International Nuclear Information System (INIS)
Keller, C.
1977-01-01
There are only very few investigations dealing with the chemical and physical properties of actinium, the lanthanum homologue in the actinide series, 227 Ac, the only long-lived isotope can be produced in gram amounts only by neutron irradiation of 226 Ra, the amounts occurring in nature are too low for isolation (about 1 μg 227 Ac/1 uranium ore). Experimental work with 227 Ac gives rise to a lot of problems due to the radiation characteristics of the 227 Ac daughter nuclides. Therefore, the metal and the only ten solid compounds, prepared up to now, have been isolated in the microgram scale. Due to the high specific activity of 227 Ac, the preparation of a lot of compounds, e.g. metal-organic compounds seems to be very difficult, if not impossible. The properties of actinium in aqueous solutions have been deduced from experiments in the tracer scale only. The present investigations on actinium show that only the oxidation state + 3 exists - only radiopolarographic studies indicate the possibility of a lower valancy state (Ac 2+ ). - This review will give a critical and comprehensive description on the present knowledge about this element. The presently decreasing interest in the development of thermionic batteries using 227 Ac 2 O 3 radionuclide also implies that there will be only small progress in the chemistry of this radio-element in the near future. (orig.) [de
Application of partition chromatography method for separation and analysis of actinium radionuclides
International Nuclear Information System (INIS)
Sinitsina, G.S.; Shestakova, I.A.; Shestakov, B.I.; Plyushcheva, N.A.; Malyshev, N.A.; Belyatskij, A.F.; Tsirlin, V.A.
1979-01-01
The method of partition chromatography is considered with the use of different extractants for the extraction of actinium-227, actinium-225 and actinium-228. It is advisable to extract actinium-227 from the irradiated radium with the help of D2FGFK. The use of 2DEGFK allows us to separate actinium-227 from alkaline and alkaline-earth elements. Amines have a higher radiative stability. An express-method has been developed for the identification of actinium-227 with TOA by its intrinsic α-emission in nonequilibrium preparations of irradiated radium-226 of small activity. Actinium-225 is extracted from uranium-233 with due regard for the fact that U, Th, and Ac are extracted differently by TBP from HNO 3 solutions. With the help of the given procedure one can reach the purifying coefficient of 10 4 . Actinium-228 is extracted from the radiummesothorium preparations by a deposition of decay products, including polonium-210 on the iron hydroxyde. Actinium-228 extraction from the mixture of radium radionuclides is performed by the partition chromatography method on D2EGFK. All the procedures for separation of actinium isotopes by the above methods are described
Separation of protactinum, actinium, and other radionuclides from proton irradiated thorium target
Fassbender, Michael E.; Radchenko, Valery
2018-04-24
Protactinium, actinium, radium, radiolanthanides and other radionuclide fission products were separated and recovered from a proton-irradiated thorium target. The target was dissolved in concentrated HCl, which formed anionic complexes of protactinium but not with thorium, actinium, radium, or radiolanthanides. Protactinium was separated from soluble thorium by loading a concentrated HCl solution of the target onto a column of strongly basic anion exchanger resin and eluting with concentrated HCl. Actinium, radium and radiolanthanides elute with thorium. The protactinium that is retained on the column, along with other radionuclides, is eluted may subsequently treated to remove radionuclide impurities to afford a fraction of substantially pure protactinium. The eluate with the soluble thorium, actinium, radium and radiolanthanides may be subjected to treatment with citric acid to form anionic thorium, loaded onto a cationic exchanger resin, and eluted. Actinium, radium and radiolanthanides that are retained can be subjected to extraction chromatography to separate the actinium from the radium and from the radio lanthanides.
Separation of actinium-227 from its daughter products by cationic resins technique
International Nuclear Information System (INIS)
Nastasi, M.J.C.
1976-01-01
A method for separating actinium-227 from its daughter products based on ion exchange principle is shown. Radionuclides mixture in perchloric acid 8,5 N and chloridric acid 0,5 N medium pass by a cationic resin column. Thorium-227 and actinium-227, which are retained by the resin, are eluted with nitric acid 6 N which releases actinium-227 while oxalic acid 7% is used for thorium-227 elution [pt
Separation of Actinium 227 from the uranium minerals
International Nuclear Information System (INIS)
Martinez-Tarango, S.
1991-01-01
The purpose of this work was to separate Actinium 227, whose content is 18%, from the mineral carnotite found in Gomez Chihuahua mountain range in Mexico. The mineral before processing is is pre-concentrated and passed, first through anionic exchange resins, later the eluate obtained is passed through cationic resins. The resins were 20-50 MESH QOWEX and 100-200 MESH 50 X 8-20 in some cased 200-400 MESH AG 50W-X8, 1X8 in other cases. The eluates from the ionic exchange were electrodeposited on stainless steel polished disc cathode and platinum electrode as anode; under a current ODF 10mA for 2.5 to 5 hours and of 100mA for .5 of an hour. it was possible to identify the Actinium 227 by means of its descendents, TH-227 and RA-223, through alpha spectroscopy. Due to the radiochemical purity which the electro deposits were obtained the Actinium 227 was low and was not quantitatively determined. A large majority of the members of the natural radioactive series 3 were identified and even alpha energies reported in the literature with very low percentages of non-identified emissions were observed. We conclude that a more precise study is needed concerning ionic exchange and electrodeposit to obtain an Actinium 227 of radiochemical purity. (Author)
Short history of radioactivity. No. XIII. The actinium and thorium series
Energy Technology Data Exchange (ETDEWEB)
Chalmers, T W
1950-06-16
Discussions of the actinium disintegration series (about 1905), the /sup 235/U or actinium series (as it is accepted today), the disintegration of thorium (about 1905), the thorium series in the modern form, and the 4n, 4n + 1, 4n + 2, and 4n + 3 series are presented.
Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232
Energy Technology Data Exchange (ETDEWEB)
Harvey, James T.; Nolen, Jerry; Vandergrift, George; Gomes, Itacil; Kroc, Tom; Horwitz, Phil; McAlister, Dan; Bowers, Del; Sullivan, Vivian; Greene, John
2011-12-30
The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces {approx}100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 Ge
The sorption of polonium, actinium and protactinium onto geological materials
International Nuclear Information System (INIS)
Baston, G.M.N.; Berry, J.A.; Brownsword, M.; Heath, T.G.; Ilett, D.J.; McCrohon, R.; Tweed, C.J.; Yui, M.
1999-01-01
This paper describes a combined experimental and modeling program of generic sorption studies to increase confidence in the performance assessment for a potential high-level radioactive waste repository in Japan. The sorption of polonium, actinium and protactinium onto geological materials has been investigated. Sorption of these radioelements onto bentonite, tuff and granodiorite from equilibrated de-ionized water was studied under reducing conditions at room temperature. In addition, the sorption of actinium and protactinium was investigated at 60 C. Thermodynamic chemical modeling was carried out to aid interpretation of the results
The sorption of polonium, actinium and protactinium onto geological materials
Energy Technology Data Exchange (ETDEWEB)
Baston, G.M.N.; Berry, J.A.; Brownsword, M.; Heath, T.G.; Ilett, D.J.; McCrohon, R.; Tweed, C.J.; Yui, M.
1999-07-01
This paper describes a combined experimental and modeling program of generic sorption studies to increase confidence in the performance assessment for a potential high-level radioactive waste repository in Japan. The sorption of polonium, actinium and protactinium onto geological materials has been investigated. Sorption of these radioelements onto bentonite, tuff and granodiorite from equilibrated de-ionized water was studied under reducing conditions at room temperature. In addition, the sorption of actinium and protactinium was investigated at 60 C. Thermodynamic chemical modeling was carried out to aid interpretation of the results.
Radchenko, V; Engle, J W; Wilson, J J; Maassen, J R; Nortier, F M; Taylor, W A; Birnbaum, E R; Hudston, L A; John, K D; Fassbender, M E
2015-02-06
Actinium-225 (t1/2=9.92d) is an α-emitting radionuclide with nuclear properties well-suited for use in targeted alpha therapy (TAT), a powerful treatment method for malignant tumors. Actinium-225 can also be utilized as a generator for (213)Bi (t1/2 45.6 min), which is another valuable candidate for TAT. Actinium-225 can be produced via proton irradiation of thorium metal; however, long-lived (227)Ac (t1/2=21.8a, 99% β(-), 1% α) is co-produced during this process and will impact the quality of the final product. Thus, accurate assays are needed to determine the (225)Ac/(227)Ac ratio, which is dependent on beam energy, irradiation time and target design. Accurate actinium assays, in turn, require efficient separation of actinium isotopes from both the Th matrix and highly radioactive activation by-products, especially radiolanthanides formed from proton-induced fission. In this study, we introduce a novel, selective chromatographic technique for the recovery and purification of actinium isotopes from irradiated Th matrices. A two-step sequence of cation exchange and extraction chromatography was implemented. Radiolanthanides were quantitatively removed from Ac, and no non-Ac radionuclidic impurities were detected in the final Ac fraction. An (225)Ac spike added prior to separation was recovered at ≥ 98%, and Ac decontamination from Th was found to be ≥ 10(6). The purified actinium fraction allowed for highly accurate (227)Ac determination at analytical scales, i.e., at (227)Ac activities of 1-100 kBq (27 nCi to 2.7 μCi). Copyright © 2014 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Cuillerdier, C.; Musikas, C.
1993-01-01
Present invention is concerned with new amides with nitrogenous heterocyclic substituent utilizable to separate trivalent actinium series from trivalent lanthanides. In these molecules, it is possible to obtain particularly covalent liaison which has more affinity with 5f series, that is to say actinium series; included a manufacturing process for these amides with nitrogenous heterocyclic substituent
Analysis of the gamma spectra of the uranium, actinium, and thorium decay series
International Nuclear Information System (INIS)
Momeni, M.H.
1981-09-01
This report describes the identification of radionuclides in the uranium, actinium, and thorium series by analysis of gamma spectra in the energy range of 40 to 1400 keV. Energies and absolute efficiencies for each gamma line were measured by means of a high-resolution germanium detector and compared with those in the literature. A gamma spectroscopy method, which utilizes an on-line computer for deconvolution of spectra, search and identification of each line, and estimation of activity for each radionuclide, was used to analyze soil and uranium tailings, and ore
Actinium-225 and Bismuth-213 Alpha Particle Immunotherapy of Cancer
International Nuclear Information System (INIS)
Scheinberg, D.
2013-01-01
Nuclides with appropriate half-lives and emission characteristics that would be potent enough to kill neoplastic cells in the small quantities that reach targets in vivo, include the high linear energy transfer (LET) alpha emitters such as Actinium-225 and Bi-213. We developed methods for the attachment of radiometals via bifunctional chelates to monoclonal antibodies (mAb) without loss of immunoreactivity. We developed alphaemitting Bi-213 lintuzumab constructs, characterized and qualified them in preclinical models, and took them into human clinical trials in patients with AML. Safety, anti-leukemic activity, and complete responses (CR’s) have been demonstrated through phase 2 trilas. Bi-213 is produced in a portable small generator device based on Ac- 225 in the hospital nuclear medicine lab. The isotope is then purified, attached to the antibody, and the product is qualified and processed. Despite this success, the major obstacle to the widespread use of these drugs remains the short 213 Bi half-life (46 minutes), which poses a large logistical hurdle before injection and limits its delivery to only the most accessible cancer cells after injection
Some studies on extractive liquid scintillation counting for Th-234/P-234m
International Nuclear Information System (INIS)
Grudpan, K.; Singjanusong, P.; Punyodom, W.
1990-01-01
A study on solvent extraction for Th-234/Pa-234m by liquid scintillation counting has not been reported. This paper will report an application of the technique on such a study. In a hydrochloric acid solution of an uranyl salt, Pa-234m which is one of the daughters of U-238 can be separated by extraction into isobutyl methyl ketone (IBMK). Cerenkov counting was applied for the extraction investigation. Solvent extraction of Th-234/Pa-234m from an aqueous nitric acid solution by TOPO/PPO in toluene by using liquid scintillation counting will be described
2010-07-01
... 32 National Defense 2 2010-07-01 2010-07-01 false Gambling. 234.16 Section 234.16 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS CONDUCT ON THE PENTAGON RESERVATION § 234.16 Gambling. Gambling in any form, or the operation of gambling devices, is...
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLH234 (Link to dictyBase) - - - Contig-U08154-1 SLH234F (Link to Original site) SLH2...34F 535 - - - - - - Show SLH234 Library SL (Link to library) Clone ID SLH234 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-B/SLH234Q.Seq.d/ Representative seq. ID SLH23...4F (Link to Original site) Representative DNA sequence >SLH234 (SLH234Q) /CSM/SL/SLH2-B/SLH234Q.Seq.d/ ACAAA...DCTTV--- Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SLH2
49 CFR 234.105 - Activation failure.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Activation failure. 234.105 Section 234.105... of Warning System Malfunction § 234.105 Activation failure. Upon receipt of a credible report of warning system malfunction involving an activation failure, a railroad having maintenance responsibility...
49 CFR 234.251 - Standby power.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Standby power. 234.251 Section 234.251 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION..., Inspection, and Testing Inspections and Tests § 234.251 Standby power. Standby power shall be tested at least...
49 CFR 234.221 - Lamp voltage.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Lamp voltage. 234.221 Section 234.221 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION..., Inspection, and Testing Maintenance Standards § 234.221 Lamp voltage. The voltage at each lamp shall be...
20 CFR 234.33 - Survivor annuities.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Survivor annuities. 234.33 Section 234.33 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT LUMP-SUM PAYMENTS Annuities Due but Unpaid at Death § 234.33 Survivor annuities. Any survivor annuity which is...
14 CFR 234.11 - Disclosure to consumers.
2010-01-01
... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Disclosure to consumers. 234.11 Section 234...) ECONOMIC REGULATIONS AIRLINE SERVICE QUALITY PERFORMANCE REPORTS § 234.11 Disclosure to consumers. Link to..., § 234.11 was revised, effective Apr. 29, 2010. For the convenience of the user, the revised text is set...
49 CFR 234.259 - Warning time.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Warning time. 234.259 Section 234.259..., Inspection, and Testing Inspections and Tests § 234.259 Warning time. Each crossing warning system shall be tested for the prescribed warning time at least once every 12 months and when the warning system is...
Journal of Naval Science. Volume 2. Number 3. July 1976
1976-07-01
supplementary food to the beakers containing stage VI nauplii: cyprids do not feed. The larvae in each beaker were con- fined within a close-fitting plastic...99-274% of Natural U) Uranium-234 (234U) (0-006% of Natural U) 2-48 X 10"’yrs Thorium-230 (230Th) Polonium -218(2I8Po) /through short lived...Natural U) Actinium-227 (--7Ac) FIG. 1. Nuclide chart. 4-51 X 10’Yrs 7 hours P 8 X 10’ Yrs 4 days Lead- 210 (210Pb) (22 yrs,/3"). 1-39 X 10
Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL
International Nuclear Information System (INIS)
Raeder, S.; Bastin, B.; Block, M.; Creemers, P.; Delahaye, P.; Ferrer, R.; Fléchard, X.; Franchoo, S.; Ghys, L.; Gaffney, L.P.; Granados, C.; Heinke, R.; Hijazi, L.
2016-01-01
To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.
Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL
Energy Technology Data Exchange (ETDEWEB)
Raeder, S., E-mail: s.raeder@gsi.de [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Bastin, B. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Block, M. [Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Institut für Kernchemie, Johannes Gutenberg Universität, 55128 Mainz (Germany); Creemers, P. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Delahaye, P. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Ferrer, R. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Fléchard, X. [LPC Caen, ENSICAEN, Université de Caen, CNRS/IN2P3, Caen (France); Franchoo, S. [Institute de Physique Nucléaire (IPN) d’Orsay, 91406 Orsay, Cedex (France); Ghys, L. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); SCK-CEN, Belgian Nuclear Research Center, Boeretang 200, 2400 Mol (Belgium); Gaffney, L.P.; Granados, C. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Heinke, R. [Institut für Physik, Johannes Gutenberg Universität, 55128 Mainz (Germany); Hijazi, L. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); and others
2016-06-01
To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.
32 CFR 234.12 - Restriction on animals.
2010-07-01
... 32 National Defense 2 2010-07-01 2010-07-01 false Restriction on animals. 234.12 Section 234.12 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS CONDUCT ON THE PENTAGON RESERVATION § 234.12 Restriction on animals. Animals, except guide dogs...
24 CFR 234.65 - Nature of title.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Nature of title. 234.65 Section 234.65 Housing and Urban Development Regulations Relating to Housing and Urban Development (Continued... OWNERSHIP MORTGAGE INSURANCE Eligibility Requirements-Individually Owned Units § 234.65 Nature of title. A...
49 CFR 234.201 - Location of plans.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Location of plans. 234.201 Section 234.201..., Inspection, and Testing Maintenance Standards § 234.201 Location of plans. Plans required for proper maintenance and testing shall be kept at each highway-rail grade crossing warning system location. Plans shall...
48 CFR 234.004 - Acquisition strategy.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Acquisition strategy. 234..., DEPARTMENT OF DEFENSE SPECIAL CATEGORIES OF CONTRACTING MAJOR SYSTEM ACQUISITION 234.004 Acquisition strategy. (1) See 209.570 for policy applicable to acquisition strategies that consider the use of lead system...
32 CFR 234.17 - Vehicles and traffic safety.
2010-07-01
... 32 National Defense 2 2010-07-01 2010-07-01 false Vehicles and traffic safety. 234.17 Section 234...) MISCELLANEOUS CONDUCT ON THE PENTAGON RESERVATION § 234.17 Vehicles and traffic safety. (a) In general. Unless... an alcoholic beverage. (1) Each person within a vehicle is responsible for complying with the...
22 CFR 23.4 - Representative value in exchange.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Representative value in exchange. 23.4 Section 23.4 Foreign Relations DEPARTMENT OF STATE FEES AND FUNDS FINANCE AND ACCOUNTING § 23.4 Representative value in exchange. Representative value in exchange for the collection of a fee means foreign...
46 CFR 153.234 - Fore and aft location.
2010-10-01
... 46 Shipping 5 2010-10-01 2010-10-01 false Fore and aft location. 153.234 Section 153.234 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) CERTAIN BULK DANGEROUS CARGOES SHIPS CARRYING... Containment Systems § 153.234 Fore and aft location. Except as allowed in § 153.7, each ship must meet the...
14 CFR 234.6 - Baggage-handling statistics.
2010-01-01
... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Baggage-handling statistics. 234.6 Section 234.6 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION... statistics. Each reporting carrier shall report monthly to the Department on a domestic system basis...
40 CFR 86.233-94-86.234-94 - [Reserved
2010-07-01
... 40 Protection of Environment 18 2010-07-01 2010-07-01 false [Reserved] 86.233-94-86.234-94 Section 86.233-94-86.234-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... New Medium-Duty Passenger Vehicles; Cold Temperature Test Procedures §§ 86.233-94—86.234-94 [Reserved] ...
49 CFR 195.234 - Welds: Nondestructive testing.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Welds: Nondestructive testing. 195.234 Section 195... HAZARDOUS LIQUIDS BY PIPELINE Construction § 195.234 Welds: Nondestructive testing. (a) A weld may be... weld. (b) Any nondestructive testing of welds must be performed— (1) In accordance with a written set...
International Nuclear Information System (INIS)
Hung, Chin-Chang; Roberts, Kimberly A.; Santschi, Peter H.; Guo, Laodong
2004-01-01
Size-fractionated particulate 234 Th and particulate organic carbon (POC) fluxes were measured in the Gulf of Mexico during 2000 and 2001 in order to obtain a better estimation of upper ocean organic carbon export out of the euphotic zone within cold core and warm core rings, and to assess the relative merit of sediment trap and POC/ 234 Th methods. In 2000, the flux of POC measured by sediment traps at 120 m ranged from 60 to 148 mg C m -2 d -1 , while 234 Th-derived POC fluxes in large particles (>53 μm) varied from 18 to 61 mg C m -2 d -1 using the ratio of POC/ 234 Th at 120 m, and from 51 to 163 mg C m -2 d -1 using an average ratio of POC/ 234 Th for the upper 120 m water column. In 2001, the fluxes of POC measured by traps deployed at 120 m water depth ranged from 39 to 48 mg C m -2 d -1 , while the 234 Th-derived POC fluxes in large particles (>53 μm) varied from 7 to 37 mg C m -2 d -1 using a ratio of POC/ 234 Th at 120 m, and from 37 to 45 mg C m -2 d -1 using an average ratio of POC/ 234 Th within the 0-120 m interval. The results show that POC fluxes estimated by the 234 Th method using the average ratio of POC/ 234 Th within the euphotic zone are similar to those measured by sediment traps. Furthermore, the results demonstrate that the variability in POC export fluxes estimated by the 234 Th/ 238 U disequilibrium approach is strongly related to the ratio of POC/ 234 Th that is taken, and for which we have independent evidence that it may be controlled by the chemical composition of the suspended particles. The results also reveal that using POC/ 234 Th ratios in small particles may result in an estimate of the POC export flux that is considerably higher than when using POC/ 234 Th ratios in large particles (>53 μm). The POC flux calculated from ratios in large particles is, however, more comparable to the POC flux determined directly by sediment traps, but both of these estimates are much lower than that determined by using the POC/ 234 Th ratios in
48 CFR 352.234-4 - Partial earned value management system.
2010-10-01
... management system. 352.234-4 Section 352.234-4 Federal Acquisition Regulations System HEALTH AND HUMAN....234-4 Partial earned value management system. As prescribed in 334.203-70(d), the Contracting Officer shall insert the following clause: Partial Earned Value Management System (October 2008) (a) The...
48 CFR 352.234-3 - Full earned value management system.
2010-10-01
... management system. 352.234-3 Section 352.234-3 Federal Acquisition Regulations System HEALTH AND HUMAN....234-3 Full earned value management system. As prescribed in 334.203-70(c), the Contracting Officer shall insert the following clause: Full Earned Value Management System (October 2008) (a) The Contractor...
8 CFR 234.4 - International airports for entry of aliens.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false International airports for entry of aliens. 234.4 Section 234.4 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS DESIGNATION OF PORTS OF ENTRY FOR ALIENS ARRIVING BY CIVIL AIRCRAFT § 234.4 International airports for entry...
238U, 234U and 232Th in seawater
International Nuclear Information System (INIS)
Chen, J.H.; Edwards, R.L.; Wasserburg, G.J.
1986-01-01
We have developed techniques to determine 238 U, 234 U and 232 Th concentrations in seawater by isotope dilution mass spectrometry. Using these techniques, we have measured 238 U, 234 U and 232 Th in vertical profiles of unfiltered, acidified seawater from the Atlantic and 238 U and 234 U in vertical profiles from the Pacific. Determinations of 234 U/ 238 U at depths ranging from 0 to 4900 m in the Atlantic (7 0 44'N, 40 0 43'W) and the Pacific (14 0 41'N, 160 0 01'W) Oceans are the same within experimental error (±5per mille, 2σ). The average of these 234 U/ 238 U measurements is 144±2per mille (2σ) higher than the equilibrium ratio of 5.472 x 10 -5 . U concentrations, normalized to 35per mille salinity, range from 3.162 to 3.281 ng/g, a range of 3.8%. The average concentration of the Pacific samples (31 0 4'N, 159 0 1'W) is ∝1% higher than that of the Atlantic (7 0 44'N, 40 0 43'W and 31 0 49'N, 64 0 6'W). 232 Th concentrations from an Atlantic profile range from 0.092 to 0.145 pg/g. The observed constancy of the 234 U/ 238 U ratio is consistent with the predicted range of 234 U/ 238 U using a simple two-box model and the residence time of deep water in the ocean determined from 14 C. The variation in salinity-normalized U concentrations suggests that U may be much more reactive in the marine environment than previously thought. (orig./WB)
Seawater 234U/238U recorded by modern and fossil corals
Chutcharavan, Peter M.; Dutton, Andrea; Ellwood, Michael J.
2018-03-01
U-series dating of corals is a crucial tool for generating absolute chronologies of Late Quaternary sea-level change and calibrating the radiocarbon timescale. Unfortunately, coralline aragonite is susceptible to post-depositional alteration of its primary geochemistry. One screening technique used to identify unaltered corals relies on the back-calculation of initial 234U/238U activity (δ234Ui) at the time of coral growth and implicitly assumes that seawater δ234U has remained constant during the Late Quaternary. Here, we test this assumption using the most comprehensive compilation to date of coral U-series measurements. Unlike previous compilations, this study normalizes U-series measurements to the same decay constants and corrects for offsets in interlaboratory calibrations, thus reducing systematic biases between reported δ234U values. Using this approach, we reassess (a) the value of modern seawater δ234U, and (b) the evolution of seawater δ234U over the last deglaciation. Modern coral δ234U values (145.0 ± 1.5‰) agree with previous measurements of seawater and modern corals only once the data have been normalized. Additionally, fossil corals in the surface ocean display δ234Ui values that are ∼5-7‰ lower during the last glacial maximum regardless of site, taxon, or diagenetic setting. We conclude that physical weathering of U-bearing minerals exposed during ice sheet retreat drives the increase in δ234U observed in the oceans, a mechanism that is consistent with the interpretation of the seawater Pb-isotope signal over the same timescale.
Influence of glacial meltwater on global seawater δ234U
Arendt, Carli A.; Aciego, Sarah M.; Sims, Kenneth W. W.; Das, Sarah B.; Sheik, Cody; Stevenson, Emily I.
2018-03-01
We present the first published uranium-series measurements from modern Greenland Ice Sheet (GrIS) runoff and proximal seawater, and investigate the influence of glacial melt on global seawater δ234U over glacial-interglacial (g-ig) timescales. Climate reconstructions based on closed-system uranium-thorium (U/Th) dating of fossil corals assume U chemistry of seawater has remained stable over time despite notable fluctuations in major elemental compositions, concentrations, and isotopic compositions of global seawater on g-ig timescales. Deglacial processes increase weathering, significantly increasing U-series concentrations and changing the δ234U of glacial meltwater. Analyses of glacial discharge from GrIS outlet glaciers indicate that meltwater runoff has elevated U concentrations and differing 222Rn concentrations and δ234U compositions, likely due to variations in subglacial residence time. Locations with high δ234U have the potential to increase proximal seawater δ234U. To better understand the impact of bulk glacial melt on global seawater δ234U over time, we use a simple box model to scale these processes to periods of extreme deglaciation. We account for U fluxes from the GrIS, Antarctica, and large Northern Hemisphere Continental Ice Sheets, and assess sensitivity by varying melt volumes, duration and U flux input rates based on modern subglacial water U concentrations and compositions. All scenarios support the hypothesis that global seawater δ234U has varied by more than 1‰ through time as a function of predictable perturbations in continental U fluxes during g-ig periods.
49 CFR 234.211 - Security of warning system apparatus.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Security of warning system apparatus. 234.211... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION GRADE CROSSING SIGNAL SYSTEM SAFETY AND STATE ACTION PLANS Maintenance, Inspection, and Testing Maintenance Standards § 234.211 Security of warning system apparatus...
48 CFR 252.234-7002 - Earned Value Management System.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Earned Value Management... of Provisions And Clauses 252.234-7002 Earned Value Management System. As prescribed in 234.203(2), use the following clause: Earned Value Management System (APR 2008) (a) In the performance of this...
Implication of POC/234Th ratios in oceanic particulate matter. An approach to particle aggregation
International Nuclear Information System (INIS)
Hirose, Katumi
2003-01-01
234 Th has been widely applied as a tracer of particulate organic carbon (POC) fluxes in the upper ocean. Fundamental to this approach is the determination of 234 Th fluxes from water column measurements of the 234 Th- 238 U disequilibria, and the conversion of 234 Th flux to POC export, using the measured POC/ 234 Th ratio on particles. As such, POC/ 234 Th ratios are one of the most critical factors in quantifying the carbon export flux in ocean interior when using this approach. However, the POC/ 234 Th ratios show significant temporal and spatial variations, but cannot be predicted at this time. therefore, it is important to elucidate factors controlling the variations of the POC/ 234 Th ratios. To achieve this purpose, we should understand the chemical interactions between POC and 234 Th. In the open ocean, POC/ 234 Th ratios have been determined together with other oceanographic parameters. We examined here the relationship between POC/ 234 Th and primary production. The POC/ 234 Th ratios were linearly related to logarithmic values of primary production. Taken into account the complexation between surface ligand on particulate organic matter (POM) and 234 Th, a complexation model suggests that the size of particles adsorbing 234 Th is related to primary production; in the equatorial Pacific, the size of particles adsorbing 234 Th apparently decreases with increasing primary production, whereas opposite phenomenon occurs in the North Atlantic. Since the POC/ 234 Th ratios were determined in filtered particulate matter, this finding suggests that aggregation of small particles would be dominant in the equatorial Pacific, which can be explained by a chemical aggregation model. (author)
20 CFR 234.32 - Spouse or divorced spouse annuities.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Spouse or divorced spouse annuities. 234.32... LUMP-SUM PAYMENTS Annuities Due but Unpaid at Death § 234.32 Spouse or divorced spouse annuities. A spouse annuity or divorced spouse annuity which is unpaid at the death of the spouse or divorced spouse...
Szabo, B. J.
1982-01-01
Isotopic fractionation as great as 1600% exists between 234U and 238U in spring waters, sediments, and fossils in the Pomme de Terre Valley, southwestern Missouri. The activity ratios of 234U 238U in five springs range from 7.2 to 16 in water which has been discharged for at least the past 30,000 years. The anomalies in 234U 238U ratio in deep water have potential usefulness in hydrologic investigations in southern Missouri. Clayey units overlying the spring bog sediments of Trolinger Spring are enriched in 230Th relative to their parent 234U by as much as 720%. The results indicate that both preferential displacement via alpha recoil ejection and the preferential emplacement via recoiling and physical entrapment are significant processes that are occurring in the geologic environment. ?? 1982.
2010-10-01
... Maintenance Standards § 234.213 Grounds. Each circuit that affects the proper functioning of a highway-rail... in the circuit. This requirement does not apply to: circuits that include track rail; alternating current power distribution circuits that are grounded in the interest of safety; and common return wires...
Effectiveness of intragastric administration of 8102 for removal of thorium-234 in rats
International Nuclear Information System (INIS)
Luo Meichu; Li Landi; Sun Meizhen; Ye Qian; Liu Yi
1992-01-01
8102, a 1,2-dihydroxy-3,6-bismethylamino diacetic derivative, is a new chelating agent for decorporation of radionuclides. The effectiveness of intragastric administration of this drug at different doses (50-1000 mg/kg of body) and at different times before or after giving thorium-234 in rats was reported. The results show that for rats given intragastricly 1000 mg/kg of 8102, the excretion of thorium-234 in urine for first two days is 4.5 times more than that for control rats and accumulations of thorium-234 in liver, skeleton and kidney for these rats were 30%, 62% and 68% as those for control rats, respectively. The effectiveness was reduced with decrease in dosage of 8102. Administration of 8102 at 1 or 2 h before injection of thorium-234 can improve the effectiveness for decorporation of thorium-234: accumulation of thorium-234 in liver was markedly less than that for rats given 8102 immediately after injection of thorium-234. Delayed administration of 9102 resulted in reduction of the effectiveness. The practicality of oral administration of 8102 in clinic for decorporation of radionuclides was discussed
Relation between 234Th scavenging and zooplankton biomass in Mediterranean surface waters
International Nuclear Information System (INIS)
Schmidt, S.; Reyss, J.L.; Buat-Menard, P.; Nival, P.; Baker, M.
1992-01-01
Dissolved and particulate 234 Th activities were determined and phyto-and zooplankton biomass were periodically measured 8 miles off Nice (Mediterranean Sea) during spring 1987. The results show a strong variability of 234 Th distribution on short time scales in northwestern Mediterranean surface waters. The good correlation observed the zooplankton biomass and the rate of 234 Th export to deep water in particulate form is agreement with the assumption that the residence time of particulate 234 Th in oceanic surface waters is controlled by zooplankton grazing. Moreover, our results indicate the importance of salps in particular as efficient removers of small suspended particles in surface waters
2010-10-01
... TRANSPORTATION GRADE CROSSING SIGNAL SYSTEM SAFETY AND STATE ACTION PLANS General § 234.5 Definitions. As used in... meaning of this paragraph if—more than 50% of the flashing lights (not gate arm lights) on any approach.... For nighttime flagging, similar outside garments shall be retro reflective. Acceptable hand signal...
49 CFR 234.253 - Flashing light units and lamp voltage.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Flashing light units and lamp voltage. 234.253... Maintenance, Inspection, and Testing Inspections and Tests § 234.253 Flashing light units and lamp voltage. (a... voltage shall be tested when installed and at least once every 12 months thereafter. (c) Each flashing...
Measurement of 233U/234U ratios in contaminated groundwater using alpha spectrometry
International Nuclear Information System (INIS)
Harrison, Jennifer J.; Payne, Timothy E.; Wilsher, Kerry L.; Thiruvoth, Sangeeth; Child, David P.; Johansen, Mathew P.; Hotchkis, Michael A.C.
2016-01-01
The uranium isotope 233 U is not usually observed in alpha spectra from environmental samples due to its low natural and fallout abundance. It may be present in samples from sites in the vicinity of nuclear operations such as reactors or fuel reprocessing facilities, radioactive waste disposal sites or sites affected by clandestine nuclear operations. On an alpha spectrum, the two most abundant alpha emissions of 233 U (4.784 MeV, 13.2%; and 4.824 MeV, 84.3%) will overlap with the 234 U doublet peak (4.722 MeV, 28.4%; and 4.775 MeV, 71.4%), if present, resulting in a combined 233+234 U multiplet. A technique for quantifying both 233 U and 234 U from alpha spectra was investigated. A series of groundwater samples were measured both by accelerator mass spectrometry (AMS) to determine 233 U/ 234 U atom and activity ratios and by alpha spectrometry in order to establish a reliable 233 U estimation technique using alpha spectra. The Genie™ 2000 Alpha Analysis and Interactive Peak Fitting (IPF) software packages were used and it was found that IPF with identification of three peaks ( 234 U minor, combined 234 U major and 233 U minor, and 233 U major) followed by interference correction on the combined peak and a weighted average activity calculation gave satisfactory agreement with the AMS data across the 233 U/ 234 U activity ratio range (0.1–20) and 233 U activity range (2–300 mBq) investigated. Correlation between the AMS 233 U and alpha spectrometry 233 U was r 2 = 0.996 (n = 10). - Highlights: • Describes a technique for deconvoluting the combined 233 U and 234 U multiplet in alpha spectra. • Enables 233 U and 234 U activities and 233 U/ 234 U ratios to be quantified without requiring additional analysis and measurement. • Applicable to an environmental matrix (groundwater) using standard alpha spectrometry counting equipment, operation and set-up.
Preparation of microcuries of 234-thorium
International Nuclear Information System (INIS)
Suner, A.; La Gamma de Batistoni, A.M.; Botbol, J.
1974-11-01
A procedure for the preparation of microcuries of 234 Th from hydrochloric acid solutions of uranium (VI) is described. A solution of uranyl chloride in radioactive equilibrium with 234 Th (older than 6 months) and having 232 Th as carrier, is percoled through a Dowex 50 Wx8 (H + ) resin bed, wherein is absorbed 85% of Th and some uranium, which is then desorbed with 10 N HCl. The thorium remains in the column and is extracted later with a 0,025 M SO 4 H 2 plus 1 M SO 4 (NH 4 ) 2 solution. The thorium solution is freed from sulfate by precipitation with ammonia, dissolving the precipitate with 10 N HCl, whose solution is treated with Dowex 2x8 resin. The ion exchanger absorbs the anionic impurities and the thorium obtained is of high chemical and radiochemical purity. (author)
Spectroscopic study of 228-234Th nuclei using multi-nucleon transfer reactions
International Nuclear Information System (INIS)
Amzal, N.; Butler, P.A.; Cann, K.J.; Greenlees, P.T.; Jones, G.D.; Cocks, J.F.C.; Asztalos, S.; Clark, R.M.; Deleplanque, M.A.; Diamond, R.M.; Fallon, P.; Lees, I.Y.; Machiavelli, A.O.; MacLeod, R.W.; Stephens, F.S.; Jones, P.M.; Julin, R.; Broda, R.; Fornal, B.; Smith, J.F.; Lauritsen, T.; Bhattacharyya, P.; Zhang, C.T.
1999-01-01
Light-actinide nuclei in the octupole deformed region have been populated using multi-nucleon transfer from 232 Th. The energy level schemes of several thorium isotopes with A=228-234 have been extended up to I∼24ℎ and negative parity states have been observed for the first time in 234 Th. A systematic study of the difference in alignment between the positive- and negative-parity bands in thorium nuclei in this mass region shows that 228,230,234 Th behave like octupole vibrators, in contrast with 224,226 Th, which are octupole-deformed in character. An intrinsic electric dipole moment has been measured for the first time in 234 Th. The small value obtained is consistent with the vibrational description of this nucleus. (author)
14 CFR 234.5 - Form of reports.
2010-01-01
... REGULATIONS AIRLINE SERVICE QUALITY PERFORMANCE REPORTS § 234.5 Form of reports. Except where otherwise noted... in accounting and reporting directives issued by the Bureau of Transportation Statistics' Assistant...
49 CFR 234.241 - Protection of insulated wire; splice in underground wire.
2010-10-01
... underground wire. 234.241 Section 234.241 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION GRADE CROSSING SIGNAL SYSTEM SAFETY... of insulated wire; splice in underground wire. Insulated wire shall be protected from mechanical...
Uranium Age Determination by Measuring the 230Th / 234U Ratio
International Nuclear Information System (INIS)
LAMONT, STEPHEN P.
2004-01-01
A radiochemical isotope dilution mass spectrometry method has been developed to determine the age of uranium materials. The amount of 230Th activity, the first progeny of 234U, that had grown into a small uranium metal sample was used to determine the elapsed time since the material was last radiochemically purified. To preserve the sample, only a small amount of oxidized uranium was removed from the surface of the sample and dissolved. Aliquots of the dissolved sample were spiked with 233U tracer and radiochemically purified by anion-exchange chromatography. The 234U isotopic concentration was then determined by thermal ionization mass spectrometry. Additional aliquots of the sample were spiked with 229Th tracer, and the thorium was purified using two sequential anion-exchange chromatography separations. The isotopic concentrations of 230Th and 232Th were determined by TIMS. The lack of any 232Th confirmed the assumption that all thorium was removed from the uranium sample at the time of purification. The 230Th and 234U mass concentrations were converted to activities and the 230Th/234U ratio for the sample was calculated. The experimental 230Th/234U ratio showed the uranium in this sample was radiochemically purified in about 1945. Isotope dilution thermal ionization mass spectrometry has sufficient sensitivity to determine the age of 100 samples of uranium. This method could certainly be employed as a nuclear forensic method to determine the age of small quantities of uranium metal or salts. Accurate determination of the ultra-trace 230Th radiochemically separated from the uranium is possible due to the use of 229Th as an isotope dilution tracer. The precision in the experimental age of the uranium could be improved by making additional replicate measurements of the 230Th/234U isotopic ratio or using a larger initial sample
24 CFR 234.26 - Project requirements.
2010-04-01
... Commissioner for the purpose of constructing or converting the project in phases or stages, any special right..., the management company, the real estate broker, and the project developer, but the lender must ensure... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Project requirements. 234.26...
45 CFR 234.11 - Assistance in the form of money payments.
2010-10-01
... 45 Public Welfare 2 2010-10-01 2010-10-01 false Assistance in the form of money payments. 234.11... FINANCIAL ASSISTANCE TO INDIVIDUALS § 234.11 Assistance in the form of money payments. (a) Federal financial participation is available in money payments made under a State plan under title I, IV-A, X, XIV, or XVI of the...
234Th/238U disequilibrium in near-shore sediment: particle reworking and diagenetic time scales
International Nuclear Information System (INIS)
Aller, R.C.; Cochran, J.K.
1976-01-01
The distribution of 234 Th (tsub(1.2)=24.1 days) in excess of its parent 238 U in the upper layers of near-shore sediment makes possible the evaluation of short-term sediment reworking and diagenetic rates. 234 Th has a maximum residence time in Long Island Sound water of 1.4 days. Seasonal measurement of 234 Th/ 238 U disequilibrium in sediment at a single station in central Long Island Sound demonstrates rapid particle reworking and high 234 Thsub(XS)(>1 dpm/g) in the upper 4 cm of sediment with slower, irregular reworking and low 234 Thsub(XS) to at least 12 cm. The rate of rapid particle reworking varies seasonally and is highest in the fall. The rapidly mixed zone is characterized by steep gradients in sediment chemistry implying fast reactions spanned by 234 Th decay time scales. 238 U is depleted in the upper mixed zone and shows addition in reducing sediment at depth. (Auth.)
Lin, Wuhui; Chen, Liqi; Zeng, Shi; Li, Tao; Wang, Yinghui; Yu, Kefu
2016-01-01
Sediment resuspension occurs in the global ocean, which greatly affects material exchange between the sediment and the overlying seawater. The behaviours of carbon, nutrients, heavy metals, and other pollutants at the sediment-seawater boundary will further link to climate change, eutrophication, and marine pollution. Residual β activity of particulate 234Th (RAP234) is used as a novel proxy to track sediment resuspension in different marine environments, including the western Arctic Ocean, the South China Sea, and the Southern Ocean. Sediment resuspension identified by high activity of RAP234 is supported by different lines of evidence including seawater turbidity, residence time of total 234Th, Goldschmidt’s classification, and ratio of RAP234 to particulate organic carbon. A conceptual model is proposed to elucidate the mechanism for RAP234 with dominant contributions from 234Th-238U and 212Bi-228Th. The ‘slope assumption’ for RAP234 indicated increasing intensity of sediment resuspension from spring to autumn under the influence of the East Asian monsoon system. RAP234 can shed new light on 234Th-based particle dynamics and should benefit the interpretation of historical 234Th-238U database. RAP234 resembles lithophile elements and has broad implications for investigating particle dynamics in the estuary-shelf-slope-ocean continuum and linkage of the atmosphere-ocean-sediment system. PMID:27252085
Lin, Wuhui; Chen, Liqi; Zeng, Shi; Li, Tao; Wang, Yinghui; Yu, Kefu
2016-06-02
Sediment resuspension occurs in the global ocean, which greatly affects material exchange between the sediment and the overlying seawater. The behaviours of carbon, nutrients, heavy metals, and other pollutants at the sediment-seawater boundary will further link to climate change, eutrophication, and marine pollution. Residual β activity of particulate (234)Th (RAP234) is used as a novel proxy to track sediment resuspension in different marine environments, including the western Arctic Ocean, the South China Sea, and the Southern Ocean. Sediment resuspension identified by high activity of RAP234 is supported by different lines of evidence including seawater turbidity, residence time of total (234)Th, Goldschmidt's classification, and ratio of RAP234 to particulate organic carbon. A conceptual model is proposed to elucidate the mechanism for RAP234 with dominant contributions from (234)Th-(238)U and (212)Bi-(228)Th. The 'slope assumption' for RAP234 indicated increasing intensity of sediment resuspension from spring to autumn under the influence of the East Asian monsoon system. RAP234 can shed new light on (234)Th-based particle dynamics and should benefit the interpretation of historical (234)Th-(238)U database. RAP234 resembles lithophile elements and has broad implications for investigating particle dynamics in the estuary-shelf-slope-ocean continuum and linkage of the atmosphere-ocean-sediment system.
45 CFR 234.70 - Protective payments for the aged, blind, or disabled.
2010-10-01
..., administrator or fiscal agent of a nursing home, or social care, medical or nonmedical institution, except for... disabled. 234.70 Section 234.70 Public Welfare Regulations Relating to Public Welfare OFFICE OF FAMILY ASSISTANCE (ASSISTANCE PROGRAMS), ADMINISTRATION FOR CHILDREN AND FAMILIES, DEPARTMENT OF HEALTH AND HUMAN...
Disk mini-adsorbers with radial flow for determination of 234Th concentration in seawater
International Nuclear Information System (INIS)
Gulin, S.B.; Gorelov, Yu.S.; Sidorov, I.G.; Proskurnin, V.Yu.
2013-01-01
A modified method has been developed for measuring the 234 Th concentration in seawater, which is based upon the use of MnO 2 -impregnated disk mini adsorbers with radial flow connected in-line and the direct beta counting of 234 Th and/or its daughter 234m Pa. This allows determining the 234 Th concentration in a relatively small volume of seawater (20-50 L) with the possibility to check the extraction efficiency in every individual sample. The field testing, which was carried out at different areas of Sevastopol Bay during different seasons, has shown applicability of the proposed method to evaluate particle fluxes in marine environments within a wide range of concentrations of suspended matter. (author)
14 CFR 234.13 - Reports by air carriers on incidents involving animals during air transport.
2010-01-01
... involving animals during air transport. 234.13 Section 234.13 Aeronautics and Space OFFICE OF THE SECRETARY... REPORTS § 234.13 Reports by air carriers on incidents involving animals during air transport. (a) Any air... during air transport provided by the air carrier. (b) The report shall be made in the form and manner set...
24 CFR 234.285 - Waived title objections.
2010-04-01
... have not been violated to a material extent. (f) Federal tax liens and rights of redemption arising... Commissioner will not object to an outstanding right of redemption in IRS if: (1) The Federal tax lien was... CONDOMINIUM OWNERSHIP MORTGAGE INSURANCE Contract Rights and Obligations-Individually Owned Units § 234.285...
20 CFR 234.20 - Computation of the employee's 1937 Act LSDP basic amount.
2010-04-01
... compensation and section 209 of the Social Security Act for a definition of creditable wages.) Closing date... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Computation of the employee's 1937 Act LSDP basic amount. 234.20 Section 234.20 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE...
234U and 238U in the Carrizo Sandstone aquifer of South Texas
International Nuclear Information System (INIS)
Cowart, J.B.; Osmond, J.K.
1974-01-01
The waters of the Carrizo Sand formation of South Texas, United States of America, exhibit a pattern of uranium isotopic disequilibrium, described in terms of 234 U/ 238 U activity ratio ('A.R.') and uranium concentration, which may be a function of geochemical factors and the hydrologic history of the area. In terms of uranium, two regimes seem to exist. The first, including outcrop and near outcrop sample locations, has waters with relatively high concentration and low A.R. Somewhat downdip, the uranium concentration decreases sharply at the downdip limit of the oxidation environment, a zone of uranium precipitation. Recoil of daughter products from the precipitated uranium causes an increase of A.R. of the water. Water of low uranium concentration and high A.R. is found throughout the downdip regime. If a constant input of 234 U through time is assumed, the downdip decrease in A.R. after the initial introduction of 234 U into the water may be ascribed to radioactive decay of 234 U. However, this assumption leads to the calculation of a water flow rate one twentieth that determined by other means. Alternatively, this pattern may be an artifact of a change of climate from 20,000 years to 10,000 years ago. In this case, the decrease in A.R. downdip is a function of a varying input of 234 U as well as decay. (author)
International Nuclear Information System (INIS)
Shah, P.M.; Saxena, M.K.; Sanjai Kumar; Aggarwal, S.K.; Jain, H.C.
1995-01-01
With an objective to prepare double spike of 233 U+ 234 U for determination of uranium concentration by Isotopic Dilution Thermal Ionisation Mass Spectrometry (ID-TIMS), 234 U was separated and purified from aged 238 Pu sample (15 years old) using several ion exchange and solvent extraction procedures. Final product containing 95% and 5% alpha activities of 234 and 238 Pu, respectively, which translates into 99.998 atom% of 234 U and 0.002 atom% of 238 Pu was found suitable for double spike. (author). 1 ref
234Th distributions in coastal and open ocean waters by non-destructive β-counting
International Nuclear Information System (INIS)
Miller, L.A.; Svaeren, I.
2003-01-01
Non-destructive β-counting analyses of particulate and dissolved 234 Th activities in seawater are simpler but no less precise than traditional radioanalytical methods. The inherent accuracy limitations of the non-destructive β-counting method, particularly in samples likely to be contaminated with anthropogenic nuclides, are alleviated by recounting the samples over several half-lives and fitting the counting data to the 234 Th decay curve. Precision (including accuracy, estimated at an average of 3%) is better than 10% for particulate or 5% for dissolved samples. Thorium-234 distributions in the Skagerrak indicated a vigorous, presumably biological, particle export from the surface waters, and while bottom sediment resuspension was not an effective export mechanism, it did strip thorium from the dissolved phase. In the Greenland and Norwegian Seas, we saw clear evidence of particulate export from the surface waters, but at 75 m, total 234 Th activities were generally in equilibrium with 238 U. (author)
The sediment budget of an urban coastal lagoon (Jamaica Bay, NY) determined using 234Th and 210Pb
Renfro, Alisha A.; Cochran, J. Kirk; Hirschberg, David J.; Bokuniewicz, Henry J.; Goodbred, Steven L.
2016-10-01
The sediment budget of Jamaica Bay (New York, USA) has been determined using the natural particle-reactive radionuclides 234Th and 210Pb. Inventories of excess thorium-234 (234Thxs, half-life = 24.1 d) were measured in bottom sediments of the Bay during four cruises from September 2004 to July 2006. The mean bay-wide inventory for the four sampling periods ranged from 3.5 to 5.0 dpm cm-2, four to six times that expected from 234Th production in the overlying water column. The presence of dissolved 234Th and a high specific activity of 234Thxs on particles at the bay inlet (∼30 dpm g-1) indicated that both dissolved and particulate 234Th could be imported into the bay from the ocean. Based on these observations, a mass balance of 234Th yields an annual input of ∼39 ± 14 × 1010 g sediment into the bay. Mass accumulation rates determined from profiles of excess 210Pb (half-life = 22.3 y) in sediment cores require annual sediment import of 7.4 ± 4.5 × 1010 g. Both radionuclides indicate that there is considerable marine-derived sediment import to Jamaica Bay, consistent with earlier work using 210Pb. Such sediment input may be important in sustaining longer-term accretion rates of salt marshes in the bay.
230Th/234U activity ratio in the products from Izu-Bonin island-arc volcanoes
International Nuclear Information System (INIS)
Kurihara, Y.; Takahashi, M.; Sato, J.
2006-01-01
Magma genesis at subduction zone is generally inferred to be induced by the partial melting of the mantle wedge by the addition of fluid derived from the subducting slab. Uranium-series disequilibria in the volcanic products are a useful tracer to understand various magma processes. Young island-arc volcanic rocks showed the characteristic feature of excess 234 U over 230 Th. Observation was carried out on the radioactive disequilibrium between 234 U and 230 Th in the volcanic products from Asama volcano and Izu-Mariana island-arc volcanoes. Thorium and Uranium in the volcanic rock samples were separated by anion-exchange resin and purified by TEVA·Spec. and UTEVA·Spec. resins, respectively. Purified Th and U were electrodeposited onto a stainless steel planchet for α-ray counting. U-234 and 230 Th in volcanic rock samples were determined by isotope dilution method coupled with α-ray spectrometry. 230 Th/ 234 U activity ratio in the volcanic products from Asama volcano and Izu-Bonin island-arc volcanoes were in radioactive disequilibrium, enriched in 234 U relative to 230 Th, which is often observed for volcanic products from young island-arc volcanic products. (author)
27 CFR 24.234 - Other use of spirits.
2010-04-01
..., DEPARTMENT OF THE TREASURY LIQUORS WINE Spirits § 24.234 Other use of spirits. The proprietor producing sparkling wine, artificially carbonated wine, formula wine, or essences for which spirits are required may use tax-free wine spirits or brandy. For nonbeverage wine, tax-free spirits other than wine spirits or...
Intake of 210Po, 234U and 238U radionuclides with beer in Poland
International Nuclear Information System (INIS)
Skwarzec, B.; Struminska, D.I.; Borylo, A.; Falandysz, J.
2004-01-01
238 U, 234 U and 210 Po activity concentrations were determined in beer in Poland by alpha-spectrometry with low-level activity silicon detectors. The results revealed that the mean concentrations of 238 U, 234 U and 210 Po in the analyzed beer samples were 4.63, 4.11 and 4.94 mBq x dm -3 , respectively, the highest in Tyskie (5.71 for 210 Po, 5.06 for 234 U and 6.11 for 238 U) and the lowest in Lech (2.49 for 210 Po). The effective radiation dose due to uranium and polonium ingestions by beer was calculated and were compared to the effective radiation dose from drinking water. (author)
The inflow of 234U and 238U from the River Odra drainage basin to the Baltic Sea
Directory of Open Access Journals (Sweden)
Bogdan Skwarzec
2010-12-01
Full Text Available In this study the activity of uranium isotopes 234U and 238U in Odra river water samples, collected from October 2003 to July2004, was measured using alpha spectrometry. The uranium concentrations were different in each of the seasons analysed; the lowest values were recorded in summer. In all seasons, uranium concentrations were the highest in Bystrzyca river waters (from 27.81 ± 0.29Bq m-3 of 234U and 17.82 ± 0.23 Bq m-3 of 238U in spring to 194.76 ± 3.43 Bq m-3 of 234U and 134.88 ± 2.85 Bq m-3 of 238U in summer. The lowest concentrations were noted in the Mała Panew (from 1.33 ± 0.02 Bq m-3 of 234U and 1.06 ± 0.02 Bq m-3 of 238U in spring to 3.52 ± 0.05 Bq m-3 of 234U and 2.59± 0.04 Bq m-3 of 238U in autumn. The uranium radionuclides 234U and 238U in the water samples were not in radioactive equilibrium. The 234U / 238U activity ratios were the highest in Odra water samples collected at Głogów (1.84 in autumn, and the lowest in water from the Noteć (1.03 in winter and spring. The 234U / 238U activity ratio decreases along the main stream of the Odra, owing to changes in the salinity of the river's waters. Annually, 8.19 tons of uranium (126.29 G Bq of 234U and 100.80 G Bq of 238U flow into the Szczecin Lagoon with Odra river waters.
Dissolution behaviour of 238U, 234U and 230Th deposited on filters from personal dosemeters
International Nuclear Information System (INIS)
Beckova, V.; Malatova, I.
2008-01-01
Kinetics of dissolution of 238 U, 234 U and 230 Th dust deposited on filters from personal alpha dosemeters was studied by means of a 26-d in vitro dissolution test with a serum ultra-filtrate simulant. Dosemeters had been used by miners at the uranium mine 'Dolni Rozinka' at Rozna, Czech Republic. The sampling flow-rate as declared by the producer is 4 l h -1 and the sampling period is typically 1 month. Studied filters contained 125 ± 6 mBq 238 U in equilibrium with 234 U and 230 Th; no 232 Th series nuclides were found. Half-time of rapid dissolution of 1.4 d for 238 U and 234 U and slow dissolution half-times of 173 and 116 d were found for 238 U and 234 U, respectively. No detectable dissolution of 230 Th was found. (authors)
Dissolution behaviour of 238U, 234U and 230Th deposited on filters from personal dosemeters.
Becková, Vera; Malátová, Irena
2008-01-01
Kinetics of dissolution of (238)U, (234)U and (230)Th dust deposited on filters from personal alpha dosemeters was studied by means of a 26-d in vitro dissolution test with a serum ultrafiltrate simulant. Dosemeters had been used by miners at the uranium mine 'Dolní Rozínka' at Rozná, Czech Republic. The sampling flow-rate as declared by the producer is 4 l h(-1) and the sampling period is typically 1 month. Studied filters contained 125 +/- 6 mBq (238)U in equilibrium with (234)U and (230)Th; no (232)Th series nuclides were found. Half-time of rapid dissolution of 1.4 d for (238)U and (234)U and slow dissolution half-times of 173 and 116 d were found for (238)U and (234)U, respectively. No detectable dissolution of (230)Th was found.
Tracking particle-associated processes in nearshore environments by use of 234Th/238U disequilibrium
International Nuclear Information System (INIS)
Aller, R.C.; Benninger, L.K.; Cochran, J.K.
1980-01-01
Measurement of excess 234 Th (t 1 sub(/) 2 = 24.1 days) in surface sediment from 12 stations throughout Long Island Sound, U.S.A., demonstrates: (1) a mean (summer) sediment inventory of 3.6 dpm/cm 2 consistent with complete, nearly instantaneous removal of 234 Th from the overlying water and capture within the estuary, and (2) preferential association of excess 234 Th with small particles and inventory build-ups in muddy bottom areas. There may also be a tendency for higher inventories in areas of high physical or biogenic reworking of surface sediments. A range of particle reworking rates (0-5 cm) from -6 to 1.6 x 10 -6 cm 2 /s is found in the Sound with most values approx. 0.2-0.5 x 10 -6 cm 2 /s. The inventory and reworking patterns demonstrate the high mobility, both horizontal and vertical, of particles in the estuary on 234 Th decay time scales and are unequivocal evidence for control of reactive element distribution in the water column by the muddy regions of the basin. (orig.)
222Rn content and 234U/238U activity ratio in groundwaters
International Nuclear Information System (INIS)
Olguin, M.T.; Segovia, N.; Ordonez, E.; Iturbe, J.L.; Bulbulian, S.; Carrillo, J.
1990-01-01
Geochemical radioanalytical studies of ground water were perfomed in the valleys of Villa de Reyes and San Luis Potosi, Mexico. The experiments were designed to measure radon and uranium content and 234 U/ 238 U activity ratio in ground water samples taken from wells in these sites and at the Nuclear Center of Salazar, Mexico. 222 Rn content varied depending on the sample source, reaching a maximum value of 235 pCi/l; uranium concentration results were less than 1 μg/l and 234 U/ 238 U activity ratios were close to equilibrium. (author) 9 refs.; 1 fig.; 1 tab
48 CFR 52.234-4 - Earned Value Management System.
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Earned Value Management....234-4 Earned Value Management System. As prescribed in 34.203(c), insert the following clause: Earned Value Management System (JUL 2006) (a) The Contractor shall use an earned value management system (EVMS...
48 CFR 352.234-1 - Notice of earned value management system-pre-award Integrated Baseline Review.
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Notice of earned value management system-pre-award Integrated Baseline Review. 352.234-1 Section 352.234-1 Federal Acquisition... provision: Notice of Earned Value Management System—Pre-Award Integrated Baseline Review (October 2008) The...
48 CFR 352.234-2 - Notice of earned value management system-post-award Integrated Baseline Review.
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Notice of earned value management system-post-award Integrated Baseline Review. 352.234-2 Section 352.234-2 Federal Acquisition... provision: Notice of Earned Value Management System—Post-Award Integrated Baseline Review (October 2008) (a...
48 CFR 1852.234-2 - Earned Value Management System.
2010-10-01
... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Earned Value Management... and Clauses 1852.234-2 Earned Value Management System. As prescribed in 1834.203-70(b) insert the following clause: Earned Value Management System (NOV 2006) (a) In the performance of this contract, the...
238U, 234U and 230Th in uranium miners' lungs
International Nuclear Information System (INIS)
Singh, M.P.; Wrenn, M.E.; Archer, V.E.; Saccomanno, G.
1981-01-01
Fourteen uranium miners' lungs from Colorado plateau were collected at autopsy and the concentrations of 238 U, 234 U and 230 Th were determined by radiochemical procedures utilizing solvent extraction - alpha spectrometric techniques. The uranium and thorium isotopes are in near equilibrium with average concentrations of 238 U, 234 U and 230 Th being 89.3, 95.2 and 91.1 pCi/kg respectively. The combined average radiation dose rate to lung from these three isotopes is about 24.2 mrad/year at death excluding the unmeasured contribution from the 226 Ra and daughters. The average concentration of 230 Th is about 65 times higher than the mean concentration of 230 Th in lungs of non-miners dying at comparable ages from the same region
2010-01-01
... decision and order of the FAA decisionmaker on appeal. 13.234 Section 13.234 Aeronautics and Space FEDERAL... PROCEDURES Rules of Practice in FAA Civil Penalty Actions § 13.234 Petition to reconsider or modify a final decision and order of the FAA decisionmaker on appeal. (a) General. Any party may petition the FAA...
sup(234) Th scavenging and particle export fluxes from the upper 100 m of the Arabian Sea
Digital Repository Service at National Institute of Oceanography (India)
Sarin, M.M.; Rengarajan, R.; Ramaswamy, V.
of column primary productivity. Using the sup(234) Th export fluxes and the measured specific activity of sup(234) Th in the sediment traps, we have computed th eparticle and carbon fluxes at 100 m. These results reveal that the particle fluxes determined...
234U/238U activity ratio in groundwater - an indicator of past hydrogeological processes
International Nuclear Information System (INIS)
Rasilainen, K.; Suksi, J.; Marcos, N.; Nordman, H.
2005-01-01
In this report we describe the long-term behaviour of the uranium isotopes, U-234 and U-238 in groundwater systems. U is a redox sensitive element what for its behaviour is largely controlled by changes in the environmental conditions. A striking feature in U isotope geochemistry is seemingly different behaviour of U-238 and U-234. U isotopes fractionate at the rock-groundwater interface depending on chemical and radiological factors. Changes of the redox conditions in groundwater may thus affect the behaviour of U and its isotopes resulting in variable U concentration and U-234/U-238 activity ratios (AR). We examined the formation of ARs in different groundwater types from a geochemical and a physical/radiological point of view. It was envisaged that AR in groundwater is the consequence of radiological, chemical and hydrological processes. Groundwater condition (redox, flow, etc.) play a very important role in controlling the mass flow of U isotopes. Quantitative α-recoil modelling showed that α-recoil induced flux can be considered insignificant in cases of high-flow. This was an important finding because the exclusion of direct a-recoil means that it is groundwater chemistry and its variations which controls the U-234 mass flow and the formation of AR. Therefore, AR values could be used more confidently to indicate past redox changes and possibly flow paths. (orig.)
238U, 234U and 230Th in uranium miners' lungs
International Nuclear Information System (INIS)
Singh, N.P.; Wrenn, M.E.; Bennett, D.B.; Archer, V.; Saccomanno, G.
1982-01-01
Fourteen uranium miners' lungs from the Colorado Plateau were collected at autopsy and the concentrations of 238 U, 234 U and 230 Th were determined by radiochemical procedures utilizing solvent extraction and alpha spectrometric techniques. The uranium and thorium isotopes are in near equilibrium with average concentrations of 238 U, 234 U and 230 Th being 89.3, 95.2, and 91.1 pCi/kg respectively. The combined average radiation dose rate to lung from these three isotopes is about 24.1 mrad/year at death excluding the unmeasured contribution from the 226 Ra and daughters. The average concentration of 230 Th is about 65 times higher than the mean concentration of 230 Th in lungs of non-miners from the same region dying at comparable ages
International Nuclear Information System (INIS)
McKee, B.A.; DeMaster, D.J.; Nittrouer, C.A.
1984-01-01
Measurements of 234 Th (tsub(1/2)=24.1 d) in water column and seabed samples from an area near the mouth of the Yangtze River (People's Republic of China) provide the following information: Most of the 234 Th in waters near the mouth of the Yangtze River is in particulate form, and horizontal transport and sedimentation of 234 Th-bearing particles dominate the 234 Th budget in this area. A model incorporating processes in at least two dimensions is required to understand the fate of particle-reactive species on the Yangtze continental shelf. The residence times of particle-reactive species (with respect to scavenging) range from 0.3 days (nearshore) to 4.0 days (offshore). The residence times (with respect to removal to the seabed) range from 0.5 day (nearshore) to 11.0 days (offshore). Scavenging residence times for 234 Th decrease as the concentration of suspended particles increases. The time for removal of 234 Th to the seabed increases with distance from shore (a variable which integrates such factors as scavenging rate, bathymetry, and frequency of resuspension). (orig.)
49 CFR 234.7 - Accidents involving grade crossing signal failure.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Accidents involving grade crossing signal failure... PLANS Reports and Plans § 234.7 Accidents involving grade crossing signal failure. (a) Each railroad... (activation failure report) and 49 CFR 225.11 (accident/ incident report). (b) Each telephone report must...
@u234@@Th scavenging and particle export fluxes from the upper 100 m of the Arabian Sea
Digital Repository Service at National Institute of Oceanography (India)
Sarin, M.M.; Rengarajan, R.; Ramaswamy, V.
for the upper 100 m yields a mean scavenging residence time of ~k30 days and a removal rate of ~k 3400 dpm m@u-2@@ d@u-1@@ for @u234@@Th, from dissolved to particulate phases. The deficiency of total @u234@@Th (dissolved + particulate) relative to @u238@@U...
Identification of Rad23-4 gene required for pollen development in ...
African Journals Online (AJOL)
雨林木风
2012-05-31
May 31, 2012 ... in ultraviolet (UV)-B–treated rad23-4 mutants. Compared with the wild type ... discovered in yeast (Guzder et al., 1998). Recent studies showed that ... UV-B irradiation can induce accumulations of anthocyanin in the plants.
Uranium contents and 234U/238U activity ratios of modern and fossil marine bivalle molluscan shells
International Nuclear Information System (INIS)
Mitsuda, Hiroshi
1984-01-01
Uranium contents and 234 U/ 238 U activity ratios in modern and fossil marine bivalle molluscan shells were measured by alpha-spectrometry. Uranium contents and 234 U/ 238 U activity ratios in modern shells were averaged to be 0.266 (dpm/g), and 1.18, respectively and those in fossil shells were averaged to be 0.747 (dpm/g), and 1.19, respectivily. Uranium contents in fossil shells were obviously higher than those in modern shells. It can be explained by the addition of uranium to shell during the deposition. In fossil shells, 234 U/ 238 U activity ratio decreases as 238 U content increases the same tendency is not found in modern shells. The author proposed a mechanism of selective loss of 238 U from the fossil shells for the explanation of this tendency. The height activity ratio of 234 U/ 238 U measured on the fossil shells than that measured on the modern shells, also support the selective loss of 238 U from the fossil shells. (author)
Energy Technology Data Exchange (ETDEWEB)
Vieira, Lucia Helena
2011-07-01
The Southern Ocean is the largest of several high-nutrient, low-chlorophyll (HNLC) regions in the world's oceans. This region plays a major role in regulating the global net transfer of carbon dioxide between the ocean and the atmosphere, in part because the annual photosynthetic uptake of CO{sub 2} by phytoplankton and resulting export of particulate organic carbon (POC) to the deep ocean. The element thorium has multiple radioisotopes that have emerged collectively as a powerful set of tracers for particle associated processes in the oceans. Of all the Th isotopes, {sup 234}Th (half-life 24.1 d) has been the focus of increasing attention and application in the past years. The production of {sup 234}Th from {sup 238}U, coupled with the conservative behavior of {sup 238}U in seawater, makes the source of {sup 234}Th easy to characterize. Moreover, the half-life of {sup 234}Th is sufficiently short to make it sensitive to the short-term (e.g. seasonal) changes that occur in the upper water column of the open ocean or in sediments or water column in coastal areas. Because of its very particle reactive behavior, {sup 234}Th is removed from a parcel of water in only two ways, through decay and through particle flux. Therefore, a steady-state 1D activity balance can be used to calculate its flux. Natural Ra isotopes have been also widely used in marine studies to trace water masses and to quantify mixing processes. This work presents results of a collaborative research on organic carbon fluxes distribution in the Bransfield Strait in order to evaluate its influence in the CO{sub 2} drawdown. Macro-nutrients, micro-nutrients and chlorophyll-a distributions were used to examine the pathway sources. Natural radium isotopes were applied as tracers to study the movement of shelf water, while {sup 234}Th was used as a tracer of particle flux in the upper ocean, since POC export via sinking particles is the primary mechanism of carbon sequestration in the Southern Ocean
International Nuclear Information System (INIS)
Vieira, Lucia Helena
2011-01-01
The Southern Ocean is the largest of several high-nutrient, low-chlorophyll (HNLC) regions in the world's oceans. This region plays a major role in regulating the global net transfer of carbon dioxide between the ocean and the atmosphere, in part because the annual photosynthetic uptake of CO 2 by phytoplankton and resulting export of particulate organic carbon (POC) to the deep ocean. The element thorium has multiple radioisotopes that have emerged collectively as a powerful set of tracers for particle associated processes in the oceans. Of all the Th isotopes, 234 Th (half-life 24.1 d) has been the focus of increasing attention and application in the past years. The production of 234 Th from 238 U, coupled with the conservative behavior of 238 U in seawater, makes the source of 234 Th easy to characterize. Moreover, the half-life of 234 Th is sufficiently short to make it sensitive to the short-term (e.g. seasonal) changes that occur in the upper water column of the open ocean or in sediments or water column in coastal areas. Because of its very particle reactive behavior, 234 Th is removed from a parcel of water in only two ways, through decay and through particle flux. Therefore, a steady-state 1D activity balance can be used to calculate its flux. Natural Ra isotopes have been also widely used in marine studies to trace water masses and to quantify mixing processes. This work presents results of a collaborative research on organic carbon fluxes distribution in the Bransfield Strait in order to evaluate its influence in the CO 2 drawdown. Macro-nutrients, micro-nutrients and chlorophyll-a distributions were used to examine the pathway sources. Natural radium isotopes were applied as tracers to study the movement of shelf water, while 234 Th was used as a tracer of particle flux in the upper ocean, since POC export via sinking particles is the primary mechanism of carbon sequestration in the Southern Ocean. Sea water samples for total 234 Th and natural Ra
International Nuclear Information System (INIS)
Cuesta, E.; Lozano, R.L.; Miguel, E.G. San; Casas-Ruiz, M.; Bolívar, J.P.
2016-01-01
This paper relates the calibration of a low background gas-flow proportional counter. This calibration has been used to determine low activity of "2"3"4Th in coastal water samples. Two methods were used to prepare calibration samples: Evaporation and Electrodeposition. First method was rejected due to the lack of reproducibility because the different geometry adopted by the drops of tracer once dried on the disk. On the contrary, through the second method, similar efficiencies were obtained in all detectors with an average of 0.401±0.004. In this paper, the whole procedure to obtain "2"3"4Th activity in dissolution as well as in particulate matter has been detailed, and all the algorithms needed to calculate activities and efficiencies are shown. Finally, two experiments have been designed in order to validate the calibration of the beta counter and the method to determine "2"3"4Th in coastal waters with high concentration of particulate matter. - Highlights: • This paper shows a Home-made calibration using two methods to prepare calibration samples. • The algorithms needed to obtain Th-234 activity concentrations are described in full detail. • This is the first time Th-234 has been determined in water samples from Huelva Estuary.
The study of structure in 224–234 thorium nuclei within the framework IBM
Directory of Open Access Journals (Sweden)
Lee Su Youn
2017-01-01
Full Text Available An investigation has been made of the behaviour of nuclear structure as a function of an increase in neutron number from 224Th to 234Th. Thorium of mass number 234 is a typical rotor nucleus that can be explained by the SU(3 limit of the interacting boson model(IBM in the algebraic nuclear model. Furthermore, 224−232Th lie on the path of the symmetry-breaking phase transition. Moreover, the nuclear structure of 224Th can be explained using X(5 symmetry. However, as 226−230Th nuclei are not fully symmetrical nuclei, they can be represented by adding a perturbed term to express symmetry breaking. Through the following three calculation steps, we identified the tendency of change in nuclear structure. Firstly, the structure of 232Th is described using the matrix elements of the Hamiltonian and the electric quadrupole operator between basis states of the SU(3 limit in IBM. Secondly, the low-lying energy levels and E2 transition ratios corresponding to the observable physical values are calculated by adding a perturbed term with the first-order Casimir operator of the U(5 limit to the SU(3 Hamiltonian in IBM. We compared the results with experimental data of 224−234Th. Lastly, the potential of the Bohr Hamiltonian is represented by a harmonic oscillator, as a result of which the structure of 224−234Th could be expressed in closed form by an approximate separation of variables. The results of these theoretical predictions clarify nuclear structure changes in Thorium nuclei over mass numbers of practical significance.
Rates of sediment reworking at the HEBBLE site based on measurements of Th-234, Cs-137 and Pb-210
International Nuclear Information System (INIS)
DeMaster, D.J.; McKee, B.A.; Nittrouer, C.A.; Brewster, D.C.; Biscaye, P.E.
1985-01-01
Th-234, Cs-137 and Pb-210 measurements have been made on ten cores from the HEBBLE site on the Nova Scotian continental rise. Th-234 mixing coefficients from HEBBLE sediments show substantial lateral variability with values ranging from 1 to 33 cm 2 yr -1 . These mixing coefficients are one to two orders of magnitude greater than values from typical continental-rise and abyssal sediments because of high densities of benthic macrofauna. Th-234 data from HEBBLE cores indicate that particles at the sediment-water interface are mixed to depths of 1-5 cm on a 100-day time scale. Cs-137 and Pb-210 data indicate that on time scales of 30-100 yrs surface sediments are reworked to depths ranging from 1 to 12 cm. Based on Th-234 profiles from two HEBBLE cores collected less than 200 m apart during consecutive years, no temporal variability in mixing rate could be resolved. (Auth.)
Uranium 234U and 238U isotopes in the southern Baltic environment
International Nuclear Information System (INIS)
Borylo, A.; Skwarzec, B.
2002-01-01
The concentration and distribution of uranium in water and sediment of selected basins of the southern Baltic Sea have been analysed. It was observed that the concentration of uranium in sediments increases with core depth. This is probably connected to diffusion processes from sediments to water through interstitial water where uranium concentration is much higher than in bottom water. The measurements of 234 U/ 238 U activity ratios indicate that sedimentation of terrigenic material and transport through Vistula river are the major sources of uranium in sediments of the southern Baltic Sea. Estimation of the 234 U/ 238 U ratios in reduction areas of the Baltic Deep and the Bornholm Deep suggest that the processes of reduction of U(VI) to U(IV) and of removal of authogenic uranium from seawater to sediments do not play major roles in the Gdansk Deep. (author)
Arabidopsis rad23-4 gene is required for pollen development under ...
African Journals Online (AJOL)
Nucleotide excision repair (NER) is a highly conserved DNA repair pathway for correcting DNA lesions that cause distortion of the double helical structure. The protein heterodimer Rad23 is involved in recognition and binding to such lesions. Here, we showed that rad23-4 (AT5g38470) was expressed in the roots, mature ...
Intermediate structure studies of 234U cross sections
International Nuclear Information System (INIS)
James, G.D.; Schindler, R.H.
1976-01-01
Neutron induced fission and total cross sections of 234 U have been measured over the neutron energy range from a few eV to several MeV. Neutron and fission widths for 118 cross section resonances below 1500 eV have been determined and give a class I level spacing of 10.64 + -0.46 eV and a neutron strength function of (0.857 +- 0.108)x10 -4 . These fine structure resonances comprise a narrow intermediate structure resonance in the sub-threshold fission cross section of 234 U. Parameters for the Lorentzian energy dependence of the mean fission width are deduced on the assumption that, relative to this mean, the observed fission widths have a Porter-Thomas distribution. Two large fission widths measured for resonances at 1092.5 eV and 1134 eV may indicate the presence of a second narrow intermediate structure resonance at about this energy. The class II level spacing derived from the observation of 7 resonances below 13 keV is 2.1 +-0.3 keV. Pronounced breaks in the fission cross section at 310 keV, 550 keV and 720 keV are assumed to be due to β-vibrational levels in the second minimum of the Strutinsky potential. Fluctuations due to the presence of class II resonances are strongly evident for each of these vibrational levels. It is shown that the fluctuations near 310 keV are consistent with parameters deduced from the low energy data and this enables parameters for the double humped fission barrier potential to be obtained
International Nuclear Information System (INIS)
Grant Evenson
2007-01-01
Corrective Action Unit 234, Mud Pits, Cellars, and Mud Spills, consists of 12 inactive sites located in the north and northeast section of the NTS. The 12 CAU 234 sites consist of mud pits, mud spills, mud sumps, and an open post-test cellar. The CAU 234 sites were all used to support nuclear testing conducted in the Yucca Flat and Rainier Mesa areas during the 1950s through the 1970s. The CASs in CAU 234 are being investigated because hazardous and/or radioactive constituents may be present in concentrations that could potentially pose a threat to human health and the environment. Existing information on the nature and extent of potential contamination is insufficient to evaluate and recommend corrective action alternatives for the CASs. Additional information will be generated by conducting a CAI before evaluating and selecting appropriate corrective action alternatives
Isotope shift of 234U, 236U, 238U in U I
International Nuclear Information System (INIS)
Gagne, J.M.; Nguyen Van, S.; Saint-Dizier, J.P.; Pianarosa, P.
1976-01-01
New and very accurate data of isotope shifts and relative isotope shifts in 234 U, 236 U, 238 U are presented. The invariance of the relative isotope shift, for the transitions we have investigated, supports the hypothesis that the so called specific mass effect is negligible in uranium
International Nuclear Information System (INIS)
Souza, Francisca de
2006-01-01
Activity concentrations of ( 234 U) and ( 238 U) were determined in groundwaters drawn from three deep wells drilled in rocks from Itu Intrusive Suite (SP), two located in Salto town (S and SY wells) and the other one in Itu (I well). Sampling was done from September, 2004 to December, 2005, and twelve samples of each well were collected monthly. For those determinations alpha spectrometry technique was used, providing high precision results, as shown by the very good agreement of the data obtained in the analyses of 23 duplicates. The waters from the three wells presented a considerable enrichment of 234 U in relation to 238 U, indicating an important radioactive disequilibrium of these isotopes. In well I, the activity concentrations of ( 238 U) varied from (1,06 +- 0,03) to (2,1+- 0,2) mBq/L and those of ( 234 U) spanned from (3,1 +- 0,2) to (6,0 +- 0,4) mBq/L, whereas ( 234 U/ 238 U) activity ratios did not present significant variation, during the sampling time interval, presenting an average of 2,8 +- 0,1. The S waters showed the lowest uranium concentrations and the largest diversity of ( 238 U) and ( 234 U) activity concentrations, which varied from (0,26 +- 0,02) to (1,07+- 0,08) mBq/L and from (1,8 +- 0,1) to (7,0 +- 0,5) mBq/L, respectively, and also presented variable ( 234 U/ 238 U) activity ratios, spanning from (2,79 +- 0,07) to (8,1+- 0,3). In SY well, ( 238 U) activities varied between (0,8 +- 0,1) and (4,2 +- 0,3) mBq/L and those ones of ( 234 U) from (14 +- 1) to (53 +- 4) mBq/L, whereas ( 234 U/ 238 U) ratios fell in the interval from 12,6 +- 0,3 to 18,3 +- 0,4, with the highest activities of both radioisotopes registered during the dry season and the lowest ones in the rainy time period. The ( 234 U/ 238 U) activity ratios, which were invariable during sampling period of well I, indicated the contribution of rainfall to recharge the aquifer. The observed correlation between those ratios and uranium concentrations, for S and SY wells, showed
Recovery and purification of uranium-234 from aged plutonium-238
International Nuclear Information System (INIS)
Keister, P.L.; Figgins, P.W.; Watrous, R.M.
1978-01-01
The current production methods used to recover and purify uranium-234 from aged plutonium-238 at Mound Laboratory are presented. The three chemical separation steps are described in detail. In the initial separation step, the bulk of the plutonium is precipitated as the oxalate. Successively lower levels of plutonium are achieved by anion exchange in nitrate media and by anion exchange in chloride media. The procedures used to characterize and analyze the final U 3 O 8 are given
New explanation for extreme u-234 u-238 disequilibria in a dolomitic aquifer
CSIR Research Space (South Africa)
Kronfeld, J
1994-05-01
Full Text Available High U-234/U-238 activity ratios are found in the shallow groundwater of the phreatic Transvaal Dolomite Aquifer. The aquifer is uranium poor, while the waters are oxygen rich and young. Tritium and C-14 are used to show that the disequilibrium...
McClintic, Mark A.; DeMaster, David J.; Thomas, Carrie J.; Smith, Craig R.
2008-11-01
Naturally occurring 234Th (24-d half-life) was used on the West Antarctic continental shelf to evaluate temporal variations in the flux of particulate material reaching the seabed, bioturbation intensity, the seasonal continuity of feeding by benthic fauna, and trends in particle selection during ingestion for six common detritivores (four surface deposit feeders and two subsurface deposit feeders). These measurements were made at three stations during the five FOODBANCS cruises (December 1999, March, June, and October 2000, and March 2001) to assess the nature of pelagic-benthic coupling on the shelf and to evaluate the seabed as a potential food bank for deposit feeders when surface primary production is minimal. Two summer regimes were sampled (March 2000 and March 2001) with the latter exhibiting a distinct 1-2-cm-thick phytodetritus layer in nearly all sediment core samples. At site B, the 234Th fluxes into the near-bottom (150/170 mab) sediment traps were indistinguishable for the December-March 2000, March-June 2000, and June-October 2000 sampling intervals (fluxes ranging from 170 to 280 dpm m -2 d -1). However, the sediment-trap 234Th flux measured for the October 2000-March 2001 interval (1000 dpm m -2 d -1) was ˜5-fold greater than during the other three sampling periods, consistent with the deposition of a phytodetritus layer. The steady-state 234Th fluxes derived from seabed inventories at site B were 2.4-2.7 times greater than the sediment-trap 234Th fluxes, indicating substantial scavenging of this particle-reactive radiotracer in the bottom 150 m of the water column and/or lateral transport near the seabed. The seabed 234Th inventories at the three stations showed no variation during the first four cruises, but were significantly greater during cruise FB-V (March 2001), when the phytodetritus layer occurred. Based on 234Th distributions in the seabed, bioturbation intensities (quantified using the diffusive mixing coefficient, Db) varied from 0
Planchon, F.; Cavagna, A.-J.; Cardinal, D.; André, L.; Dehairs, F.
2012-04-01
As part of the Bonus-GoodHope expedition (late summer 2008; Feb-March) in the Atlantic sector of the Southern Ocean, we present combined 234Th and biogenic particulate barium (Baxs) results. These data are used to estimate the export of particulate organic carbon (POC) from the upper mixed layer and the impact of twilight zone remineralisation on the carbon export. Total 234Th activity in surface waters is depleted relative to its parent nuclide 238U (234Th/238U ratio ranging from 0.74 to 0.91), while equilibrium is reached at the base of the surface mixed-layer. The export fluxes of 234Th from the 100m horizon, as estimated using steady state (SS) and non steady state (NSS) models, reveal different latitudinal trends. SS 234Th export varies from 496 dpm m-2 d-1 in the subtropical domain of the Cape Basin to 1195 dpm m-2 d-1 close to the Polar Front (PF). NSS export representative for a 15 to 22 day period preceding the cruise, is consistently less than SS export in the sub-Antarctic Zone (SAZ, 150 dpm m-2 d-1) and the Polar Frontal Zone (PFZ, 440 dpm m-2 d-1) but is similar further south in the Antarctic Zone (AZ, 1217 dpm m-2 d-1) and the northern Weddell Gyre (N-WG; 757 dpm m-2 d-1). This reflects temporal variability of export north of the PF, while south of the PF the export system appears to be in steady state during this late summer situation. The POC:Th ratio of large (>53 µm) particles collected below the surface mixed layer increases from 1.7 µmol dpm-1 in the STZ to a maximum of 4.8 µmol dpm-1 at the Southern Antarctic Circumpolar Current Front (SACCF), suggesting a southward increase of the contribution of larger cells, such as diatoms, to sinking material. Using these POC:Th ratios we calculate that the POC SS export from the 100m horizon reaches 0.9-1.7 mmol m-2 d-1 in the STZ and the SAZ, 2.6-4.7 mmol m-2 d-1 in the PFZ, and 3.3 mmol m-2 d-1 in the N-WG. Below the export layer, in the mesopelagic zone (100-600 m), 234Th activities generally reach
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Waters subject to tidal influence; waters subject to the ebb and flow of the tide; mean high water. 2.34 Section 2.34 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY GENERAL JURISDICTION Jurisdictional Terms § 2...
International Nuclear Information System (INIS)
Hollenbach, Mark; Grohs, James; Mamich, Stephen; Kroft, Marilyn; Denoyer, E.R.
1994-01-01
A new method is described for the determination of 99 Tc, 230 Th, and 234 U at ultra-trace levels in soils. The method used flow injection (FI) for on-line preconcentration of 99 Tc, 230 Th and 234 U prior to detection using inductively coupled plasma mass spectrometry (ICP-MS). The FI-ICP-MS method results in greater sensitivity and freedom from interferences compared with direct aspiration into an ICP mass spectrometer. Detection limits are improved by approximately a factor of 10. The FI-ICP-MS method is also faster, less labour intensive and generates less laboratory waste than traditional radiochemical methods. The accuracy of the method was tested for 99 Tc by comparison to liquid scintillation counting and for 230 Th and 234 U by analysis of a US Department of Energy reference soil. Detection limits in the soil for 99 Tc, 230 Th and 234 U were 11 mBq g -1 (0.02 ng g -1 ), 3.7 mBq g -1 (0.005 ng g -1 ) and 0.74 mBq g -1 (0.003 ng g -1 ), respectively. Sample preparation, analysis protocol, and method validation are described. (Author)
International Nuclear Information System (INIS)
Latham, A.G.
1991-01-01
The observed profiles of uranium content and 234 U/ 238 U activity ratios as they vary with distance into the rock at a granite fracture wall have been interpreted using a simple diffusion-sorption model. For simplicity, the model assumes a linear reversible isotherm. Using simple constraints, it has been possible to estimate long-term values appropriate for the distribution coefficient, K d for uranium in granite. A potential constraint on the uranium K d value is provided by the 234 U/ 238 U activity ratio variations. However, natural 234 U/ 238 U activity ratios seldom change monotonically with distance and it is suspected that they are the result, to some extent, of later uranium removal. To take this approach further, corresponding physical rock property data and closer sampling in the fracture profiles would be required. Estimates of K d are in the range 0.1 to 10 m 3 kg -1 , and are in agreement with the upper part of the range obtained from laboratory experiments. (author)
distributions for the thermal neutron induced fission of 234U
Directory of Open Access Journals (Sweden)
Al-Adili A.
2016-01-01
In addition, the analysis of thermal neutron induced fission of 234U(n,f will be discussed. Currently analysis of data is ongoing, originally taken at the ILL reactor. The experiment is of particular interest since no measurement exist of the mass and energy distributions for this system at thermal energies. One main problem encountered during analysis was the huge background of 235U(nth,f. Despite the negligible isotopic traces in the sample, the cross section difference is enormous. Solution to this parasitic background will be highlighted.
230Th/234U age of a Mousterian site in France
International Nuclear Information System (INIS)
Schwarcz, H.P.; Blackwell, B.
1983-01-01
The 230 Th/ 234 U dating method has been used to determine the age of a travertine layer in the Pech 1 cave of Sarlat, South-West France. The reported age of 123 +- 15 kyr is consistent with deposition of this travertine during isotope state 5e, the warmest substage of the last inter-glacial. It is shown that this result is consistent with geological and paleontological estimates of the age of sediments filling the cave. (U.K.)
International Nuclear Information System (INIS)
Gulin, S.B.; National Academy of Sciences of Ukraine, Sevastopol, Autonomous Republic of Crimea
2014-01-01
Measurements of particulate and dissolved 234 Th were carried out in March 2002 in the Bransfield Strait located between the Antarctic Peninsula and the South Shetland Islands. The 234 Th/ 238 U disequilibrium found in the upper water column has allowed evaluation of downward particle fluxes across a frontal zone, which divides water masses coming from the Bellingshausen Sea and the Weddell Sea. The highest particle flux has been found in this mixing zone, where it was 3-5 times greater than in the adjacent waters. Total mass fluxes in the upper 150-m water column were estimated as about 2.2 g m -2 day -1 in the eastern part of the Strait and 3.1 g m -2 day -1 in the western area. (author)
International Nuclear Information System (INIS)
Francesco De Santis; Massimo Esposito
2015-01-01
In this paper, we compare the 234 U/ 238 U activity ratios (ARs) in various internal tissues and organs of a goat kid with the ingested 234 U/ 238 U AR to assess isotopic fractionation. The results obtained from soft tissues (i.e., the kidneys, liver, lung, and bladder) that undergo indirect assimilation of uranium from the feed through the bloodstream suggest an increase in the 234 U/ 238 U AR. In contrast, the intestine, bones and feces had the same AR values as the feed. Finally, we broadly assess uranium transfer from the feed to the animal based on the concentration ratio and the feed transfer coefficient. (author)
230Th/234U dating of coral limestones and vertical uplift at Djibouti
International Nuclear Information System (INIS)
Faure, Hugues; Hoang, C.T.; Lalou, Claude
1980-01-01
Coral limestones sampled from marine terraces along the Afar coast have been dated by the 230 Th/ 234 U method. The ages confirm the stratigraphic unity of these formations and the existence of the paleo sea level dated 124 000 years ago in this region. These results permit to deduce the uplift rates of this littoral [fr
International Nuclear Information System (INIS)
Lapa, Flavia V.; Oliveira, Joselene de; Costa, Alice M.R.; Braga, Elisabete S.
2013-01-01
In this study the naturally occurring radionuclides 234 Th and 238 U were used to investigate the magnitude of upper ocean particulate organic carbon export in Bransfield Strait, Southern Ocean. This region is the largest oceanic high-nitrate low-chlorophyll (HNLC) area in the world and is known to contribute to regulate of the atmospheric CO 2 via the biological pump. Due to its different geochemical behavior in seawater, the resulting U/Th disequilibria can be easily used to constrain the transport rates of particles and reaction processes between solution and particulate phases. Sampling occurred during the summer (March and November) 2011. Total 234 Th activities in surface seawater samples ranged from 1.3 to 3.7 dpm L -1 (station EB 011) during March/11 campaign, while in October/11 total 234 Th activity concentrations varied from 1.4 to 2.9 dpm L -1 . Highest total 234 Th activities were found late in the austral summer season. Activity concentrations of dissolved 238 U in surface seawater varied from 2.1 to 2.4 dpm L -1 . Taking into account all sampling stations established in March and October/11 the relative variability of total 234 Th distribution was 22%. (author)
International Nuclear Information System (INIS)
Rolison, J.M.; Treinen, K.C.; McHugh, K.C.; Gaffney, A.M.; Williams, R.W.
2017-01-01
Uranium certified reference materials (CRM) issued by New Brunswick Laboratory were subjected to dating using four independent uranium-series radiochronometers. In all cases, there was acceptable agreement between the model ages calculated using the 231 Pa- 235 U, 230 Th- 234 U, 227 Ac- 235 U or 226 Ra- 234 U radiochronometers and either the certified 230 Th- 234 U model date (CRM 125-A and CRM U630), or the known purification date (CRM U050 and CRM U100). The agreement between the four independent radiochronometers establishes these uranium certified reference materials as ideal informal standards for validating dating techniques utilized in nuclear forensic investigations in the absence of standards with certified model ages for multiple radiochronometers. (author)
International Nuclear Information System (INIS)
Chabaux, F.; Cohen, A.S.; O'Nions, R.K.; Hein, J.R.
1995-01-01
Comparison of ( 234 U) excess /( 238 U) and ( 230 Th)/( 232 Th) activity ratios in oceanic Fe-Mn deposits provides a method for assessing the closed-system behaviour of 238 U- 234 U- 230 Th, as well as variations in the initial uranium and thorium isotopic ratios of the precipitated metal oxides. This approach is illustrated using a Fe-Mn crust from Lotab seamount (Marshall Islands, west equatorial Pacific). Here we report uranium and thorium isotopic compositions in five subsamples from the surface of one large 5 cm diameter botyroid of this crust, and from two depth profiles of the outermost rim of the same botyroid. The decrease of ( 234 U) excess /( 238 U) and ( 230 Th/ 232 Th) activity ratio with depth in the two profiles gives mean growth rates, for the last 150 ka, of 7.8 ± 2 mm/Ma and 6.6 ± 1 mm/Ma, respectively. All data points (surface and core samples) but one, define a linear correlation in the Ln ( 230 Th/ 232 Th) - Ln [( 234 U) excess ( 238 U)] diagram. This correlation indicates that for all points the U-Th system remained closed after the Fe-Mn layer precipitated, and that the different samples possessed the same initial Uranium and thorium isotope ratios. Furthermore, these results show that the preserved surface of this Fe-Mn crust may not be the present-day growth surface, and that the thorium and uranium isotopic ratios of seawater in west equatorial Pacific have not changed during the past 150 ka. The initial thorium activity ratio is estimated from the correlation obtained between Ln( 230 Th/ 232 Th) and Ln [( 234 U) excess /( 238 U)
International Nuclear Information System (INIS)
Gulin, S.B.
2000-01-01
Two seasonal surveys of 234 Th activity in surface water were carried out in November 1998 and June 1999 along the transect Sevastopol (Ukraine) - Istanbul (Turkey) crossing the entire western Black Sea between the SW Crimean Peninsula and the Bosphorus Strait entry. A steady-state model of 234 Th/ 238 U equilibrium in seawater was used to calculate the net removal flux of 234 Th by particles. The results obtained from central stations of the transect were in good agreement with those observed seasonally in 1992-1994 within the western cyclonic gyre of the abyssal Black Sea, showing that in June 1999 the sampling was conducted during the peak summer bloom of coccolithophorids, while in November 1998 the samples were collected three weeks after the autumn phytoplankton bloom. The 234 Th scavenging rates and the total mass fluxes were thus much higher in the June sampling period than in November at the stations located in the western cyclonic gyre and at the northern margin of the abyssal Black Sea basin. In contrast, the considerable seasonal differences were not found at the location near the Bosphorus Strait entry, suggesting a larger lateral input of particulate matter transported to this area from the western and northwestern shelf due to cyclonic circulation of the surface waters
International Nuclear Information System (INIS)
Oliveira Alves, M.A. de; Arruda, C.S.; Ogliari, P.J.; Meinert, E.M.; Teixeira, E.; Barrera-Arellano, D.; Block, J.M.
2005-01-01
In this work, the effect of the addition of the UV absorber Tinuvin 234 on the quality of soybean oil packaged in PET bottles stored at ambient temperature for 6 months under fluorescent light (634 lux). Along this period determinations were made of: peroxide value (PV), free fatty acids (FFA), specific extinction at 232 and 270 nm (EE) and sensorial evaluation (SE). The analysis of variance and resistance between the linear coefficients of each treatment indicates that significant difference does not exist (p0.0001) during the storage in relation to all determinations (PV, FFA, EE and SE). The results indicate that the addition of the absorbent Tinuvin 234 to PET bottles in the concentrations of 0.12% and 0.22% was not efficient in slowing down the deterioration of the oil exposed to the fluorescent light, when compared with soybean oil in PET bottles without addition of Tinuvin 234. (author) [es
International Nuclear Information System (INIS)
Smoak, J.M.; DeMaster, D.J.; Pope, R.H.; Kuehl, S.A.; McKee, B.A.
1996-01-01
Excess 234 Th and 210 Pb seabed inventories were measured in cores collected from the Amazon continental shelf to examine particle scavenging and seabed dynamics. Typical excess 210 Pb inventories range from 100 to 300 dpm cm -2 , and the total excess 210 Pb inventory for the Amazon shelf was determined to be 2.7 x 10 17 dpm. The 210 Pb measurements indicate that particle-reactive species are scavenged not only form the Amazon River but also from the lateral advection of offshore water. In order to sustain the 210 Pb inventories, the volume of water supplied by the lateral advection from offshore must be approximately five to ten times the water discharge of the Amazon River. This lateral advection supplies about 67% of the total excess 210 Pb to the Amazon continental shelf with relatively small contributions from riverine input (31%), atmospheric fallout (2.3%), and in-situ production (0.1%). The 234 Th inventories were measured on four cruises, which occurred during periods of differing river discharge, wind stress, and flow rates of the North Brazil Current. The 234 Th excess seabed inventories show large spatial and seasonal variability, with a range from 0 to 22 dpm cm -2 . This approach indicates that for most of the shelf, the inventories of the shorter-term tracer ( 234 Th) are less than predicted by the inventories of the longer-term tracer ( 210 Pb). There are two explanations for this trend. The first is that a larger portion of the 234 Th inventory occurs in the fluid muds or the water column relative to 210 Pb. The second is that the supply of offshore water, scavenging efficiency, and/or deposition have been lower over the two year study period relative to the last one hundred years. 38 refs., 7 figs
238,234U contents on Lepomis Cyanellus from San Marcos dam located in a uraniferous area
Lares, Magaly Cabral; Luna-Porres, Mayra Y.; Montero-Cabrera, María E.; Renteria-Villalobos, Marusia
2014-07-01
Fish species are suitable biomonitors of radioisotopes in aquatic systems. In the present study, it was made the determination of uranium isotopic contents on fish fillet (Lepomis Cyanellus) from San Marcos dam which is located in uranium mineralized zone. Uranium activity concentrations (AC) in fish samples were obtained on wet weight (ww), using liquid scintillation. 238U and 234U AC in fish fillet ranged from 0.0004 to 0.0167 Bq kg-1, and from 0.0013 to 0.0394 Bq kg-1, respectively. The activity ratio (234U/overflow="scroll">238U) in fish fillet ranged from 2.2 to 8.8. Lepomis cyanellus from San Marcos dam shows bioaccumulation factor (FB) of 0.6 L kg-1. The results suggest that the Lepomis Cyanellus in environments with high U contents tends to have a greater bioaccumulation compared to others.
Mass spectrometric 230Th-234U-238U dating of the Devils Hole calcite vein
International Nuclear Information System (INIS)
Ludwig, K.R.; Simmons, K.R.; Szabo, B.J.; Riggs, A.C.; Winograd, I.J.; Landwehr, J.M.; Hoffman, R.J.
1992-01-01
The Devils Hole calcite vein contains a long-term climatic record, but requires accurate chronologic control for its interpretation. Mass-spectrometric U-series ages for samples from core DH-11 yielding 230 Th ages with precisions ranging from less than 1,000 years (2σ) for samples younger than ∼140 ka (thousands of years ago) to less than 50,000 years for the oldest samples (∼566 ka). The 234 U/ 238 U ages could be determined to a precision of ∼20,000 years for all ages. Calcite accumulated continuously from 566 ka until ∼60 ka at an average rate of 0.7 millimeter per 10 3 years. The precise agreement between replicate analyses and the concordance of the 230 Th/ 238 U and 234 U/ 238 U ages for the oldest samples indicate that the DH-11 samples were closed systems and validate the dating technique in general
The estuarine chemistry and isotope systematics of 234,238U in the Amazon and Fly Rivers
Swarzenski, P.; Campbell, P.; Porcelli, D.; McKee, B.
2004-01-01
Natural concentrations of 238U and ??234U values were determined in estuarine surface waters and pore waters of the Amazon and Fly (Papua New Guinea) Rivers to investigate U transport phenomena across river-dominated land-sea margins. Discharge from large, tropical rivers is a major source of dissolved and solid materials transported to the oceans, and are important in defining not only oceanic mass budgets, but also terrestrial weathering rates. On the Amazon shelf, salinity-property plots of dissolved organic carbon, pH and total suspended matter revealed two vastly contrasting water masses that were energetically mixed. In this mixing zone, the distribution of uranium was highly non-conservative and exhibited extensive removal from the water column. Uranium removal was most pronounced within a salinity range of 0-16.6, and likely the result of scavenging and flocculation reactions with inorganic (i.e., Fe/Mn oxides) and organic colloids/particles. Removal of uranium may also be closely coupled to exchange and resuspension processes at the sediment/water interface. An inner-shelf pore water profile indicated the following diagenetic processes: extensive (???1 m) zones of Fe(III) - and, to a lesser degree, Mn(IV) - reduction in the absence of significant S(II) concentrations appeared to facilitate the formation of various authigenic minerals (e.g., siderite, rhodocrosite and uraninite). The pore water dissolved 238U profile co-varied closely with Mn(II). Isotopic variations as evidenced in ??234U pore waters values from this site revealed information on the origin and history of particulate uranium. Only after a depth of about 1 m did the ??234U value approach unity (secular equilibrium), denoting a residual lattice bound uranium complex that is likely an upper-drainage basin weathering product. This suggests that the enriched ??234U values represent a riverine surface complexation product that is actively involved in Mn-Fe diagenetic cycles and surface
The estuarine chemistry and isotope systematics of 234,238U in the Amazon and Fly Rivers
Swarzenski, Peter; Campbell, Pamela; Porcelli, Don; McKee, Brent
2004-12-01
Natural concentrations of 238U and δ234U values were determined in estuarine surface waters and pore waters of the Amazon and Fly (Papua New Guinea) Rivers to investigate U transport phenomena across river-dominated land-sea margins. Discharge from large, tropical rivers is a major source of dissolved and solid materials transported to the oceans, and are important in defining not only oceanic mass budgets, but also terrestrial weathering rates. On the Amazon shelf, salinity-property plots of dissolved organic carbon, pH and total suspended matter revealed two vastly contrasting water masses that were energetically mixed. In this mixing zone, the distribution of uranium was highly non-conservative and exhibited extensive removal from the water column. Uranium removal was most pronounced within a salinity range of 0-16.6, and likely the result of scavenging and flocculation reactions with inorganic (i.e., Fe/Mn oxides) and organic colloids/particles. Removal of uranium may also be closely coupled to exchange and resuspension processes at the sediment/water interface. An inner-shelf pore water profile indicated the following diagenetic processes: extensive (˜1 m) zones of Fe(III)—and, to a lesser degree, Mn(IV)—reduction in the absence of significant S(II) concentrations appeared to facilitate the formation of various authigenic minerals (e.g., siderite, rhodocrosite and uraninite). The pore water dissolved 238U profile co-varied closely with Mn(II). Isotopic variations as evidenced in δ234U pore waters values from this site revealed information on the origin and history of particulate uranium. Only after a depth of about 1 m did the δ234U value approach unity (secular equilibrium), denoting a residual lattice bound uranium complex that is likely an upper-drainage basin weathering product. This suggests that the enriched δ234U values represent a riverine surface complexation product that is actively involved in Mn-Fe diagenetic cycles and surface
Biological effect on removal of Th-234, Po-210 and Pb-210 from surface water in Funka Bay, Japan
Energy Technology Data Exchange (ETDEWEB)
Tanaka, N; Takeda, Y; Tsunogai, S [Hokkaido Univ., Hakodate (Japan). Dept. of Chemistry
1983-10-01
Vertical and temporal variations in the radioactivities of Th-234, Pb-210 and Po-210 were measured at a station in Funka Bay from April 1979 to February 1980. The inventory of Th-234 showed a minimum in early spring, when a spring bloom of phytoplankton was observed, then a steady increase to a maximum value in late summer, just before open sea water invaded the bay and a secondary phytoplankton bloom started. The inventories of Pb-210 and Po-210 also showed minima in early spring. These results suggest that the removal of these nuclides from sea water is accelerated by biological activity. The concentration of Th-234 decreased with depth, but those of Po-210 and Pb-210 were higher in the bottom water in August 1979 when the bay water was strongly stratified. This may be due to the supply of Pb-210 and Po-210 from the bottom. However, if the supply of these nuclides is expected in sediment particles, the concentrations of these nuclides in suspended matter were not sufficient to explain their increments in the bottom water. Residence times of Th, Pb and Po were estimated.
Energy Technology Data Exchange (ETDEWEB)
Lapa, Flavia V.; Oliveira, Joselene de; Costa, Alice M.R., E-mail: fvlapa@ipen.br, E-mail: jolivei@ipen.br, E-mail: lice_mrc@hotmail.com [Instituto de Pesquisas Energeticas e Nucleares (IPEN-CNEN/SP), Sao Paulo, SP (Brazil). Laboratorio de Radiometria Ambiental; Braga, Elisabete S., E-mail: edsbraga@usp.br [Universidade de Sao Paulo (USP), Sao Paulo, SP (Brazil). Inst. Oceanografico. Lab. de Nutrientes, Micronutrientes e Tracos nos Oceanos
2013-07-01
In this study the naturally occurring radionuclides {sup 234}Th and {sup 238}U were used to investigate the magnitude of upper ocean particulate organic carbon export in Bransfield Strait, Southern Ocean. This region is the largest oceanic high-nitrate low-chlorophyll (HNLC) area in the world and is known to contribute to regulate of the atmospheric CO{sub 2} via the biological pump. Due to its different geochemical behavior in seawater, the resulting U/Th disequilibria can be easily used to constrain the transport rates of particles and reaction processes between solution and particulate phases. Sampling occurred during the summer (March and November) 2011. Total {sup 234}Th activities in surface seawater samples ranged from 1.3 to 3.7 dpm L{sup -1} (station EB 011) during March/11 campaign, while in October/11 total {sup 234}Th activity concentrations varied from 1.4 to 2.9 dpm L{sup -1}. Highest total {sup 234}Th activities were found late in the austral summer season. Activity concentrations of dissolved {sup 238}U in surface seawater varied from 2.1 to 2.4 dpm L{sup -1}. Taking into account all sampling stations established in March and October/11 the relative variability of total {sup 234}Th distribution was 22%. (author)
230Th-234U Model-Ages of Some Uranium Standard Reference Materials
International Nuclear Information System (INIS)
Williams, R.W.; Gaffney, A.M.; Kristo, M.J.; Hutcheon, I.D.
2009-01-01
The 'age' of a sample of uranium is an important aspect of a nuclear forensic investigation and of the attribution of the material to its source. To the extent that the sample obeys the standard rules of radiochronometry, then the production ages of even very recent material can be determined using the 230 Th- 234 U chronometer. These standard rules may be summarized as (a) the daughter/parent ratio at time=zero must be known, and (b) there has been no daughter/parent fractionation since production. For most samples of uranium, the 'ages' determined using this chronometer are semantically 'model-ages' because (a) some assumption of the initial 230 Th content in the sample is required and (b) closed-system behavior is assumed. The uranium standard reference materials originally prepared and distributed by the former US National Bureau of Standards and now distributed by New Brunswick Laboratory as certified reference materials (NBS SRM = NBL CRM) are good candidates for samples where both rules are met. The U isotopic standards have known purification and production dates, and closed-system behavior in the solid form (U 3 O 8 ) may be assumed with confidence. We present here 230 Th- 234 U model-ages for several of these standards, determined by isotope dilution mass spectrometry using a multicollector ICP-MS, and compare these ages with their known production history
Activity disequilibrium between 234U and 238U isotopes in natural environment
Bory?o, Alicja; Skwarzec, Bogdan
2014-01-01
The aim of this work was to calculate the values of the 234U/238U activity ratio in natural environment (water, sediments, Baltic organisms and marine birds from various regions of the southern Baltic Sea; river waters (the Vistula and the Oder River); plants and soils collected near phosphogypsum waste heap in Wi?linka (Northern Poland) and deer-like animals from Northern Poland. On the basis of the studies it was found that the most important processes of uranium geochemical migration in th...
International Nuclear Information System (INIS)
Pregnolatto, Y.
1975-01-01
Several types of alive carbonated organisms of marine fluvial or mixed environment origin were analized in its concentrations of Uranium and about its activity ratio U 234 /U 238 . In the same way measurements were made from the water of these three types of environments. The results indicate that the mollusks shells show a very low concentration compared with corals. Its concentration varies from 0.04 to 0.33 ppm. Inside the limit of errors we can say that the several types of carbonated organisms show the same disequilibrium U 234 /U 238 which was found in associated waters. An analysis of a piece of wood from long time immersed in the sea water was made. The result indicates that there was a marked high in concentration of Uranium due to chelatation with organic matter. (C.D.G.) [pt
Maiti, Kanchan; Benitez-Nelson, Claudia R.; Lomas, Michael W.; Krause, Jeffrey W.
2009-06-01
Direct measurements of new production and carbon export in the subtropical North Atlantic Ocean appear to be too low when compared to geochemical-based estimates. It has been hypothesized that episodic inputs of new nutrients into surface water via the passage of mesoscale eddies or winter storms may resolve at least some of this discrepancy. Here, we investigated particulate organic carbon (POC), particulate organic nitrogen (PON), and biogenic silica (BSiO 2) export using a combination of water column 234Th: 238U disequilibria and free-floating sediment traps during and immediately following two weather systems encountered in February and March 2004. While these storms resulted in a 2-4-fold increase in mixed layer NO 3 inventories, total chlorophyll a and an increase in diatom biomass, the systems were dominated by generally low 234Th: 238U disequilibria, suggesting limited particle export. Several 234Th models were tested, with only those including non-steady state and vertical upwelling processes able to describe the observed 234Th activities. Although upwelling velocities were not measured directly in this study, the 234Th model suggests reasonable rates of 2.2-3.7 m d -1. Given the uncertainties associated with 234Th derived particle export rates and sediment traps, both were used to provide a range in sinking particle fluxes from the upper ocean during the study. 234Th particle fluxes were determined applying the more commonly used steady state, one-dimensional model with element/ 234Th ratios measured in sediment traps. Export fluxes at 200 m ranged from 1.91±0.20 to 4.92±1.22 mmol C m -2 d -1, 0.25±0.08 to 0.54±0.09 mmol N m -2 d -1, and 0.22±0.04 to 0.50±0.06 mmol Si m -2 d -1. POC export efficiencies (Primary Production/Export) were not significantly different from the annual average or from time periods without storms, although absolute POC fluxes were elevated by 1-11%. This increase was not sufficient, however, to resolve the discrepancy
230Th-234U Model-Ages of Some Uranium Standard Reference Materials
Energy Technology Data Exchange (ETDEWEB)
Williams, R W; Gaffney, A M; Kristo, M J; Hutcheon, I D
2009-05-28
The 'age' of a sample of uranium is an important aspect of a nuclear forensic investigation and of the attribution of the material to its source. To the extent that the sample obeys the standard rules of radiochronometry, then the production ages of even very recent material can be determined using the {sup 230}Th-{sup 234}U chronometer. These standard rules may be summarized as (a) the daughter/parent ratio at time=zero must be known, and (b) there has been no daughter/parent fractionation since production. For most samples of uranium, the 'ages' determined using this chronometer are semantically 'model-ages' because (a) some assumption of the initial {sup 230}Th content in the sample is required and (b) closed-system behavior is assumed. The uranium standard reference materials originally prepared and distributed by the former US National Bureau of Standards and now distributed by New Brunswick Laboratory as certified reference materials (NBS SRM = NBL CRM) are good candidates for samples where both rules are met. The U isotopic standards have known purification and production dates, and closed-system behavior in the solid form (U{sub 3}O{sub 8}) may be assumed with confidence. We present here {sup 230}Th-{sup 234}U model-ages for several of these standards, determined by isotope dilution mass spectrometry using a multicollector ICP-MS, and compare these ages with their known production history.
International Nuclear Information System (INIS)
Rodriguez-Alvarez, M.J.; Sanchez, F.
1995-01-01
The uranium concentration and the 234 U/ 238 U, 235 U/ 238 U activity ratios were studied in water samples from Jucar River, using low-level α-spectrometry. The effects of pH, temperature and salinity were considered and more detailed sampling was done in the neighbourhood of Cofrentes Nuclear Plant (Valencia, Spain). Changes were observed in the uranium concentration with the salinity and the 234 U/ 238 U activity ratio was found to vary with pH. Leaching and dilution, which depend on pH and salinity, are the probable mechanisms for these changes in the concentration of uranium and the activity ratios. (author) 25 refs.; 4 figs.; 1 tab
2010-04-01
... 25 Indians 2 2010-04-01 2010-04-01 false What types of personal conflicts of interest involving... ASSISTANCE ACT Conflicts of Interest § 900.234 What types of personal conflicts of interest involving tribal... in which that person has a financial or employment interest that conflicts with that of the trust...
Energy Technology Data Exchange (ETDEWEB)
Bocian, W.; Stefaniak, L. [Inst. Chemii Organicznej, Polska Akademia Nauk, Warsaw (Poland)
1994-12-31
The chemical shifts and coupling constants have been measured in series of mesoionic triazoles by means of inadequate atoms and dynamic NMR techniques. The electronic structure and other parameters of C5-C6 chemical bond in different derivatives of mesoionic 3-phenyl-1-thio-2,3,4-triazole-5 methyls have been determined. 14 refs, 3 figs, 2 tabs.
2012-06-01
..., Refugees, and Migration, Office of Admissions (PRM/A). Form Number: DS-234. Respondents: Iraqi and Afghan... Population, Refugees and Migration. Dated: May 14, 2012. Kelly A. Gauger, Deputy Director, Office of Admissions, Bureau of Population, Refugees, and Migration, Department of State. [FR Doc. 2012-13343 Filed 5...
Measurements of 234U, 238U and 230Th in excreta of uranium-mill crushermen
International Nuclear Information System (INIS)
Fisher, D.R.; Jackson, P.O.; Brodacynski, G.G.; Scherpelz, R.I.
1982-07-01
Uranium and thorium levels in excreta of uranium mill crushermen who are routinely exposed to airborne uranium ore dust were measured. The purpose was to determine whether 230 Th was preferentially retained over either 234 U or 238 U in the body. Urine and fecal samples were obtained from fourteen active crushermen with long histories of exposure to uranium ore dust, plus four retired crushermen and three control individuals for comparison. Radiochemical procedures were used to separate out the uranium and thorium fractions, which were then electroplated on stainless steel discs and assayed by alpha spectrometry. Significantly greater activity levels of 234 U and 238 U were measured in both urine and fecal samples obtained from uranium mill crushermen, indicating that uranium in the inhaled ore dust was cleared from the body with a shorter biological half-time than the daughter product 230 Th. The measurements also indicated that uranium and thorium separate in vivo and have distinctly different metabolic pathways and transfer rates in the body. The appropriateness of current ICRP retention and clearance parameters for 230 Th in ore dust is questioned
International Nuclear Information System (INIS)
Turnewitsch, R.; Turnewitsch, R.; Waniek, J.J.; Reyss, J.L.; Nycander, J.; Lampitt, R.S.
2008-01-01
Residual flow, baro-tropic tides and internal (baro-clinic) tides interact in a number of ways with kilometer-scale sea floor topography such as abyssal hills and sea mounts. Because of their likely impact on vertical mixing such interactions are potentially important for ocean circulation and the mechanisms and the geometry of these interactions are a matter of ongoing studies. In addition, very little is known about how these interactions are reflected in the sedimentary record. This multi-year study investigates if flow/topography interactions are reflected in distributional patterns of the natural short-lived (half-life: 24.1 d) particulate-matter tracer 234 Th relative to its conservative (non-particle-reactive) and very long-lived parent nuclide 238 U. The sampling sites were downstream of, or surrounded by, fields of short sea mounts and, therefore, very likely to be influenced by nearby flow/topography interactions. At the sampling sites between about 200 and 1000 m above the sea floor recurrent 'fossil' disequilibria were detected. 'Fossil' disequilibria are defined by clearly detectable 234 Th/ 238 U disequilibria (total 234 Th radioactivity ≤ 238 U radioactivity, indicating a history of intense particulate 234 Th scavenging and particulate-matter settling from the sampled parcel of water) and conspicuously low particle-associated 234 Th activities. 'Fossil' disequilibria were centered at levels in the water column that correspond to the average height of the short sea mounts near the sampling sites. This suggests the 'fossil' disequilibria are formed on the sea mount slopes. Moreover, the magnitude of the 'fossil' disequilibria suggests that the slopes of the short sea mounts in the study region are characterized by particularly vigorous fluid dynamics. Since 'fossil' disequilibria already occurred at ∼ O (1-10 km) away from the sea mount slopes it is likely that these vigorous fluid dynamics rapidly decay away from the slopes on scales of O (1-10 km
Exo-oligosaccharides of Rhizobium sp. strain NGR234 are required for symbiosis with various legumes.
Staehelin, Christian; Forsberg, Lennart S; D'Haeze, Wim; Gao, Mu-Yun; Carlson, Russell W; Xie, Zhi-Ping; Pellock, Brett J; Jones, Kathryn M; Walker, Graham C; Streit, Wolfgang R; Broughton, William J
2006-09-01
Rhizobia are nitrogen-fixing bacteria that establish endosymbiotic associations with legumes. Nodule formation depends on various bacterial carbohydrates, including lipopolysaccharides, K-antigens, and exopolysaccharides (EPS). An acidic EPS from Rhizobium sp. strain NGR234 consists of glucosyl (Glc), galactosyl (Gal), glucuronosyl (GlcA), and 4,6-pyruvylated galactosyl (PvGal) residues with beta-1,3, beta-1,4, beta-1,6, alpha-1,3, and alpha-1,4 glycoside linkages. Here we examined the role of NGR234 genes in the synthesis of EPS. Deletions within the exoF, exoL, exoP, exoQ, and exoY genes suppressed accumulation of EPS in bacterial supernatants, a finding that was confirmed by chemical analyses. The data suggest that the repeating subunits of EPS are assembled by an ExoQ/ExoP/ExoF-dependent mechanism, which is related to the Wzy polymerization system of group 1 capsular polysaccharides in Escherichia coli. Mutation of exoK (NGROmegaexoK), which encodes a putative glycanase, resulted in the absence of low-molecular-weight forms of EPS. Analysis of the extracellular carbohydrates revealed that NGROmegaexoK is unable to accumulate exo-oligosaccharides (EOSs), which are O-acetylated nonasaccharide subunits of EPS having the formula Gal(Glc)5(GlcA)2PvGal. When used as inoculants, both the exo-deficient mutants and NGROmegaexoK were unable to form nitrogen-fixing nodules on some hosts (e.g., Albizia lebbeck and Leucaena leucocephala), but they were able to form nitrogen-fixing nodules on other hosts (e.g., Vigna unguiculata). EOSs of the parent strain were biologically active at very low levels (yield in culture supernatants, approximately 50 microg per liter). Thus, NGR234 produces symbiotically active EOSs by enzymatic degradation of EPS, using the extracellular endo-beta-1,4-glycanase encoded by exoK (glycoside hydrolase family 16). We propose that the derived EOSs (and not EPS) are bacterial components that play a crucial role in nodule formation in various legumes.
Environmental control of U concentration and 234U/238U in speleothems at subannual resolution
Hu, C.; Henderson, G. M.
2003-12-01
Trace element and isotope variability in speleothems encodes a range of information about the past environment, although its interpretation is often problematic. U concentration and isotopes have frequently been analysed in speleothems in order to provide chronology, but their use as environmental proxies in their own right has not been comprehensively investigated. In this study, we have investigated the environmental controls of U in a stalagmite from the Central Yangtze Valley in China. This stalagmite grew rapidly throughout the Holocone and contains visible annual layers about 300microns thick. Analysis of a portion of the stalagmite corresponding to the 1970s by electron probe, LA-ICP-MS, and by physical subsampling indicate clear annual cycles in Sr/Ca, Mg/Ca, and Ba/Ca. The reasonably open cave structure and the correlation of Sr/Ca with Mg/Ca suggest that temperature exerts considerable control over these trace element variations. U/Ca also varies seasonally by up to 42 % and shows a clear anti-correlation with Mg/Ca (correlation coefficient -0.64). Based on the inverse relationship between U/Ca and temperature exhibited in other carbonates (e.g. corals) the speleothem U/Ca is suggested to be controlled primarily by temperature and may provide a paleo cave thermometer with less rainfall influence than Mg/Ca. Ongoing monitoring of the cave temperature and humidity will assess the robustness of this conclusion and the sensitivity of speleothem U/Ca to temperature. (234U/238U) in this stalagmite range from 1.733 to 1.872 during the Holocene. The U concentration is high enough (typically 0.48 ppm) and growth rate fast enough, that (234U/238U) can also be measured at a subannual resolution. The expected alpha-recoil control of excess 234U supply suggests that these measurements may provide a measure of the transit time of recharge waters to the stalagmite during the seasonal cycle. Such a proxy would enable deconvolution of temperature and recharge-rate control
Energy Technology Data Exchange (ETDEWEB)
Santos, Rosana N. dos [Pontificia Univ. Catolica de Sao Paulo, SP (Brazil). Dept. de Fisica]. E-mail: rosana@pucsp.br; Marques, Leila S. [Sao Paulo Univ., SP (Brazil). Inst. de Astronomia, Geofisica e Ciencias Atmosfericas. Dept. de Geofisica]. E-mail: leila@iag.usp.br
2005-07-01
This work presents the first results obtained on the investigation of the behavior of uranium and radium radioisotopes in the processes of weathering and rock-water interaction of Morungaba granitoids belonging to Meridional Pluton (Valinhos Town-SP-Brazil). Specific activities of {sup 238}U, {sup 234}U, {sup 228}Ra and {sup 226}Ra were determined in non altered granitoids (Group A), as well as in those affected by different degrees of weathering (Groups B, C and D). The uranium specific activities were determined by alpha spectrometry method, whereas for the determination of radium isotopes high resolution gamma-ray spectrometry technique was employed. The data indicate that {sup 238}U and {sup 234}U are in radioactive equilibrium in the fresh analyzed granitoids, but show a slight depletion of {sup 234}U in relation to {sup 238}U in the weathered rocks. The ({sup 226}Ra/{sup 238}U) and ({sup 226}Ra/{sup 234}U) activity ratios of all investigated rocks are similar, showing a significant {sup 226}Ra depletion, which is probably caused by its preferential leaching. These results indicate that even samples macroscopically classified as fresh rocks, their systems have been opened for some geochemical changes. The high ({sup 234}U/{sup 238}U) activity ratios of groundwaters which are found in the fractures of these granitoids suggest their prolonged residence times in the aquifer and/or their percolation by other rocks presenting different geochemical properties. (author)
International Nuclear Information System (INIS)
Sokolik, G.A.; Ovsiannikova, S.V.; Voinikava, K.V.; Ivanova, T.G.; Papenia, M.V.
2014-01-01
This work is devoted to investigation of behavior of 234 U, 238 U and 226 Ra by determining the soil to plant transfer under different natural conditions such as forest or swamped areas and meadow lands with different soil types. The paper summarizes the data on investigation of uranium and radium uptake by wild berries and natural meadow grasses in the typical conditions of Belarus. Parameters characterizing the biological availability of 234 U, 238 U and 226 Ra for bilberry (Vaccinium myrtillus), lingonberry (Vaccinium viti-idaea), blueberry (Vaccinium iliginosum) and cranberry (Vaccinium oxycoccus palustris) as well as for widely occurring mixed meadow vegetation, which belongs to the sedge-grass or grass-sedge associations and forbs, have been established. In the sites under investigation, the deposition levels of 238+239+240 Pu were less than 0.37 kBq m −2 and 137 Cs deposition ranged between less than 0.37 and 37 kBq m −2 . It was found that activity concentrations of radionuclides in berries varied in the ranges of 0.037–0.11 for 234 U, 0.036–0.10 for 238 U and 0.11–0.43 Bq kg −1 for 226 Ra, but in the mixed meadow grasses they were 0.32–4.4, 0.24–3.9 and 0.14–6.9 Bq kg −1 accordingly. The 234 U/ 238 U activity ratios were 1.02 ± 0.01 for wild berries, 1.20 ± 0.09 for underground meadow grasses and 1.02 ± 0.02 for proper soils. The concentration ratios (CRs, dry weight basis) of 234 U and 238 U for mixed meadow grasses were 0.036–0.42 and 0.041–0.46 respectively. The correspondent geometric means (GM) were 0.13 and 0.15 with geometric standard deviations (GSD) of 2.4. The CRs of 226 Ra for meadow grasses were 0.031–1.0 with GM 0.20 and GSD 2.6. The CRs of 234 U, 238 U and 226 Ra for wild berries ranged within 0.0018–0.008 (GM is 0.0034, GSD is 1.8), 0.0018–0.008 (GM is 0.0035, GSD is 1.8) and 0.005–0.033 (GM is 0.016, GSD is 2.1) accordingly. The highest CR values of uranium for mixed meadow grasses were found in the sites
Measurement of the U-234(n,f) cross section with PPAC detectors at the nTOF facility
International Nuclear Information System (INIS)
Dobarro, C.P.
2005-06-01
The aim of this work was twofold: to measure the 234 U neutron-induced fission cross section in an extended energy range with an unprecedented resolution, and, in the process, to validate the experimental method we used at the new n-TOF-CERN facility. The experiment was designed in order to take advantage of the unique characteristics of the n-TOF facility: the long flight path offers a high energy resolution and the high-intensity, instantaneous neutron flux greatly reduces the background from the sample activities, making it possible to measure highly radioactive samples. The fission detection setup is based on an innovative technique that benefits from the use of very thin targets and detectors. Up to nine targets of high purity fission samples are sandwiched by Parallel Plate Avalanche Counters (PPAC). When a fission event happens, the two complementary fission fragments are detected by the PPACs adjacent to the fissioning target in a narrow time coincidence. Because several targets are simultaneously placed in-beam, relative measurements with respect to reference nuclei can be obtained. In this work, an original data-reduction method has been developed to deal with the particular characteristics of both the n-TOF data acquisition system, which is based on very accurate Flash-ADC digitizers, and the fission detection setup. The data reduction includes the coincidence windows and the signal amplitude requirements that we obtained from preliminary data analysis. The applied coincidence method is very powerful for dealing with the background rejection such as contamination by α activity, which is quite high for 234 U, and the signals produced by highly energetic reactions in the detectors. The data-reduction method also implements the fission event reconstruction using the position information obtained from the stripped cathodes and the delay line readout, which makes it possible to determine the fission fragment angular distributions, and the time-of-flight to
Giraudo, Maeva; Cottin, Guillaume; Esperanza, Marta; Gagnon, Pierre; Silva, Amila O De; Houde, Magali
2017-12-01
Benzotriazole ultra violet stabilizers (BZT-UVs) are compounds used in many applications and products to prevent photochemical degradation. Despite their widespread presence in aquatic ecosystems and persistence in the environment, there are very limited data on their effects and toxicity, and their modes of action remain largely unknown. The objectives of the present study were to evaluate the chronic effects of 2 BZT-UVs, 2-(2H-benzotriazol-2-yl)-4,6-bis(1-methyl-1-phenylethyl)phenol (UV-234) and 2-(2H-benzotriazol-2-yl)-4,6-di-tert-pentylphenol (UV-328), on the freshwater green algae Chlamydomonas reinhardtii and the freshwater crustacean Daphnia magna. Organisms were exposed to 0.01 and 10 μg/L of UV-234, UV-328, as well as a mixture of the 2 compounds. Life-history endpoints (viability, reproduction, and growth) and oxidative stress-related biomarkers (gene transcription, reactive oxygen species [ROS] production, and lipid peroxidation) were measured. Daphnia magna growth, reproduction, and gene transcription were not impacted by 21-d individual or mixed exposure. After 96-h of exposure, no differences were observed on the cellular viability of C. reinhardtii for either of the 2 BZT-UVs. In the algae, results showed increased ROS production in response to UV-328 and lipid peroxidation following exposure to UV-234. Synergistic effects of the 2 BZT-UVs were evident at the transcriptional level with 2 to 6 times up-regulation of glutathione peroxidase (gp x ) in response to the mixture for all treatment conditions. The transcription of superoxide dismutase (sod), catalase (cat), and ascorbic peroxidase (apx) was also regulated by UV-234 and UV-328 in the green algae, most likely as a result of ROS production and lipid peroxidation. Results from the present study suggest potential impacts of UV-234 and UV-328 exposure on the antioxidant defense system in C. reinhardtii. Environ Toxicol Chem 2017;36:3333-3342. © 2017 Crown in the Right of Canada. Published by
Olszewski, Grzegorz; Boryło, Alicja; Skwarzec, Bogdan
2015-08-01
The aim of this work was to determine the uranium concentration ((234)U, (235)U and (238)U) and values of the activity ratio (234)U/(238)U in soil samples collected near phosphogypsum waste heap in Wiślinka (northern Poland). On the basis of the studies it was found that the values of the (234)U/(238)U activity ratio in the analyzed soils collected in the vicinity of phosphogypsum dump in Wiślinka are in most cases close to one and indicate the phosphogypsum origin of the analyzed nuclides. The obtained results of uranium concentrations are however much lower than in previous years before closing of the phosphogypsum stockpile. After this process and covering the phosphogypsum stockpile in Wiślinka with sewage sludge, phosphogypsum particles are successfully immobilized. In the light of the results the use of phosphate fertilizers seems to be a major problem. Prolonged and heavy rains can cause leaching accumulated uranium isotopes in the phosphogypsum stockpile, which will be washed into the Martwa Wisła and on the fields in the immediate vicinity of this storage. Copyright © 2015 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
2009-02-01
The presence of actinium-227 has been noticed in the Mont d'Arree region (Finistere district) and such a presence in the environment had never been reported before. Thus, a study has been performed to investigate the origin of this element: about 300 samples have been analysed. After an indication of the investigation chronology, the report outlines that there is no relationship between the excess of actinium-227 and land amendment or embankments, that there is no obvious relationship between this presence and radioactive liquid effluents or atmospheric effluents from the Brennilis nuclear site. It shows that there is an obvious relationship with the radiological quality. It states that this excess of actinium 227 is related to the management of rain waters about the Brennilis site. An appendix specifies the location, nature and agenda of samplings (bio-indicators, samplings in sludge, soils, food and tap water, aquatic foams and sediments, ponds, wet lands, and at the vicinity of the power plant channel), presents detailed results obtained by gamma spectrometry, and measurement equipment and methods
Early hominid stone tool production and technical skill 2.34 Myr ago in West Turkana, Kenya.
Roche, H; Delagnes, A; Brugal, J P; Feibel, C; Kibunjia, M; Mourre, V; Texier, P J
1999-05-06
Well-documented Pliocene archaeological sites are exceptional. At present they are known only in East Africa, in the Hadar and Shungura formations of Ethiopia and in the Nachukui formation of Kenya. Intensive archeological survey and a series of test excavations conducted in the Nachukui formation since 1987 have led to the discovery of more than 25 archaeological sites whose ages range from 2.34 to 0.7 million years before present (Myr), and to the extensive excavation of two 2.34-Myr sites, Lokalalei 1 in 1991 and Lokalalei 2C in 1997. Lokalalei 2C yielded nearly 3,000 archaeological finds from a context of such good preservation that it was possible to reconstitute more than 60 sets of complementary matching stone artefacts. These refits, predating the Koobi Fora refits by 500 Kyr, are the oldest ever studied. Here we describe a technological analysis of the core reduction sequences, based on these refits, which allows unprecedented accuracy in the understanding of flake production processes. We can thus demonstrate greater cognitive capacity and motor skill than previously assumed for early hominids, and highlight the diversity of Pliocene technical behaviour.
IGRINS NEAR-IR HIGH-RESOLUTION SPECTROSCOPY OF MULTIPLE JETS AROUND LkHα 234
Energy Technology Data Exchange (ETDEWEB)
Oh, Heeyoung; Yuk, In-Soo; Park, Byeong-Gon; Park, Chan; Chun, Moo-Young; Kim, Kang-Min; Oh, Jae Sok; Jeong, Ueejeong; Yu, Young Sam; Lee, Jae-Joon; Kim, Hwihyun; Hwang, Narae; Lee, Sungho [Korea Astronomy and Space Science Institute, 776 Daedeok-daero, Yuseong-gu, Daejeon 305-348 (Korea, Republic of); Pyo, Tae-Soo [Subaru Telescope, National Astronomical Observatory of Japan, 650 North A’ohoku Place, Hilo, HI 96720 (United States); Pak, Soojong; Lee, Hye-In; Le, Huynh Anh Nguyen [School of Space Research and Institute of Natural Sciences, Kyung Hee University, 1732 Deogyeong-daero, Giheung-gu, Yongin-si, Gyeonggi-do 17104 (Korea, Republic of); Kaplan, Kyle; Pavel, Michael; Mace, Gregory, E-mail: hyoh@kasi.re.kr [Department of Astronomy, University of Texas at Austin, Austin, TX (United States); and others
2016-02-01
We present the results of high-resolution near-IR spectroscopy toward the multiple outflows around the Herbig Be star LkHα 234 using the Immersion Grating Infrared Spectrograph. Previous studies indicate that the region around LkHα 234 is complex, with several embedded young stellar objects and the outflows associated with them. In simultaneous H- and K-band spectra from HH 167, we detected 5 [Fe ii] and 14 H{sub 2} emission lines. We revealed a new [Fe ii] jet driven by radio continuum source VLA 3B. Position–velocity diagrams of the H{sub 2} 1−0 S(1) λ2.122 μm line show multiple velocity peaks. The kinematics may be explained by a geometrical bow shock model. We detected a component of H{sub 2} emission at the systemic velocity (V{sub LSR} = −10.2 km s{sup −1}) along the whole slit in all slit positions, which may arise from the ambient photodissociation region. Low-velocity gas dominates the molecular hydrogen emission from knots A and B in HH 167, which is close to the systemic velocity; [Fe ii] emission lines are detected farther from the systemic velocity, at V{sub LSR} = −100–−130 km s{sup −1}. We infer that the H{sub 2} emission arises from shocked gas entrained by a high-velocity outflow. Population diagrams of H{sub 2} lines imply that the gas is thermalized at a temperature of 2500–3000 K and the emission results from shock excitation.
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Establishments whose only regular employees are the owner... Employment to Which the Act May Apply; Enterprise Coverage Leased Departments, Franchise and Other Business Arrangements § 779.234 Establishments whose only regular employees are the owner or members of his immediate...
Study of 234U(n,f) Resonances Measured at the CERN n_TOF Facility
Leal-Cidoncha, E; Paradela, C; Tarrío, D; Leong, L S; Audouin, L; Tassan-Got, L; Praena, J; Berthier, B; Ferrant, L; Isaev, S; Le Naour, C; Stephan, C; Trubert, D; Abbondanno, U; Aerts, G; Álvarez, H; Álvarez-Velarde, F; Andriamonje, S; Andrzejewski, J; Badurek, G; Baumann, P; Bečvář, F; Berthoumieux, E; Calviño, F; Calviani, M; Cano-Ott, D; Capote, R; Carrapiço, C; Cennini, P.; Chepel, V; Chiaveri, E.; Colonna, N; Cortes, G; Couture, A; Cox, J; Dahlfors, M; David, S.; Dillmann, I; Domingo-Pardo, C; Dridi, W; Eleftheriadis, C; Embid-Segura, M; Ferrari, A.; Ferreira-Marques, R; Fujii, K; Furman, W; Gonçalves, I; González-Romero, E; Gramegna, F; Guerrero, C; Gunsing, F; Haas, B; Haight, R; Heil, M; Herrera-Martinez, A.; Igashira, M; Jericha, E; Kadi, Y.; Käppeler, F; Karadimos, D; Kerveno, M; Koehler, P; Kossionides, E; Krtička, M; Lampoudis, C; Leeb, H; Lindote, A; Lopes, I; Lozano, M; Lukic, S; Marganiec, J; Marrone, S; Martínez, T; Massimi, C; Mastinu, P; Mengoni, A; Milazzo, P M; Moreau, C; Mosconi, M; Neves, F; Oberhummer, H; O'Brien, S; Oshima, M; Pancin, J; Papadopoulos, C; Pavlik, A; Pavlopoulos, P.; Perrot, L; Pigni, M T; Plag, R; Plompen, A; Plukis, A; Poch, A; Pretel, C; Quesada, J; Rauscher, T.; Reifarth, R; Rubbia, C.; Rudolf, G; Rullhusen, P; Salgado, J; Santos, C; Sarchiapone, L.; Savvidis, I; Tagliente, G; Tain, J L; Tavora, L; Terlizzi, R; Vannini, G; Vaz, P; Ventura, A.; Villamarin, D; Vincente, M C; Vlachoudis, V.; Vlastou, R; Voss, F; Walter, S; Wiescher, M; Wisshak, K
2014-01-01
We present the analysis of the resolved resonance region for the U-234(n,f) cross section data measured at the CERN n\\_TOF facility. The resonance parameters in the energy range from 1 eV to 1500 eV have been obtained with the SAMMY code by using as initial parameters for the fit the resonance parameters of the JENDL-3.3 evaluation. In addition, the statistical analysis has been accomplished, partly with the SAMDIST code, in order to study the level spacing and the Mehta-Dyson correlation.
The β+ decay of 234Np and other isospin-forbidden 0+ -> 0+ Fermi transitions
International Nuclear Information System (INIS)
Yap, C.T.; Saw, E.L.
1984-01-01
Although experimental values of the Fermi nuclear matrix elements vary widely from about 1x10 -3 to 40x10 -3 for isospin-forbidden 0 + ->0 + β transitions, theoretical calculations using the Coulomb potential and Nilsson wave functions yielded values of Msub(F) in reasonably good agreement, except that of 234 Np. However, our calculation of Msub(F) for this decay as a function of the deformation parameter β yielded a value of Msub(F) in good agreement with experiment for values of β between 0.1 and 0.2. (orig.)
International Nuclear Information System (INIS)
Finkel, R.C.
1981-01-01
In order to assess the utility of uranium isotopes as fluid phase earthquake precursors, uranium concentrations and 234 U/ 238 U activity ratios have been monitored on a monthly or bimonthly basis in water from 24 wells and springs associated with Southern California fault zones. Uranium concentrations vary from 0.002 ppb at Indian Canyon Springs on the San Jacinto fault to 8.3 ppb at Lake Hughes well on the San Andreas fault in the Palmdale area. 234 U/ 238 U activity ratios vary from 0.88 at Agua Caliente Springs on the Elsinore fault to 5.4 at Niland Slab well on the San Andreas fault in the Imperial Valley. There was one large earthquake in the study area during 1979, the 15 October 1979 M = 6.6 Imperial Valley earthquake. Correlated with this event, uranium concentrations varied by a factor of more than 60 and activity ratios by a factor of 3 at the Niland Slab site, about 70 km from the epicenter. At the other sites monitored, uranium concentrations varied in time, but with no apparent pattern, while uranium activity ratios remained essentially constant throughout the monitoring period
Energy Technology Data Exchange (ETDEWEB)
Stewart, Gillian, E-mail: gstewart@qc.cuny.ed [Queens College, CUNY Flushing, NY 11367 (United States); Moran, S. Bradley, E-mail: moran@gso.uri.ed [Graduate School of Oceanography, URI Narragansett, RI 02882 (United States); Lomas, Michael W., E-mail: Michael.Lomas@bios.ed [Bermuda Institute for Ocean Sciences, St. George' s, GE01 (Bermuda); Kelly, Roger P., E-mail: rokelly@gso.uri.ed [Graduate School of Oceanography, URI Narragansett, RI 02882 (United States)
2011-05-15
Particle-reactive, naturally occurring radionuclides are useful tracers of the sinking flux of organic matter from the surface to the deep ocean. Since the Joint Global Ocean Flux Study (JGOFS) began in 1987, the disequilibrium between {sup 234}Th and its parent {sup 238}U has become widely used as a technique to measure particle export fluxes from surface ocean waters. Another radionuclide pair, {sup 210}Po and {sup 210}Pb, can be used for the same purpose but has not been as widely adopted due to difficulty with accurately constraining the {sup 210}Po/{sup 210}Pb radiochemical balance in the ocean and because of the more time-consuming radiochemical procedures. Direct comparison of particle flux estimated in different ocean regions using these short-lived radionuclides is important in evaluating their utility and accuracy as tracers of particle flux. In this paper, we present paired {sup 234}Th/{sup 238}U and {sup 210}Po/{sup 210}Pb data from oligotrophic surface waters of the subtropical Northwest Atlantic and discuss their advantages and limitations. Vertical profiles of total and particle size-fractionated {sup 210}Po and {sup 234}Th activities, together with particulate organic carbon (POC) concentrations, were measured during three seasons at the Bermuda Atlantic Time-series Study (BATS) site. Both {sup 210}Po and {sup 234}Th reasonably predict sinking POC flux caught in sediment traps, and each tracer provides unique information about the magnitude and efficiency of the ocean's biological pump.
International Nuclear Information System (INIS)
Kuesters, H.; Lalovic, M.
1976-04-01
In this report a review is given on the actinium isotope build-up and decay in LWRs, LMFBRs and HTRs. The dependence of the corresponding physical aspects on reactor type, fuel cycle strategy, calculational methods and cross section uncertainties is discussed. Results from postirradiation analyses and from integral experiments in fast zero power assemblies are compared with theoretical predictions. Some sensitivity studies about the influence of actinium nuclear data uncertainties on the isotopic concentration, decay heat, and the radiation out-put in fuel and waste are presented. In a second part, the main results of the IAEA-Advisory Group Meeting on Transactinium Nuclear Data are summarized and discussed. (orig.) [de
International Nuclear Information System (INIS)
Inagaki, Miyuki; Omura, Akio; Sasaki, Keiichi
2007-01-01
High-precision α-spectrometric 230 Th/ 234 U dating was achieved by recent improvements of measurement system and chemical procedures and enabled critical evaluation of age reliability. We review the status and application of α-spectrometric 230 Th/ 234 U dating of Pleistocene and Holocene corals to reconstruct past sea level changes and tectonic movements in Ryukyus, southwestern Japan and the Philippines in the western rim of circum-Pacific island arcs. The highest terrace in Kikai Island was formed during MIS 5c not MIS 5e that previously reported. Coral reef sediments deposited not only during MIS 5e but also during glacial periods, e.g. MIS 6 and 2, have been found in the Ryukyus. Coral reef sediments formed during MIS 2 were found at ca. 120 m below present sea level off Irabu Island located at 25degN. In addition, it was clear that three terraces developed during MIS 5e, 5c and 5a at Pamilacan Island on the Philippines. (author)
International Nuclear Information System (INIS)
Bonotto, D.M.
1982-01-01
The uranium-238, uranium-234 and radon content of spring waters of Aguas da Prata (SP) - Platina, Paiol, Villela, Sao Bento, Prata-Radioativa, Prata-Nova, Boi, Vitoria and Prata-Antiga - was found; the activity ratio AR ( 234 U/ 238 U) was applied to the geochemistry of local water sources. The uranium analysis procedure consisted of the following steps: adition of 232 U- 228 Th spike to the samples, coprecipitation with iron, iron extraction with organic solvent, separation on anion-exchange resin, extraction with TTA, deposition on stainless steel disc and determination of uranium content by alpha spectrometry. The uranium-238 content changed from 0,10 to 11,56 ppb (average value = 2,3 ppb). The higher values were observed for the waters circulating through sandstones and the lower through volcanic rocks. The inverse correlation (r sub(s) =-0,76) between pH and uranium-238 content confirmed the contribution of this factor on its solubility. The significative correlation r sub(s) = 0,76 between dissolved oxygen and uranium-238 content also confirmed the higher uranium on the more oxidizing zones. The AR changed from 2,84 to 11,68 (average value = 6). These values defined the regional aquifer systems as mineralized in uranium. The higher AR were observed for the deep groundwaters and the lower for the shallow one. Because the 238 U→ 234 Th decay, the 234 Th ejection to the solution was confirmed as the most important factor responsible for the extreme observed isotopic fractionation. (Author) [pt
Coupled 230Th/234U-ESR analyses for corals: A new method to assess sealevel change
International Nuclear Information System (INIS)
Blackwell, Bonnie A.B.; Teng, Steve J.T.; Lundberg, Joyce A.; Blickstein, Joel I.B.; Skinner, Anne R.
2007-01-01
Although coupled 230 Th/ 234 U-ESR analyses have become routine for dating teeth, they have never been used for corals. While the ESR age depends on, and requires assumptions about, the time-averaged cosmic dose rate, D-bar cos (t), 230 Th/ 234 U dates do not. Since D-bar cos (t) received by corals depends on the attenuation by any intervening material, D-bar cos (t) response reflects changing water depths and sediment cover. By coupling the two methods, one can determine the age and a unique D-bar cos,coupled (t) simultaneously. From a coral's water depth and sedimentary history as predicted by a given sealevel curve, one can predict D-bar cos,sealevel (t). If D-bar cos,coupled (t) agrees well with D-bar cos,sealevel (t), this provides independent validation for the curve used to build D-bar cos,sealevel (t). For six corals dated at 7-128 ka from Florida Platform reef crests, the sealevel curve by Waelbroeck et al. [2002. Sea-level and deep water temperature changes derived from benthonic foraminifera isotopic records. Quat. Sci. Rev. 21, 295-305] predicted their D-bar cos,coupled (t) values as well as, or better than, the SPECMAP sealevel curve. Where a whole reef can be sampled over a transect, a precise test for sealevel curves could be developed
230Th/234U dates of late Pleistocene corals from Kita- and Minami-Diato Island, Okinawa, Japan
International Nuclear Information System (INIS)
Omura, Akio; Iwata, Hideki; Ota, Yoko; Koba, Motoharu; Kawana, Toshio.
1991-01-01
Alpha spectrometric Th-230/U-234 dating was applied to 50 Pleistocene corals from Kita- and Minami-Daito Islands, both have been well known as the noteworthy representatives of raised atolls. The Th-230/U-234 dates ranged from 113±6 to 133±6 ka (123±1 ka on average) in the autochthonous corals from Kita-, and from 111±5 to 159±10 ka (123±1 ka on average) in those from Minami-Daito Island, intimating that the fringing reefs have been developed during the high sea level stand of the last interglacial maximum. These dates are correlative to the oxygen isotope stage 5e. The upper limit of occurrence of the dated autochthonous corals was 8.1 m in Kita- and 11 m in Minami-Daito Island. Besides, the somewhat younger dates corresponding to OIS-5a or 5c were obtained from some allochthonous corals in a detrital limestone unit in Kita-Daito Island. However, hermatypic corals were alive, forming small scale reefs in shallow sea around Kita-Daito Island. The former shoreline was proved by the presence of raised surf bench at some localities, where the dated autochthonous corals were collected. (K.I.)
International Nuclear Information System (INIS)
Iturbe G, J.L.
1990-02-01
In this work the determination of the isotope ratio 234 U/ 238 U and 235 U/ 238 U obtained by means of the alpha spectroscopy technique in uranium reagents of commercial marks is presented. The analyzed uranium reagents were: UO 2 (*) nuclear purity, UO 3 (*) poly-science, metallic uranium, uranyl nitrate and uranyl acetate Merck, uranyl acetate and uranyl nitrate Baker, uranyl nitrate (*) of the Refinement and Conversion Department of the ININ, uranyl acetate (*) Medi-Lab Sigma of Mexico and uranyl nitrate Em Science. The obtained results show that the reagents that are suitable with asterisk (*) are in radioactive balance among the one 234 U/ 238 U, since the obtained value went near to the unit. In the case of the isotope ratio 235 U/ 238 U the near value was also obtained the one that marks the literature that is to say 0.04347, what indicates that these reagents contain the isotope of 235 U in the percentage found in the nature of 0.71%. The other reagents are in radioactive imbalance among the 234 U/ 238 U, the found values fluctuated between 0.4187 and 0.1677, and for the quotient of activities 235 U/ 238 U its were of 0.0226, and the lowest of 0.01084. Also in these reagents it was at the 236 U as impurity. The isotope of 236 U is an isotope produced artificially, for what is supposed that the reagents that are in radioactive imbalance were synthesized starting from irradiated fuel. (Author)
Directory of Open Access Journals (Sweden)
C H J Albers-Wolthers
Full Text Available Kisspeptins (KPs and their receptor (GPR54 or KiSS1R play a key-role in regulation of the hypothalamic-pituitary-gonadal axis and are therefore interesting targets for therapeutic interventions in the field of reproductive endocrinology. As dogs show a rapid and robust LH response after the administration of KP10, they can serve as a good animal model for research concerning KP signaling. The aims of the present study were to test the antagonistic properties of KP analogs p234, p271, p354, and p356 in vitro, by determining the intracellular Ca2+ response of CHEM1 cells that stably express human GPR54, and to study the in vivo effects of these peptides on basal plasma LH concentration and the KP10-induced LH response in female dogs. Exposure of the CHEM1 cells to KP-10 resulted in a clear Ca2+ response. P234, p271, p354, and p356 did not prevent or lower the KP10-induced Ca2+ response. Moreover, the in vivo studies in the dogs showed that none of these supposed antagonists lowered the basal plasma LH concentration and none of the peptides lowered the KP10-induced LH response. In conclusion, p234, p271, p354, and p356 had no antagonistic effects in vitro nor any effect on basal and kisspeptin-stimulated plasma LH concentration in female dogs.
International Nuclear Information System (INIS)
Sepulveda Munita, C.J.A.; Atalla, L.T.
1980-01-01
The determination of thorium via the measurement of 233 Th activity (obtained by irradiating natural thorium with neutrons) may suffer the interference of various radioisotopes which may be also formed during irradiation, if their parent isotopes are present in the sample. Taking into account this possibility, another technique was chosen for the determination of thorium, based on isotopic exchange associated with ionic exchange. Conditions for the isotopic exchange between 234 Th in solution and 232 Th in the resin were optimized. It was verified that the behaviour of 233 Th and 234 Th is the same regarding isotopic exchange with 232 Th. 234 Th was chosen for the experiments since it has a longer half-life (24.1 days) than 233 Th (22.3 min), thus facilitating the performance of the work. As the major objective of this work is to separate thorium and europium isotopes, the behaviour of 152-154 Eu was studied in the same system used for thorium, envisaging a minimum retention of these radioisotopes in the resin. In order to establish the best conditions for separating 234-Th and 152/154-Eu, the following parameters were considered: the thorium concentration in the solution; the hydrochloric acid concentration in solution; the concentration of other elements in solution; the degree of cross-linking of the resin; the flow rate of the solution through the column. The other elements added to the elutant solution were: uranium, molybdenum, lanthanum, europium, ytterbium, bromine, cobalt, barium, manganese, indium, cesium and selenium. Europium was added so to dilute the 152/154-Eu tracer and avoid the retention of the latter in the resin. The other elements were added because they give rise to radioisotopes which interfere in the activation analysis of thorium when 233-Th activity is used and, the separation of these elements from thorium will also be subsequently studied by the method used in the present work. (C.L.B.) [pt
International Nuclear Information System (INIS)
Lapa, Flavia Valverde
2013-01-01
Research on the distribution of natural radionuclides in Antarctica is rare and thus, there is great interest in to know their occurrence and factors related to its mobilization, transference and accumulation in this extremely fragile environment. Natural radionuclides have been used intensively as tracers in the ocean, helping to better understand processes as sinking and particle resuspension, water masses mixture and oceanic circulation. 234 Th (t½ = 24.1 days) is a particle-reactive radionuclide produced continuously in seawater by the decay of its soluble precursor conservative with salinity 238 U (t½ = 4.5 10 9 years). Since 234 Th presents relatively short half-life, it is used to quantify processes that occur in temporal scale varying from days to weeks. The disequilibrium 234 Th/ 238 U in the surface ocean has been applied to estimate carbon fluxes exported via sinking material. The flux of particles biologically productive out of the euphotic zone in the Southern Ocean has special attention due to its importance in the control of CO 2 atmospheric concentrations. The radionuclides 210 Pb (t½ = 22.3 years) and 210 Po (t½ = 138 days) are also particle-reactive. The disequilibrium 210 Po/ 210 Pb has been used to estimate fluxes of particles exported in the ocean in the time scale of weeks. The long-lived Ra isotopes, 226 Ra (t½ = 1,600 years) and 228 Ra (t½ = 5.75 years) are soluble in seawater, presenting unique properties that make them excellent tracers of water masses. This research work had the aim to study the distributions of natural radionuclides 238 U, 234 Th, 22 '6Ra, 22 '8Ra, 210 Pb and 210 Po in the Bransfield Strait during 2 samplings carried out in the 2011 Austral Summer (OPERANTAR XXIX and XXX). (author)
Defense In-Depth Accident Analysis Evaluation of Tritium Facility Bldgs. 232-H, 233-H, and 234-H
International Nuclear Information System (INIS)
Blanchard, A.
1999-01-01
'The primary purpose of this report is to document a Defense-in-Depth (DID) accident analysis evaluation for Department of Energy (DOE) Savannah River Site (SRS) Tritium Facility Buildings 232-H, 233-H, and 234-H. The purpose of a DID evaluation is to provide a more realistic view of facility radiological risks to the offsite public than the bounding deterministic analysis documented in the Safety Analysis Report, which credits only Safety Class items in the offsite dose evaluation.'
International Nuclear Information System (INIS)
Kotthaus, Tanja
2010-01-01
In this thesis five heavy deformed isotopes from the mass region A≥230, namely 234 U, 233 U, 231 Th, 230 Pa and 232 Pa, were investigated by means of deuteron-induced neutron transfer reactions. The even-even isotope 234 U has been studied with the 4π-γ-spectrometer MINIBALL at the Cologne Tandem accelerator. Excited nuclei in the isotope 234 U were produced using the reaction 235 U(d,t) at a beam energy of 11 MeV. The target thickness was 3.5 mg/cm 2 . The analysis of the γγ-coincidence data yielded a reinterpretation of the level scheme in 12 cases. Considering its decay characteristics, the 4 + state at an excitation energy of 1886.7 keV is a potential candidate for a two-phonon vibrational state. The isotopes 233 U, 231 Th, 230 Pa and 232 Pa were investigated at the Munich Q3D spectrometer. For each isotope an angular distribution with angles between 5 and 45 were measured. In all four cases the energy of the polarized deuteron beam (vector polarization of 80%) was 22 MeV. As targets 234 U (160 μg/cm 2 ), 230 Th (140 μg/cm 2 ) and 231 Pa (140 μg/cm 2 ) were used. The experimental angular distributions were compared to results of DWBA calculations. For the odd isotope 233 U spin and parity for 33 states are assigned and in the other odd isotope 231 Th 22 assignments are made. The excitation spectra of the two odd-odd isotopes 230 Pa and 232 Pa were investigated for the first time. For the isotope 230 Pa 63 states below an excitation energy of 1.5 MeV are identified. Based on the new experimental data the Nilsson configuration of the ground state is either 1/2[530] p -5/2[633] n or 1/2[530] p +3/2[631] n . In addition 12 rotational bands are proposed and from this six values for the GM splitting energy are deduced as well as two new values for the Newby shift. In the other odd-odd isotope 232 Pa 40 states below an excitation energy of 850 keV are observed and suggestions for the groundstate band and its GM partner are made. From this one GM splitting
Defense In-Depth Accident Analysis Evaluation of Tritium Facility Bldgs. 232-H, 233-H, and 234-H
Energy Technology Data Exchange (ETDEWEB)
Blanchard, A.
1999-05-10
'The primary purpose of this report is to document a Defense-in-Depth (DID) accident analysis evaluation for Department of Energy (DOE) Savannah River Site (SRS) Tritium Facility Buildings 232-H, 233-H, and 234-H. The purpose of a DID evaluation is to provide a more realistic view of facility radiological risks to the offsite public than the bounding deterministic analysis documented in the Safety Analysis Report, which credits only Safety Class items in the offsite dose evaluation.'
Energy Technology Data Exchange (ETDEWEB)
Choukri, A.; Hakam, O.K. [Lab. des Faibles Radioactivites et d' Environnements, UFR: Faibles Radioactivites, Mathematiques physiques et environnement, Kenitra (Morocco); Reyss, J.L. [Lab. des Sciences de Climat et de l' Environnement, Domaine du CNRS, Gif sur Yvette (France); Plaziat, J.C. [Univ. de Paris-Sud, Dept. des Sciences de la Terre, Orsay (France)
2002-07-01
In this work, radiochemical analysis results of 126 uncrystallized coral samples from the Egyptian shoreline of northwestern Red Sea and 120 fossil mollusk shell samples from the Atlantic coast of Moroccan High Atlas at the North of Agadir City in Morocco are presented and discussed. The coral samples were collected in Egypt from the emerged coral reef terraces over 500 km from The Ras Gharib-Ras Shukeir depression (28 10') in the north to Wadi Lahami (north of Ras Banas, 24 10') in the south. The fossil mollusk shells were collected in Morocco from Agadir-Harbour in the south to Tamri village in the north extending over about 50 km. The statistical distributions of results ({sup 238}U content, {sup 234}U/{sup 238}U activity ratio and ages) obtained on the dated materials in the two different regions were compared for three fossil sea levels corresponding to three different climatic stages (Holocene, 5e, 7 and/or 9) in the aim to establish methodological criteria for judging validity of the measured ages. For corals, {sup 238}U content varies in narrow interval around the same average value of 3 ppm for the three sea levels, the calculated initial {sup 234}U/{sup 238}U values are in agreement with the actual sea water ratio (1.15) with some values slightly higher than for the older sea levels. The obtained ages are in good agreement with the ages reported previously for the three emerged fossil sea levels on unrecrystallized corals by alpha spectrometry and by mass spectrometry. For mollusk shells, except for Holocene sea level, {sup 238}U and initial {sup 234}U/{sup 238}U activity ratios vary for the older levels in wide intervals, independent of species and calcite contents of samples. The high {sup 238}U contents and {sup 234}U/{sup 238}U activity ratio are due eventually to a post-incorporation of secondary uranium from sea water or from continental waters drained away rivers. This incorporation leads to a rejuvenation of mollusk shell ages and is
Directory of Open Access Journals (Sweden)
S. V. Rasskazov
2015-01-01
Full Text Available Introduction. Determinations of (234U/238U in groundwater samples are used for monitoring current deformations in active faults (parentheses denote activity ratio units. The cyclic equilibrium of activity ratio 234U/238U≈≈(234U/238U≈γ≈1 corresponds to the atomic ratio ≈5.47×10–5. This parameter may vary due to higher contents of 234U nuclide in groundwater as a result of rock deformation. This effect discovered by P.I. Chalov and V.V. Cherdyntsev was described in [Cherdyntsev, 1969, 1973; Chalov, 1975; Chalov et al., 1990; Faure, 1989]. In 1970s and 1980s, only quite laborious methods were available for measuring uranium isotopic ratios. Today it is possible to determine concentrations and isotopic ration of uranium by express analytical techniques using inductively coupled plasma mass spectrometry (ICP‐MS [Halicz et al., 2000; Shen et al., 2002; Cizdziel et al., 2005; Chebykin et al., 2007]. Sets of samples canbe efficiently analysed by ICP‐MS, and regularly collected uranium isotope values can be systematized at a new quality level for the purposes of earthquake prediction. In this study of (234U/238U in groundwater at the Kultuk polygon, we selected stations of the highest sensitivity, which can ensure proper monitoring of the tectonic activity of the Obruchev and Main Sayan faults. These two faults that limit the Sharyzhalgai block of the crystalline basement of the Siberian craton in the south are conjugated in the territory of the Kultuk polygon (Fig 1. Forty sets of samples taken from 27 June 2012 to 28 January 2014 were analysed, and data on 170 samples are discussed in this paper.Methods. Isotope compositions of uranium and strontium were determined by methods described in [Chebykin et al., 2007; Pin et al., 1992] with modifications. Analyses of uranium by ISP‐MS technique were performed using an Agilent 7500ce quadrapole mass spectrometer of the Ultramicroanalysis Collective Use Centre; analyses of
Assessment of uranium exposure from total activity and 234U:238U activity ratios in urine
International Nuclear Information System (INIS)
Nicholas, T.; Bingham, D.
2011-01-01
Radiation workers at Atomic Weapons Establishment (AWE) are monitored for uranium exposure by routine bioassay sampling (primarily urine sampling). However, the interpretation of uranium in urine and faecal results in terms of occupational intakes is difficult because of the presence of uranium due to intakes from environmental (dietary) sources. For uranium in urine data obtained using current analytical techniques at AWE, the mean, median and standard deviation of excreted uranium concentrations were 0.006, 0.002 and 0.012 μg per g creatinine, respectively. These values are consistent with what might be expected from local dietary intakes and the knowledge that occupational exposures at AWE are likely to be very low. However, some samples do exceed derived investigation levels (DILs), which have been set up taking account of the likely contribution from environmental sources. We investigate how the activity and isotopic composition of uranium in the diet affects the sensitivity of uranium in urine monitoring for occupational exposures. We conclude that DILs based on both total uranium in urine activity and also 234 U: 238 U ratios are useful given the likely variation in dietary contribution for AWE workers. Assuming a background excretion rate and that the enrichment of the likely exposure is known, it is possible to assess exposures using 234 U: 238 U ratios and/or total uranium activity. The health implications of internalised uranium, enriched to 235 U, centre on its nephrotoxicity; the DILs for bioassay samples at AWE are an order of magnitude below the conservative recommendations made by the literature. (authors)
International Nuclear Information System (INIS)
Khattab, Mahmoud R.
2016-01-01
The present study is an application of a radiochemical procedure using alpha spectrometry technique for determination of uranium isotopes "2"3"8U, "2"3"4U and "2"3"5U on 13 granitic samples. These samples were collected from Gabal Gattar area, Northeastern Desert, Egypt. The collected samples were digested using microwave technique with aqua regia and spiked with "2"3"2U for chemical yield and activity calculation. Separation of uranium isotopes from the samples was done by Dowex 1 x 4 (50-100 mesh) resin followed by source preparation using microprecipitation technique. The concentrations of "2"3"8U were ranged between 28.9±0.9 and 134.8±1.8 Bq/g, and the "2"3"4U concentrations were between 24±0.6 and 147.7±2.2 Bq/g. For the "2"3"5U, the activity concentrations were between 1.3±0.2 and 6.7±1.2 Bq/g. The activity ratio of "2"3"4U/"2"3"8U was calculated and varied from 0.80 to 1.30. (author)
Energy Technology Data Exchange (ETDEWEB)
Iturbe G, J L
1990-02-15
In this work the determination of the isotope ratio {sup 234} U/{sup 238} U and {sup 235} U/{sup 238} U obtained by means of the alpha spectroscopy technique in uranium reagents of commercial marks is presented. The analyzed uranium reagents were: UO{sub 2} (*) nuclear purity, UO{sub 3} (*) poly-science, metallic uranium, uranyl nitrate and uranyl acetate Merck, uranyl acetate and uranyl nitrate Baker, uranyl nitrate (*) of the Refinement and Conversion Department of the ININ, uranyl acetate (*) Medi-Lab Sigma of Mexico and uranyl nitrate Em Science. The obtained results show that the reagents that are suitable with asterisk (*) are in radioactive balance among the one {sup 234} U/{sup 238} U, since the obtained value went near to the unit. In the case of the isotope ratio {sup 235} U/{sup 238} U the near value was also obtained the one that marks the literature that is to say 0.04347, what indicates that these reagents contain the isotope of {sup 235} U in the percentage found in the nature of 0.71%. The other reagents are in radioactive imbalance among the {sup 234} U/{sup 238} U, the found values fluctuated between 0.4187 and 0.1677, and for the quotient of activities {sup 235} U/{sup 238} U its were of 0.0226, and the lowest of 0.01084. Also in these reagents it was at the {sup 236} U as impurity. The isotope of {sup 236} U is an isotope produced artificially, for what is supposed that the reagents that are in radioactive imbalance were synthesized starting from irradiated fuel. (Author)
Energy Technology Data Exchange (ETDEWEB)
Borylo, A.; Skwarzec, B. [Gdansk Univ. (Poland). Faculty of Chemistry
2011-07-01
In the study the activities of polonium {sup 210}Po and uranium {sup 234}U, {sup 238}U in plants, collected near phosphogypsum waste heap in Wis'linka (northern Poland), were determined by using the alpha spectrometry. The obtained results revealed that the concentrations of {sup 210}Po, {sup 234}U, and {sup 238}U in the analyzed plants were differentiated. In the analyzed flora organisms the highest amounts of polonium and uranium were found in ruderal plant samples as well as willow samples (Salix viminalis) from protection zone of phosphogypsum waste heap. The concentrations of {sup 210}Po, {sup 234}U and {sup 238}U in the analyzed plants were higher in roots than in green parts of plants. The higher concentrations of {sup 210}Po and {sup 238}U radionuclides were estimated for hydrophyte (common sedge Carex nigra Reichard), the favourite habitat of which is particularly wet meadow and for plants collected in the vicinity of phosphogypsum waste heap. The major source of polonium and uranium in analyzed plants is root system. The values of {sup 234}U/ {sup 238}U activity ratio in all analyzed plants are closed to one, what indicated that source of uranium in analyzed plants is phosphogypsum. The highest uranium and polonium concentrations were characterized for plants, which are covered with tomentose. The comparability polonium and uranium contents were confirmed in edible plants, but higher accumulation was determined in ripe species than immature species of vegetables. The higher polonium and uranium concentrations were noticed in green parts of plant, the lower in roots. Polonium concentration in cultivated plants samples was not species diverse. Therefore, the significant source of polonium and uranium in analyzed plants is wet and dry atmospheric falls gathering the soil and air dust from phosphogypsum waste dump. The maximum {sup 210}Po and {sup 238}U radionuclides concentrations were found in green parts of red beet (Beta vulgaris esculenta), the
International Nuclear Information System (INIS)
Moulin, J.
2008-06-01
Understanding natural radionuclides behaviour in surface water is a required step to achieve uranium mine rehabilitation and preserve water quality. The first objective of this thesis is to determine which are the radionuclides sources in a drinking water reservoir. The second objective is to improve the knowledge about the behaviour of uranium series radionuclides, especially actinium. The investigated site is a brook (Sagnes, Limousin, France) which floods a peat bog contaminated by a former uranium mine and which empties into the Crouzille lake. It allows studying radionuclides transport in surface water and radionuclides retention through organic substance or water reservoir. Radionuclides distribution in particulate, colloidal and dissolved phases is determined thanks to ultra-filtrations. Gamma spectrometry allows measuring almost all natural radionuclides with only two counting stages. However, low activities of 235 U series radionuclides impose the use of very low background well-type Ge detectors, such as those of the Underground Laboratory of Modane (France). Firstly, this study shows that no or few radionuclides are released by the Sagnes peat bog, although its radioactivity is important. Secondly, it provides details on the behaviour of uranium series radionuclides in surface water. More specifically, it provides the first indications of actinium solubility in surface water. Actinium's behaviour is very close to uranium's even if it is a little less soluble. (author)
International Nuclear Information System (INIS)
2007-01-01
This study resumes the discovery of an excess of actinium 227 found around by EL4 nuclear reactor actually in dismantling. The search for the origin of this excess revealed a real inquiry of investigation during three years. Because a nuclear reactor existed in this area a particular attention will have concerned this region. The doubt became the line of conduct to find the answer to the human or natural origin of this excess. Finally and against any evidence, it appears that the origin of this phenomenon was natural, consequence of the particular local geology. The detail of the different investigations is given: search of a possible correlation with the composition of elevations constituent of lanes, search (and underlining) of new sites in the surroundings of the Rusquec pond and the Plouenez station, study of the atmospheric deposits under winds of the nuclear power plant and in the east direction, search of a possible relationship with the gaseous effluents of the nuclear power plant in the past, historical study of radioactive effluents releases in the fifty last years by the analysis of the sedimentary deposits in the Saint-Herbiot reservoir, search of a possible correlation between the excess of actinium 227 and the nuclear power plant activity; search of a possible correlation with a human activity without any relationship with the nuclear activities, search of a correlation with the underground waters, search of a correlation with the geological context, collect of information on the possible transfers in direction of the food chain, determination of the radiological composition of the underground waters ( not perturbed by human activity), search of the cause of an excess of actinium 227 in the old channel of liquid effluents release of the nuclear power plant. The results are given and discussed. And contrary to all expectations the origin of the excess of actinium 227 is completely natural. (N.C.)
Energy Technology Data Exchange (ETDEWEB)
NONE
2007-07-01
This study resumes the discovery of an excess of actinium 227 found around by EL4 nuclear reactor actually in dismantling. The search for the origin of this excess revealed a real inquiry of investigation during three years. Because a nuclear reactor existed in this area a particular attention will have concerned this region. The doubt became the line of conduct to find the answer to the human or natural origin of this excess. Finally and against any evidence, it appears that the origin of this phenomenon was natural, consequence of the particular local geology. The detail of the different investigations is given: search of a possible correlation with the composition of elevations constituent of lanes, search (and underlining) of new sites in the surroundings of the Rusquec pond and the Plouenez station, study of the atmospheric deposits under winds of the nuclear power plant and in the east direction, search of a possible relationship with the gaseous effluents of the nuclear power plant in the past, historical study of radioactive effluents releases in the fifty last years by the analysis of the sedimentary deposits in the Saint-Herbiot reservoir, search of a possible correlation between the excess of actinium 227 and the nuclear power plant activity; search of a possible correlation with a human activity without any relationship with the nuclear activities, search of a correlation with the underground waters, search of a correlation with the geological context, collect of information on the possible transfers in direction of the food chain, determination of the radiological composition of the underground waters ( not perturbed by human activity), search of the cause of an excess of actinium 227 in the old channel of liquid effluents release of the nuclear power plant. The results are given and discussed. And contrary to all expectations the origin of the excess of actinium 227 is completely natural. (N.C.)
International Nuclear Information System (INIS)
Kronfeld, J.
1988-07-01
Springs and lake deposits (travertines) sampled along the western margins of the Arava segment of the Dead Sea Rift Valley, Israel, were studied as a potential source of palaeoclimatic information. The 230 Th/ 234 U disequilibrium method was used to determine the age of the investigated deposits. The radiometric dating was supplemented by detailed petrographic and chemical analyses of the collected samples. Detailed petrographic observations of the analysed travertine samples suggest their deposition under moderately-arid conditions, alternating with arid to extremely arid periods. This evidence is consistent with the preliminary conclusions drawn from palynological studies in the area. Dating by the 230 Th/ 234 U disequilibrium method indicates that most travertine ages correspond to oceanic 18 O stages 5 and 7. The good correspondence between apparent ages as deduced from the position of the travertines in vertical and lateral successions and the radiometric ages, lends credibility to the radiometric ages. The clustering of ages during the warm 18 O stages bears similarity to the temporal distribution of middle to late Pleistocene sapropelic horizons in the Eastern Mediterranean Basin which further leads to suspicion that during insolation maxima monsoonal cells originating in the Indian Ocean have shifted northwards reaching the latitude of the Arava and Negev Highlands. Refs and figs
Coupled {sup 230}Th/{sup 234}U-ESR analyses for corals: A new method to assess sealevel change
Energy Technology Data Exchange (ETDEWEB)
Blackwell, Bonnie A.B. [Department of Chemistry, Williams College, Williamstown, MA 01267 (United States); RFK Science Research Institute, Glenwood Landing, NY 11547 (United States)], E-mail: bonnie.a.b.blackwell@williams.edu; Teng, Steve J.T. [RFK Science Research Institute, Glenwood Landing, NY 11547 (United States)], E-mail: mteng1584@gmail.com; Lundberg, Joyce A. [Department of Geography and Environmental Studies, Carleton University, Ottawa, ON, Canada K1S 5B6 (Canada)], E-mail: joyce_lundberg@carleton.ca; Blickstein, Joel I.B. [Department of Chemistry, Williams College, Williamstown, MA 01267 (United States); RFK Science Research Institute, Glenwood Landing, NY 11547 (United States); Skinner, Anne R. [Department of Chemistry, Williams College, Williamstown, MA 01267 (United States); RFK Science Research Institute, Glenwood Landing, NY 11547 (United States)], E-mail: anne.r.skinner@williams.edu
2007-07-15
Although coupled {sup 230}Th/{sup 234}U-ESR analyses have become routine for dating teeth, they have never been used for corals. While the ESR age depends on, and requires assumptions about, the time-averaged cosmic dose rate, D-bar{sub cos}(t), {sup 230}Th/{sup 234}U dates do not. Since D-bar{sub cos}(t) received by corals depends on the attenuation by any intervening material, D-bar{sub cos}(t) response reflects changing water depths and sediment cover. By coupling the two methods, one can determine the age and a unique D-bar{sub cos,coupled}(t) simultaneously. From a coral's water depth and sedimentary history as predicted by a given sealevel curve, one can predict D-bar{sub cos,sealevel}(t). If D-bar{sub cos,coupled}(t) agrees well with D-bar{sub cos,sealevel}(t), this provides independent validation for the curve used to build D-bar{sub cos,sealevel}(t). For six corals dated at 7-128 ka from Florida Platform reef crests, the sealevel curve by Waelbroeck et al. [2002. Sea-level and deep water temperature changes derived from benthonic foraminifera isotopic records. Quat. Sci. Rev. 21, 295-305] predicted their D-bar{sub cos,coupled}(t) values as well as, or better than, the SPECMAP sealevel curve. Where a whole reef can be sampled over a transect, a precise test for sealevel curves could be developed.
Sorption studies of radioelements on geological materials
International Nuclear Information System (INIS)
Berry, John A.; Yui, Mikazu; Kitamura, Akira
2007-11-01
Batch sorption experiments have been carried out to study the sorption of uranium, technetium, curium, neptunium, actinium, protactinium, polonium, americium and plutonium onto bentonite, granodiorite and tuff. Mathematical modelling using the HARPHRQ program and the HATCHES database was carried out to predict the speciation of uranium and technetium in the equilibrated seawater, and neptunium, americium and plutonium in the rock equilibrated water. Review of the literature for thermodynamic data for curium, actinium, protactinium and polonium was carried out. Where sufficient data were available, predictions of the speciation and solubility were made. This report is a summary report of the experimental work conducted by AEA Technology during April 1991-March 1998, and the main results have been presented at Material Research Society Symposium Proceedings and published as proceedings of them. (author)
A comparative analysis of alpha-decay half-lives for even-even 178Pb to 234U isotopes
Hosseini, S. S.; Hassanabadi, H.; Zarrinkamar, S.
2018-02-01
The feasibility for the alpha decay from the even-even transitions of 178Pb to 234U isotopes has been studied within the Coulomb and proximity potential model (CPPM). The alpha decay half-lives are considered from different theoretical approaches using Semi-empirical formula of Poenaru et al. (SemFIS), the Universal Decay law (UDL) of Qi et al., Akrawy-Dorin formula of Akrawy and Poenaru (ADF), the Scaling law of Brown (SLB) and the Scaling Law of Horoi et al. (SLH). The numerical results obtained by the CPPM and compared with other method as well the experimental data.
Bioaccumulation of uranium 234U and 238U in marine birds
International Nuclear Information System (INIS)
Borylo, A.; Skwarzec, B.
2010-01-01
In the paper was presented results of our study about uranium 234 U and 238 U radioactivity in the marine birds samples, collected in the Polish area of the southern Baltic Sea. We chose 11 species of sea birds: three species permanently residing at southern Baltic, four species of wintering birds and three species of migrating birds. The obtained results indicated that uranium is very irregularly distributed in organs and tissues of marine birds. The highest uranium content is characterized in liver, rest of viscera and feathers, the smallest in skin and muscles. The uranium concentration was higher for carnivorous species (long-tailed duck (C. hyemalis), common eider (S. mollissima), lower for species eating fish (great cormorant (P. carbo), common guillemot (U. aalge), red-throated diver (G. stellata) and razorbill (A. tarda)), but the biggest amounts for herbivorous species [tufted duck (A. fuligula) and eurasian coot (F. atra)]. About 63-67% of uranium, which was located in feathers of two species of marine birds: razorbill (A. tarda) and long-tailed duck (C. hymealis), was apparently adsorbed, which suggests that uranium adsorption on the feathers may be an important transfer from air to water. (author)
Sherlin, Y. Sheeba; Vijayakumar, T.; Roy, S. D. D.; Jayakumar, V. S.
2018-05-01
Molecular geometry of Parkinson's drug 2-(3,4-Dihydroxyphenyl)ethylamine hydrochloride (Dopamine, DA) has been evaluated and compared with experimental XRD data. Molecular docking and vibrational spectral analysis of DA have been carried out using FT-Raman and FT-IR spectra aided by Density Functional Theory at B3LYP/6-311++G(d,p). The present investigation deals with the analysis of structural and spectral features responsible for drug activities, nature of hydrogen bonding interactions of the molecule and the correlation of Parkinson's nature with its molecular structural features.
U-234/U-238 ratio: Qualitative estimate of groundwater flow in Rocky Flats monitoring wells
International Nuclear Information System (INIS)
Laul, J.C.
1994-01-01
Groundwater movement through various pathways is the primary mechanism for the transport of radionuclides and trace elements in a water/rock interaction. About three dozen wells, installed in the Rocky Flats Plant (RFP) Solar Evaporation Ponds (SEP) area, are monitored quarterly to evaluate the extent of any lateral and downgradient migration of contaminants from the Solar Evaporation Ponds: 207-A; 207-B North, 207-B Center, and 207-B South; and 207-C. The Solar Ponds are the main source for the various contaminants: radionuclides (U-238, U-234, Pu-239, 240 and Am-241); anions; and trace metals to groundwaters. The U-238 concentrations in Rocky Flats groundwaters vary from 2 (CO 3 ) 2 2- , because of the predominant bicarbonate medium
International Nuclear Information System (INIS)
Szymczak, R.; Zaw, M.
1999-01-01
In this study samples were collected in the Gulf of Papua region of PNG, on board the research vessel Franklin as apart of a multidisciplinary study of factors influencing the fate of terrestrial material entering the tropical coastal ocean. Samples for 234 Th were collected using a in situ large volume pump device (Challenger Oceanic) passing seawater (1000-2000 litres) through a series of cartridge filters in polycarbonate housings
Fission Fragment Angular Distributions in the $^{234}$U(n,f) and $^{236}$U(n,f) reactions
We propose to measure the fission fragment angular distribution (FFAD) of the $^{234}$U(n,f) and $^{236}$U (n,f) reactions with the PPAC detection setup used in previous n_TOF-14 experiment. This experiment would take advantage of the high resolution of the n_TOF facility to investigate the FFAD behaviour in the pronounced vibrational resonances that have been observed between 0.1 and 2 MeV for the thorium cycle isotopes. In addition, the angular distribution of these isotopes will be measured for the first time beyond 14 MeV. Furthermore, the experiment will also provide the fission cross section with reduced statistical uncertainty, extending the $^{236}$U(n,f) data up to 1 GeV
Energy Technology Data Exchange (ETDEWEB)
Lapa, Flavia Valverde
2013-07-01
Research on the distribution of natural radionuclides in Antarctica is rare and thus, there is great interest in to know their occurrence and factors related to its mobilization, transference and accumulation in this extremely fragile environment. Natural radionuclides have been used intensively as tracers in the ocean, helping to better understand processes as sinking and particle resuspension, water masses mixture and oceanic circulation. {sup 234}Th (t½ = 24.1 days) is a particle-reactive radionuclide produced continuously in seawater by the decay of its soluble precursor conservative with salinity {sup 238}U (t½ = 4.5 10{sup 9} years). Since {sup 234}Th presents relatively short half-life, it is used to quantify processes that occur in temporal scale varying from days to weeks. The disequilibrium {sup 234}Th/{sup 238}U in the surface ocean has been applied to estimate carbon fluxes exported via sinking material. The flux of particles biologically productive out of the euphotic zone in the Southern Ocean has special attention due to its importance in the control of CO{sub 2} atmospheric concentrations. The radionuclides {sup 210}Pb (t½ = 22.3 years) and {sup 210}Po (t½ = 138 days) are also particle-reactive. The disequilibrium {sup 210}Po/{sup 210}Pb has been used to estimate fluxes of particles exported in the ocean in the time scale of weeks. The long-lived Ra isotopes, {sup 226}Ra (t½ = 1,600 years) and {sup 228}Ra (t½ = 5.75 years) are soluble in seawater, presenting unique properties that make them excellent tracers of water masses. This research work had the aim to study the distributions of natural radionuclides {sup 238}U, {sup 234}Th, {sup 22}'6Ra, {sup 22}'8Ra, {sup 210}Pb and {sup 210}Po in the Bransfield Strait during 2 samplings carried out in the 2011 Austral Summer (OPERANTAR XXIX and XXX). (author)
DEFF Research Database (Denmark)
Pedersen, Daniel Sejer; Robinson, Tony V; Taylor, Dennis K
2009-01-01
-94% yield), including the natural plant lactone (+/-)-2-C-d-methylerythrono-1,4-lactone 1. The latter compound was treated with aqueous potassium hydroxide to afford potassium (+/-)-(2R,3R)-2,3,4-trihydroxy-2-methylbutanoate 2, which is a leaf-closing substance of Leucaena leucocephalam....
International Nuclear Information System (INIS)
Agha, A.R.; El-Mongy, S.A.; Kandel, A.E.
2011-01-01
Nasser Lake is the greatest man-made lake in the World. It is considered as the main source of water where the Nile water is impounded behind the Aswan high dam.. Uranium has three naturally occurring isotopes 234 U, 235 U and 238 U with isotopic abundance 0.00548, 0.7200 and 99.2745 atom percent. Dissolved uranium in the lake is primary due to weathering process. Monitoring of the isotopic ratios of uranium is used as a good indicator to trace and evaluate the origin and activities associated with any variation of uranium in the lake environment. The main objective of the present study is to clarify any potential variation of natural uranium 234 U/ 238 U, 235 U/ 238 U ratios in sediment samples of Nasser Lake by using destructive alpha and non destructive gamma- techniques. The results show that the uranium isotopic activity ratios are very close to the natural values. This study can also be used for radiological protection and safety evaluation purposes.
International Nuclear Information System (INIS)
Kronfeld, J.
1977-11-01
The attempt to use uranium analysis of the ratio 234 U/ 238 U to investigate the flow pattern and the recharge mechanism of the Nubian Sandstone waters in the Negev Desert is reported. 105 water samples were collected from the Nubian Sandstone, the overlying aquifers and from crystalline rocks in Southern Sinai. The latter is supposed to be the recharge area of the Nubian Sandstone waters. Although the uranium value group discretes water bodies no conclusion can be drawn as to the origin of the Nubian Sandstone waters. Due to the results artesian leakage from the Nubian Sandstone into the overlying aquifers probably can be ruled out
International Nuclear Information System (INIS)
Dridi, W.
2006-11-01
Accurate and reliable neutron capture cross sections are needed in many research areas, including stellar nucleosynthesis, advanced nuclear fuel cycles, waste transmutation, and other applied programs. In particular, the accurate knowledge of U 234 (n,γ) reaction cross section is required for the design and realization of nuclear power plants based on the thorium fuel cycle. We have measured the neutron capture cross section of U 234 , with a 4π BaF 2 Total Absorption Calorimeter, at the recently constructed neutron time-of-flight facility n-TOF at CERN in the energy range from 0.03 eV to 1 MeV. Monte-Carlo simulations with GEANT4 and MCNPX of the detector response have been performed. After the background subtraction and correction with dead time and pile-up, the capture yield from 0.03 eV up to 1.5 keV was derived. The analysis of the capture yield in terms of R-matrix resonance parameters is discussed. We have identified 123 resonances and measured the resonance parameters in the energy range from 0.03 eV to 1.5 keV. The mean radiative width γ > is found to be (38.2 ± 1.5) meV and the mean spacing parameter 0 > is (11.0 ± 0.2) eV, both values agree well with recommended values
Lin, Peng; Xu, Chen; Zhang, Saijin; Sun, Luni; Schwehr, Kathleen A.; Bretherton, Laura; Quigg, Antonietta; Santschi, Peter H.
2017-08-01
Laboratory incubation experiments using the coccolithophore Emiliania huxleyi were conducted in the presence of 234Th, 233Pa, 210Pb, 210Po, and 7Be to differentiate radionuclide uptake to the CaCO3 coccosphere from coccolithophore-associated biopolymers. The coccosphere (biogenic calcite exterior and its associated biopolymers), extracellular (nonattached and attached exopolymeric substances), and intracellular (sodium-dodecyl-sulfate extractable and Fe-Mn-associated metabolites) fractions were obtained by sequentially extraction after E. huxleyi reached its stationary growth phase. Radionuclide partitioning and the composition of different organic compound classes, including proteins, total carbohydrates (TCHO), and uronic acids (URA), were assessed. 210Po was closely associated with the more hydrophobic biopolymers (high protein/TCHO ratio, e.g., in attached exopolymeric substances), while 234Th and 233Pa showed similar partitioning behavior with most activity being distributed in URA-enriched, nonattached exopolymeric substances and intracellular biopolymers. 234Th and 233Pa were nearly undetectable in the coccosphere, with a minor abundance of organic components in the associated biopolymers. These findings provide solid evidence that biogenic calcite is not the actual main carrier phase for Th and Pa isotopes in the ocean. In contrast, both 210Pb and 7Be were found to be mostly concentrated in the CaCO3 coccosphere, likely substituting for Ca2+ during coccolith formation. Our results demonstrate that even small cells (E. huxleyi) can play an important role in the scavenging and fractionation of radionuclides. Furthermore, the distinct partitioning behavior of radionuclides in diatoms (previous studies) and coccolithophores (present study) explains the difference in the scavenging of radionuclides between diatom- and coccolithophore-dominated marine environments.
Energy Technology Data Exchange (ETDEWEB)
Dridi, W
2006-11-15
Accurate and reliable neutron capture cross sections are needed in many research areas, including stellar nucleosynthesis, advanced nuclear fuel cycles, waste transmutation, and other applied programs. In particular, the accurate knowledge of U{sup 234}(n,{gamma}) reaction cross section is required for the design and realization of nuclear power plants based on the thorium fuel cycle. We have measured the neutron capture cross section of U{sup 234}, with a 4{pi} BaF{sub 2} Total Absorption Calorimeter, at the recently constructed neutron time-of-flight facility n-TOF at CERN in the energy range from 0.03 eV to 1 MeV. Monte-Carlo simulations with GEANT4 and MCNPX of the detector response have been performed. After the background subtraction and correction with dead time and pile-up, the capture yield from 0.03 eV up to 1.5 keV was derived. The analysis of the capture yield in terms of R-matrix resonance parameters is discussed. We have identified 123 resonances and measured the resonance parameters in the energy range from 0.03 eV to 1.5 keV. The mean radiative width <{gamma}{sub {gamma}}> is found to be (38.2 {+-} 1.5) meV and the mean spacing parameter
Energy Technology Data Exchange (ETDEWEB)
Dridi, W
2006-11-15
Accurate and reliable neutron capture cross sections are needed in many research areas, including stellar nucleosynthesis, advanced nuclear fuel cycles, waste transmutation, and other applied programs. In particular, the accurate knowledge of U{sup 234}(n,{gamma}) reaction cross section is required for the design and realization of nuclear power plants based on the thorium fuel cycle. We have measured the neutron capture cross section of U{sup 234}, with a 4{pi} BaF{sub 2} Total Absorption Calorimeter, at the recently constructed neutron time-of-flight facility n-TOF at CERN in the energy range from 0.03 eV to 1 MeV. Monte-Carlo simulations with GEANT4 and MCNPX of the detector response have been performed. After the background subtraction and correction with dead time and pile-up, the capture yield from 0.03 eV up to 1.5 keV was derived. The analysis of the capture yield in terms of R-matrix resonance parameters is discussed. We have identified 123 resonances and measured the resonance parameters in the energy range from 0.03 eV to 1.5 keV. The mean radiative width <{gamma}{sub {gamma}}> is found to be (38.2 {+-} 1.5) meV and the mean spacing parameter
Energy Technology Data Exchange (ETDEWEB)
Organo, Catherine [Paris-11 Univ., 91 - Orsay (France)
1997-01-20
The first part of this thesis presents the current situation of knowledge of uranium in marine environment. The second part describes the methods of analysis as well as the material support of the study, i.e., the sediments and marine deposits investigated. The third part is dedicated to the study of uranium mobility in marine sediments characterized by detrital terrigenous composition (pelagic clays). This approach allowed quantifying the entering and leaving flux of uranium after the sediment settling and, to discuss, on this basis, the consequences on the uranium oceanic balance. In the third part the origin and behavior of uranium in zones of high surface productivity is studied. The uranium enrichments observed in the hemi-pelagic sediments of the EUMELI (J.G.O.F.S.-France) programme will constitute a material of study adequate for measuring the variations in the {sup 234}U/2{sup 38U} ratio in solid phase, in response to the oxido-reducing characteristics of the sediment. Thus establishing the origin of the trapped uranium has been possible. Also, the nature of the sedimentary phases related to uranium in bio-genetic sediments in the Austral Ocean was determined. Thus a relationship between the variations in the {sup 234}U/{sup 238} and the diagenetic transformations was possible to establish. Finally in the fifth part a study of the behavior of uranium in a polymetallic shell characteristic for deposits of hydrogenized origin 146 refs., 57 figs., 23 tabs.
International Nuclear Information System (INIS)
Organo, Catherine
1997-01-01
The first part of this thesis presents the current situation of knowledge of uranium in marine environment. The second part describes the methods of analysis as well as the material support of the study, i.e., the sediments and marine deposits investigated. The third part is dedicated to the study of uranium mobility in marine sediments characterized by detrital terrigenous composition (pelagic clays). This approach allowed quantifying the entering and leaving flux of uranium after the sediment settling and, to discuss, on this basis, the consequences on the uranium oceanic balance. In the third part the origin and behavior of uranium in zones of high surface productivity is studied. The uranium enrichments observed in the hemi-pelagic sediments of the EUMELI (J.G.O.F.S.-France) programme will constitute a material of study adequate for measuring the variations in the 234 U/2 38U ratio in solid phase, in response to the oxido-reducing characteristics of the sediment. Thus establishing the origin of the trapped uranium has been possible. Also, the nature of the sedimentary phases related to uranium in bio-genetic sediments in the Austral Ocean was determined. Thus a relationship between the variations in the 234 U/ 238 and the diagenetic transformations was possible to establish. Finally in the fifth part a study of the behavior of uranium in a polymetallic shell characteristic for deposits of hydrogenized origin
Directory of Open Access Journals (Sweden)
J. A. Hall
2012-03-01
Full Text Available We evaluated the export fluxes of Particulate Organic Carbon (POC in the Subtropical Frontal zone (STF of the SW Pacific sector of the Southern Ocean. The site is characterized by enhanced primary productivity, which has been suggested to be stimulated through so-called natural iron fertilization processes where iron-depleted subantarctic water (SAW mixes with mesotrophic, iron-replete subtropical water (STW. We adopted the small-volume 234Th method to achieve the highest possible spatial sampling resolution in austral late autumn-early winter, May–June, 2008. Inventories of chlorophyll-a, particulate 234Th and POC observed in the upper 100 m were all elevated in the mid-salinity water type (34.5 34.8 salinity waters which were of STW origin with low macronutrients. However, Steady-State 234Th fluxes were similar across the salinity gradient being, 25 ± 0.78 ((1.5 ± 0.047 × 103 in the mid-salinity, and 29 ± 0.53 ((1.8 ± 0.032 × 103 and 22 ± 1.1 Bq m−2 d−1 ((1.3 ± 0.066 × 103 dpm m−2 d–1 in the high and low salinity waters respectively. Bottle POC/Th ratios at the depth of 100 m were used to convert 234Th fluxes into POC export fluxes. The derived POC flux did not appear to be enhanced in mid-salinity waters where the primary productivity was inferred to be the highest at the time of sampling, with a flux of 11 ± 0.45 mmol C m−2 d−1, compared to 14 ± 0.39 mmol C m−2 d−1 in high salinity waters and 8.5 ± 0.66 mmol C m−2 d−1 in low salinity waters. This study thus implied that natural iron fertilization does not necessarily lead to an enhancement of POC export in STF regions.
Dias da Cunha, Kenya Moore; Henderson, Helenes; Thomson, Bruce M; Hecht, Adam A
2014-06-01
The objectives of the study are to present a critical review of the (238)U, (234)U, (235)U, (226)Ra and (210)Pb levels in water samples from the EPA studies (U.S. EPA in Abandoned uranium mines and the Navajo Nation: Red Valley chapter screening assessment report. Region 9 Superfund Program, San Francisco, 2004, Abandoned uranium mines and the Navajo Nation: Northern aum region screening assessment report. Region 9 Superfund Program, San Francisco, 2006, Health and environmental impacts of uranium contamination, 5-year plan. Region 9 Superfund Program, San Franciso, 2008) and the dose assessment for the population due to ingestion of water containing (238)U and (234)U. The water quality data were taken from Sect. "Data analysis" of the published report, titled Abandoned Uranium Mines Project Arizona, New Mexico, Utah-Navajo Lands 1994-2000, Project Atlas. Total uranium concentration was above the maximum concentration level for drinking water (7.410-1 Bq/L) in 19 % of the water samples, while (238)U and (234)U concentrations were above in 14 and 17 % of the water samples, respectively. (226)Ra and (210)Pb concentrations in water samples were in the range of 3.7 × 10(-1) to 5.55 × 102 Bq/L and 1.11 to 4.33 × 102 Bq/L, respectively. For only two samples, the (226)Ra concentrations exceeded the MCL for total Ra for drinking water (0.185 Bq/L). However, the (210)Pb/(226)Ra ratios varied from 0.11 to 47.00, and ratios above 1.00 were observed in 71 % of the samples. Secular equilibrium of the natural uranium series was not observed in the data record for most of the water samples. Moreover, the (235)U/(total)U mass ratios ranged from 0.06 to 5.9 %, and the natural mass ratio of (235)U to (total)U (0.72 %) was observed in only 16 % of the water samples, ratios above or below the natural ratio could not be explained based on data reported by U.S. EPA. In addition, statistical evaluations showed no correlations among the distribution of the radionuclide concentrations
International Nuclear Information System (INIS)
Al-Hamarneh, Ibrahim F.; Alkhomashi, N.; Almasoud, Fahad I.
2016-01-01
The present study addresses the soil-to-plant transfer factors (TFs) of 226 Ra, 234 U and 238 U for 13 types of vegetables and agricultural crops planted under semi-arid environment in the northwestern part of Saudi Arabia. Crop plants along with plant-growing soils were collected from selected farms, which are irrigated from the non-renewable Saq aquifer, and investigated for their radioactivity content by means of alpha spectrometry after applying a radiochemical separation procedure. Hence, TF data for plant roots, green parts (stem and leaves) and fruits were calculated and contrasted to those reported in the literature. Substantial differences were observed in the TFs of Ra and U radioisotopes among plant species. In crop fruits, eggplant exhibited the highest uptake of 226 Ra (TF value of 0.11), while beans (0.16) have the highest TF for 234 U and 238 U. The geometric mean TF values indicated that the crop roots tend to accumulate Ra and U about four to six-folds higher than fruits. The relation between TF values and soil concentrations showed a weak correlation. Activity ratios between radionuclides in crop plants indicated the preferential translocation of U in fruits than Ra even though Ra is more available for root uptake. The fruit/root (F/R) ratios obtained for the investigated plants shown that pepper had the smallest F/R ratios (0.07 ± 0.01, 0.12 ± 0.02 and 0.11 ± 0.02 for 226 Ra, 234 U and 238 U, respectively), while the highest F/R ratios were observed in potatoes (0.71 ± 0.15, 0.44 ± 0.10 and 0.40 ± 0.08 for 226 Ra, 234 U and 238 U, respectively). The TF and F/R ratios data of natural radionuclides in the study region can hopefully improve the scientific knowledge for future studies. - Highlights: • Ra and U isotopes were measured in soils and plant crops in farms in Saudi Arabia. • Ra and U activities in plant roots (R) slightly exceeded that in their fruits (F). • Ra/U activity ratios showed preferential translocation of U
238U-234U-230Th-232Th systematics and the precise measurement of time over the past 500,000 years
International Nuclear Information System (INIS)
Edwards, R.L.; Chen, J.H.; Wasserburg, G.J.
1987-01-01
We have developed techniques to measure the 230 Th abundance in corals by isotope dilution mass spectrometry. This, coupled with our previous development of mass spectrometric techniques for 234 U and 232 Th measurement, has allowed us to reduce significantly the analytical errors in 238 U- 234 U- 230 Th dating and greatly reduce the sample size. We show that 6x10 8 atoms of 230 Th can be measured to ±30per mille (2 σ) and 2x10 10 atoms of 230 Th to ±2per mille. The time over which useful age data on corals can be obtained ranges from a few years to ≅ 500 ky. The uncertainty in age, based on analytical errors, is ±5 y(2 σ) for a 180 year old coral (3 g), ±44 y at 8294 years and ±1.1 ky at 123.1 ky (250 mg of coral). We also report 232 Th concentrations in corals (0.083-1.57 pmol/g) that are more than two orders of magnitude lower than previous values. Ages with high analytical precision were determined for several corals that grew during high sea level stands ≅ 120 ky ago. These ages lie specifically within or slightly postdate the Milankovitch insolation high at 128 ky and support the idea that the dominant cause of Pleistocene climate change is Milankovitch forcing. (orig.)
Directory of Open Access Journals (Sweden)
Da-Wei Xin
Full Text Available Type 3 effector proteins secreted via the bacterial type 3 secretion system (T3SS are not only virulence factors of pathogenic bacteria, but also influence symbiotic interactions between nitrogen-fixing nodule bacteria (rhizobia and leguminous host plants. In this study, we characterized NopM (nodulation outer protein M of Rhizobium sp. strain NGR234, which shows sequence similarities with novel E3 ubiquitin ligase (NEL domain effectors from the human pathogens Shigella flexneri and Salomonella enterica. NopM expressed in Escherichia coli, but not the non-functional mutant protein NopM-C338A, showed E3 ubiquitin ligase activity in vitro. In vivo, NopM, but not inactive NopM-C338A, promoted nodulation of the host plant Lablab purpureus by NGR234. When NopM was expressed in yeast, it inhibited mating pheromone signaling, a mitogen-activated protein (MAP kinase pathway. When expressed in the plant Nicotiana benthamiana, NopM inhibited one part of the plant's defense response, as shown by a reduced production of reactive oxygen species (ROS in response to the flagellin peptide flg22, whereas it stimulated another part, namely the induction of defense genes. In summary, our data indicate the potential for NopM as a functional NEL domain E3 ubiquitin ligase. Our findings that NopM dampened the flg22-induced ROS burst in N. benthamiana but promoted defense gene induction are consistent with the concept that pattern-triggered immunity is split in two separate signaling branches, one leading to ROS production and the other to defense gene induction.
Formation and evolution of ultrafine particles produced by radiolysis and photolysis
International Nuclear Information System (INIS)
Madelaine, G.J.; Perrin, M.L.; Renoux, A.
1980-01-01
Results are presented, concerning the formation, the size distribution, and the behavior of ultrafine particles produced by alpha disintegration of actinium and uv irradiation in filtered and natural atmospheric air. The characterization of these particles is obtained by electrical aerosol analyzer and diffusion battery method. Measurements are made in the range between 0.003 and 0.5 micrometer. Some qualitative indications are obtained on the different mechanisms which govern the evolution of ultrafine particles in the atmosphere (nucleation, coagulation, and condensation). It is now well established that the photo-oxydation of SO 2 in the atmosphere leads to the production of sulphuric acid and of sulphate, which are usually found in the form of submicronic particles. This paper concerns the evolution of ultrafine particles generated in the presence of a preexisting aerosol. They are either instantaneously produced by the alpha disintegrations of actinium 219 or continuously produced by the transformation of SO 2 under uv irradiation
Energy Technology Data Exchange (ETDEWEB)
Brown, Paul L. [Geochem Australia, Kiama, NSW (Australia); Ekberg, Christian [Chalmers Univ. of Technology, Goeteborg (Sweden). Nuclear Chemistry/Industrial Materials Recycling
2016-07-01
All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO{sub 2}OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH{sup 2+} for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.
Status of liquid metal reactor development in the United States of America
International Nuclear Information System (INIS)
Griffith, J.D.; Horton, K.E.
1991-01-01
An existing network of government and industry research facilities and engineering test centers in the United States is currently providing test capabilities and the technical expertise required to conduct an aggressive advanced reactor development program. Subsequent to the directive to shut down the Fast Flux Test Facility in early 1990, a variety of activities were undertaken to provide support for continued operation. The United States has made substantial progress in achieving ALMR program objectives. The metal fuel cycle is designed to recycle and burn its own actiniums, and has the potential to be a very effective burner of actiniums generated in the LWRs. The current emphasis in the IFR Program is on the comprehensive development of the IFR (Integral Fast Reactor) technology, to be followed by a period of technology demonstration which would verify the economic feasibility of the concept. The United States has been active in international cooperative activities in the fast reactor sector since 1969. (author). 11 figs, 1 tab
International Nuclear Information System (INIS)
Brown, Paul L.; Ekberg, Christian
2016-01-01
All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO 2 OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH 2+ for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.
Funakoshi, Natalie; Chaze, Iphigénie; Alary, Anne-Sophie; Tachon, Gaëlle; Cunat, Séverine; Giansily-Blaizot, Muriel; Bismuth, Michael; Larrey, Dominique; Pageaux, Georges-Philippe; Schved, Jean-François; Donnadieu-Rigole, Hélène; Blanc, Pierre; Aguilar-Martinez, Patricia
2016-05-01
Iron overload (IO) in HFE-related hereditary haemochromatosis is associated with increased risk of liver cancer. This study aimed to investigate the role of other genes involved in hereditary IO among patients with hepatocellular carcinoma (HCC). Patients with HCC diagnosed in our institution were included in this prospective study. Those with ferritin levels ≥300 μg/L (males) or ≥200 μg/L (females) and/or transferrin saturation ≥50% (males) or ≥45% (females) had liver iron concentration (LIC) evaluated by MRI. HFE C282Y and H63D mutations were screened. Genetic analyses of genes involved in hereditary IO (HFE, HJV/HFE2, HAMP, TFR2, SLC40A1, GNPAT) were performed in patients with increased LIC. A total of 234 patients were included; 215 (92%) had common acquired risk factors of HCC (mainly alcoholism or chronic viral hepatitis). 119 patients had abnormal iron parameters. Twelve (5.1%) were C282Y homozygotes, three were compound C282Y/H63D heterozygotes. LIC was measured by MRI in 100 patients. Thirteen patients with a LIC>70 μmol/g were enrolled in further genetic analyses: two unrelated patients bore the HAMP:c.-153C>T mutation at the heterozygous state, which is associated with increased risk of IO and severe haemochromatosis. Specific haplotypes of SLC40A1 were also studied. Additional genetic risk factors of IO were found in 18 patients (7.7%) among a large series of 234 HCC patients. Screening for IO and the associated at-risk genotypes in patients who have developed HCC, is useful for both determining etiologic diagnosis and enabling family screening and possibly primary prevention in relatives. © 2015 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.
International Nuclear Information System (INIS)
Lemaitre, Nolwenn
2017-01-01
The main objective of this thesis is to improve our understanding of the different controls that affect the oceanic biological carbon pump. Particulate export and remineralisation fluxes were investigated using the thorium-234 ( 234 Th) and biogenic barium (Baxs) proxies. In the North Atlantic, the highest particulate organic carbon (POC) export fluxes were associated to biogenic (biogenic silica or calcium carbonate) and lithogenic minerals, ballasting the particles. Export efficiency was generally low (≤ 10%) and inversely related to primary production, highlighting a phase lag between production and export. The highest transfer efficiencies, i.e. the fraction of POC that reached 400 m, were driven by sinking particles ballasted by calcite or lithogenic minerals. The regional variation of meso-pelagic remineralisation was attributed to changes in bloom intensity, phytoplankton cell size, community structure and physical forcing (down-welling). Carbon remineralisation balanced, or even exceeded, POC export, highlighting the impact of meso-pelagic remineralisation on the biological pump with a near-zero, deep carbon sequestration for spring 2014. Export of trace metals appeared strongly influenced by lithogenic material advected from the margins. However, at open ocean stations not influenced by lithogenic matter, trace metal export rather depended on phytoplankton activity and biomass. A last part of this work focused on export of biogenic silica, particulate nitrogen and iron near the Kerguelen Island. This area is characterized by a natural iron-fertilization that increases export fluxes. Inside the fertilized area, flux variability is related to phytoplankton community composition. (author)
DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS
Energy Technology Data Exchange (ETDEWEB)
P. Bernot
2005-07-13
The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this activity is to predict dissolved concentrations or solubility limits for elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) relevant to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are provided in the form of tabulated functions with pH and log fCO{sub 2} as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. Even though selection of an appropriate set of radionuclides documented in Radionuclide Screening (BSC 2002 [DIRS 160059]) includes actinium, transport of Ac is not modeled in the total system performance assessment for the license application (TSPA-LA) model because of its extremely short half-life. Actinium dose is calculated in the TSPA-LA by assuming secular equilibrium with {sup 231}Pa (Section 6.10); therefore, Ac is not analyzed in this report. The output data from this report are fundamental inputs for TSPA-LA used to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for the actinides discussed in this report. These models cover broad ranges of environmental conditions so they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or
DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS
International Nuclear Information System (INIS)
P. Bernot
2005-01-01
The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this activity is to predict dissolved concentrations or solubility limits for elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) relevant to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are provided in the form of tabulated functions with pH and log fCO 2 as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. Even though selection of an appropriate set of radionuclides documented in Radionuclide Screening (BSC 2002 [DIRS 160059]) includes actinium, transport of Ac is not modeled in the total system performance assessment for the license application (TSPA-LA) model because of its extremely short half-life. Actinium dose is calculated in the TSPA-LA by assuming secular equilibrium with 231 Pa (Section 6.10); therefore, Ac is not analyzed in this report. The output data from this report are fundamental inputs for TSPA-LA used to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for the actinides discussed in this report. These models cover broad ranges of environmental conditions so they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or otherwise
Kinetics of radioisotope exchange between brine and rock in a geothermal system
International Nuclear Information System (INIS)
Hammond, D.E.; Zukin, J.G.; Teh-Lung Ku
1988-01-01
A wide range of isotopes in the /sup 238/U, /sup 235/U, and /sup 232/Th decay chains was measured in geothermal brines collected from two production zones at 1898 and 3220 m in the Salton Sea Scientific Drilling Project well. High concentrations of radium, radon, and lead isotopes are generated and maintained by the input of these isotopes from solid phases into brine by both recoil and leaching processes, by the high chloride content of the brine which complexes radium and lead, and by the apparent absence of suitable unoccupied adsorption sites. In contrast, uranium, thorium, actinium, bismuth, and polonium isotopes all have low concentrations due to their efficient sorption from brine to rock. Measurements of short-lived isotopes in these decay series yield insights regarding the mechanisms controlling radioisotope exchange, and they permit estimation of rates of brine-rock interaction. For example, the /sup 228/Ac//sup 228/Ra activity ratio of 0.2 in brines indicates that the mean residence time of actinium in solution before sorption onto solid surfaces is less than 2.5 hours
Luna-Porres, M. Y.; Rodríguez-Villa, M. A.; Herrera-Peraza, E.; Cabral-Lares, M.; Renteria-Villalobos, M.; Montero-Cabrera, M. E.
2014-07-01
The Conchos River is one of the most important in northern Mexico and the main surface waterway in the arid state of Chihuahua. The Luis L. Leon dam produces the Luis L. Leon Reservoir, which is the last major reservoir before the Conchos River enters the Rio Grande at the Texas-Chihuahua border. Activity concentrations (AC) of 234,238U and 210Po in fillet and liver of three stocked fish species (Lepomis cyanellus, Cyprinus carpio and Ictalurus furcatus), as well as in water from the Luis L. Leon reservoir were determined. 238U and 234U ACs in fillet samples showed values of 0.007-0.014 and 0.01-0.02 Bq kg-1 wet weight (ww), respectively. Liver samples for Lepomis cyanellus, Cyprinus carpio and Ictalurus furcatus species, present 210Po AC of 1.16-3.26 0.70-1.13 and 0.93-1.37 Bqṡkg-1 ww. The elemental Bioaccumulation Factor (BAF) for fish tissues respect to their concentrations in water was determined. Lepomis cyanellus species showed the highest BAF for total uranium in fillet, with value 1.5. The annual effective dose for uranium in adults by fish consumption in this work ranged from 4.46×10-3 to 3.68×10-2 μSvṡyear-1. The difference in concentrations of uranium in fillet among the studied species is likely primarily due to their differences in diet and habitat.
234U/230Th ratio as an indicator of redox state, and U, Th and Ra behavior in briney aquifers
International Nuclear Information System (INIS)
Laul, J.C.; Smith, M.R.; Hubbard, N.
1985-06-01
The 234 U/ 230 Th ratio serves as an in-situ indicator of the redox state in groundwater aquifers. The higher this ratio, the more U there is in the +6 state and thus a lesser reducing environment. Radium is retarded in the shallow aquifer and its sorption is dependent on the CaSO 4 content and redox state. Relative to Ra, U and Th are highly sorbed. The total retardation factor for Th is approx.1400 and mean sorption time for 228 Th is approx.10 days in the shallow zone. The desorption rate of Ra is significantly slower in the shallow than in the deep aquifer. There is no effect of colloids in brines. 6 refs., 5 figs., 2 tabs
Photodissociation of C3H5Br and C4H7Br at 234 nm
International Nuclear Information System (INIS)
Kim, Hyun Kook; Paul, Dababrata; Hong, Ki Ryong; Cho, Ha Na; Kim, Tae Kyu; Lee, Kyoung Seok
2012-01-01
The photodissociation dynamics of cyclopropyl bromide (C-3H 5 Br) and cyclobutyl bromide (C 4 H 7 Br) at 234 nm was investigated. A two-dimensional photofragment ion-imaging technique coupled with a [2+1] resonance enhanced multiphoton ionization scheme was utilized to obtain speed and angular distributions of the nascent Br( 2 P 3/2 ) and Br*( 2 P 1/2 ) atoms. The recoil anisotropies for the Br and Br* channels were measured to be βBr = 0.92 ± 0.03 and βBr* = 1.52 ± 0.04 for C 3 H 5 Br and βBr = 1.10 ± 0.03 and βBr* = 1.49 ± 0.05 for C 4 H 7 Br. The relative quantum yield for Br was found to be ΦBr = 0.13 ± 0.03 and for C 3 H 5 Br and C 4 H 7 Br, respectively. The soft radical limit of the impulsive model adequately modeled the related energy partitioning. The nonadiabatic transition probability from the 3A' and 4A' potential energy surfaces was estimated and discussed
International Nuclear Information System (INIS)
Saari, Hanna-Kaisa; Schmidt, Sabine; Castaing, Patrice; Blanc, Gerard; Sautour, Benoit; Masson, Olivier; Cochran, J. Kirk
2010-01-01
The short-lived natural radionuclides 7 Be (T 1/2 = 53 days), 234 Th xs (T 1/2 = 24.1 days) and 210 Pb xs (T 1/2 = 22.3 years), i.e. 234 Th and 210 Pb in excesses of that supported within particles by the decay of their parent isotopes, were analysed in suspended particulate matter (SPM) to study the particle dynamics in the Gironde fluvial estuarine system (France), strongly impacted by heavy metal pollution. From surveys of this land-ocean interface in 2006 and 2007, we established a times series of these radioisotopes and of their activity ratios ( 7 Be/ 210 Pb xs and 234 Th/ 210 Pb xs ARs) in particles sampled under different hydrological conditions. The particulate 7 Be/ 210 Pb xs AR varies along the fluvial estuarine system mainly due to variations in 7 Be activities, controlled by riverine, oceanic and atmospheric inputs and by resuspension of old 7 Be-deficient sediments. These processes vary with river discharge, tidal cycle and season. Therefore, seasonal particle transport processes can be described using variations of the SPM 7 Be/ 210 Pb xs ARs. During high river discharge, the SPM 7 Be/ 210 Pb x ARs decrease from river to the ocean. The turbidity maximum zone (TMZ) is dispersed and the particles, and the associated contaminants, are rapidly transported from river to coastal waters, without significant retention within the TMZ. During low river discharge, the TMZ intrudes into the fluvial estuary, and the lowest 7 Be/ 210 Pb x ARs are observed there due to resuspension of 7 Be-deficient sediments. Away from the TMZ, from the middle to lower estuary, SPM 7 Be/ 210 Pb x ARs increase, indicating that the particles have been recently tagged with 7 Be. We explain this trend as being caused by marine input of dissolved radionuclides, as traced by SPM 234 Th/ 210 Pb xs ARs, followed by scavenging in the estuary. This result indicates that particle transport models based on 7 Be and trace-metal budgets must consider oceanic dissolved inputs as an additional
Olszewski, Grzegorz; Boryło, Alicja; Skwarzec, Bogdan
The aim of this study was to determine uranium concentrations in common nettle ( Urtica dioica ) plants and corresponding soils samples which were collected from the area of phosphogypsum stockpile in Wiślinka (northern Poland). The uranium concentrations in roots depended on its concentrations in soils. Calculated BCF and TF values showed that soils characteristics and air deposition affect uranium absorption and that different uranium species have different affinities to U . dioica plants. The values of 234 U/ 238 U activity ratio indicate natural origin of these radioisotopes in analyzed plants. Uranium concentration in plants roots is negatively weakly correlated with distance from phosphogypsum stockpile.
International Nuclear Information System (INIS)
Olszewski, Grzegorz; Borylo, Alicja; Skwarzec, Bogdan
2016-01-01
The aim of this study was to determine uranium concentrations in common nettle (Urtica dioica) plants and corresponding soils samples which were collected from the area of phosphogypsum stockpile in Wislinka (northern Poland). The uranium concentrations in roots depended on its concentrations in soils. Calculated BCF and TF values showed that soils characteristics and air deposition affect uranium absorption and that different uranium species have different affinities to U. dioica plants. The values of 234 U/ 238 U activity ratio indicate natural origin of these radioisotopes in analyzed plants. Uranium concentration in plants roots is negatively weakly correlated with distance from phosphogypsum stockpile. (author)
International Nuclear Information System (INIS)
Lira, Sabrina Lopes; Paiva, Mayara Rafaela Soares; Misso, Agatha Matos; Elias, Daniel Ricco; Yamagata, Chieko
2012-01-01
Lanthanum silicate oxyapatite materials are promising for application as electrolyte in solid oxide fuel cells because of high ionic conductivity at temperatures between 600 deg C and 800 deg C. In this work, oxyapatites with the composition La 9,56 (SiO 4 ) 6 O 2,34 , and La 9,8 Si 5,7 Mg 0,3 O 26,4 were synthesized by using the sol-gel method, followed by precipitation. Initially, the gel of silica was synthesized from sodium silicate solution, by acid catalysis using lanthanum and magnesium chloride solution. Then, the La and Mg hydroxides were precipitated with NaOH in the gel. The powders were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM) and measurements of specific surface area. The crystalline oxyapatite phase of La 9,56 (SiO 4 ) 6 O 2,34 , and was La 9,8 Si 5,7 Mg 0,3 O 26,4 obtained by calcination at 900 deg C for 2 and 1h respectively (author)
International Nuclear Information System (INIS)
Polikarpov, G.G.; Gulin, S.B.; Krivenko, O.V.; Stokozov, N.A.; Popovichev, V.N.
1994-01-01
The uranium-238 seawater concentrations were determined mass-spectrometrically and compared with several literature data, obtained in different time within the same Black Sea region. In all these cases the 238 U activity did not deviate significantly from the level of 1,5 dpm ·1 -1 .The total surface phytoplankton biomass was about 2089 mg · m -3 in February, 465 in August and 502 in autumn 1992.Our results of three different seasons sampling have generally shown the presence of significant disequilibria of uranium-238 and total thorium-234 in the upper water column. It was largest in October and least in early February, although the largest total phytoplankton and heavy diatoms biomass were obtained in winter
Safety analysis on Non-LOCA events for the revision of Wolsong NPP unit 2,3,4 sar
International Nuclear Information System (INIS)
Kim, Jong Hyun; Jin, Dong Sik; Ryu, Eui Seung; Kho, Dong Wook; Kim, Sung Min
2015-01-01
Korean Wolsong Nuclear Power Plant Units 2,3,4 (CANDU-6 Type) has prepared the revision of safety analysis report (Final Safety Analysis Report (FSAR) chapter 15) from the original performed in the year of 1990s, using the updated and state-of-the-art methodology and tools including IST safety analysis codes and more detail modelling. Compared with the original FSAR15, the revised FSAR15 has significant improvement in both the scope and the depth of safety analysis, which has demonstrated the safety analysis results have complied with the safety requirements(acceptance criteria). This paper will present the analysis scope for Non-LOCA events re-analyzed or added for the FSAR15 revision, methodologies applied such as codes and modelling and some important analysis results will be demonstrated with comparison to acceptance criteria. Application of more detail and near-realistic assumptions and method including Dev-PDO options and uncertainty related to the CHF correlations has altogether brought about more safety margin compared with the original FSAR15 with respect to SDS trip effectiveness etc. (author)
International Nuclear Information System (INIS)
Lima, M.F.
1992-01-01
The distribution coefficients (K α) were determined in order to foresee the fate of the radionuclides discharged to the environment. Based upon the source-term released by IPEN's facilities in Pinheiros River during the year of 1988, three radionuclides were chosen as being the more critical, according to the radiation protection standards: 137 Cs, 60 Co and 232 Th. Their K α were determined experimentally in laboratory by using the corresponding radioactive tracers 134 Cs, 60 Co and 234 Th. Three different experimental methodologies were used: the static method, the shaken method and the dynamic method. The parameters studied were the effects of pH, aerobic condition and time of contact. The results obtained experimentally for the Kds confirm the predictions that: the cesium is slowly retained by the sediment along the Pinheiros River, the cobalt is an unstable element, therefore its retention by the sediment is affected by variations in the pH values, and finally, the thorium is almost completely retained in the vicinity of the discharge point. (author)
Fission cross section ratios for 233,234,236U relative to 235U from 0.5 to 400 MeV
International Nuclear Information System (INIS)
Lisowski, P.W.; Gavron, A.; Parker, W.E.; Balestrini, S.J.; Carlson, A.D.; Wasson, O.A.; Hill, N.W.
1991-01-01
Neutron-induced fission cross section ratios from 0.5 to 400 MeV for samples of 233, 234, 236 U relative to 235 U have been measured at the WNR neutron Source at Los Alamos. The fission reaction rate was determined using a fast parallel plate ionization chamber at a 20-m flight path. Cross sections over most the energy range were also extracted using the neutron fluence determined with three different proton telescope arrangements. Those data provided the shape of the 235 U(n,f) cross section relative to the hydrogen scattering cross section. That shape was then normalized to the very accurately known value for 235 U(n,f) at 14.1 MeV to allow us to obtain cross section section values from the ratio data and our values for 235 U(n,f). 6 refs., 1 fig
Fission cross section ratios for 233,234,236U relative to 235U from 0.5 to 400 MeV
International Nuclear Information System (INIS)
Lisowski, P.W.; Gavron, A.; Parker, W.E.; Balestrini, S.J.; Carlson, A.D.; Wasson, O.A.; Hill, N.W.
1992-01-01
Neutron-induced fission cross section ratios from 0.5 to 400 MeV for samples of 233,234,236 U relative to 235 U have been measured at the WNR neutron Source at Los Alamos. The fission reaction rate was determined using a fast parallel plate ionization chamber at a 20-m flight path. Cross sections over most of the energy range were also extracted using the neutron fluence determined with three different proton telescope arrangements. Those data provided the shape of the 235 U(n, f) cross section relative to the hydrogen scattering cross section. That shape was then normalized to the very accurately known value for 235 U(n, f) at 14.1 MeV which will allow us to obtain cross section values from the ratio data and our values for 235 U(n, f). (orig.)
LASL experience in decontamination of the environment
International Nuclear Information System (INIS)
Ahlquist, A.J.
1981-01-01
This discussion represents one part of a major effort in soil decontamination at the Los Alamos site. A contaminated industrial waste line in the Los Alamos townsite was removed, and a plutonium incineration facility, and a filter building contaminated with actinium-227 were dismantled. The former plutonium handling facility has been decontaminated, and canyons and an old firing site contaminated with strontium-90 have been surveyed
Determination of radionuclides in discharged water from gold ...
African Journals Online (AJOL)
Long-lived radionuclides from the Uranium-, Thorium- and Actinium-decay chains in the discharged water into the environment were radiochemically separated and the activity concentrations determined for 238U-series ranged from 3.8 ± 1.5 to 178 ± 19 mBqL-1, 232Th-series ranged from < 2.0 to 47.8 ± 7.3 mBqL-1 and ...
Energy Technology Data Exchange (ETDEWEB)
1962-08-01
On Saturday morning, April 7, 1962, at about 1059 Armed Forces time, an accidental nuclear excursion occurred in the plutonium waste recovery facility (Recuplex) of the 234-5 Building. This excursion did not result in any mechanical damage or spread of contamination. Three employees of the General Electric Company received overexposures to gamma and neutron radiation. None were fatally exposed; in each case the overexposure was recognized promptly, and following medical observation and testing the men were released to return to work. In compliance with AEC Manual Chapter 0703, an AEC-HAPO committee composed of two AEC employees and five General Electric employees was appointed by the Manger, HOO, with the concurrence of the General Manager, HAPO, to conduct an investigation of the incident. The committee`s purpose was to determine the cause, nature, and extent of the incident, and recommend action to be taken by others to minimize or preclude future incidents of this magnitude. A study of operating practices and operating conditions that appeared to exist prior to, during, and subsequent to the accident was made by the committee. The committee believes that this report provides sufficient information to answer questions which may arise as a result of the criticality incident except those relating to its cause.
International Nuclear Information System (INIS)
Slovinskij, B.; Mulas, Eh.
1981-01-01
The energy spectra of protons (ESP) emitted in reactions p+Xe→kp+... at 2.34 GeV/c (k=1-9) and π - +Xe→kp+... at 9 GeV/c (k=1-17) have been studied. An evidence has been obtained for a unified description of those spectra by an exponential dependence of the invariant cross sections upon the kinetic energy independently of the proton emission angle. It is found that the ESP temperature becomes independent of the proton emission frequency when the energy of the interaction induced hadron is greater than approximately 3 GeV [ru
International Nuclear Information System (INIS)
Costa Lauria, D. da.
1986-01-01
A sequential analytical method for the determination of U-238, U-234, Th-232, Th-230, Th-228, Ra-226 and Ra-228 in environmental samples and applied to the analysis of mineral waters is studied. Thorium isotopes are coprecipitated with lanthanium fluoride before counting in alpha spectrometer, the uranium isotopes are determined by alpha spectrometry following extraction with TOPO onto a polymenic membrane. Radium-226 is determined with the radom emanation technique. (M.J.C.) [pt
230Th and 234Th as coupled tracers of particle cycling in the ocean: A maximum likelihood approach
Wang, Wei-Lei; Armstrong, Robert A.; Cochran, J. Kirk; Heilbrun, Christina
2016-05-01
We applied maximum likelihood estimation to measurements of Th isotopes (234,230Th) in Mediterranean Sea sediment traps that separated particles according to settling velocity. This study contains two unique aspects. First, it relies on settling velocities that were measured using sediment traps, rather than on measured particle sizes and an assumed relationship between particle size and sinking velocity. Second, because of the labor and expense involved in obtaining these data, they were obtained at only a few depths, and their analysis required constructing a new type of box-like model, which we refer to as a "two-layer" model, that we then analyzed using likelihood techniques. Likelihood techniques were developed in the 1930s by statisticians, and form the computational core of both Bayesian and non-Bayesian statistics. Their use has recently become very popular in ecology, but they are relatively unknown in geochemistry. Our model was formulated by assuming steady state and first-order reaction kinetics for thorium adsorption and desorption, and for particle aggregation, disaggregation, and remineralization. We adopted a cutoff settling velocity (49 m/d) from Armstrong et al. (2009) to separate particles into fast- and slow-sinking classes. A unique set of parameters with no dependence on prior values was obtained. Adsorption rate constants for both slow- and fast-sinking particles are slightly higher in the upper layer than in the lower layer. Slow-sinking particles have higher adsorption rate constants than fast-sinking particles. Desorption rate constants are higher in the lower layer (slow-sinking particles: 13.17 ± 1.61, fast-sinking particles: 13.96 ± 0.48) than in the upper layer (slow-sinking particles: 7.87 ± 0.60 y-1, fast-sinking particles: 1.81 ± 0.44 y-1). Aggregation rate constants were higher, 1.88 ± 0.04, in the upper layer and just 0.07 ± 0.01 y-1 in the lower layer. Disaggregation rate constants were just 0.30 ± 0.10 y-1 in the upper
Directory of Open Access Journals (Sweden)
Mai T Q Le
2008-10-01
Full Text Available Prior to 2007, highly pathogenic avian influenza (HPAI H5N1 viruses isolated from poultry and humans in Vietnam were consistently reported to be clade 1 viruses, susceptible to oseltamivir but resistant to amantadine. Here we describe the re-emergence of human HPAI H5N1 virus infections in Vietnam in 2007 and the characteristics of the isolated viruses.Respiratory specimens from patients suspected to be infected with avian influenza in 2007 were screened by influenza and H5 subtype specific polymerase chain reaction. Isolated H5N1 strains were further characterized by genome sequencing and drug susceptibility testing. Eleven poultry outbreak isolates from 2007 were included in the sequence analysis. Eight patients, all of them from northern Vietnam, were diagnosed with H5N1 in 2007 and five of them died. Phylogenetic analysis of H5N1 viruses isolated from humans and poultry in 2007 showed that clade 2.3.4 H5N1 viruses replaced clade 1 viruses in northern Vietnam. Four human H5N1 strains had eight-fold reduced in-vitro susceptibility to oseltamivir as compared to clade 1 viruses. In two poultry isolates the I117V mutation was found in the neuraminidase gene, which is associated with reduced susceptibility to oseltamivir. No mutations in the M2 gene conferring amantadine resistance were found.In 2007, H5N1 clade 2.3.4 viruses replaced clade 1 viruses in northern Vietnam and were susceptible to amantadine but showed reduced susceptibility to oseltamivir. Combination antiviral therapy with oseltamivir and amantadine for human cases in Vietnam is recommended.
International Nuclear Information System (INIS)
Oliveira, Roges de; Lopes, Ricardo T.; Melo, Dunstana R.; Juliao, Ligia M.Q.C.
2005-01-01
The object of this study consists of an open mine from which Niobium ore (pyrochlore) is extracted and a metallurgy company, where Fe-Nb alloys are produced for export. For geological reasons, the main ore is associated to natural radionuclides U and Th, and its decay products. The concentration of 234 U, 238 U, 232 Th, 226 Ra and 228 Ra, 228 Th, including 210 Pb in fecal excretion of 12:0 am, 29 workers and 13 family members were determined. The technique employed for the determination of the elements was the sequential method of radiochemical separation, followed by alpha spectrometry and counting α and β in proportional detector. Statistically significant difference was observed in the concentration of 234 U and 238 U, in feces samples, among the group of mining workers and family members; as well as for 232 Th in the feces of workers of crushing and metallurgy groups when compared with the Family Group. No statistically significant difference was detected at a concentration of 226 Ra, 228 Ra and 210 Pb, in feces of any group of workers of the installation in relation to the family group
International Nuclear Information System (INIS)
Briel, L.I.
1976-01-01
Typical surface water masses in the Santa Fe basin are characterized by a 238 U concentration of 0.224 +- .014 ppB and a 234 U/ 238 U activity ratio of 1.081 +- .038. The Floridan aquifer in this area is represented by at least two distinct regimes of ground water. The effluent from the Poe Springs group has a nominal uranium concentration of 0.938 +- .014 ppB and an activity ratio of 0.900 +- .012, while the effluent from the Ichetucknee Springs group has a nominal uranium concentration of 0.558 +- .018 ppB and an activity ratio of 0.707 +- .022. The effluent from ten additional springs in the Santa Fe system can be represented by hypothetical mixtures of these two ground water regimes and a hypothetical surface water component, which may reflect the extent of local recharge to the aquifer in different parts of the basin
Marsh, Dylan T; Das, Sukanya; Ridell, Jessica; Smid, Scott D
2017-07-15
Naturally-occurring flavonoids have well documented anti-aggregatory and neuroprotective properties against the hallmark toxic protein in Alzheimer's disease, amyloid β (Aβ). However the extensive diversity of flavonoids has limited the insight into the precise structure-activity relationships that confer such bioactive properties against the Aβ protein. In the present study we have characterised the Aβ binding properties, anti-aggregatory and neuroprotective effects of a discreet set of flavones, including the recently described novel protein sumoylation inhibitor 2',3',4'-trihydroxyflavone (2-D08). Quercetin, transilitin, jaceosidin, nobiletin and 2-D08 were incubated with human Aβ 1-42 for 48h in vitro and effects on Aβ fibrillisation kinetics and morphology measured using Thioflavin T (ThT) and electron microscopy respectively, in addition to effects on neuronal PC12 cell viability. Of the flavones studied, only quercetin, transilitin and 2-D08 significantly inhibited Aβ 1-42 aggregation and toxicity in PC12 cells. Of those, 2-D08 was the most effective inhibitor. The strong anti-amyloid activity of 2-D08 indicates that extensive hydroxylation in the B ring is the most important determinant of activity against β amyloid within the flavone scaffold. The lack of efficacy of jaceosidin and nobiletin indicate that extension of B ring hydroxylation with methoxyl groups result in an incremental loss of anti-fibrillar and neuroprotective activity, highlighting the constraint to vicinal hydroxyl groups in the B ring for effective inhibition of aggregation. These findings reveal further structural insights into anti-amyloid bioactivity of flavonoids in addition to a novel and efficacious anti-aggregatory and neuroprotective effect of the semi-synthetic flavone and sumoylation inhibitor 2',3',4'-trihydroxyflavone (2-D08). Such modified flavones may facilitate drug development targeting multiple pathways in neurodegenerative disease. Crown Copyright © 2017
An aerial radiological survey of the Sandia National Laboratories and surrounding area
International Nuclear Information System (INIS)
Riedhauser, S.R.
1994-06-01
A team from the Remote Sensing Laboratory conducted an aerial radiological survey of the area surrounding the Sandia National Laboratories and Kirtland Air Force Base in Albuquerque, New Mexico, during March and April 1993. The survey team measured the terrestrial gamma radiation at the site to determine the levels of natural and man-made radiation. This survey includes the areas covered by a previous survey in 1981. The results of the aerial survey show a background exposure rate which varies between 5 and 18 μR/h plus an approximate 6 μR/h contribution from cosmic rays. The major radioactive isotopes found in this survey were: potassium-40, thallium-208, bismuth-214, and actinium-228, which are all naturally-occurring isotopes, and cobalt-60, cesium-137, and excess amounts of thallium-208 and actinium-228, which are due to human actions in the survey area. In regions away from man-made activity, the exposure rates inferred from this survey's gamma ray measurements agree almost exactly with the exposure rates inferred from the 1981 survey. In addition to the aerial measurements, another survey team conducted in situ and soil sample radiation measurements at three sites within the survey perimeter. These ground-based measurements agree with the aerial measurements within ± 5%
Alio, Jorge L; Al-Shymali, Olena; Amesty, Maria A; Rodriguez, Alejandra E
2018-06-01
To report the complications observed in a consecutive large series of cases treated with keratopigmentation (KTP). KTP was performed in 234 eyes of 204 patients for therapeutic and cosmetic reasons. From them, 50 eyes of 29 patients suffered complications. Different KTP techniques and three generations of pigments (GP) were used. The follow-up period ranged from 4 months to 12 years. Light sensitivity (LS), visual field (VF) limitations and MRI alterations were considered functional complications. Organic complications were described as change in colour, colour fading and neovascularisation. The percentage of complications was 12.82%. Most patients complained of LS (49%), then colour fading and change in colour (19%). Neovascularisation, VF limitations and MRI complications constituted 7%, 4% and 2%, respectively. Organic complications were observed with the previous GP but resolved with the latest third GP with CE mark certification (Conformité Européene). Although LS remained with the corneal-specific pigments, it gradually disappeared in most of the patients (81.81%) 6 months postoperatively. To the best of our knowledge this is the first time a study systematically and comprehensively approaches and reports KTP complications. KTP with third GP provides better results and fewer complications than previous ones. It is a modern, minimally invasive technique that helps solve several functional ocular problems and improves cosmetic appearance of the patients. Dermatological pigments should not be used as they lead to complications; instead pigments specifically tested for the eye in terms of toxicity and teratogenicity should be used. © Article author(s) (or their employer(s) unless otherwise stated in the text of the article) 2018. All rights reserved. No commercial use is permitted unless otherwise expressly granted.
Energy Technology Data Exchange (ETDEWEB)
Lira, Sabrina Lopes; Paiva, Mayara Rafaela Soares; Misso, Agatha Matos; Elias, Daniel Ricco; Yamagata, Chieko, E-mail: yamagata@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (CCTM/IPEN/CNEN-SP), Sao Paulo, SP (Brazil). Centro de Ciencia e Tecnologia de Materiais
2012-07-01
Lanthanum silicate oxyapatite materials are promising for application as electrolyte in solid oxide fuel cells because of high ionic conductivity at temperatures between 600 deg C and 800 deg C. In this work, oxyapatites with the composition La{sub 9,56}(SiO{sub 4}){sub 6}O{sub 2,34}, and La{sub 9,8}Si{sub 5,7}Mg{sub 0,3}O{sub 26,4} were synthesized by using the sol-gel method, followed by precipitation. Initially, the gel of silica was synthesized from sodium silicate solution, by acid catalysis using lanthanum and magnesium chloride solution. Then, the La and Mg hydroxides were precipitated with NaOH in the gel. The powders were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM) and measurements of specific surface area. The crystalline oxyapatite phase of La{sub 9,56}(SiO{sub 4}){sub 6}O{sub 2,34}, and was La{sub 9,8}Si{sub 5,7}Mg{sub 0,3}O{sub 26,4} obtained by calcination at 900 deg C for 2 and 1h respectively (author)
A search for nonnucleonic degrees of freedom by means of πXe interactions at 2.34 and 3.5 GeV/c
International Nuclear Information System (INIS)
Slowinski, B.
1999-01-01
The experimental data concerning the peripheral interactions of π mesons with xenon nuclei at 2.34 and 3.5 GeV/c [1] are reanalysed in order to search for a nonnucleonic intranuclear target, which may appear in these interactions. Since such interactions are predominantly one-step intranuclear collisions (or, otherwise, the so-called quasi-free collisions) only, therefore a possible correlation between the measured emission angles θ π and total energies E π of π mesons produced in these interactions, and, in particular, in quasi-two-body channels, may give information about the intranuclear target's mass [1]. Our results presented in the form of two-dimensional scatter plots (θ π vs. E π ) show a clear concentration of experimental points around the kinetic curve corresponding to the intranuclear target of pion's rest mass [2]. Background effects, which may simulate the observed correlation, are also discussed
Fission cross section ratios for sup 233,234,236 U relative to sup 235 U from 0. 5 to 400 MeV
Energy Technology Data Exchange (ETDEWEB)
Lisowski, P.W.; Gavron, A.; Parker, W.E.; Balestrini, S.J. (Los Alamos National Lab., NM (USA)); Carlson, A.D.; Wasson, O.A. (National Inst. of Standards and Technology, Gaithersburg, MD (USA)); Hill, N.W. (Oak Ridge National Lab., TN (USA))
1991-01-01
Neutron-induced fission cross section ratios from 0.5 to 400 MeV for samples of {sup 233, 234, 236}U relative to {sup 235}U have been measured at the WNR neutron Source at Los Alamos. The fission reaction rate was determined using a fast parallel plate ionization chamber at a 20-m flight path. Cross sections over most the energy range were also extracted using the neutron fluence determined with three different proton telescope arrangements. Those data provided the shape of the {sup 235}U(n,f) cross section relative to the hydrogen scattering cross section. That shape was then normalized to the very accurately known value for {sup 235}U(n,f) at 14.1 MeV to allow us to obtain cross section section values from the ratio data and our values for {sup 235}U(n,f). 6 refs., 1 fig.
Directory of Open Access Journals (Sweden)
P.V. Chalapathi
2014-12-01
Full Text Available A new catalytic and kinetic spectrophotometric method for the determination of vanadium(V was studied using 2,3,4-trihydroxyacetophenonephenylhydrazone (THAPPH as an analytical reagent. The present method was developed on the catalytic effect of vanadium on oxidation of THAPPH by hydrogen peroxide in hydrochloric acid–potassium chloride buffer (pH = 2.8 at the 20th minute. The metal ion has formed 1:2 (M:L complex with THAPPH. Beer’s law was obeyed in the range 20–120 ng/mL of V(V at λmax 390 nm. The sensitivity of the method was calculated in terms of molar absorptivity (1.999 × 105 L mol−1cm−1 and Sandell’s sensitivity (0.000254 μg cm−2, shows that this method is more sensitive. The standard deviation (0.0022, relative standard deviation (0.56%, confidence limit (±0.0015 and standard error (0.0007 revealed that the developed method has more precision and accuracy. The stability constant was calculated with the help of Asmu’s (9.411 × 10−11 and Edmond’s & Birnbaum’s (9.504 × 10−11 methods at room temperature. The interfering effect of various cations and anions was also studied. The present method was successfully applied for the determination of vanadium(V in environmental and alloy samples. The method’s validity was checked by comparing the results obtained with atomic-absorption spectrophotometry and also by evaluation of results using F-test.
International Nuclear Information System (INIS)
Venchiarutti, C.; Richter, S.; Jakopic, R.; Aregbe, Y.; Varga, Z.; Nicholl, A.; Krajko, J.; Mayer, K.
2016-01-01
The IRMM-1000a and IRMM-1000b uranium reference materials, of 20 and 50 mg uranium, respectively, were produced by the European Commission Joint Research Centre's Institute for Reference Materials and Measurements (EC-JRC-IRMM) in collaboration with the Institute for Transuranium Elements (EC-JRC-ITU). They are novel uranium reference materials certified for the production date based on the 230 Th/ 234 U radiochronometer, i.e. the date of the last chemical separation of these two radionuclides. The certified reference value and its uncertainty, homogeneity and stability of the material were established in accordance with the ISO Guide 34:2009 and the 'Guide to the Expression of Uncertainty in Measurement'. (author)
International Nuclear Information System (INIS)
Boenig, H.J.; Rogers, J.D.; McLelland, G.R.; Pelts, C.T.
1989-01-01
A 1430 MVA steam turbine generator was acquired from a cancelled nuclear power plant in Tennessee to be used as the pulsed power and energy storage unit for the Confinement Physics Research Facility being built at Los Alamos, NM. The transportation from Hartsville, near Nashville, TN, to Los Alamos, NM, of the two largest single pieces of the generator, a 451 t stator and a 234 t rotor presented a special challenge. Details of the move, by barge from Hartsville to Catoosa, near Tulsa, OK, by rail from Catoosa to Lamy, near Santa Fe, NM, and by road from Lamy to Los Alamos are described. The greatest difficulty of the successful move was the crossing of the Rio Grande river on an existing reinforced concrete bridge. The two-lane wide road transporters for the stator and rotor were fitted with outriggers to provide a four-lane wide vehicle, thus spreading the load over the entire bridge width and meeting acceptable load distribution and bridge safety factors. 2 refs., 6 figs
Energy Technology Data Exchange (ETDEWEB)
Zarins, E; Kokars, V; Utinans, M, E-mail: elmix2003@inbox.lv [Institute of Applied Chemistry, Riga Technical University, 14/24 Azenes Str., Riga LV-1048 (Latvia)
2011-06-23
In this work we present a simply obtainable compound 2-(3-(4-(bis(2-(trityloxy)ethyl)amino)styryl)-5, 5-dimethylcyclohex-2-enylidene)malononitrile (IWK) capable of forming a thin solid amorphous film from volatile organic solvents (chloroform and dichloromethane). The synthesized glassy compound IWK absorption band is between 450 nm to 550 nm. It absorption maximums show small batochromic shift going from less polar to polar solvents. Compound IWK is also characterized with intensive photoluminescence, which maximum is dependant on solvent and is between 600 nm to 675 nm. The electron system of molecules were investigated with semi-empirical method ZINDO/S and show, that IWK type molecule chromophore fragment geometrical, electronic, and optical properties are not influenced by N-alkyl substituents.
Zvizdic, Davor; Veliki, Tomislav; Grgec Bermanec, Lovorka
2008-06-01
This article describes the realization of the International Temperature Scale in the range from 234.3 K (mercury triple point) to 1084.62°C (copper freezing point) at the Laboratory for Process Measurement (LPM), Faculty of Mechanical Engineering and Naval Architecture (FSB), University of Zagreb. The system for the realization of the ITS-90 consists of the sealed fixed-point cells (mercury triple point, water triple point and gallium melting point) and the apparatus designed for the optimal realization of open fixed-point cells which include the gallium melting point, tin freezing point, zinc freezing point, aluminum freezing point, and copper freezing point. The maintenance of the open fixed-point cells is described, including the system for filling the cells with pure argon and for maintaining the pressure during the realization.
International Nuclear Information System (INIS)
Kromphorn, G.
1996-02-01
Different materials containing urandium are regularly investigated in the Laboratory for Environmental Radioactivity of the Physikalisch-Technische Bundesanstalt (PTB) with respect to the activity of the uranium isotopes ( 234 U, 235 U, and 238 U). Moreover for reasons of quality assurance, the PTB takes part in international comparisons where also uranium contents are to be determined in environmental samples and in the framework of which reference materials can be certified. Finally in national comparisons the PTB has the task to determine values of the specific activity for the different isotopes which can play the role of nominal (orientation) values. The single steps of uranium analyses are described after a compilation of the most important data of the uranium isotopes contained in natural uranium: The use of 232 U as tracer, the chemical separation analytics, the production of α-sources and the measuring methods. Analyses of a soil sample and a waste water sample with respect to their specific uranium activity have been chosen as examples of a practical application. (orig.) [de
Luna-Porres, Mayra Y; Rodríguez-Villa, Marco A; Herrera-Peraza, Eduardo F; Renteria-Villalobos, Marusia; Montero-Cabrera, María E
2014-06-25
Concentrations of As, Cu, Fe, Hg, Pb and Zn and activity concentrations from 234,238U and 210Po in water, fillet, liver and gills were determined in three stocked fish species from the Luis L. Leon reservoir, located in Northern Mexico. The considered species were Lepomis cyanellus, Cyprinus carpio and Ictalurus furcatus. 238U and 234U activity concentration (AC) in fillet samples showed values of 0.007-0.014 and 0.01-0.02 Bq∙kg-1 wet weight (ww), respectively. Liver samples for L. cyanellus, C. carpio and I. furcatus present 210Po AC of 1.16-3.26, 0.70-1.13 and 0.93-1.37 Bq∙kg-1 ww. Arsenic, mercury and lead concentration intervals in fillet samples were 0.13-0.39, 0.005-0.126 and 0.009-0.08 mg∙kg-1 ww, respectively, while in gill samples they were 0.11-0.43, 0.002-0.039 and 0.02-0.26 mg∙kg-1 ww. The elemental Bioaccumulation Factor (BAF) for fish tissues with respect to their concentrations in water was determined. L. cyanellus showed the highest BAF values for As and total U, being BAFAs = 37 and 40 L∙kg-1 in fillet and gills, respectively, and BAFU total = 1.5 L∙kg-1 in fillet. I. furcatus showed the highest BAF values for Hg and Pb, being BAFHg = 40 and 13 L∙kg-1 in fillet and gills, and BAFPb = 6.5 and 22 L∙kg-1 in fillet and gills, respectively. Some metal(loid) concentrations are slightly higher than European regulations for fish fillets. The difference in concentrations of metal(loid)s in fillet among the studied species is probably due to their differences in diet and habitat.
Directory of Open Access Journals (Sweden)
Mayra Y. Luna-Porres
2014-06-01
Full Text Available Concentrations of As, Cu, Fe, Hg, Pb and Zn and activity concentrations from 234,238U and 210Po in water, fillet, liver and gills were determined in three stocked fish species from the Luis L. Leon reservoir, located in Northern Mexico. The considered species were Lepomis cyanellus, Cyprinus carpio and Ictalurus furcatus. 238U and 234U activity concentration (AC in fillet samples showed values of 0.007–0.014 and 0.01–0.02 Bq∙kg−1 wet weight (ww, respectively. Liver samples for L. cyanellus, C. carpio and I. furcatus present 210Po AC of 1.16–3.26, 0.70–1.13 and 0.93–1.37 Bq∙kg−1 ww. Arsenic, mercury and lead concentration intervals in fillet samples were 0.13–0.39, 0.005–0.126 and 0.009–0.08 mg∙kg−1 ww, respectively, while in gill samples they were 0.11–0.43, 0.002–0.039 and 0.02–0.26 mg∙kg−1 ww. The elemental Bioaccumulation Factor (BAF for fish tissues with respect to their concentrations in water was determined. L. cyanellus showed the highest BAF values for As and total U, being BAFAs = 37 and 40 L∙kg−1 in fillet and gills, respectively, and BAFU total = 1.5 L∙kg−1 in fillet. I. furcatus showed the highest BAF values for Hg and Pb, being BAFHg = 40 and 13 L∙kg−1 in fillet and gills, and BAFPb = 6.5 and 22 L∙kg−1 in fillet and gills, respectively. Some metal(loid concentrations are slightly higher than European regulations for fish fillets. The difference in concentrations of metal(loids in fillet among the studied species is probably due to their differences in diet and habitat.
Alpha-emitting isotopes and chromium in a coastal California aquifer
Densmore, Jill N.; Izbicki, John A.; Murtaugh, Joseph M.; Swarzenski, Peter W.; Bullen, Thomas D.
2014-01-01
The unadjusted 72-h gross alpha activities in water from two wells completed in marine and alluvial deposits in a coastal southern California aquifer 40 km north of San Diego were 15 and 25 picoCuries per liter (pCi/L). Although activities were below the Maximum Contaminant Level (MCL) of 15 pCi/L, when adjusted for uranium activity; there is concern that new wells in the area may exceed MCLs, or that future regulations may limit water use from the wells. Coupled well-bore flow and depth-dependent water-quality data collected from the wells in 2011 (with analyses for isotopes within the uranium, actinium, and thorium decay-chains) show gross alpha activity in marine deposits is associated with decay of naturally-occurring 238U and its daughter 234U. Radon activities in marine deposits were as high as 2230 pCi/L. In contrast, gross alpha activities in overlying alluvium within the Piedra de Lumbre watershed, eroded from the nearby San Onofre Hills, were associated with decay of 232Th, including its daughter 224Ra. Radon activities in alluvium from Piedra de Lumbre of 450 pCi/L were lower than in marine deposits. Chromium VI concentrations in marine deposits were less than the California MCL of 10 μg/L (effective July 1, 2014) but δ53Cr compositions were near zero and within reported ranges for anthropogenic chromium. Alluvial deposits from the nearby Las Flores watershed, which drains a larger area having diverse geology, has low alpha activities and chromium as a result of geologic and geochemical conditions and may be more promising for future water-supply development.
An aerial radiological survey of the Nevada Test Site
International Nuclear Information System (INIS)
Hendricks, T.J.; Riedhauser, S.R.
1999-01-01
A team from the Remote Sensing Laboratory conducted an aerial radiological survey of the US Department of Energy's Nevada Test Site including three neighboring areas during August and September 1994. The survey team measured the terrestrial gamma radiation at the Nevada Test Site to determine the levels of natural and man-made radiation. This survey included the areas covered by previous surveys conducted from 1962 through 1993. The results of the aerial survey showed a terrestrial background exposure rate that varied from less than 6 microroentgens per hour (mR/h) to 50 mR/h plus a cosmic-ray contribution that varied from 4.5 mR/h at an elevation of 900 meters (3,000 feet) to 8.5 mR/h at 2,400 meters (8,000 feet). In addition to the principal gamma-emitting, naturally occurring isotopes (potassium-40, thallium-208, bismuth-214, and actinium-228), the man-made radioactive isotopes found in this survey were cobalt-60, cesium-137, europium-152, protactinium-234m an indicator of depleted uranium, and americium-241, which are due to human actions in the survey area. Individual, site-wide plots of gross terrestrial exposure rate, man-made exposure rate, and americium-241 activity (approximating the distribution of all transuranic material) are presented. In addition, expanded plots of individual areas exhibiting these man-made contaminations are given. A comparison is made between the data from this survey and previous aerial radiological surveys of the Nevada Test Site. Some previous ground-based measurements are discussed and related to the aerial data. In regions away from man-made activity, the exposure rates inferred from the gamma-ray measurements collected during this survey agreed very well with the exposure rates inferred from previous aerial surveys
Byrnes, Matthew J; Chisholm, Malcolm H; Patmore, Nathan J
2005-12-12
The reactions between M2(O2CtBu)4, where M=Mo or W, and thienyl-3,4-dicarboxylic acid (0.5-1.5 equiv) in toluene proceed via a series of detectable intermediates to the compounds M8(O2CtBu)4(mu-SC4H2-3,4-{CO2}2)6, which are isolated as air-sensitive yellow (M=Mo) or red (M=W) powders and show parent molecular ions in their mass spectra (MALDI). The structure of the molybdenum complex was determined by single-crystal X-ray crystallography and shown to contain an unusual M8 polygon involving four Mo2 quadruply bonded units linked via the agency of the six 3,4-thienylcarboxylate groups. The structure has crystallographically imposed S4 symmetry and may be described in terms of a highly distorted tetrahedron of Mo2 units or a bisphenoid in which two Mo2 units are linked by a thienyldicarboxylate such that intramolecular Mo2...O bonding is present, while the other thienylcarboxylate bridges merely serve to link these two [Mo2]...[Mo2] units together. The color of the compounds arises from intense M2 delta-to-thienyl pi transitions and, in THF, the complexes are redox-active and show four successive quasi-reversible oxidation waves. The [M8]+ radical cations, generated by one-electron oxidation with AgPF6, are shown to be valence-trapped (class II) by UV-vis-near-IR and electron paramagnetic resonance spectroscopy. These results are supported by the electronic structure calculations on model compounds M8(O2CH)4(mu-SC4H2-3,4-{CO}2)6 employing density functional theory that reveal only a small splitting of the M2 delta manifold via mixing with the 3,4-thienylcarboxylate pi system.
Luna-Porres, Mayra Y.; Rodríguez-Villa, Marco A.; Herrera-Peraza, Eduardo F.; Renteria-Villalobos, Marusia; Montero-Cabrera, María E.
2014-01-01
Concentrations of As, Cu, Fe, Hg, Pb and Zn and activity concentrations from 234,238U and 210Po in water, fillet, liver and gills were determined in three stocked fish species from the Luis L. Leon reservoir, located in Northern Mexico. The considered species were Lepomis cyanellus, Cyprinus carpio and Ictalurus furcatus. 238U and 234U activity concentration (AC) in fillet samples showed values of 0.007–0.014 and 0.01–0.02 Bq∙kg−1 wet weight (ww), respectively. Liver samples for L. cyanellus, C. carpio and I. furcatus present 210Po AC of 1.16–3.26, 0.70–1.13 and 0.93–1.37 Bq∙kg−1 ww. Arsenic, mercury and lead concentration intervals in fillet samples were 0.13–0.39, 0.005–0.126 and 0.009–0.08 mg∙kg−1 ww, respectively, while in gill samples they were 0.11–0.43, 0.002–0.039 and 0.02–0.26 mg∙kg−1 ww. The elemental Bioaccumulation Factor (BAF) for fish tissues with respect to their concentrations in water was determined. L. cyanellus showed the highest BAF values for As and total U, being BAFAs = 37 and 40 L∙kg−1 in fillet and gills, respectively, and BAFU total = 1.5 L∙kg−1 in fillet. I. furcatus showed the highest BAF values for Hg and Pb, being BAFHg = 40 and 13 L∙kg−1 in fillet and gills, and BAFPb = 6.5 and 22 L∙kg−1 in fillet and gills, respectively. Some metal(loid) concentrations are slightly higher than European regulations for fish fillets. The difference in concentrations of metal(loid)s in fillet among the studied species is probably due to their differences in diet and habitat. PMID:24968208
International Nuclear Information System (INIS)
Deschamps, P.
2003-11-01
This thesis forms part of the geological investigations undertaken by the French agency for nuclear waste management, ANDRA, around the Meuse/Haute-Marne Underground Research Laboratory (URL) located in the Eastern part of the Paris Basin in order to evaluate the feasibility of high-level radioactive waste repository in deep argilite formations. The aim of the study is to examine the radionuclide migration in the deep Callovo-Oxfordian target argilite layer and its surrounding low- permeability Bathonian and Oxfordian limestone formations in order to assess the long term confining capacities of the sedimentary series. This study is based on measurement of radioactive disequilibria within U-series by Multiple- Collector Inductively Coupled Plasma Mass Spectrometry (MC-ICP-MS). The high precision and accuracy achieved allowed to demonstrate the 234 U/ 238 U radioactive equilibrium in the Callovo-Oxfordian argilites. This result shows the uranium immobility in the target formation and provides a strong evidence for the current chemical stability and closure of the system for uranium and most probably for the other actinides. This is a fundamental result with respect to the problematic of disposal of high level radioactive waste in deep geological formation since it provides a in situ indication of the confining capacities of the clayey target formation in the current settings. Conversely, ( 234 U/ 238 U) disequilibria are systematically observed within zones, located in the surrounding carbonate formations, that are characterized by pressure dissolution structures (stylolites or dissolution seams). These disequilibria provide evidence for a discrete uranium relocation during the last two million years in the vicinity of stylolitic structures. This is a surprising result since it is generally supposed that these deep, low permeability, compact formations behave as closed system at the time scale of the U-series. (author)
Energy Technology Data Exchange (ETDEWEB)
Harangozo, M; Toelgyessy, J; Lesny, J; Cik, G [Slovak Technical Univ., Bratislava (Slovakia). Fac. of Chemical Technology, Dept. of Environmental Science
1996-12-31
In this paper the activities of radium-226, actinium-228 and potassium-40 in fly ashes and building materials of Slovakia were determined. Different origin of coals combusted results in significant differences in specific activities of radium-226 and activities-228 of measured fly-ashes and building materials. The knowledge of the specific activity of selected nuclides contained in fly-ashes is, therefore, very important and in specific cases can indicate the possibilities of their further technological use. (J.K.) 1 tab., 3 refs.
A Radium-223 microgenerator from cyclotron-produced trace Actinium-227
International Nuclear Information System (INIS)
Abou, Diane S.; Pickett, Juile; Mattson, John E.; Thorek, Daniel L.J.
2017-01-01
The alpha particle emitter Radium-223 dichloride ("2"2"3RaCl_2) has recently been approved for treatment of late-stage bone metastatic prostate cancer. There is considerable interest in studying this new agent outside of the clinical setting, however the supply of "2"2"3Ra is limited and expensive. We have engineered a "2"2"3Ra microgenerator using traces of "2"2"7Ac previously generated from cyclotron-produced "2"2"5Ac. Radiochemically pure "2"2"3RaCl_2 was made, characterized, evaluated in vivo, and the source was recovered in high yield for regeneration of the microgenerator. - Highlights: • A "2"2"3Ra microgenerator was built using residual "2"2"7Ac from cyclotron-produced "2"2"5Ac. • Following "2"2"5Ac decay, the residual "2"2"7Ac was processed into pure "2"2"3Ra. • "2"2"7Ac and "2"2"7Th were recovered in high yield for a permanent supply of "2"2"3Ra. • Clinically supplied and generator-produced "2"2"3Ra have equivalent in vivo distribution. • Microdose column provides sufficient material for research use.
Energy Technology Data Exchange (ETDEWEB)
Colaianni, A. [Dipartimento di Geologia e Geofisica dell' Universita di Bari, Via Orabona, 4 - 70125 Bari (Italy); I.N.F.N. Sezione di Bari, Via G. Amendola, 173 - 70126 Bari (Italy); D' Erasmo, G. [Dipartimento Interateneo di Fisica dell' Universita di Bari, Via G. Amendola, 173 - 70126 Bari (Italy); I.N.F.N. Sezione di Bari, Via G. Amendola, 173 - 70126 Bari (Italy); Pantaleo, A., E-mail: pantaleo@ba.infn.i [I.N.F.N. Sezione di Bari, Via G. Amendola, 173 - 70126 Bari (Italy); Schiavulli, L. [Dipartimento Interateneo di Fisica dell' Universita di Bari, Via G. Amendola, 173 - 70126 Bari (Italy); I.N.F.N. Sezione di Bari, Via G. Amendola, 173 - 70126 Bari (Italy)
2011-02-15
A new laboratory for the spectroscopy of natural radioactivity with a good energy resolution is presented. It consists of two distinct parts equipped, respectively, the first one with a HpGe {gamma}-ray detector, whose setup has been already completed, and the second one with large area Silicon {alpha}-ray detectors and a radiochemical section for thin {alpha}-samples preparation, whose setup is yet in progress and will be the argument of a separate work. The {gamma}-ray spectrometer was calibrated by means of IAEA Reference Materials n. 312, 313, 314 and 375. A large difference from the predictions of secular equilibrium emerged between the activities of {sup 234}Th and {sup 230}Th in Materials n. 312, 313 and 314.
International Nuclear Information System (INIS)
Lulinski, Piotr; Maciejewska, Dorota
2011-01-01
The main objective of this paper was to examined the impact of synthetic reagents on morphology and recognition properties of 2-(3,4-dimethoxyphenyl)ethylamine imprinted polymers. The effect of nine different functional monomers, five porogens and four cross-linkers on the binding capacity of particles was analyzed. The results revealed that the highest imprinting factor (1.81) showed the polymer obtained from methacrylic acid and ethylene glycol dimethacrylate in toluene. The binding capacities of imprinted (MIP1) and non-imprinted (NIP1) materials were 135.3 ± 9.8 and 74.8 ± 7.8 μmol g -1 , respectively. The specific surface areas were 55.05 ± 3.89 for MIP1 and 38.72 ± 2.40 m 2 g -1 for NIP1. The SEM analysis confirmed that the surface of MIP1 is rougher and denser than NIP1. Structural analysis supported by 13 C CP/MAS NMR spectra was also performed. The binding abilities of homoveratrylamine and eight structurally related compounds to MIP1 showed that strong interactions between carboxylic group in the polymer and amine group in the analyte together with its molecular volume govern the recognition mechanism.
Energy Technology Data Exchange (ETDEWEB)
Deschamps, P
2003-11-01
This thesis forms part of the geological investigations undertaken by the French agency for nuclear waste management, ANDRA, around the Meuse/Haute-Marne Underground Research Laboratory (URL) located in the Eastern part of the Paris Basin in order to evaluate the feasibility of high-level radioactive waste repository in deep argilite formations. The aim of the study is to examine the radionuclide migration in the deep Callovo-Oxfordian target argilite layer and its surrounding low- permeability Bathonian and Oxfordian limestone formations in order to assess the long term confining capacities of the sedimentary series. This study is based on measurement of radioactive disequilibria within U-series by Multiple- Collector Inductively Coupled Plasma Mass Spectrometry (MC-ICP-MS). The high precision and accuracy achieved allowed to demonstrate the {sup 234}U/{sup 238}U radioactive equilibrium in the Callovo-Oxfordian argilites. This result shows the uranium immobility in the target formation and provides a strong evidence for the current chemical stability and closure of the system for uranium and most probably for the other actinides. This is a fundamental result with respect to the problematic of disposal of high level radioactive waste in deep geological formation since it provides a in situ indication of the confining capacities of the clayey target formation in the current settings. Conversely, ({sup 234}U/{sup 238}U) disequilibria are systematically observed within zones, located in the surrounding carbonate formations, that are characterized by pressure dissolution structures (stylolites or dissolution seams). These disequilibria provide evidence for a discrete uranium relocation during the last two million years in the vicinity of stylolitic structures. This is a surprising result since it is generally supposed that these deep, low permeability, compact formations behave as closed system at the time scale of the U-series. (author)
Energy Technology Data Exchange (ETDEWEB)
Deschamps, P
2003-11-01
This thesis forms part of the geological investigations undertaken by the French agency for nuclear waste management, ANDRA, around the Meuse/Haute-Marne Underground Research Laboratory (URL) located in the Eastern part of the Paris Basin in order to evaluate the feasibility of high-level radioactive waste repository in deep argilite formations. The aim of the study is to examine the radionuclide migration in the deep Callovo-Oxfordian target argilite layer and its surrounding low- permeability Bathonian and Oxfordian limestone formations in order to assess the long term confining capacities of the sedimentary series. This study is based on measurement of radioactive disequilibria within U-series by Multiple- Collector Inductively Coupled Plasma Mass Spectrometry (MC-ICP-MS). The high precision and accuracy achieved allowed to demonstrate the {sup 234}U/{sup 238}U radioactive equilibrium in the Callovo-Oxfordian argilites. This result shows the uranium immobility in the target formation and provides a strong evidence for the current chemical stability and closure of the system for uranium and most probably for the other actinides. This is a fundamental result with respect to the problematic of disposal of high level radioactive waste in deep geological formation since it provides a in situ indication of the confining capacities of the clayey target formation in the current settings. Conversely, ({sup 234}U/{sup 238}U) disequilibria are systematically observed within zones, located in the surrounding carbonate formations, that are characterized by pressure dissolution structures (stylolites or dissolution seams). These disequilibria provide evidence for a discrete uranium relocation during the last two million years in the vicinity of stylolitic structures. This is a surprising result since it is generally supposed that these deep, low permeability, compact formations behave as closed system at the time scale of the U-series. (author)
Photodissociation of C{sub 3}H{sub 5}Br and C{sub 4}H{sub 7}Br at 234 nm
Energy Technology Data Exchange (ETDEWEB)
Kim, Hyun Kook; Paul, Dababrata; Hong, Ki Ryong; Cho, Ha Na; Kim, Tae Kyu [Pusan National University, Busan (Korea, Republic of); Lee, Kyoung Seok [Korea Research Institute of Standards and Science, Daejeon (Korea, Republic of)
2012-01-15
The photodissociation dynamics of cyclopropyl bromide (C-3H{sub 5}Br) and cyclobutyl bromide (C{sub 4}H{sub 7}Br) at 234 nm was investigated. A two-dimensional photofragment ion-imaging technique coupled with a [2+1] resonance enhanced multiphoton ionization scheme was utilized to obtain speed and angular distributions of the nascent Br({sup 2}P{sub 3/2}) and Br*({sup 2}P{sub 1/2}) atoms. The recoil anisotropies for the Br and Br* channels were measured to be βBr = 0.92 ± 0.03 and βBr* = 1.52 ± 0.04 for C{sub 3}H{sub 5}Br and βBr = 1.10 ± 0.03 and βBr* = 1.49 ± 0.05 for C{sub 4}H{sub 7}Br. The relative quantum yield for Br was found to be ΦBr = 0.13 ± 0.03 and for C{sub 3}H{sub 5}Br and C{sub 4}H{sub 7}Br, respectively. The soft radical limit of the impulsive model adequately modeled the related energy partitioning. The nonadiabatic transition probability from the 3A' and 4A' potential energy surfaces was estimated and discussed.
Purification of cerium, neodymium and gadolinium for low background experiments
Directory of Open Access Journals (Sweden)
Boiko R.S.
2014-01-01
Full Text Available Cerium, neodymium and gadolinium contain double beta active isotopes. The most interesting are 150Nd and 160Gd (promising for 0ν2β search, 136Ce (2β+ candidate with one of the highest Q2β. The main problem of compounds containing lanthanide elements is their high radioactive contamination by uranium, radium, actinium and thorium. The new generation 2β experiments require development of methods for a deep purification of lanthanides from the radioactive elements. A combination of physical and chemical methods was applied to purify cerium, neodymium and gadolinium. Liquid-liquid extraction technique was used to remove traces of Th and U from neodymium, gadolinium and for purification of cerium from Th, U, Ra and K. Co-precipitation and recrystallization methods were utilized for further reduction of the impurities. The radioactive contamination of the samples before and after the purification was tested by using ultra-low-background HPGe gamma spectrometry. As a result of the purification procedure the radioactive contamination of gadolinium oxide (a similar purification efficiency was reached also with cerium and neodymium oxides was decreased from 0.12 Bq/kg to 0.007 Bq/kg in 228Th, from 0.04 Bq/kg to <0.006 Bq/kg in 226Ra, and from 0.9 Bq/kg to 0.04 Bq/kg in 40K. The purification methods are much less efficient for chemically very similar radioactive elements like actinium, lanthanum and lutetium.
International Nuclear Information System (INIS)
Keller, C.
1988-01-01
Fifty years after the discovery of fission, the scientific community is aware that this type of nuclear reaction could have been discovered more than a decade earlier. Noddack, Tacke and Berg announced in 1925 the discovery of elements Z = 43 (masurium) and rhenium (Z = 75), the first one could be detected only in U-bearing minerals. A recent re-examination by P.H.M. von Assche of the published data clearly showed that the original claim for element Z = 43 of the authors in 1925 was correct and, therefore, they detected not only element Z = 43 but also the first fission product. Because this discovery of element Z = 43 could not be repeated by other authors as that time, the scientific credibility of Noddack-Tacke was very low in order to give credit to her proposal that the 'early' transuranium elements by Enrico Fermi might also be fragments of known (lighter) elements. Enrico Fermi in 1934 obtained these 'early' (and as we today know: wrong) transuranium isotopes by irradiation of uranium with neutrons. A 'wrong' periodic system in the thirties which placed Th, Pa and U as 6d-elements and not as 5f-actinides chemically helped to consider these fission products as transuranium elements Z = 93/94. In 1937/38 I. Curie and P. Savitch discovered an 'actinium-nuclide' with 3,5 h half-life which, however, had properties similar to lanthanium and not to actinium, as they stated. (orig.) [de
Shape of intrinsic alpha pulse height spectra in lanthanide halide scintillators
Wolszczak, W.; Dorenbos, P.
2017-06-01
Internal contamination with actinium-227 and its daughters is a serious drawback in low-background applications of lanthanide-based scintillators. In this work we showed the important role of nuclear γ de-excitations on the shape of the internal alpha spectrum measured in scintillators. We calculated with Bateman equations the activities of contamination isotopes and the time evolution of actinium-227 and its progenies. Next, we measured the intrinsic background spectra of LaBr3(Ce), LaBr3(Ce,Sr) and CeBr3 with a digital spectroscopy technique, and we analyzed them with a pulse shape discrimination method (PSD) and a time-amplitude analysis. Finally, we simulated the α background spectrum with Geant4 tool-kit, consequently taking into account complex α-γ-electron events, the α / β ratio dependence on the α energy, and the electron/γ nonproportionality. We found that α-γ mixed events have higher light yield than expected for alpha particles alone, which leads to overestimation of the α / β ratio when it is measured with internal 227Th and 223Ra isotopes. The time-amplitude analysis showed that the α peaks of 219Rn and 215Po in LaBr3(Ce) and LaBr3(Ce,Sr) are not symmetric. We compared the simulation results with the measured data and provided further evidence of the important role of mixed α-γ-electron events for understanding the shape of the internal α spectrum in scintillators.
International Nuclear Information System (INIS)
Martinot, L.; Fuger, J.
1985-01-01
The oxidation behavior of the actinides is explained on the basis of their electronic structure. The actinide elements, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium, curium, berkelium, californium, einsteinium, fermium, mendelevium, nobelium, and laurencium are included. For all except the last three elements, the points of discussion are oxidation states, Gibbs energies and potentials, and potential diagram for the element in acid solution; and thermodynamic properties of these same elements are tabulated. References are cited following discussion of each element with a total of 97 references being cited. 13 tables
International Nuclear Information System (INIS)
Tekuchev, V.V.; Barashkov, B.I.; Rygalov, L.N.; Dolzhikov, Yu.S.
2001-01-01
For the first time one obtained the polytherms of ultrasound velocity for liquid high-melting metals within wide temperature range. In terms of the rigid sphere model on the basis of the acoustic data one calculated the entropy values for 34 liquid metals at the melting point. The average discrepancy of the calculated values of entropy with the published one constitutes 8.2%. With increase of metal valency the error increases from 2.8 up to 13%. In case of francium, radium, promethium, actinium, hafnium, polonium, rhenium one obtained data for the first time [ru
Status of the lanthanides and actinides in the periodic table
International Nuclear Information System (INIS)
Holden, N.E.
1985-01-01
In extended discussions and correspondence with Ekkehard Fluck, the author was made aware of a problem with the Periodic Table, i.e., which element should be shown in the main table as the representative of the lanthanide series and the actinide series. In earlier discussion, he came to the conclusion that lanthanum and actinium are not the elements which should appear, but rather lutetium and lawrencium are more appropriate for inclusion in their place. This paper will attempt to justify the reasons for the above conclusions. 4 refs
International Nuclear Information System (INIS)
Silva, Teresinha de Moraes da; Sordi, Gian M.A.A.
2008-01-01
radioisotopes in secular equilibrium have been made with the thorium 234 Th and protactinium 234 Pa of the uranium series, whose secular equilibrium happens in 100 days. The actinium series the secular equilibrium with 235 U happens after 100 hours. Thus, there was the contribution of these radioisotopes in secular equilibrium in the transport index of compounds UO 2 and U 3 Si 2 or uranium element, for each enrichment up to 10% and the U 3 O 8 up to 20% of enrichment. (author)
International Nuclear Information System (INIS)
Schuster, Martina
2015-01-01
The guiding value of the effective dose for the consumption of drinking water is 0.1 mSv per calendar year. For the purpose of dose assessment the intake of all relevant radio nuclides via drinking water has to be determined. Some analysis methods for the determination of relevant natural occurring radio nuclides are published but they need complete different and time consuming analysis methods for each radionuclide. This study shows an analysis method which is able to determine the radio nuclides 210 Pb, 210 Po, 226 Ra, 228 Ra, 238 U and 234 U quantitatively within a justifiable time scale. It is based on a chromatography method which has been validated for determination of 90 Sr and 89 Sr in milk, vegetable food and human and animal bones respectively. Applying this method the elution ranges for lead and polonium are so different from uranium and radium that a combined separation with high chemical yield is possible, even by miniaturization the chromatography column which means significant time saving. The activity concentration of 228 Ra and 226 Ra is determined applying gamma-spectrometry and that of 210 Pb, 210 Po, 234 U and 238 U by LSC. The chemical yield of 210 Pb is calculated with a stable lead applying AAS and that of the radium isotopes with 223 Ra. Therefor 223 Ra is separated of a 227 Ac standard solution. The method is validated by a interlaboratory test for the determination of natural radio nuclides in drinking water which was released by the Bundesamt fuer Strahlenschutz. For the analysis only about four litres of drinking water are necessary to realize the required limit of detection. The method is very efficient, enough specific and allows the determination of dose relevant radio nuclides.
International Nuclear Information System (INIS)
Payne, T.E.
1991-01-01
One way to gain confidence in modelling possible radionuclide releases is to study natural systems which are similar to components of the multibarrier waste repository. Several such analogues are currently under study and these provide useful data about radionuclide behaviour in the natural environment. One such system is the Koongarra uranium deposit in the Northern Territory. In this dissertation, the migration of actinides, primarily uranium and thorium, has been studied as an analogue for the behaviour of transuranics in the far-field of a waste repository. The major findings of this study are: 1. the main process retarding uranium migration in the dispersion fan at Koongarra is sorption, which suppresses dissolved uranium concentrations well below solubility limits, with ferrihydrite being a major sorbing phase; 2. thorium is extremely immobile, with very low dissolved concentrations and corresponding high distribution ratios for 230 Th. Overall, it is estimated that colloids are relatively unimportant in Koongarra groundwater. Uranium migrates mostly as dissolved species, whereas thorium and actinium are mostly adsorbed to larger, relatively immobile particles and the stationary phase. However, of the small amount of 230 Th that passes through a 1μm filter, a significant proportion is associated with colloidal particles. Actinium appears to be slightly more mobile than thorium and is associated with colloids to a greater extent, although generally present in low concentrations. These results support the possibility of colloidal transport of trivalent and tetravalent actinides in the vicinity of a nuclear waste repository. 112 refs., 23 tabs., 32 figs
An eighteen-membered macrocyclic ligand for actinium-225 targeted alpha therapy
International Nuclear Information System (INIS)
Thiele, Nikki A.; MacMillan, Samantha N.; Wilson, Justin J.; Rodriguez-Rodriguez, Cristina
2017-01-01
The 18-membered macrocycle H 2 macropa was investigated for 225 Ac chelation in targeted alpha therapy (TAT). Radiolabeling studies showed that macropa, at submicromolar concentration, complexed all 225 Ac (26 kBq) in 5 min at RT. [ 225 Ac(macropa)] + remained intact over 7 to 8 days when challenged with either excess La 3+ ions or human serum, and did not accumulate in any organ after 5 h in healthy mice. A bifunctional analogue, macropa-NCS, was conjugated to trastuzumab as well as to the prostate-specific membrane antigen-targeting compound RPS-070. Both constructs rapidly radiolabeled 225 Ac in just minutes at RT, and macropa-Tmab retained >99 % of its 225 Ac in human serum after 7 days. In LNCaP xenograft mice, 225 Ac-macropa-RPS-070 was selectively targeted to tumors and did not release free 225 Ac over 96 h. These findings establish macropa to be a highly promising ligand for 225 Ac chelation that will facilitate the clinical development of 225 Ac TAT for the treatment of soft-tissue metastases. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)
An eighteen-membered macrocyclic ligand for actinium-225 targeted alpha therapy
Energy Technology Data Exchange (ETDEWEB)
Thiele, Nikki A.; MacMillan, Samantha N.; Wilson, Justin J. [Cornell Univ., Ithaca, NY (United States). Chemistry and Chemical Biology; Brown, Victoria; Jermilova, Una; Ramogida, Caterina F.; Robertson, Andrew K.H.; Schaffer, Paul; Radchenko, Valery [TRIUMF, Vancouver, BC (Canada). Life Science Div.; Kelly, James M.; Amor-Coarasa, Alejandro; Nikolopoulou, Anastasia; Ponnala, Shashikanth; Williams, Clarence Jr.; Babich, John W. [Radiology, Weill Cornell Medicine, New York, NY (United States); Rodriguez-Rodriguez, Cristina [British Columbia Univ., Vancouver, BC (Canada). Dept. of Physics and Astronomy and Centre for Comparative Medicine
2017-11-13
The 18-membered macrocycle H{sub 2}macropa was investigated for {sup 225}Ac chelation in targeted alpha therapy (TAT). Radiolabeling studies showed that macropa, at submicromolar concentration, complexed all {sup 225}Ac (26 kBq) in 5 min at RT. [{sup 225}Ac(macropa)]{sup +} remained intact over 7 to 8 days when challenged with either excess La{sup 3+} ions or human serum, and did not accumulate in any organ after 5 h in healthy mice. A bifunctional analogue, macropa-NCS, was conjugated to trastuzumab as well as to the prostate-specific membrane antigen-targeting compound RPS-070. Both constructs rapidly radiolabeled {sup 225}Ac in just minutes at RT, and macropa-Tmab retained >99 % of its {sup 225}Ac in human serum after 7 days. In LNCaP xenograft mice, {sup 225}Ac-macropa-RPS-070 was selectively targeted to tumors and did not release free {sup 225}Ac over 96 h. These findings establish macropa to be a highly promising ligand for {sup 225}Ac chelation that will facilitate the clinical development of {sup 225}Ac TAT for the treatment of soft-tissue metastases. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)
International Nuclear Information System (INIS)
Merchant, Thomas E.; Kun, Larry E.; Krasin, Matthew J.; Wallace, Dana; Chintagumpala, Murali M.; Woo, Shiao Y.; Ashley, David M.; Sexton, Maree; Kellie, Stewart J.; Ahern, Verity M.B.B.S.; Gajjar, Amar
2008-01-01
Purpose: Limiting the neurocognitive sequelae of radiotherapy (RT) has been an objective in the treatment of medulloblastoma. Conformal RT to less than the entire posterior fossa (PF) after craniospinal irradiation might reduce neurocognitive sequelae and requires evaluation. Methods and Materials: Between October 1996 and August 2003, 86 patients, 3-21 years of age, with newly diagnosed, average-risk medulloblastoma were treated in a prospective, institutional review board-approved, multi-institution trial of risk-adapted RT and dose-intensive chemotherapy. RT began within 28 days of definitive surgery and consisted of craniospinal irradiation (23.4 Gy), conformal PF RT (36.0 Gy), and primary site RT (55.8 Gy). The planning target volume for the primary site included the postoperative tumor bed surrounded by an anatomically confined margin of 2 cm that was then expanded with a geometric margin of 0.3-0.5 cm. Chemotherapy was initiated 6 weeks after RT and included four cycles of high-dose cyclophosphamide, cisplatin, and vincristine. Results: At a median follow-up of 61.2 months (range, 5.2-115.0 months), the estimated 5-year event-free survival and cumulative incidence of PF failure rate was 83.0% ± 5.3% and 4.9% ± 2.4% (± standard error), respectively. The targeting guidelines used in this study resulted in a mean reduction of 13% in the volume of the PF receiving doses >55 Gy compared with conventionally planned RT. The reductions in the dose to the temporal lobes, cochleae, and hypothalamus were statistically significant. Conclusion: This prospective trial has demonstrated that irradiation of less than the entire PF after 23.4 Gy craniospinal irradiation for average-risk medulloblastoma results in disease control comparable to that after treatment of the entire PF
Energy Technology Data Exchange (ETDEWEB)
Vandenbosch, R. [University of Washington, Seattle, WA (United States); Unik, J. P.; Huizenga, J. R. [Argonne National Laboratory, Argonne, IL (United States)
1965-07-15
The fission of the compound nucleus U{sup 235} in the neighbourhood of its fission threshold has been studied by means of the U{sup 234} (d.pf) reaction. A three-parameter analyser was used to record simultaneously the two fission-fragment kinetic energies and the proton energy for each coincident event. The excitation energy at which fission occurs is defined by the kinetic energy of the stripped.proton. The variation of angular anisotropy with excitation energy shows considerably more structure than that obtained by Lamphere for the same nucleus resulting from fast-neutron bombardment of U{sup 234}. At least eight fission channels at the saddle point have been observed for the energy region between threshold and 2 MeV above threshold. Nilsson-type calculations of single particle energies for deformed nuclei have been made for the larger deformations more nearly describing the saddle-point configuration. The single particle states identified by Lamphere are consistent with those calculated to be close to the Fermi surface for reasonable saddle-point deformations. The primary motivation for this experiment was to search for a possible correlation between mass asymmetry and angular anisotropy. Mass yields obtained from the correlated fragment energies show no variation of the anisotropy with mass ratio, in contrast with experiments where the excitation energy at which fission is occurring is not fixed and where a dependence of anisotropy on mass ratio has been observed. There is therefore no evidence from anisotropy measurements that the properties of the saddle point influence the final mass division. The average total kinetic energy release in fission varies by less than 0.5% for the different saddle-point channels observed. The variation of total kinetic energy with mass ratio has also been investigated. (author) [French] Les auteurs ont etudie la fission du noyau compose {sup 235}U au voisinage de son seuil de fission par la reaction {sup 234}U(d,pf). A l'aide d
Alpha-emitting isotopes and chromium in a coastal California aquifer
International Nuclear Information System (INIS)
Densmore, Jill N.; Izbicki, John A.; Murtaugh, Joseph M.; Swarzenski, Peter W.; Bullen, Thomas D.
2014-01-01
Highlights: • Alluvium in Piedra de Lumbre basin higher radionuclides likely from natural Th. • Natural uranium decay-chain isotopes, including Ra, present in marine deposits. • Marine deposits also contain low concentrations of chromium. • Radionuclides and chromium concentrations lower in alluvium in the Las Flores basin. - Abstract: The unadjusted 72-h gross alpha activities in water from two wells completed in marine and alluvial deposits in a coastal southern California aquifer 40 km north of San Diego were 15 and 25 picoCuries per liter (pCi/L). Although activities were below the Maximum Contaminant Level (MCL) of 15 pCi/L, when adjusted for uranium activity; there is concern that new wells in the area may exceed MCLs, or that future regulations may limit water use from the wells. Coupled well-bore flow and depth-dependent water-quality data collected from the wells in 2011 (with analyses for isotopes within the uranium, actinium, and thorium decay-chains) show gross alpha activity in marine deposits is associated with decay of naturally-occurring 238 U and its daughter 234 U. Radon activities in marine deposits were as high as 2230 pCi/L. In contrast, gross alpha activities in overlying alluvium within the Piedra de Lumbre watershed, eroded from the nearby San Onofre Hills, were associated with decay of 232 Th, including its daughter 224 Ra. Radon activities in alluvium from Piedra de Lumbre of 450 pCi/L were lower than in marine deposits. Chromium VI concentrations in marine deposits were less than the California MCL of 10 μg/L (effective July 1, 2014) but δ 53 Cr compositions were near zero and within reported ranges for anthropogenic chromium. Alluvial deposits from the nearby Las Flores watershed, which drains a larger area having diverse geology, has low alpha activities and chromium as a result of geologic and geochemical conditions and may be more promising for future water-supply development
Directory of Open Access Journals (Sweden)
Rihua Lei
2018-03-01
Full Text Available Male gametogenesis in plants is tightly controlled and involves the complex and precise regulation of transcriptional reprogramming. Interactions between WRKY proteins and VQ motif-containing proteins are required to control these complicated transcriptional networks. However, our understanding of the mechanisms by which these complexes affect downstream gene expression is quite limited. In this study, we found that WRKY2 and WKRY34 repress MYB97, MYB101, and MYB120 expression during male gametogenesis. MYB expression was up-regulated in the wrky2-1 wrky34-1 vq20-1 triple mutant during male gametogenesis. The expression levels of six potential targets of the three MYBs increased the most in the wrky2-1 wrky34-1 vq20-1 triple mutant, followed by the wrky2-1 wrky34-1 double mutant, compared with in wild-type. Yeast one-hybrid and dual luciferase reporter assays indicated that WRKY2 and WRKY34 recognized the MYB97 promoter by binding to its W-boxes. MYB97 overexpression caused defects in pollen germination and pollen tube length, which impacted male fertility. Thus, WRKY2/34–VQ20 complexes appear to negatively regulate the expression of certain MYBs during plant male gametogenesis.
Stamatopoulos, A.; Kanellakopoulos, A.; Kalamara, A.; Diakaki, M.; Tsinganis, A.; Kokkoris, M.; Michalopoulou, V.; Axiotis, M.; Lagoyiannis, A.; Vlastou, R.
2018-01-01
The 234U neutron-induced fission cross-section has been measured at incident neutron energies of 452, 550, 651 keV and 7.5, 8.7, 10 MeV using the 7Li ( p, n) and the 2H( d, n) reactions, respectively, relative to the 235U( n, f ) and 238U( n, f ) reference reactions. The measurement was performed at the neutron beam facility of the National Center for Scientific Research "Demokritos", using a set-up based on Micromegas detectors. The active mass of the actinide samples and the corresponding impurities were determined via α-spectroscopy using a surface barrier silicon detector. The neutron spectra intercepted by the actinide samples have been thoroughly studied by coupling the NeuSDesc and MCNP5 codes, taking into account the energy and angular straggling of the primary ion beams in the neutron source targets in addition to contributions from competing reactions ( e.g. deuteron break-up) and neutron scattering in the surrounding materials. Auxiliary Monte Carlo simulations were performed making combined use of the FLUKA and GEF codes, focusing particularly on the determination of the fission fragment detection efficiency. The developed methodology and the final results are presented.
Coulex fission of 234U, 235U, 237Np, and 238Np studied within the SOFIA experimental program
International Nuclear Information System (INIS)
Martin, Julie-Fiona
2014-01-01
SOFIA (Studies On FIssion with Aladin) is an experimental project which aims at systematically measuring the fission fragments' isotopic yields as well as their total kinetic energy, for a wide variety of fissioning nuclei. The PhD work presented in this dissertation takes part in the SOFIA project, and covers the fission of nuclei in the region of the actinides: 234 U, 235 U, 237 Np and 238 Np. The experiment is led at the heavy-ion accelerator GSI in Darmstadt, Germany. This facility provides intense relativistic primary beam of 238 U. A fragmentation reaction of the primary beam permits to create a secondary beam of radioactive ions, some of which the fission is studied. The ions of the secondary beam are sorted and identified through the FR-S (Fragment Separator), a high resolution recoil spectrometer which is tuned to select the ions of interest.The selected - fissile - ions then fly further to Cave-C, an experimental area where the fission experiment itself takes place. At the entrance of the cave, the secondary beam is excited by Coulomb interaction when flying through an target; the de-excitation process involves low-energy fission. Both fission fragments fly forward in the laboratory frame, due to the relativistic boost inferred from the fissioning nucleus.A complete recoil spectrometer has been designed and built by the SOFIA collaboration in the path of the fission fragments, around the existing ALADIN magnet. The identification of the fragments is performed by means of energy loss, time of flight and deviation in the magnet measurements. Both fission fragments are fully (in mass and charge) and simultaneously identified.This document reports on the analysis performed for (1) the identification of the fissioning system, (2) the identification of both fission fragments, on an event-by-event basis, and (3) the extraction of fission observables: yields, TKE, total prompt neutron multiplicity. These results, concerning the actinides, are discussed, and
International Nuclear Information System (INIS)
Montoya, M.; Rojas, J.; Lobato, I.
2008-01-01
The standard deviation of the final kinetic energy distribution (σ e ) as a function of mass of final fragments (m) from low energy fission of 234 U, measured with the Lohengrin spectrometer by Belhafaf et al., presents a peak around m = 109 and another around m = 122. The authors attribute the first peak to the evaporation of a large number of neutrons around the corresponding mass number, i.e. there is no peak on the standard deviation of the primary kinetic energy distribution (σ E ) as a function of primary fragment mass (A). The second peak is attributed to a real peak on σ E (A). However, theoretical calculations related to primary distributions made by H.R. Faust and Z. Bao do not suggest any peak on σ E (A). In order to clarify this apparent controversy, we have made a numerical experiment in which the masses and the kinetic energy of final fragments are calculated, assuming an initial distribution of the kinetic energy without structures on the standard deviation as function of fragment mass. As a result we obtain a pronounced peak on σ e (m) curve around m = 109, a depletion from m = 121 to m = 129, and an small peak around m = 122, which is not as great as that measured by Belhafaf et al. Our simulation also reproduces the experimental results on the yield of the final mass Y(m), the average number of emitted neutrons as a function of the provisional mass (calculated from the values of the final kinetic energy of the complementary fragments) and the average value of fragment kinetic energy as a function of the final mass. From our results we conclude that there are no peaks on the σ E (A) curve, and the observed peaks on σ e (m) are due to the emitted neutron multiplicity and the variation of the average fragment kinetic energy as a function of primary fragment mass. (Author)
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFC234 (Link to dictyBase) - - - Contig-U16464-1 VFC234P (Link... to Original site) VFC234F 292 VFC234Z 462 VFC234P 754 - - Show VFC234 Library VF (Link to library) Clone ID VFC234 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16464-1 Original site URL http://dict...2 5e-06 6 AL844509 |AL844509.1 Plasmodium falciparum chromosome 13. 48 4e-04 4 AC117075 |AC117075.2 Dict...brane 4.0 %: Golgi 4.0 %: vesicles of secretory system >> prediction for VFC234 is nuc 5' end seq. ID VFC234
Energy Technology Data Exchange (ETDEWEB)
Marx, Sebastian Markus
2014-09-23
The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.
Directory of Open Access Journals (Sweden)
Anelise Coelho Nunes
2016-06-01
Full Text Available Los cambios introducidos por la promulgación de la Ley n° 12.234 /10 trajeron una cierta controversia con respecto a una posible prescripción de la extinción (en forma retroactivo. En este sentido, el texto permite establecer un parámetro de la discusión, con la garantía de que el legislador optó por dar efecto ex tunc a la prescripción de la pretensión punitiva, en base a la sanción específica, sólo desde la recepción de la queja o reclamación. Por lo tanto, este estudio es necesario para tratar sobre el deber fundamental de la protección del Estado, que, por ley, acto administrativo o acciones de hecho, está obligado a actuar positivamente para evitar prácticas aceras sean perjudiciales para los derechos fundamentales.
Energy Technology Data Exchange (ETDEWEB)
NONE
2006-07-01
In a previous study which concerned the catchment basin of the harbour of Brest, the A.C.R.O. put in evidence a marking by artificial radioelements around the power plant of Brennilis which can be imputed without ambiguities to the nuclear installation. It also put in evidence abnormalities concerning the natural radioactivity which justifies this new study. In the area of the Monts d'Arree, actinium 227 ({sup 227}Ac), non born by its ascendents which are {sup 235}U and {sup 231}Pa is observed. This phenomenon is characterized by mass activities superior to these ones of {sup 235}U and able to reach these ones of {sup 238}U. Its presence corresponds with the drainage of the Ellez river since the former channel of radioactive effluents releases from the nuclear power plant EL-4 up to the reservoir Saint-Herblot situated 6 km downstream. The strongest values of radioactivity are registered near the disused power plant, at this place a relationship exists between the level of actinium 227 and this one of the artificial radioactivity as it exists a relationship with the decay products of radon exhaled from the subsoil ({sup 210}Pb). But its presence is not limited to a part of the Ellez river, it is equally observed in terrestrial medium, in places in priori not influenced by the direct liquid effluents of the power plant. This place is situated at more than 4 km and without any connection with the Ellez waters. At this stage of the study, it is not possible to answer with certainty the question of the origin of this phenomenon. A new reorientation is considered indispensable to clarify definitively the origin of this unknown phenomenon in the scientific publications and the environmental monitoring. (N.C.)
International Nuclear Information System (INIS)
2006-01-01
In a previous study which concerned the catchment basin of the harbour of Brest, the A.C.R.O. put in evidence a marking by artificial radioelements around the power plant of Brennilis which can be imputed without ambiguities to the nuclear installation. It also put in evidence abnormalities concerning the natural radioactivity which justifies this new study. In the area of the Monts d'Arree, actinium 227 ( 227 Ac), non born by its ascendents which are 235 U and 231 Pa is observed. This phenomenon is characterized by mass activities superior to these ones of 235 U and able to reach these ones of 238 U. Its presence corresponds with the drainage of the Ellez river since the former channel of radioactive effluents releases from the nuclear power plant EL-4 up to the reservoir Saint-Herblot situated 6 km downstream. The strongest values of radioactivity are registered near the disused power plant, at this place a relationship exists between the level of actinium 227 and this one of the artificial radioactivity as it exists a relationship with the decay products of radon exhaled from the subsoil ( 210 Pb). But its presence is not limited to a part of the Ellez river, it is equally observed in terrestrial medium, in places in priori not influenced by the direct liquid effluents of the power plant. This place is situated at more than 4 km and without any connection with the Ellez waters. At this stage of the study, it is not possible to answer with certainty the question of the origin of this phenomenon. A new reorientation is considered indispensable to clarify definitively the origin of this unknown phenomenon in the scientific publications and the environmental monitoring. (N.C.)
International Nuclear Information System (INIS)
Meadows, J.W.
1986-12-01
The measurement of the fission cross section ratios of nine isotopes relative to 235 U at an average neutron energy of 14.74 MeV is described with particular attention to the determination of corrections and to sources of error. The results are compared to ENDF/B-V and to other measurements of the past decade. The ratio of the neutron induced fission cross section for these isotopes to the fission cross section for 235 U are: 230 Th - 0.290 +- 1.9%; 232 Th - 0.191 +- 1.9%; 233 U - 1.132 +- 0.7%; 234 U - 0.998 +- 1.0%; 236 U - 0.791 +- 1.1%; 238 U - 0.587 +- 1.1%; 237 Np - 1.060 +- 1.4%; 239 Pu - 1.152 +- 1.1%; 242 Pu - 0.967 +- 1.0%. 40 refs., 11 tabs., 9 figs
Energy Technology Data Exchange (ETDEWEB)
Montoya, M.; Rojas, J. [Instituto Peruano de Energia Nuclear, Av. Canada 1470, Lima 41 (Peru); Lobato, I. [Facultad de Ciencias, Universidad Nacional de Ingenieria, Av. Tupac Amaru 210, Apartado Postal 31-139, Lima (Peru)]. e-mail: mmontoya@ipen.gob.pe
2008-07-01
The standard deviation of the final kinetic energy distribution ({sigma}{sub e}) as a function of mass of final fragments (m) from low energy fission of {sup 234}U, measured with the Lohengrin spectrometer by Belhafaf et al., presents a peak around m = 109 and another around m = 122. The authors attribute the first peak to the evaporation of a large number of neutrons around the corresponding mass number, i.e. there is no peak on the standard deviation of the primary kinetic energy distribution ({sigma}{sub E}) as a function of primary fragment mass (A). The second peak is attributed to a real peak on {sigma}{sub E}(A). However, theoretical calculations related to primary distributions made by H.R. Faust and Z. Bao do not suggest any peak on {sigma}{sub E}(A). In order to clarify this apparent controversy, we have made a numerical experiment in which the masses and the kinetic energy of final fragments are calculated, assuming an initial distribution of the kinetic energy without structures on the standard deviation as function of fragment mass. As a result we obtain a pronounced peak on {sigma}{sub e} (m) curve around m = 109, a depletion from m = 121 to m = 129, and an small peak around m = 122, which is not as great as that measured by Belhafaf et al. Our simulation also reproduces the experimental results on the yield of the final mass Y(m), the average number of emitted neutrons as a function of the provisional mass (calculated from the values of the final kinetic energy of the complementary fragments) and the average value of fragment kinetic energy as a function of the final mass. From our results we conclude that there are no peaks on the {sigma}{sub E} (A) curve, and the observed peaks on {sigma}{sub e} (m) are due to the emitted neutron multiplicity and the variation of the average fragment kinetic energy as a function of primary fragment mass. (Author)
Energy Technology Data Exchange (ETDEWEB)
Stamatopoulos, A.; Kanellakopoulos, A.; Kalamara, A.; Kokkoris, M.; Michalopoulou, V.; Vlastou, R. [National Technical University of Athens, Department of Physics, Athens (Greece); Diakaki, M. [National Technical University of Athens, Department of Physics, Athens (Greece); European Organisation for Nuclear Research (CERN), Geneva (Switzerland); Tsinganis, A. [European Organisation for Nuclear Research (CERN), Geneva (Switzerland); Axiotis, M.; Lagoyiannis, A. [Tandem Accelerator Laboratory, Institute of Nuclear and Particle Physics, N.C.S.R. Demokritos, Athens (Greece)
2018-01-15
The {sup 234}U neutron-induced fission cross-section has been measured at incident neutron energies of 452, 550, 651 keV and 7.5, 8.7, 10 MeV using the {sup 7}Li (p, n) and the {sup 2}H(d, n) reactions, respectively, relative to the {sup 235}U(n, f) and {sup 238}U(n, f) reference reactions. The measurement was performed at the neutron beam facility of the National Center for Scientific Research ''Demokritos'', using a set-up based on Micromegas detectors. The active mass of the actinide samples and the corresponding impurities were determined via α-spectroscopy using a surface barrier silicon detector. The neutron spectra intercepted by the actinide samples have been thoroughly studied by coupling the NeuSDesc and MCNP5 codes, taking into account the energy and angular straggling of the primary ion beams in the neutron source targets in addition to contributions from competing reactions (e.g. deuteron break-up) and neutron scattering in the surrounding materials. Auxiliary Monte Carlo simulations were performed making combined use of the FLUKA and GEF codes, focusing particularly on the determination of the fission fragment detection efficiency. The developed methodology and the final results are presented. (orig.)
African Journals Online (AJOL)
pc
risks from exposure to geological materials associa with mining ... alue both to the mining industry and to the health of the commun cal exploitation ... ent production, ceramics petroleum .... controls can minimize exposures to workers and.
International Nuclear Information System (INIS)
Bordenave-Montesquieu, A.; Benoit-Cattin, P.; Gleizes, A.; Marrakchi, A.I.; Dousson, S.; Hitz, D.
1984-01-01
a spectroscopic investigation of electrons coming from autoionising states N 5+ (nln'l'), with n=2,3,4 and n' >= n, of the fast ion has been made at 11.6 0 and 4.9 keV amu -1 . Only exothermic reactions are observed. It is shown that the ionisation potential of the target has a strong influence on the more probable values of n and n'. In N 7+ -He collisions, the n=3, n'=3 configurations are the more excited. In N 7+ -H 2 , the capture process is less selective since n=3, n' > 3 and also n=4, n' >= 4 configurations are strongly populated. In all these cases, the residual N 6+ ion is left in an excited state (n=2 or 3). The n=2, n' > 2 excitation probability is found to be much smaller for the two collisional systems. (author)
Radionuclide interactions with marine sediments
International Nuclear Information System (INIS)
Higgo, J.J.W.
1987-09-01
A critical review of the literature on the subject of the interactions of radionuclides with marine sediments has been carried out. On the basis of the information available, an attempt has been made to give ranges and 'best estimates' for the distribution ratios between seawater and sediments. These estimates have been based on an understanding of the sediment seawater system and the porewater chemistry and mineralogy. Field measurements, laboratory measurements and estimates based on stable-element geochemical data are all taken into account. Laboratory measurements include distribution-ratio and diffusion-coefficient determinations. The elements reviewed are carbon, chlorine, calcium, nickel, selenium, strontium, zirconium, niobium, technetium, tin, iodine, caesium, lead, radium, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium and curium. (author)
Calculation technique of free and impurity ion electronic structures
International Nuclear Information System (INIS)
Kulagin, N.A.; Sviridov, D.T.
1986-01-01
The monograph deals with calculation technique of free and impurity ion spectra with completed nl N -shell. The principles of the theory of irreducible tensor operators, genealogical coefficients, calculation technique of angular and radial parts of matrix elements operators are stated. The correlation accounting methods in free ions are considered in detail. The principles of the theory of crystal field and ligand field, the method of self-consistent field for impurity ions are reported. The technique efficiency based on example of lanthanum and actinium group ions is shown. Experimental data by nf N -ion spectra are given. The tables of angular coefficients, energy values of X-ray lines of rare earth ions and genealogical coefficients are given in the appendix
International Nuclear Information System (INIS)
Kitamura, Akira; Fujiwara, Kenso; Yui, Mikazu
2010-01-01
Within the scope of the JAEA thermodynamic database project for performance assessment of geological disposal of high-level radioactive and TRU wastes, the refinement of the thermodynamic data for the inorganic compounds and complexes of trivalent actinoids (actinium(III), plutonium(III), americium(III) and curium(III)) and samarium(III) was carried out. Refinement of thermodynamic data for these elements was based on the thermodynamic database for americium published by the Nuclear Energy Agency in the Organisation for Economic Co-operation and Development (OECD/NEA). Based on the similarity of chemical properties among trivalent actinoids and samarium, complementary thermodynamic data for their species expected under the geological disposal conditions were selected to complete the thermodynamic data set for the performance assessment of geological disposal of radioactive wastes. (author)
Energy Technology Data Exchange (ETDEWEB)
None
1979-09-01
Results of two radiological surveys of the St. Louis-Lambert Airport property, formerly known as the Airport Storage Site, St. Louis, Missouri, are presented. Uranium- and radium-bearing waste materials were stored from the 1940's to the late 1960's in this area. The surveys included direct measurements of beta-gamma radiation; determination of uranium, actinium, and radium concentrations in soil samples and from bore holes; determination of radionuclide concentrations in groundwater and surface water; measurement of radon flux from the ground surface; and measurements of /sup 222/Rn in air near the site. Results indicate that some offsite drainage pathways are becoming contaminated, probably by runoff from the site; no migration of /sup 222/Rn from the site was observed.
Tsinganis, A.; Kokkoris, M.; Vlastou, R.; Kalamara, A.; Stamatopoulos, A.; Kanellakopoulos, A.; Lagoyannis, A.; Axiotis, M.
2017-09-01
Accurate data on neutron-induced fission cross-sections of actinides are essential for the design of advanced nuclear reactors based either on fast neutron spectra or alternative fuel cycles, as well as for the reduction of safety margins of existing and future conventional facilities. The fission cross-section of 234U was measured at incident neutron energies of 560 and 660 keV and 7.5 MeV with a setup based on `microbulk' Micromegas detectors and the same samples previously used for the measurement performed at the CERN n_TOF facility (Karadimos et al., 2014). The 235U fission cross-section was used as reference. The (quasi-)monoenergetic neutron beams were produced via the 7Li(p,n) and the 2H(d,n) reactions at the neutron beam facility of the Institute of Nuclear and Particle Physics at the `Demokritos' National Centre for Scientific Research. A detailed study of the neutron spectra produced in the targets and intercepted by the samples was performed coupling the NeuSDesc and MCNPX codes, taking into account the energy spread, energy loss and angular straggling of the beam ions in the target assemblies, as well as contributions from competing reactions and neutron scattering in the experimental setup. Auxiliary Monte-Carlo simulations were performed with the FLUKA code to study the behaviour of the detectors, focusing particularly on the reproduction of the pulse height spectra of α-particles and fission fragments (using distributions produced with the GEF code) for the evaluation of the detector efficiency. An overview of the developed methodology and preliminary results are presented.
Energy Technology Data Exchange (ETDEWEB)
Bordenave-Montesquieu, A.; Benoit-Cattin, P.; Gleizes, A.; Marrakchi, A.I.; Dousson, S.; Hitz, D.
1984-04-14
Double electron transfer into autoionising states N/sup 4 +/(1snln'l'), with n = 2,3,4 and n' >= n has been observed in a collision between a one-electron highly charged N/sup 6 +/(1s) ion and a two-electron target (He or H/sub 2/), by electron spectrometry. The same configurations are excited in the two collisional systems but with very different probabilities. Electron capture mainly occurs into 1s2ln'l' in He-systems whereas transfer into 1s3ln'l' is stronger in H/sub 2/ systems.
Wang, Lei; Dong, Jie; Cui, Cai'e.; Tian, Yue; Huang, Ping
2015-08-01
A series of single-phase Na0.34Ca0.66Al1.66Si2.34O8:Ce3+, Sm3+ (NCASO) phosphors have been synthesized via a high temperature solid-state reaction method. The samples were studied based on photoluminescence (PL), photoluminescence excitation (PLE) spectra and fluorescence decay patterns. The obtained PLE exhibited a strong excitation band in the UV region between 250 and 380 nm. Under 340 nm excitation, NCASO:Ce3+, Sm3+ phosphor showed a broad emission band at 414 nm of Ce3+ and four emission bands from 550 nm to 725 nm of Sm3+. Spectra demonstrate nonradiative energy transfers (ET) occur from Ce3+-Sm3+. The analysis based on Inokuti-Hirayama model indicates that the ET is governed by electric dipole-dipole interaction. Moreover, the emitting colors can be adjusting from blue to white by proper tuning of the relative composition of Ce3+/Sm3+. These results show that NCASO:Ce3+, Sm3+ phosphors can be used as a potential single-phased white-emitting candidate for UV WLEDs.
International Nuclear Information System (INIS)
Lee, Mi Jin; Kim, Seog K.; Kim, Jong Moon; Lee, Dong Jin; Lee, Gil Jun
2005-01-01
The interactions of Cu(II)-meso-Tetrakis(n-N-methylpyridiniumyl)porphyrin (n = 2,3,4), respectively referred to as o-, m- and p-CuTMPyP, and DNA, poly[d(A-T) 2 ] and poly[d(G-C) 2 ] were investigated by circular and linear dichroism (CD and LD). In the o-CuTMPyP case, in which the rotation of the pyridinium ring is prevented, the shape of the CD spectrum when associated to DNA and poly[d(A-T) 2 ] resembles and is characterized by a positive band at a low drug to DNA concentration ratio (R ratio) and is bisignate at a high R ratio. The former CD spectrum shape has been attributed to porphyrin that is bound monomerically outside of DNA while the latter can be attributed to those that are stacked. When o-CuTMPyP is bound to poly[d(G-C) 2 ], the excitonic CD appeared at a relatively high R ratio. In contrast, a characteristic negative CD band in the Soret region was apparent for both m- and p-CuTMPyP when bound to DNA and poly[d(G-C) 2 ] at the low R ratios, indicating that the porphyrin molecule intercalates. However, the DNA is bent near the intercalation site and the plane of the porphyrin molecule tilts relative to the DNA helix axis, as judged by the magnitude of the reduced LD. Various stacking patterns were identified by the shape of the CD spectrum for m- and p-CuTMPyP when bound to poly[d(A-T) 2 ]. Three species for the former complex and two for the latter complex were found which may reflect the extent of the stacking
Cruz-Hurtado, Marycarmen; López-González, Ma de Lourdes; Escobar-Wilches, Derly Constanza; Sierra-Santoyo, Adolfo
2018-05-01
Vinclozolin (V) is a fungicide with anti-androgenic properties whose metabolism is not fully understood, and data on urinary elimination of either V or its metabolites are limited. Therefore the kinetics of urinary elimination of V and its metabolites, after an oral dose in adult male rats were investigated. A single oral dose of V (100 mg/kg) suspended in corn oil was administered to male adult Wistar rats, and urine was collected at different times after dosing. V and its metabolites were extracted from urine, then enzymatically hydrolyzed using β-glucuronidase/sulfatase of H. pomatia, and analyzed by HPLC/DAD. Urinary pharmacokinetic parameters were calculated using the analyte concentrations adjusted by creatinine levels. V and its metabolites 3',5'-dichloro-2,3,4-trihydroxy-2-methylbutylanilide (DTMBA, formerly denoted as M5), 2-[[(3,5-dichlorophenyl)-carbamoyl]oxy]-2-methyl-3-butenoic acid (M1), 3,5-dichloroaniline (M3), and 3',5'-dichloro-2-hydroxy-2-methylbut-3-enanilide (M2) were efficiently detected. The mean urine concentrations of V and M1 metabolite were fitted to a two-compartmental model for pharmacokinetic analysis. DTMBA approximately represented 88% of the total excreted metabolites, it was easily detected up to 168 h after dosing and its half-lives were 21.5 and 74.1 h, respectively. M1 was the second most abundant metabolite and was detected up to 144 h after being void. V and M3 were detected before 48 h, and M2 exhibited the lowest levels during the first 8 h after dosing. DTMBA, the most abundant V metabolite is quickly eliminated by urine, it is chemically stable, specific and could represent a useful alternative to be used as a biomarker of exposure to V. Copyright © 2018 Elsevier Inc. All rights reserved.
Dissolved Concentration Limits of Radioactive Elements
Energy Technology Data Exchange (ETDEWEB)
Y. Chen; E.R. Thomas; F.J. Pearson; P.L. Cloke; T.L. Steinborn; P.V. Brady
2003-06-20
The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of radioactive elements under possible repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, and measurements made in laboratory experiments and field work. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 radioactive elements (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium), which are important to calculated dose. Model outputs are mainly in the form of look-up tables plus one or more uncertainty terms. The rest are either in the form of distributions or single values. The results of this analysis are fundamental inputs for total system performance assessment to constrain the release of these elements from waste packages and the engineered barrier system. Solubilities of plutonium, neptunium, uranium, americium, actinium, thorium, protactinium, lead, and radium have been re-evaluated using the newly updated thermodynamic database (Data0.ymp.R2). For all of the actinides, identical modeling approaches and consistent environmental conditions were used to develop solubility models in this revision. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, activity coefficients, and selection of solubility controlling phase have been quantified or otherwise addressed. Moreover, a new blended plutonium solubility model has been developed in this revision, which gives a mean solubility that is three orders of magnitude lower than the plutonium solubility model used for the Total System Performance Assessment for the Site Recommendation. Two alternative neptunium solubility models have also been
Dissolved Concentration Limits of Radioactive Elements
International Nuclear Information System (INIS)
Y. Chen; E.R. Thomas; F.J. Pearson; P.L. Cloke; T.L. Steinborn; P.V. Brady
2003-01-01
The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of radioactive elements under possible repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, and measurements made in laboratory experiments and field work. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 radioactive elements (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium), which are important to calculated dose. Model outputs are mainly in the form of look-up tables plus one or more uncertainty terms. The rest are either in the form of distributions or single values. The results of this analysis are fundamental inputs for total system performance assessment to constrain the release of these elements from waste packages and the engineered barrier system. Solubilities of plutonium, neptunium, uranium, americium, actinium, thorium, protactinium, lead, and radium have been re-evaluated using the newly updated thermodynamic database (Data0.ymp.R2). For all of the actinides, identical modeling approaches and consistent environmental conditions were used to develop solubility models in this revision. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, activity coefficients, and selection of solubility controlling phase have been quantified or otherwise addressed. Moreover, a new blended plutonium solubility model has been developed in this revision, which gives a mean solubility that is three orders of magnitude lower than the plutonium solubility model used for the Total System Performance Assessment for the Site Recommendation. Two alternative neptunium solubility models have also been
International Nuclear Information System (INIS)
Fluegge, S.
1989-01-01
After the great survey of neutron induced radioactivity by Fermi and co-workers, the laboratories in Paris and Berlin-Dahlen tried to disentangle the complex results found in uranium. At that time neutron sources were small, activities low, and equipment very simple. Chemistry beyond uranium still was unknown. Hahn and Meitner believed to have observed three transuranic isomeric chains, a doubtful result even then. Early in 1938, Curie and Savic in Paris found an activity interpreted to be actinium, and Hahn and Meitner another to be radium. Both interpretations seemed impossible from energy considerations. Hahn and Strassmann, therefore, continued this work and succeeded to separate the new activity from radium. There remained no doubt that a barium isotope had been produced, the uranium nucleus splitting in the yet-unknown process we now call fission
New method for large scale production of medically applicable Actinium-225 and Radium-223
International Nuclear Information System (INIS)
Aliev, R.A.; Vasilyev, A.N.; Ostapenko, V.; Kalmykov, S.N.; Zhuikov, B.L.; Ermolaev, S.V.; Lapshina, E.V.
2014-01-01
Alpha-emitters ( 211 At, 212 Bi, 213 Bi, 223 Ra, 225 Ac) are promising for targeted radiotherapy of cancer. Only two alpha decays near a cell membrane result in 50% death of cancer cell and only a single decay inside the cell is required for this. 225 Ac may be used either directly or as a mother radionuclide in 213 Bi isotope generator. Production of 225 Ac is provided by three main suppliers - Institute for Transuranium Elements in Germany, Oak Ridge National Laboratory in USA and Institute of Physics and Power Engineering in Obninsk, Russia. The current worldwide production of 225 Ac is approximately 1.7 Ci per year that corresponds to only 100-200 patients that could be treated annually. The common approach for 225 Ac production is separation from mother 229 Th or irradiation of 226 Ra with protons in a cyclotron. Both the methods have some practical limitations to be applied routinely. 225 Ac can be also produced by irradiation of natural thorium with medium energy protons . Cumulative cross sections of 225 Ac, 227 Ac, 227 Th, 228 Th formations have been obtained recently. Thorium targets (1-9 g) were irradiated by 114-91 MeV proton beam (1-50 μA) at INR linear accelerator. After dissolution in 8 M HNO 3 + 0.004 M HF thorium was removed by double LLX by HDEHP in toluene (1:1). Ac and REE were pre-concentrated and separated from Ra and most fission products by DGA-Resin (Triskem). After washing out by 0.01 M HNO 3 Ac was separated from REE by TRU Resin (Triskem) in 3 M HNO 3 media. About 6 mCi 225 Ac were separated in hot cell with chemical yield 85%. The method may be upscaled for production of Ci amounts of the radionuclide. The main impurity is 227 Ac (0.1% at the EOB) but it does not hinder 225 Ac from being used for medical 225 Ac/ 213 Bi generators. (author)
The marine geochemistry of actinium-227: Evidence for its migration through sediment pore water
International Nuclear Information System (INIS)
Nozaki, Yoshiyuki; Yamada, Masatoshi; Nikaido, Hirofumi
1990-01-01
227 Ac with a half life of 21.8 years has a potential utility as a tracer of deep water circulation and mixing studies on time scales less than 100 years. Here the authors present the first measurement of 227 Ac profile in the pore water of Northwest Pacific deep-sea sediment and in the ∼10,000 m long water column of Izu-Ogasawara Trench. The results clearly show that 227 Ac is supplied from the sediment to the overlying water through migration in the pore water. The model calculation indicates that the molecular diffusion alone through sediment porewater can support only a half of the standing crop of excess 227 Ac in the water column and the enhanced supply of 227 Ac by particle mixing is necessary to account for the remainder. Thus, bioturbation in the deep sea plays an important role in controlling the flux of some short-lived radionuclides such as 227 Ac and 228 Ra across the sediment-water interface
International Nuclear Information System (INIS)
Cabrera, Adolfo L.; Toledo, Alma R.; Valle, José M. del; Fuente, Juan C. de la
2015-01-01
Highlights: • Solubility of nobiletin in supercritical carbon dioxide was obtained. • Measured at T = (313, 323, and 333) K and at (17.97 to 31.40) MPa. • Correlated with empirical equation expressed in terms of SC-CO_2 density. • Binary interaction parameters were fitted from experimental data using PR-EOS with Wong–Sandler mixing rule. • Thermodynamic consistency of phase equilibria data was evaluated using the G–D equation. - Abstract: Isothermal solubility of 2-(3,4-Dimethoxyphenyl)-5,6,7,8-tetramethoxychromen-4-one (nobiletin) in supercritical carbon dioxide at temperatures of (313, 323 and 333) K and pressures from (18 to 31) MPa was measured using an analytic-recirculation methodology, with direct determination of the molar composition of the carbon dioxide-rich phase by using high performance liquid chromatography. Results indicated that the range of the measured solubility of nobiletin was from 107 · 10"−"6 mol · mol"−"1 at T = 333 K and 18.35 MPa to 182 · 10"−"6 mol · mol"−"1 at T = 333 K and 31.40 MPa, with a temperature crossover around 18 MPa. The validation of the experimental solubility data was carried out by using three approaches, namely, estimation of combined expanded uncertainty for each solubility data point from experimental parameters values (⩽77 · 10"−"6 mol · mol"−"1); thermodynamic consistency, verified utilizing a test adapted from tools based on Gibbs–Duhem equation and solubility modelling results; and, self-consistency, proved by correlating the solubility data with a semi-empirical model as a function of temperature, pressure and pure CO_2 density.
Lee, Dong Woo; Jo, Vinna; Ok, Kang Min
2012-10-01
A novel noncentrosymmetric (NCS) gallium-organic framework material, [N(C3H7)4]3Ga3[C6H3(CO2)3]4 (CAUMOF-11) has been synthesized by a solvothermal reaction using Ga(NO3)3·xH2O, 1,3,5-C6H3(CO2H)3, N(C3H7)4Cl, HNO3, and HCON(CH3)2 at 180 °C. The structure of the reported material has been determined by single-crystal X-ray diffraction. CAUMOF-11 has an anionic three-dimensional framework with aligned four-coordinate GaO4 tetrahedra and 1,3,5-benzenetricarboxylate groups. Tetrapropylammonim cations reside within the channel and maintain the charge balance. Detailed structural analyses with full characterization including infrared spectroscopy, thermogravimetric analysis, elemental analysis, ion-exchange reactions, topotactic decomposition, and gas adsorption experiments are reported. Powder second-harmonic generating (SHG) measurements on CAUMOF-11, using 1064 nm radiation, exhibit SHG efficiency of 15 times that of α-SiO2 and the material is phase-matchable (type-1).
TMFunction data: 234 [TMFunction[Archive
Lifescience Database Archive (English)
Full Text Available Biol Chem. 2000 Jul 14;275(28):21017-24 mutagenesis ... affinity chromatography 1AJJ ... LDLR_HUMAN (P01130) Helix ... ligand binding site; surface exposed; acidic residue; conserved
BDML Metadata: 234 [SSBD[Archive
Lifescience Database Archive (English)
Full Text Available 9a-06cf-4f99-a337-01b1f9166310 0.105 x 0.105 x 0.5 (micrometer), 40 (second) http://ssbd.qbic.riken.jp/data/...source/Ce_KK_P002/RNAi_T26G10.1_070920_01/ http://ssbd.qbic.riken.jp/data/bdml/Ce..._KK_P002/RNAi_T26G10.1_070920_01.bdml0.15.xml http://ssbd.qbic.riken.jp/data/pdpml/Ce_KK_P002.pdpml0.05.xml ...http://ssbd.qbic.riken.jp/search/24115f9a-06cf-4f99-a337-01b1f9166310/ http://ssbd.qbic.riken.jp/omero/webclient/?show=dataset-167 ...
2010-10-01
... if one or more of the following exists on its line: (1) A public highway-rail crossing that is in use; (2) An at-grade rail crossing that is in use; (3) A bridge over a public road or waters used for commercial navigation; or (4) A common corridor with a railroad, i.e., its operations are within 30 feet of...
2010-01-01
... Air Carrier permit or a Certificate of Public Convenience and Necessity issued pursuant to the Federal Aviation Act of 1958 (72 Stat. 731). (b) International Airport. An international airport is one designated..., Secretary of the Treasury and the Secretary of Health and Human Services. (c) Landing Rights Airport. An...
International Nuclear Information System (INIS)
1999-01-01
The present issue contains a summary on energetic interconnections and regional integration schemes in Latin America and the Caribbean. A section is dedicated to Guyana and the impulse that it carries out in its energy sector considered as one of the fundamental pillars of its economic development. It also includes an article on the programs of energetic efficiency that OLADE executes. Besides it includes an article on the regulation of the environmental area linked to reform process of the energetic sector
2010-07-01
... operates, drives, controls, otherwise has charge of, or is in actual physical control of a mechanical mode.... Possession. Exercising direct physical control or dominion, with or without ownership, over property. State..., by compressed gas, or by spring power; any bow and arrow, crossbow, blowgun, spear gun, hand-thrown...
Pillai, Prof. Madhavan Radhakrishna
Indian Academy of Sciences (India)
Date of birth: 18 August 1960. Specialization: Tumour Biology, Tumour Virology Address: Director, Rajiv Gandhi Centre for Biotechnology, Jagathi, Thiruvananthapuram 695 014, Kerala Contact: Office: (0471) 234 7973, (0471) 234 1716. Residence: (0471) 273 3819. Mobile: 94471 45776. Fax: (0471) 234 9303
Process for radioisotope recovery and system for implementing same
Meikrantz, David H [Idaho Falls, ID; Todd, Terry A [Aberdeen, ID; Tranter, Troy J [Idaho Falls, ID; Horwitz, E Philip [Naperville, IL
2009-10-06
A method of recovering daughter isotopes from a radioisotope mixture. The method comprises providing a radioisotope mixture solution comprising at least one parent isotope. The at least one parent isotope is extracted into an organic phase, which comprises an extractant and a solvent. The organic phase is substantially continuously contacted with an aqueous phase to extract at least one daughter isotope into the aqueous phase. The aqueous phase is separated from the organic phase, such as by using an annular centrifugal contactor. The at least one daughter isotope is purified from the aqueous phase, such as by ion exchange chromatography or extraction chromatography. The at least one daughter isotope may include actinium-225, radium-225, bismuth-213, or mixtures thereof. A liquid-liquid extraction system for recovering at least one daughter isotope from a source material is also disclosed.
2010-04-26
... RITA 2008-0002] Agency Information Collection; Activity Under OMB Review; Airline Service Quality... Reports'' pursuant to 14 CFR 234.4 and 234.6. These reports are used to monitor the quality of air service.... SUPPLEMENTARY INFORMATION: OMB Approval No. 2138-0041. Title: Airline Service Quality Performance--Part 234...
2012-03-27
... 2008-0002] Agency Information Collection; Activity Under OMB Review; Airline Service Quality...'' pursuant to 14 CFR 234.4 and 234.6. These reports are used to monitor the quality of air service that... INFORMATION: OMB Approval No. 2138-0041. Title: Airline Service Quality Performance Reports--Part 234. Form No...
Thorium isotopes as indicators of scavenging rates in the Venice lagoon
International Nuclear Information System (INIS)
Cochran, J. K.; Hirschberg, D.J.; Barnes, C.
1995-01-01
The naturally occurring thorium isotopes 228 Th and 234 Th, produced in sea water from decay of 228 Ra and 238 U, respectively, were used to estimate the rate of scavenging onto particle surfaces and the rate of removal of particles from the water column of the Venice Lagoon. Large water samples (1000-2000 L) were collected at three sites in the shallow ( 2 -impregnated cartridges to extract dissolved thorium. Activities of particulate 234 Th ranged from 510 to 1335 μBq L -1 and dissolved 234 Th was -1 . Relative to calculated 238 U activities in the lagoon, the 234 Th data yielded mean residence times as short as 2 h for the scavenging of dissolved 234 Th onto particles and 12 h for the removal of particulate 234 Th. Resuspension rates of 0.6 to 8 mg cm -2 day -1 were estimated from the data on dissolved and particulate 234 Th, these values being comparable to those determined by sediment traps (1.8-9.5 mg cm -2 day -1 ) at the same sites. These results suggest that Th and other similarly reactive trace metals are removed rapidly from the waters of the Venice Lagoon to the sediments. 23 refs., 4 tabs., 2 figs
Energy Technology Data Exchange (ETDEWEB)
Yu, Lei.
1991-12-16
Samples from three time-series sediment traps deployed in the Santa Monica Basin off the California coast were analyzed to study the flux and scavenging of uranium and thorium series isotopes. Variations of uranium and thorium series isotopes fluxes in the water column were obtained by integrating these time-series deployment results. Mass and radionuclide fluxes measured from bottom sediment traps compare favorably with fluxed determined from sediment core data. This agreement suggests that the near-bottom sediment traps are capable of collecting settling particles representative of the surface sediment. The phase distributions of {sup 234}Th in the water column were calculated by an inverse method using sediment trap data, which help to study the variations of {sup 234}Th scavenging in the water column. Scavenging and radioactive decay of {sup 234}Th are the two principal processes for balancing {sup 234}Th budget in the water column. The residence times of dissolved and particulate {sup 234}Th were determined by a {sup 234}Th scavenging model.
Energy Technology Data Exchange (ETDEWEB)
Yu, Lei [Oregon State Univ., Corvallis, OR (United States)
1991-12-16
Samples from three time-series sediment traps deployed in the Santa Monica Basin off the California coast were analyzed to study the flux and scavenging of uranium and thorium series isotopes. Variations of uranium and thorium series isotopes fluxes in the water column were obtained by integrating these time-series deployment results. Mass and radionuclide fluxes measured from bottom sediment traps compare favorably with fluxed determined from sediment core data. This agreement suggests that the near-bottom sediment traps are capable of collecting settling particles representative of the surface sediment. The phase distributions of 234Th in the water column were calculated by an inverse method using sediment trap data, which help to study the variations of 234Th scavenging in the water column. Scavenging and radioactive decay of 234Th are the two principal processes for balancing 234Th budget in the water column. The residence times of dissolved and particulate 234Th were determined by a 234Th scavenging model.
International Nuclear Information System (INIS)
Ordonez-Regil, E.
1985-06-01
The consequences of alpha decay of 238 U in uranium compounds and in uranium bearing ores have been examined in two ways: leaching of 234 Th and determination of the activity ratio of 234 U and 238 U. The results have been interpreted mainly in terms of the ''hot'' character of the nascent 234 Th atoms [fr
Uranium-thorium disequilibrium in north-east Atlantic waters
International Nuclear Information System (INIS)
Smith, K.J.; Leon Vintro, L.; Mitchell, P.I.; Bally de Bois, P.; Boust, D.
2004-01-01
In this paper we report and compare the concentrations of 234 Th and 238 U measured in surface and subsurface waters collected in the course of a sampling campaign in the north east Atlantic in June-July 1998. Dissolved 234 Th concentrations in surface waters ranged from 5 to 20 Bq m -3 , showing a large deficiency relative to 238 U concentrations (typically 42 Bq m -3 ). This disequilibrium is indicative of active 234 Th scavenging from surface waters. Observed 234 Th/ 238 U activity ratios, together with corresponding 234 Th particulate concentrations, were used to calculate mean residence times for 234 Th with respect to scavenging onto particles (τ diss ) and subsequent removal from surface waters (τ part ). Residence times in the range 5-30 days were determined for τ diss and 4-18 days for τ part (n=14). In addition, ultrafiltration experiments at six stations in the course of the same expedition revealed that in north-east Atlantic surface waters a significant fraction (46±17%; n=6) of the thorium in the (operationally-defined) dissolved phase ( 234 Th is rapidly absorbed by colloidal particles, which then aggregate, albeit at a slower rate, into larger filterable particles. In essence, colloids act as intermediaries in the transition from the fully dissolved to the filter-retained (>0.45 μm) phase. Thus, the time (τ c ) for fully dissolved 234 Th to appear in the filter-retained fraction is dependent on the rate of colloidal aggregation. Here, we determined τ c values in the range 3-17 days
Energy Technology Data Exchange (ETDEWEB)
Bordenave-Montesquieu, A.; Benoit-Cattin, P.; Gleizes, A.; Marrakchi, A.I.; Dousson, S.; Hitz, D. (CEA Centre d' Etudes Nucleaires de Grenoble, 38 (France))
1984-03-14
a spectroscopic investigation of electrons coming from autoionising states N/sup 5 +/(nln'l'), with n=2,3,4 and n' >= n, of the fast ion has been made at 11.6/sup 0/ and 4.9 keV amu/sup -1/. Only exothermic reactions are observed. It is shown that the ionisation potential of the target has a strong influence on the more probable values of n and n'. In N/sup 7 +/-He collisions, the n=3, n'=3 configurations are the more excited. In N/sup 7 +/-H/sub 2/, the capture process is less selective since n=3, n' > 3 and also n=4, n' >= 4 configurations are strongly populated. In all these cases, the residual N/sup 6 +/ ion is left in an excited state (n=2 or 3). The n=2, n' > 2 excitation probability is found to be much smaller for the two collisional systems.
Energy Technology Data Exchange (ETDEWEB)
Meadows, J.W.
1986-12-01
The measurement of the fission cross section ratios of nine isotopes relative to /sup 235/U at an average neutron energy of 14.74 MeV is described with particular attention to the determination of corrections and to sources of error. The results are compared to ENDF/B-V and to other measurements of the past decade. The ratio of the neutron induced fission cross section for these isotopes to the fission cross section for /sup 235/U are: /sup 230/Th - 0.290 +- 1.9%; /sup 232/Th - 0.191 +- 1.9%; /sup 233/U - 1.132 +- 0.7%; /sup 234/U - 0.998 +- 1.0%; /sup 236/U - 0.791 +- 1.1%; /sup 238/U - 0.587 +- 1.1%; /sup 237/Np - 1.060 +- 1.4%; /sup 239/Pu - 1.152 +- 1.1%; /sup 242/Pu - 0.967 +- 1.0%. 40 refs., 11 tabs., 9 figs.
International Nuclear Information System (INIS)
Drexler, J.Z.; Paces, J.B.; Alpers, C.N.; Windham-Myers, L.; Neymark, L.A.; Bullen, T.D.; Taylor, H.E.
2014-01-01
Highlights: • Concentrations and isotopic values of Sr and U in peat were used to trace paleosalinity. • A three-end-member mixing model was constructed using values from water sources. • Paleosalinity of peat samples was determined relative to that of end members. • δ 87 Sr values were altered during and after the California Gold Rush period. • Oligohaline and freshwater marshes have long existed in the Sacramento-San Joaquin Delta. - Abstract: The purpose of this study was to determine the history of paleosalinity over the past 6000+ years in the Sacramento-San Joaquin Delta (the Delta), which is the innermost part of the San Francisco Estuary. We used a combination of Sr and U concentrations, δ 87 Sr values, and 234 U/ 238 U activity ratios (AR) in peat as proxies for tracking paleosalinity. Peat cores were collected in marshes on Browns Island, Franks Wetland, and Bacon Channel Island in the Delta. Cores were dated using 137 Cs, the onset of Pb and Hg contamination from hydraulic gold mining, and 14 C. A proof of concept study showed that the dominant emergent macrophyte and major component of peat in the Delta, Schoenoplectus spp., incorporates Sr and U and that the isotopic composition of these elements tracks the ambient water salinity across the Estuary. Concentrations and isotopic compositions of Sr and U in the three main water sources contributing to the Delta (seawater, Sacramento River water, and San Joaquin River water) were used to construct a three-end-member mixing model. Delta paleosalinity was determined by examining variations in the distribution of peat samples through time within the area delineated by the mixing model. The Delta has long been considered a tidal freshwater marsh region, but only peat samples from Franks Wetland and Bacon Channel Island have shown a consistently fresh signal (<0.5 ppt) through time. Therefore, the eastern Delta, which occurs upstream from Bacon Channel Island along the San Joaquin River and its
The chemistry of the actinide elements. Volume I
International Nuclear Information System (INIS)
Katz, J.J.; Seaborg, G.T.; Morss, L.R.
1986-01-01
The Chemistry of the Actinide Elements is a comprehensive, contemporary and authoritative exposition of the chemistry and related properties of the 5f series of elements: actinium, thorium, protactinium, uranium and the first eleven. This second edition has been completely restructured and rewritten to incorporate current research in all areas of actinide chemistry and chemical physics. The descriptions of each element include accounts of their history, separation, metallurgy, solid-state chemistry, solution chemistry, thermo-dynamics and kinetics. Additionally, separate chapters on spectroscopy, magnetochemistry, thermodynamics, solids, the metallic state, complex ions and organometallic compounds emphasize the comparative chemistry and unique properties of the actinide series of elements. Comprehensive lists of properties of all actinide compounds and ions in solution are given, and there are special sections on such topics as biochemistry, superconductivity, radioisotope safety, and waste management, as well as discussion of the transactinides and future elements
A neutron source of variable fluence
International Nuclear Information System (INIS)
Brachet, Guy; Demichel, Pascal; Prigent, Yvon; Riche, J.C.
1975-01-01
The invention concerns a variable fluence neutron source, like those that use in the known way a reaction between a radioactive emitter and a target, particularly of type (α,n). The emitter being in powder form lies in a carrier fluid forming the target, inside a closed containment. Facilities are provided to cause the fluidisation of the emitter by the carrier fluid in the containment. The fluidisation of the emitting powder is carried out by a booster with blades, actuated from outside by a magnetic coupling. The powder emitter is a α emitter selected in the group of curium, plutonium, thorium, actinium and americium oxides and the target fluid is formed of compounds of light elements selected from the group of beryllium, boron, fluorine and oxygen 18. The target fluid is a gas used under pressure or H 2 O water highly enriched in oxygen 18 [fr
Defective FANCI binding by a fanconi anemia-related FANCD2 mutant.
Directory of Open Access Journals (Sweden)
Koichi Sato
Full Text Available FANCD2 is a product of one of the genes associated with Fanconi anemia (FA, a rare recessive disease characterized by bone marrow failure, skeletal malformations, developmental defects, and cancer predisposition. FANCD2 forms a complex with FANCI (ID complex and is monoubiquitinated, which facilitates the downstream interstrand crosslink (ICL repair steps, such as ICL unhooking and nucleolytic end resection. In the present study, we focused on the chicken FANCD2 (cFANCD2 mutant harboring the Leu234 to Arg (L234R substitution. cFANCD2 L234R corresponds to the human FANCD2 L231R mutation identified in an FA patient. We found that cFANCD2 L234R did not complement the defective ICL repair in FANCD2-/- DT40 cells. Purified cFANCD2 L234R did not bind to chicken FANCI, and its monoubiquitination was significantly deficient, probably due to the abnormal ID complex formation. In addition, the histone chaperone activity of cFANCD2 L234R was also defective. These findings may explain some aspects of Fanconi anemia pathogenesis by a FANCD2 missense mutation.
International Nuclear Information System (INIS)
Skwarzec, B.; Borylo, A.; Kosinska, A.; Radzajewska, S.
2010-01-01
The principal sources of polonium and uranium radionuclides the Wislinka area waste dump are phosphorites and phosphogypsum produced by the Phosphoric Fertilizers Industry of Gdansk. The values of uranium and polonium concentration in water with immediate surroundings of waste heap are considerably higher than in the waters of the Martwa Wisla river. The activity ratio 234 U/ 238 U is approximately about one in the phosphogypsum (0.97±0.06 and 0.99±0.04) and in the water of a retention reservoir and a pumping station (0.92±0.01 and 0.99±0.04), while in the water from the Martwa Wisla river is slightly higher than one (1.00±0.07 and 1.06±0.02). The leaching process of uranium and polonium from the phosphogypsum waste heap is responsible for the maximum uranium concentration (1097±6 μg·dm -3 and 1177±6 μg·dm -3 ) and the high 210 Po concentration (131.4±0.9 mBq·dm -3 and 165.7±1.4 mBq·dm -3 ) in the retention reservoir. The major source of polonium and uranium in plants are wet and dry atmospheric falls gathering soil and air dust from the phosphogypsum waste dump and root system. The highest uranium and polonium concentrations were found in older part of grasses (yellow oatgrass, meadow foxtail, moneywort), exposed to atmospheric falls for a long time. The maximum concentrations of 210 Po were characterized for samples of plant root collected at the retention reservoir (150.50±4.97 and 108.55±3.95 Bq·kg -1 dry mass). Polonium and uranium concentrations in water samples of the Martwa Wisla river are relatively low in comparison with the value in the retention reservoir and pumping station near the phosphogypsum waste heap. This suggests that the radionuclides could be leached from the dumping site to the surrounding environment. (authors)
36 CFR 2.34 - Disorderly conduct.
2010-07-01
... recklessly creating a risk thereof, such person commits any of the following prohibited acts: (1) Engages in..., regardless of land ownership, on all lands and waters within a park area that are under the legislative...
Publications | Page 234 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
In the MENA region, gender and work is an important topic that has attracted a great ... Further, due to its diverse and multiple island states, research capacity is scattered and. ... What role for industrial policy in the Asia-Pacific after the crisis?
32 CFR 234.7 - Disorderly conduct.
2010-07-01
... threatening, or in violent behavior. (b) Uses language, an utterance, or gesture, or engages in a display or... injury or incite an immediate breach of the peace. (c) Makes noise that is unreasonable, considering the...
Publications | Page 234 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Their survival depends heavily on access to the natural. ... Food security and minor crops in Uganda: the farmers' perspective and policy implications ... Does the data support the neo-mercantilist preoccupation with protecting manufacturing?
40 CFR 52.234 - Source surveillance.
2010-07-01
...) Lake County APCD. (9) Mariposa County APCD. (10) Mendocino County APCD. (11) Nevada County APCD. (12... County APCD. (8) Los Angeles County APCD. (9) Mariposa County APCD. (10) Monterey Bay Unified APCD. (11...
Studying of isotope structure of uranium by alpha-spectrometric method
International Nuclear Information System (INIS)
Sattarov, G.S.; Muzafarov, A.M.; Petukhov, O.F.; Petrenko, V.Z.
2004-01-01
Full text: The knowledge of isotope structure of uranium in waters, in minerals and in finished goods gives the helpful information on the radiation and nuclear-physical processes occurring in natural environments. Besides, customers put a question before uranium producing enterprises on the control of limiting concentration of an isotope 234 U in finished goods (uranium protoxide-oxide). For these reasons studying and development of techniques of definition of isotope structure of uranium is an actual task. In this connection for researches alpha - spectrometers 'PROGRESS-ALPHA' produced by R and D 'DOZE' Russia and firms 'Canberra' the USA were used. The isotope structure of uranium ( 234 U, 235 U, 238 U) was determined on a known ratio 234 U/ 238 U, which is equal to 53,41micrograms/gram. Identification of isotopes carried out by 4198 keV ( 235 U), 4395 keV ( 234 U) and 4773 keV ( 238 U). The technique of radiochemical preparation of samples to the analysis included: clearing of organic chemistry and preventing natural isotopes; drawing by a method electrolytic sedimentation on a metal substrate (d=24mm) an active stain, the area 4,5 cm 2 , with isotropy distribution of ions 234 U, 235 U, 238 U. As standards, the international and All-Russian standards with known contents 234 U were used. The isotope structure of uranium in uranium protoxide-oxide, chemical concentrates, technological solutions is determined. Infringements of isotope balance 234 U/ 238 U on separate sites of fulfilled uranium deposits and in technological products are found out
Concentrations of uranium and thorium isotopes in uranium millers' and miners' tissues
International Nuclear Information System (INIS)
Wrenn, M.E.; Singh, N.P.; Paschoa, A.S.; Lloyd, R.D.; Saccomanno, G.
1985-09-01
The alpha-emitting isotopes of uranium and thorium were determined in the lungs of 14 former uranium miners and in soft tissues and bones of three miners and two millers. These radionuclides were also determined in soft tissues and bones of seven normal controls. The average concentrations in pCi/kg wet weight in 17 former miners' lungs are as follows: 238 U, 75; 234 U, 80; 230 Th, 79. Concentrations of each nuclide ranged from 2 to 325 pCi/kg. The average ratio of 238 U/ 234 U was 0.92, ranging from 0.64 to 1.06. The mean ratio of 230 Th/ 234 U was 1.04, ranging from 0.33 to 3.54. The near equilibrium between 230 Th and /sup 238,234/U indicates that the rate of elimination of uranium and thorium from lungs is the same in former uranium miners. The concentrations of 234 U and 238 U were highest in lung; however, the concentration of 230 Th in bones was either higher than or comparable to its concentration in lung. The concentration ratios of 230 Th/ 234 U in bone of uranium miners and millers measured in our laboratory have been compared with results predicted by ICRP-30 metabolic models. These results indicate that the ICRP metabolic models for thorium and uranium were only marginally successful in predicting the ratio of 230 Th/ 234 U in bones, and that effective release rate of uranium from skeleton may be more rapid than predicted by the ICRP model. 9 figs., 21 tabs
Planchon, F.; Cavagna, A.-J.; Cardinal, D.; André, L.; Dehairs, F.
2013-02-01
As part of the GEOTRACES Bonus-GoodHope (BGH) expedition (January-March 2008) in the Atlantic sector of the Southern Ocean, particulate organic carbon (POC) export was examined from the surface to the mesopelagic twilight zone using water column distributions of total 234Th and biogenic particulate Ba (Baxs). Surface POC export production was estimated from steady state and non steady state modelling of 234Th fluxes, which were converted into POC fluxes, using the POC/234Th ratio of large, potentially sinking particles (> 53 μm) collected via in situ pumps. Deficits in 234Th activities were observed at all stations from the surface to the bottom of the mixed layer, yielding 234Th export fluxes from the upper 100 m of 496 ± 214 dpm m-2 d-1 to 1195 ± 158 dpm m-2 d-1 for the steady state model and of 149 ±517 dpm m-2 d-1 to 1217 ± 231 dpm m-2 d-1 for the non steady state model. Using the POC/234Thp ratio of sinking particles (ratios varied from 1.7 ± 0.2 μmol dpm-1 to 4.8 ± 1.9 μmol dpm-1) POC export production at 100 m was calculated to range between 0.9 ± 0.4 and 5.1 ± 2.1 mmol C m-2 d-1,assuming steady state and between 0.3 ± 0.9 m-2 d-1 and 4.9 ± 3.3 mmol C m-2 d-1, assuming non steady state. From the comparison of both approaches, it appears that during late summer export decreased by 56 to 16% for the area between the sub-Antarctic zone and the southern Antarctic Circumpolar Current Front (SACCF), whereas it remained rather constant over time in the HNLC area south of the SACCF. POC export represented only 6 to 54% of new production, indicating that export efficiency was, in general, low, except in the vicinity of the SACCF, where export represented 56% of new production. Attenuation of the POC sinking flux in the upper mesopelagic waters (100-600 m depth interval) was evidenced both, from excess 234Th activities and from particulate biogenic Ba (Baxs) accumulation. Excess 234Th activities, reflected by 234Th/238U ratios as large as 1.21 ± 0
International Nuclear Information System (INIS)
Marx, Sebastian Markus
2014-01-01
The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.
International Nuclear Information System (INIS)
Ragavan, Anpalaki J.
2006-01-01
Linear free energy relationships for trivalent cations with crystalline M 2 O 3 and, M(OH) 3 phases of lanthanides and actinides were developed from known thermodynamic properties of the aqueous trivalent cations, modifying the Sverjensky and Molling equation. The linear free energy relationship for trivalent cations is as ΔG f,MvX 0 =a MvX ΔG n,M 3+ 0 +b MvX +β MvX r M 3+ , where the coefficients a MvX , b MvX , and β MvX characterize a particular structural family of MvX, r M 3+ is the ionic radius of M 3+ cation, ΔG f,MvX 0 is the standard Gibbs free energy of formation of MvX and ΔG n,M 3+ 0 is the standard non-solvation free energy of the cation. The coefficients for the oxide family are: a MvX =0.2705, b MvX =-1984.75 (kJ/mol), and β MvX =197.24 (kJ/molnm). The coefficients for the hydroxide family are: a MvX =0.1587, b MvX =-1474.09 (kJ/mol), and β MvX =791.70 (kJ/molnm).
Development of ion beam sputtering techniques for actinide target preparation
International Nuclear Information System (INIS)
Aaron, W.S.; Zevenbergen, L.A.; Adair, H.L.
1985-01-01
Ion beam sputtering is a routine method for the preparation of thin films used as targets because it allows the use of minimum quantity of starting material, and losses are much lower than most other vacuum deposition techniques. Work is underway in the Isotope Research Materials Laboratory (IRML) at ORNL to develop the techniques that will make the preparation of actinide targets up to 100 μg/cm 2 by ion beam sputtering a routinely available service from IRML. The preparation of the actinide material in a form suitable for sputtering is a key to this technique, as is designing a sputtering system that allows the flexibility required for custom-ordered target production. At present, development work is being conducted on low-activity in a bench-top system. The system will then be installed in a hood or glove box approved for radioactive materials handling where processing of radium, actinium, and plutonium isotopes among others will be performed. (orig.)
Development of ion beam sputtering techniques for actinide target preparation
Aaron, W. S.; Zevenbergen, L. A.; Adair, H. L.
1985-06-01
Ion beam sputtering is a routine method for the preparation of thin films used as targets because it allows the use of a minimum quantity of starting material, and losses are much lower than most other vacuum deposition techniques. Work is underway in the Isotope Research Materials Laboratory (IRML) at ORNL to develop the techniques that will make the preparation of actinide targets up to 100 μg/cm 2 by ion beam sputtering a routinely available service from IRML. The preparation of the actinide material in a form suitable for sputtering is a key to this technique, as is designing a sputtering system that allows the flexibility required for custom-ordered target production. At present, development work is being conducted on low-activity actinides in a bench-top system. The system will then be installed in a hood or glove box approved for radioactive materials handling where processing of radium, actinium, and plutonium isotopes among others will be performed.
International Nuclear Information System (INIS)
Berven, B.A.; Goldsmith, W.A.; Haywood, F.F.; Schiager, K.J.
1979-01-01
Many sites used during the early days of the US atomic energy program are contaminated with radionuclides of the primordial decay chains (uranium, thorium, and actinium series). This contamination consists of residues resulting from refining and processing uranium and thorium. Preparation of these sites for release to unrestricted private use will involve the assistance of construction workers, many of whom have limited knowledge of the hazards associated with radioactive materials. Therefore, there is a need to educate these workers in the fundamentals of radioactive material handling to minimize exposures and possible spread of contamination. This training should disseminate relevant information at an appropriate educational level and should instill a cautious, common-sense attitude toward the handling of radioactive materials. The training should emphasize basic information concerning environmental radiation within a context of relative risk. A multi-media format, including colorful visual aids, demonstration, and discussion, should be used to maximize motivation and retention. A detailed, proposed training program design is presented
Prikryl, James D.; Pickett, David A.; Murphy, William M.; Pearcy, English C.
1997-04-01
Oxidation of pyrite at the Nopal I uranium deposit, Peña Blanca district, Chihuahua, Mexico has resulted in the formation of Fe-oxides/hydroxides. Anomalous U concentrations (i.e. several hundred to several thousand ppm) measured in goethite, hematite, and amorphous Fe-oxyhydroxides in a major fracture that crosscuts the deposit and the absence of U minerals in the fracture suggest that U was retained during secondary mineral growth or sorbed on mineral surfaces. Mobilization and transport of U away from the deposit is suggested by decreasing U concentrations in fracture-infilling materials and in goethite and hematite with distance from the deposit. Greater than unity {234U}/{238U} activity ratios measured in fracture-infilling materials indicate relatively recent ( < 1 Ma) U uptake from fluids that carried excess 234U. Systematic decreases in {234U}/{238U} activity ratios of fracture materials with distance from the deposit suggest a multistage mobilization process, such as remobilization of U from 234U-enriched infill minerals or differential or diminished transport of U-bearing solutions containing excess 234U.
Directory of Open Access Journals (Sweden)
R. Léguillon
2016-10-01
Full Text Available It is shown that the multinucleon transfer reactions is a powerful tool to study fission of exotic neutron-rich actinide nuclei, which cannot be accessed by particle-capture or heavy-ion fusion reactions. In this work, multinucleon transfer channels of the 18O+232Th reaction are used to study fission of fourteen nuclei 231,232,233,234Th, 232,233,234,235,236Pa, and 234,235,236,237,238U. Identification of fissioning nuclei and of their excitation energy is performed on an event-by-event basis, through the measurement of outgoing ejectile particle in coincidence with fission fragments. Fission fragment mass distributions are measured for each transfer channel, in selected bins of excitation energy. In particular, the mass distributions of 231,234Th and 234,235,236Pa are measured for the first time. Predominantly asymmetric fission is observed at low excitation energies for all studied cases, with a gradual increase of the symmetric mode towards higher excitation energy. The experimental distributions are found to be in general agreement with predictions of the fluctuation–dissipation model.
Testing the Concept of Drift Shadow at Yucca Mountain, Nevada
International Nuclear Information System (INIS)
J.B. Paces; L.A. Neymark; T. Ghezzehei; P.F. Dobson
2006-01-01
If proven, the concept of drift shadow, a zone of reduced water content and slower ground-water travel time beneath openings in fractured rock of the unsaturated zone, may increase performance of a proposed geologic repository for high-level radioactive waste at Yucca Mountain. To test this concept under natural-flow conditions present in the proposed repository horizon, isotopes within the uranium-series decay chain (uranium-238, uranium-234, and thorium-230, or 238 U- 234 U- 230 Th) have been analyzed in samples of rock from beneath four naturally occurring lithophysal cavities. All samples show 234 U depletion relative to parent 238 U, indicating varying degrees of water-rock interaction over the past million years. Variations in 234 U/ 238 U activity ratios indicate that depletion of 234 U relative to 238 U can be either smaller or greater in rock beneath cavity floors relative to rock near cavity margins. These results are consistent with the concept of drift shadow and with numerical simulations of meter-scale spherical cavities in fractured tuff. Differences in distribution patterns of 234 U/ 238 U activity ratios in rock beneath the cavity floors are interpreted to reflect differences in the amount of past seepage into lithophysal cavities, as indicated by the abundance of secondary mineral deposits present on the cavity floors
International Nuclear Information System (INIS)
Lima, Marina Ferreira
1992-01-01
The distribution coefficients (Kd) were determined in order to foresee the fate of the radionuclides discharged to the environment. Based upon the source-term released by IPEN's facilities in Pinheiros River during the year of 1988, three radionuclides were chosen as being the more critical, according to the radiation protection standards: 137 Cs, 60 Co and 232 Th. Their Kd were determined experimentally in laboratory by using the corresponding radioactive tracers 134 Cs, 60 Co and 234 Th. Three different experimental methodologies were used: the static method. the shaken method and the dynamic method. The parameters studied were the effects of pH, aerobic condition and time of contact. No considerable changes were observed for the cesium Kd with the variation of pH and aerobic condition, the kd extreme values being 20 ml/g and 30 ml/g for the pH range between 4 and 8. The study of the time of contact showed that the equilibrium between the cesium concentration in the water and sediment was achieved in a few days. For the cobalt, the pH effect was considerable, since the Kd increased from 46 ml/g for pH 4 to 2,25x10 3 ml/g for pH 8. The Kd observed with the agitation with air was around 420 ml/g, rising to 670 ml/g with the agitation with N 2 . The results obtained in the study of the time of contact effect showed that the equilibrium between the cobalt concentration in the water and sediment was not achieved even after 15 days of contact. For the thorium, also, the pH effect was considerable, since the Kd increased fram 1,40 x 10 5 ml/g for pH 4 to 2,55 x 10 6 ml/g for pH 8. No effect was observed, on the other hand, for the kd values obtained in the experiment carried out with air agitation or N 2 agitation, around 2,75 x 10 6 ml/g. The results obtained in the study of the time of contact effect showed that the equilibrium between the thorium concentration in the water and sediment was achieved after just one hour of contact. The results obtained can be
Efficiency defense and administrative fuzziness in merger regulation
Czech Academy of Sciences Publication Activity Database
Medvedev, Andrei
-, č. 234 (2004), s. 1-42 ISSN 1211-3298 Institutional research plan: CEZ:AV0Z7085904 Keywords : merger regulation * efficiency defense Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp234.pdf
International Nuclear Information System (INIS)
Stuart, B.O.; Jackson, P.O.
1975-01-01
In previous studies the biological dispositions of individual long-lived alpha members of the uranium chain ( 238 U, 234 U and 230 Th) were determined during and following repeated inhalation exposures of rats to pitchblende (26 percent U 3 O 8 ) ore. Although finely dispersed ore in secular equilibrium was inhaled, 230 Th/ 234 U radioactivity ratios in the lungs rose from 1.0 to 2.5 during 8 weeks of exposures and increased to 9.2 by four months after cessation of exposures. Marked non-equilibrium levels were also found in the tracheobronchial lymph nodes, kidneys, liver, and femur. Daily exposures of beagle dogs to high levels of this ore for 8 days resulted in lung 230 Th/ 234 U ratios of >2.0. Daily exposures of dogs to lower levels (0.1 mg/1) for 6 months, with sacrifice 15 months later, resulted in lung and thoracic lymph node 230 Th/ 234 U ratios ranging from 3.6 to 9 and nearly 7, respectively. The lungs of hamsters exposed to carnotite (4 percent U 3 O 8 ) ore in current lifespan studies show 230 Th/ 234 U ratios as high as 2.0 during daily inhalation of this ore in secular equilibrium. Beagle dogs sacrificed after several years of daily inhalations of the same carnotite ore plus radon daughters also showed marked non-equilibrium ratios of 230 Th/ 234 U, ranging from 5.6 to 7.4 in lungs and 6.2 to 9.1 in thoracic lymph nodes. This pattern of higher retention of 230 Th than 234 U in lungs, thoracic lymph nodes, and other tissues is thus consistent for two types of uranium ore among several species and suggests a reevaluation of maximum permissible air concentrations of ore, currently based only on uranium content
Conceptual model: possible changes of the seawater uranium isotopic composition through time
Energy Technology Data Exchange (ETDEWEB)
Nowitzki, Hannah; Frank, Norbert; Fohlmeister, Jens [Universitaet Heidelberg (Germany)
2015-07-01
U behaves in seawater like a conservative element. More than 99% of the oceanic U content is {sup 238}U, whereas {sup 234}U is only present in trace amounts. As the residence time of U is significantly longer than the mixing time of the ocean, the ocean is well mixed with respect to U and its isotopic composition (Dunk 2002). Moreover, living corals incorporate U without isotopic fractionation. Therefore, the past seawater isotopic evolution of ({sup 234}U/{sup 238}U) can be accessed via U/Th age-dating of corals and the subsequent calculation of the initial ({sup 234}U/{sup 238}U) value. The isotopic ({sup 234}U/{sup 238}U) composition of seawater during the last 360 ka scatters around the modern seawater value (δ{sup 234}U ∼ (145±15) %, Henderson 2002). As these variations in the δ{sup 234}U value are rather small, a 'constant seawater isotopic composition hypothesis' is often used to validate U/Th ages of fossil corals. However, some authors find that the variability of the isotopic composition exceeds the expected range and suggest that it provides valuable information on variations in continental weathering and global run-off fluctuations or sea-level changes. This work will attempt to compare literature data of the seawater U isotopic composition to the results of a conceptual box-model of the oceanic U budget.
International Nuclear Information System (INIS)
Sarin, M.M.; Rengarajan, R.; Somayajulu, B.L.K.
1994-01-01
Vertical and temporal variations in the activities of 234 Th, 210 Po and 210 Pb have been measured, in both dissolved and particulate phases, at several stations in the eastern Arabian Sea and north-central Bay of Bengal. A comparative study allows us to make inferences about the particle associated scavenging processes in these two seas having distinct biogeochemical properties. A common feature of the 234 Th profiles, in the Arabian Sea and Bay of Bengal, is that the dissolved as well as total (dissolved + particulate) activity of 234 Th is deficient in the surface 200 m with respect of its parent, 238 U. This gross deficiency is attributed to the preferential removal of 234 Th by adsorption onto settling particles which account for its net loss from the surface waters. The scavenging rates of dissolved 234 Th are comparable in these two basins. The temporal variations in the 234 Th- 238 U disequilibrium are significantly pronounced both in the Arabian Sea and Bay of Bengal indicating that the scavenging rates are more influenced by the increased abundance of particles rather than their chemical make-up. The Bay of Bengal and the Arabian Sea appear to be the regions of most intense particle moderated scavenging processes in the world oceans. This is evidenced by the gross disequilibria exhibited by the three isotope pairs used in this study. (author). 33 refs., 8 figs., 5 tabs
Energy Technology Data Exchange (ETDEWEB)
Nagano, Tetsushi; Yanase, Nobuyuki; Ohnuki, Toshihiko [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Sato, Tsutomu; Isobe, Hiroshi; Williams, I.S.; Zaw, M.; Payne, T.E.; Airey, P.L.
1999-03-01
The SHRIMP analyses have been conducted for rock samples from the Koongarra secondary ore deposit to obtain activity ratios of {sup 234}U/{sup 238}U and isotopic ratios of {sup 207}Pb/{sup 206}Pb and {sup 204}Pb/{sup 206}Pb. Target minerals for the analyses were iron minerals and kaolinite, which are the main weathering products in this area. The activity ratios of {sup 234}U/{sup 238}U were obtained based on counts at masses of uranium metal. The {sup 234}U/{sup 238}U activity ratios based on counts of uranium oxides were not appropriate, because count rates of {sup 234}U{sup 16}O were interfered by those of {sup 238}U{sup 12}C molecule. The activity ratios of {sup 234}U/{sup 238}U were approximately unity for crystalline iron nodules. This fact suggested that the mean residence time of uranium within the iron nodules was at least 1 million years. On the other hand, slightly higher values than unity were obtained for kaolinite. Lead isotopes were investigated and a positive relationship was recognized between {sup 207}Pb/{sup 206}Pb and {sup 204}Pb/{sup 206}Pb isotope ratios. (author)
Tropical Engineering. Design Manual-11.1.
1980-03-01
Concrete exposed to the weather 3" (c) Interior beams and columns 2" (d) Interior walls and slabs 1-1/2" (e) Slabs on grade (wire fabric) 1/2 thickness of... connection design and field fabrica- tion of precast member joints. a. Prestressed Concrete Member. The use of prestressed concrete for structural members...Concrete in contact with ground 3" 3" (b) Concrete exposed to the weather 2" " (c) Interior beams and columns 1-1/2" 2" (d) Interior walls and slabs 1-1/2
2010-07-19
... DEPARTMENT OF TRANSPORTATION Research & Innovative Technology Administration [Docket ID Number RITA 2008-0002] Agency Information Collection; Activity Under OMB Review; Airline Service Quality...: Airline Service Quality Performance--Part 234. Form No.: BTS Form 234. Type Of Review: Re-instatement of...
West African Journal of Radiology: Contact
African Journals Online (AJOL)
Principal Contact. Dr BC Umerah Editor-in-Chief Lagos State University Teaching Hospital. Department of Radiology University of Nigeria Teaching Hospital Enugu State Nigeria. Phone: +234-042-303105. Email: editor_wajr@yahoo.com. Support Contact. Dr IJ Okoye Phone: +234-080 3314449
Gender | Page 234 | IDRC - International Development Research ...
International Development Research Centre (IDRC) Digital Library (Canada)
“And I thought: I'm really not making the world a better place,” she says. ... and their full potential as citizens and equal partners in decision-making and development. ... Equity issues are again attracting attention from academics and policy ...
29 CFR 1952.234 - Final approval determination.
2010-07-01
... production, or the post-harvest processing of agricultural or horticultural commodities. (c) Kentucky is... Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION... agricultural establishment where employees are engaged in “agricultural employment” within the meaning of the...
AIMSsim Version 2.3.4 - User Manual
National Research Council Canada - National Science Library
Schoenborn, Oliver; Lachance, Patrick; Bahramifarid, Nima
2008-01-01
This user manual provides an overview of the software functionality developed to support the empirical investigation of a simulated user interface for an Advanced Integrated Multi-sensor Surveillance (AIMS) system...
36 CFR 223.234 - Determination of responsibility.
2010-07-01
... declared high bidder has a satisfactory record of integrity and business ethics; (4) The declared high bidder has or is able to obtain equipment and supplies suitable for harvesting the special forest product...
Gender | Page 234 | IDRC - International Development Research ...
International Development Research Centre (IDRC) Digital Library (Canada)
Language French. IDRC has supported poor women in developing countries in their efforts to learn, to earn, and to take part in local decision-making. University degrees and decent jobs make it easier for women to speak up and demand their rights as full citizens. Download the Lasting Impacts Brief of this issue. (PDF ...
49 CFR 234.275 - Processor-based systems.
2010-10-01
...) Applicable definitions. The definitions in § 236.903 of this chapter shall apply to this section, where applicable. (b) Use of performance standard authorized or required. (1) In lieu of compliance with the... are satisfied using alternative means. Deviation from those particular requirements is authorized if...
NCBI nr-aa BLAST: CBRC-TSYR-01-0087 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TSYR-01-0087 ref|YP_002824787.1| conserved hypothetical protein, contains ice nucleation... protein domain [Rhizobium sp. NGR234] gb|ACP24034.1| conserved hypothetical protein, contains ice nucleation protein domain [Rhizobium sp. NGR234] YP_002824787.1 1e-17 20% ...
NCBI nr-aa BLAST: CBRC-TSYR-01-0156 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TSYR-01-0156 ref|YP_002824783.1| conserved hypothetical protein, contains ice nucleation... protein domain [Rhizobium sp. NGR234] gb|ACP24030.1| conserved hypothetical protein, contains ice nucleation protein domain [Rhizobium sp. NGR234] YP_002824783.1 3e-18 20% ...
NCBI nr-aa BLAST: CBRC-TSYR-01-1411 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TSYR-01-1411 ref|YP_002824787.1| conserved hypothetical protein, contains ice nucleation... protein domain [Rhizobium sp. NGR234] gb|ACP24034.1| conserved hypothetical protein, contains ice nucleation protein domain [Rhizobium sp. NGR234] YP_002824787.1 4e-43 18% ...
NCBI nr-aa BLAST: CBRC-TSYR-01-0087 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TSYR-01-0087 ref|YP_002824783.1| conserved hypothetical protein, contains ice nucleation... protein domain [Rhizobium sp. NGR234] gb|ACP24030.1| conserved hypothetical protein, contains ice nucleation protein domain [Rhizobium sp. NGR234] YP_002824783.1 2e-18 19% ...
Uranium half-lives: a critical review
International Nuclear Information System (INIS)
Holden, N.E.
1981-01-01
The experimental data are evaluated and values for the spontaneous fission half-life of 238 U and the total half-lives for 232 U, 233 U, 234 U, 235 U, 236 U, and 238 U are recommended. Also the variation of the isotopic abundance of 234 U in nature and the error involved in the assumption of secular equilibrium between 234 U and 238 U in the determination of the specific activity of natural uranium samples are discussed. The recommended half-life values and 95% confidence limits are: 238 U spontaneous fission: 8.09 +- 0.26 x 10 15 years; 232 U total: 69.8 +- 1.0 years; 233 U total: 1.592 +- 0.002 x 10 5 years; 234 U total: 2.454 +- 0.006 x 10 5 years; 235 U total: 7.037 +- 0.011 x 10 8 years; 236 U total: 2.342 +- 0.003 x 10 7 years 238 U total: 4.468 +- 0.005 x 10 9 years
International Nuclear Information System (INIS)
Latham, A.G.; Schwarcz, H.P.
1987-01-01
The removal of U from granitic rocks is characterised by 234 U/ 238 U 230 Th/ 234 U > 1. It is notable, from weathered Eye-Dashwa lakes (Canada) granite samples and from the published data, that 230 Th/ 234 U ratios seldom exceed a limiting value of about 2. A U-leach model is discussed in detail which may account for these observations. The model assumes that 230 Th is practically immobile and that the removal of U can then be measured against the decay rate of the unsupported 230 Th. A property of the model is that the isotope ratios reach constant values reflecting a kind of ''secular equilibrium'', and this implies that U is seldom removed faster than the decay of 230 Th. If the limited 230 Th/ 234 U ratios from the data correspond to ''secular equilibrium'' ratios then this allows simple calculation of U-leach rates from any given subsurface sample. (author)
International Nuclear Information System (INIS)
Schilk, A.J.; Knopf, M.A.
1994-07-01
W tested a high-energy beta scintillation sensor to evaluate its efficacy in continually characterizing washed soils moving on a conveyor belt at Fernald's Soil Decontamination Pilot Plant (SDPP). This sensor was originally developed for monitoring uranium-contaminated soils in the field. It has a multi-layer design that enables it to discriminate against lower-energy beta particles from natural sources. It can also distinguish, to some extent, gamma rays and cosmic-induced species. The sensor detects uranium activity indirectly, based on the assumption that secular equilibrium exists between the targeted radionuclide ( 234m Pa) and its parent ( 238 U). Several 1-h background counts were made at the SDPP each day of the evaluation period. The average background count rate was found to be comparable to that observed under previous laboratory conditions. Static runs were performed on soils from SDPP test runs No. 1 and No. 17 to determine the extent of any residual activity following the decontamination process. Soils were found to contain 158±30 pCi/g and 114±25 pCi/g of 234 Th- 234m Pa ( 238 U?), respectively. But the soils had considerable moisture, and concern existed that this moisture would act as an additional beta attenuator and thereby give results that were erroneously low. Therefore, a soil sample was baked overnight, and the hard-baked clay that resulted was ground into small fragments and counted. This sample was counted for 30 min as before, and the total activity was determined to be 313±44 pCi/g of 234 Th 234m Pa ( 238 U?). Based on the test No. 1 results, a dry-to-wet activity ratio of 1.98 has been established. Hence, if the moisture content of test No. 17 was equivalent to that of test No. 1, the actual 234 Th- 234m Pa ( 238 U?) activity level is expected to be approximately 226 pCi/g
An Mcm10 Mutant Defective in ssDNA Binding Shows Defects in DNA Replication Initiation.
Perez-Arnaiz, Patricia; Kaplan, Daniel L
2016-11-20
Mcm10 is an essential protein that functions to initiate DNA replication after the formation of the replication fork helicase. In this manuscript, we identified a budding yeast Mcm10 mutant (Mcm10-m2,3,4) that is defective in DNA binding in vitro. Moreover, this Mcm10-m2,3,4 mutant does not stimulate the phosphorylation of Mcm2 by Dbf4-dependent kinase (DDK) in vitro. When we expressed wild-type levels of mcm10-m2,3,4 in budding yeast cells, we observed a severe growth defect and a substantially decreased DNA replication. We also observed a substantially reduced replication protein A- chromatin immunoprecipitation signal at origins of replication, reduced levels of DDK-phosphorylated Mcm2, and diminished Go, Ichi, Ni, and San (GINS) association with Mcm2-7 in vivo. mcm5-bob1 bypasses the growth defect conferred by DDK-phosphodead Mcm2 in budding yeast. However, the growth defect observed by expressing mcm10-m2,3,4 is not bypassed by the mcm5-bob1 mutation. Furthermore, origin melting and GINS association with Mcm2-7 are substantially decreased for cells expressing mcm10-m2,3,4 in the mcm5-bob1 background. Thus, the origin melting and GINS-Mcm2-7 interaction defects we observed for mcm10-m2,3,4 are not explained by decreased Mcm2 phosphorylation by DDK, since the defects persist in an mcm5-bob1 background. These data suggest that DNA binding by Mcm10 is essential for the initiation of DNA replication. Copyright © 2016 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Jun Li
2014-01-01
Full Text Available Background. Several common single-nucleotide polymorphisms (SNPs at apolipoprotein E (ApoE have been linked with late onset sporadic Alzheimer’s disease and declining normative cognitive ability in elder people, but we are unclear about their relationship with cognition in children. Results. We studied -491A/T, -427T/C, and -219G/T promoter polymorphisms and ε2/ε3/ε4 at ApoE among children with mental retardation (MR, n=130, borderline MR (n=124, and controls (n=334 from an iodine deficiency area in China. The allelic and genotypic distribution of individual locus did not significantly differ among three groups with Mantel-Haenszel χ2 test (P>0.05. However, frequencies of haplotype of -491A/-427T/-219T/ε4 were distributed as MR > borderline MR > controls (P uncorrected = 0.004, indicating that the presence of this haplotype may increase the risk of disease. Conclusions. In this large population-based study in children, we did not find any significant association between single locus of the four common ApoE polymorphisms (-491A/T, -427T/C, -219T/G, and ε2/3/4 and MR or borderline MR. However, we found that the presence of ATTε4 haplotype was associated with an increased risk of MR and borderline MR. Our present work may help enlarge our knowledge of the cognitive role of ApoE across the lifespan and the mechanisms of human cognition.
Gastrointestinal absorption of uranium in man
International Nuclear Information System (INIS)
Larsen, R.P.; Orlandini, K.A.
1984-01-01
A method has been established for determining the fractional absorption of uranium directly in man. Measurements are made of the urinary excretion rates of uranium for individuals whose drinking water has a high 234 U to 238 U activity ratio and is the primary source of 234 U in their diets. For two individuals, the values obtained for the fractional absorption of 234 U were 0.004 and 0.006. The values obtained for the fractional absorption of 238 U, using a literature value for the 238 U intake from food, were 0.008 and 0.015. The present ICRP value is 0.20. 7 references, 1 table
International Nuclear Information System (INIS)
Shiotsuki, Masao; Miyahara, Kaname
2003-01-01
The second draft for R and D of geological disposal (second draft) was arranged in 1999. The idea of security of geological disposal in the second draft is explained. The evaluation results of the uncertainty analysis and an example of evaluation of the effect of separation nuclear transmutation on the geological disposal are shown. The construction of strong engineered barrier is a basic idea of geological disposal system. Three processes such as isolation, engineering countermeasures and safety evaluation are carried out for the security of geological disposal. The security of geological environment for a long time of 12 sites in Japan was studied by data. Provability of production and enforcement of engineered barrier were confirmed by trial of over pack, tests and the present and future technologies developed. By using the conditions of reference case in the second draft, the evaluation results of dose effects in the two cases: 1) 90 to 99% Cs and Sr removed from HLW (High Level radioactive Waste) and 2) high stripping ratio of actinium series are explained. (S.Y.)
Ac, La, and Ce radioimpurities in {sup 225}Ac produced in 40-200 MeV proton irradiations of thorium
Energy Technology Data Exchange (ETDEWEB)
Engle, Jonathan W.; Ballard, Beau D. [Los Alamos National Laboratory, NM (United States); Weidner, John W. [Air Force Institute of Technology, Wright Patterson Air Force Base, OH (United States); and others
2014-10-01
Accelerator production of {sup 225}Ac addresses the global supply deficiency currently inhibiting clinical trials from establishing {sup 225}Ac's therapeutic utility, provided that the accelerator product is of sufficient radionuclidic purity for patient use. Two proton activation experiments utilizing the stacked foil technique between 40 and 200 MeV were employed to study the likely co-formation of radionuclides expected to be especially challenging to separate from {sup 225}Ac. Foils were assayed by nondestructive γ-spectroscopy and by α-spectroscopy of chemically processed target material. Nuclear formation cross sections for the radionuclides {sup 226}Ac and {sup 227}Ac as well as lower lanthanide radioisotopes {sup 139}Ce, {sup 141}Ce, {sup 143}Ce, and {sup 140}La whose elemental ionic radii closely match that of actinium were measured and are reported. The predictions of the latest MCNP6 event generators are compared with measured data, as they permit estimation of the formation rates of other radionuclides whose decay emissions are not clearly discerned in the complex spectra collected from {sup 232}Th(p,x) fission product mixtures. (orig.)
Background radiation and individual dosimetry in the coastal area of Tamil Nadu (India)
International Nuclear Information System (INIS)
Matsuda, N.; Brahmanandhan, G. M.; Yoshida, M.; Takamura, N.; Suyama, A.; Koguchi, Y.; Juto, N.; Raj, Y. L.; Winsley, G.; Selvasekarapandian, S.
2011-01-01
South coast of India is known as the high-level background radiation area (HBRA) mainly due to beach sands that contain natural radionuclides as components of the mineral monazite. The rich deposit of monazite is unevenly distributed along the coastal belt of Tamil Nadu and Kerala. An HBRA site that laid in 2x7 m along the sea was found in the beach of Chinnavillai, Tamil Nadu, where the maximum ambient dose equivalent reached as high as 162.7 mSv y -1 . From the sands collected at the HBRA spot, the high-purity germanium semi-conductor detector identified six nuclides of thorium series, four nuclides of uranium series and two nuclides belonging to actinium series. The highest radioactivity observed was 43.7 Bq g -1 of Th-228. The individual dose of five inhabitants in Chinnavillai, as measured by the radiophotoluminescence glass dosimetry system, demonstrated the average dose of 7.17 mSv y -1 ranging from 2.79 to 14.17 mSv y -1 . (authors)
Soil nuclide distribution coefficients and their statistical distributions
International Nuclear Information System (INIS)
Sheppard, M.I.; Beals, D.I.; Thibault, D.H.; O'Connor, P.
1984-12-01
Environmental assessments of the disposal of nuclear fuel waste in plutonic rock formations require analysis of the migration of nuclides from the disposal vault to the biosphere. Analyses of nuclide migration via groundwater through the disposal vault, the buffer and backfill, the plutonic rock, and the consolidated and unconsolidated overburden use models requiring distribution coefficients (Ksub(d)) to describe the interaction of the nuclides with the geological and man-made materials. This report presents element-specific soil distribution coefficients and their statistical distributions, based on a detailed survey of the literature. Radioactive elements considered were actinium, americium, bismuth, calcium, carbon, cerium, cesium, iodine, lead, molybdenum, neptunium, nickel, niobium, palladium, plutonium, polonium, protactinium, radium, samarium, selenium, silver, strontium, technetium, terbium, thorium, tin, uranium and zirconium. Stable elements considered were antimony, boron, cadmium, tellurium and zinc. Where sufficient data were available, distribution coefficients and their distributions are given for sand, silt, clay and organic soils. Our values are recommended for use in assessments for the Canadian Nuclear Fuel Waste Management Program
Energy Technology Data Exchange (ETDEWEB)
Arevalo R, D. L.; Hernandez M, H.; Romero G, E. T.; Lara A, N. [ININ, Carretera Mexico-Toluca s/n, 52750 Ocoyoacac, Estado de Mexico (Mexico); Alfaro de la T, M. C., E-mail: arevalo0591@hotmail.com [Universidad Autonoma de San Luis Potosi, Dr. Salvador Nava s/n, Zona Universitaria, 78290 San Luis Potosi, SLP (Mexico)
2016-09-15
The present work deals with the methodology established for the quantification of {sup 232}Th, {sup 234}U, {sup 238}U and {sup 235}U in the shell of gastropod mollusks collected in the rivers Valles, Coy and Axtla of San Luis Potosi, Mexico, which belong to the Panuco River basin; these rivers have as main source of pollution the discharge of municipal sewage, waste from small industries, agricultural and cattle residues and from natural sources. Conventional methods for measuring radio-nuclides are confronted with certain conditions related to the requirement in measurement, basically in the characterization that is related to the concepts of precision and accuracy. The analysis of the gastropod mollusk shell was performed by the Icp-SFMS technique; the main advantages of this technique lie in the isotope quantification capacity, the high precision and the low limits of detection, in this study are very important because these elements are in concentrations between ppb and ppt. This technique allowed the analysis of the samples having a complex matrix by the presence CaCO{sub 3} minimizing the interferences thanks to the ionization efficiency of the Ar plasma. For the species Pachychilus monachus were found concentrations of {sup 232}Th of 0.16-5.37 μg/g and of total U of 0.101-4.081 μg/g being this species where the highest values of total U were found. For Thiara (melanoids) tuberculata the lowest values were found among the different species ({sup 232}Th 0.61-3.61 μg/g and total U 0.006-0.042 μg/g), for Pachychilus suturalis, values of {sup 232}Th of 0.58-6.4 μg/g and for Pachychilus sp. were found between 0.26-7.62 μg/g and for total U values between 0.28-3.33 μg/g. The method offers several advantages: speed, good precision, low values of quantification limits and high sensitivity in the measurement of radio-nuclides and heavy metals. (Author)
Czech Academy of Sciences Publication Activity Database
Kratchanova, M.; Denev, P.; Číž, Milan; Lojek, Antonín; Mihailov, A.
2010-01-01
Roč. 57, č. 2 (2010), s. 229-234 ISSN 0001-527X R&D Projects: GA MŠk(CZ) OC08058 Institutional research plan: CEZ:AV0Z50040507; CEZ:AV0Z50040702 Keywords : medicinal plants * ORAC * polyphenols Subject RIV: BO - Biophysics Impact factor: 1.234, year: 2010
International Nuclear Information System (INIS)
Borole, D.V.; Krishnaswami, S.; Somayajulu, B.L.K.
1982-01-01
The two major river systems on the west coast of India, Narbada and Tapti, their estuaries and the coastal Arabian sea sediments have been extensively studied for their uranium concentrations and 234 U/ 238 U activity ratios. The 238 U concentrations in the aqueous phase of these river systems exhibit a strong positive correlation with the sum of the major cations, and with the HCO 3 - ion contents. The abundance ratio of dissolved U to the sum of the major cations in these waters is similar to their ratio in typical crustal rocks. In the estuaries, both 238 U and its great-grand daughter 234 U behave conservatively beyond chlorosities 0.14 g/l. A review of the uranium isotope measurements in river waters yield a discharge weighted-average 238 U concentration of 0.22 μg/l with a 234 U/ 238 U activity ratio of 1.20 +-0.06. The residence time of uranium isotopes in the oceans estimated from the 238 U concentration and the 234 U/ 238 U A.R. of the rivers yield conflicting results; the material balance of uranium isotopes in the marine environment still remains a paradox. If the disparity between the results is real, then an additional 234 U flux of about 0.25 dpm/cm 2 .10 3 yr into the oceans is necessitated. (author)
U/Th-isotopes as natural analogues for the mobility of actinides in granitic rocks
International Nuclear Information System (INIS)
Mengel, K.; Gerdes, A.
2001-01-01
The short-lived decay products of 238 U ( 234 U and 230 Th) can be used as natural analogues for actinides in a hard rock repository. Their mobility in the past may serve as a key for understanding actinide migration in the future. For generally old calcites of the HRL Aespoethe age of disturbance of 238 U/ 234 U and 234 U/ 230 Th activity ratios ranges from 30 000 to 436 000 years at degrees of disturbance ranging from 0.5 to 6.7. The results obtained imply that during the past 440 000 years U was mobile throughout the tunnel sections of the HRL Aespoeinvestigated here. For the FL Grimsel, the disequilibrium states of the 234 U/ 238 U and 230 Th/ 234 U activity ratios in fracture minerals (calcites silicates) also imply that the reactions causing isotopic disturbances have occurred within the past 500 000 years. The U/Th-isotope data of both the samples from the HRL Aespoeand the FL Grimsel have in common the mobilization of U in secondary fracture minerals by migrating solutions within the past 500 000 years. As for the question of a final disposal of radioactive waste in granite host rocks, the transport of U - and thus of similarly behaving actinides - in migrating underground solutions can therefore not be ruled out, if suitable hydraulic systems are considered. (orig.)
Directory of Open Access Journals (Sweden)
Carolin Bier
Full Text Available BACKGROUND: The chromosomal translocation t(4;11(q21;q23 is associated with high-risk acute lymphoblastic leukemia of infants. The resulting AF4•MLL oncoprotein becomes activated by Taspase1 hydrolysis and is considered to promote oncogenic transcriptional activation. Hence, Taspase1's proteolytic activity is a critical step in AF4•MLL pathophysiology. The Taspase1 proenzyme is autoproteolytically processed in its subunits and is assumed to assemble into an αββα-heterodimer, the active protease. Therefore, we investigated here whether overexpression of catalytically inactive Taspase1 variants are able to interfere with the proteolytic activity of the wild type enzyme in AF4•MLL model systems. METHODOLOGY/FINDINGS: The consequences of overexpressing the catalytically dead Taspase1 mutant, Taspase1(T234V, or the highly attenuated variant, Taspase1(D233A, on Taspase1's processing of AF4•MLL and of other Taspase1 targets was analyzed in living cancer cells employing an optimized cell-based assay. Notably, even a nine-fold overexpression of the respective Taspase1 mutants neither inhibited Taspase1's cis- nor trans-cleavage activity in vivo. Likewise, enforced expression of the α- or β-subunits showed no trans-dominant effect against the ectopically or endogenously expressed enzyme. Notably, co-expression of the individual α- and β-subunits did not result in their assembly into an enzymatically active protease complex. Probing Taspase1 multimerization in living cells by a translocation-based protein interaction assay as well as by biochemical methods indicated that the inactive Taspase1 failed to assemble into stable heterocomplexes with the wild type enzyme. CONCLUSIONS: Collectively, our results demonstrate that inefficient heterodimerization appears to be the mechanism by which inactive Taspase1 variants fail to inhibit wild type Taspase1's activity in trans. Our work favours strategies targeting Taspase1's catalytic activity
Vliegenthart, J.F.G.; Vleugel, D.J.M. van der; Wassenburg, F.R.; Zwikker, J.W.
1982-01-01
Condensation of methyl 5-acetamido-4,7,8,9-tetra-O-acetyl-2-chloro-2,3,5-trideoxy-beta-D-glycero-D-galacto-2-nonulopyranosonate with benzyl 2,3,4-tri-O-benzyl-beta-D-galactopyranoside, using silver salicylate as promoter, gave benzyl 2,3,4-tri-O-benzyl-6-O-(methyl
Endocrine-disrupting effect of the ultraviolet filter benzophenone-3 in zebrafish, Danio rerio
DEFF Research Database (Denmark)
Kinnberg, Karin Lund; Petersen, Gitte I.; Albrektsen, Mette
2015-01-01
of BP-3 in zebrafish (Danio rerio) in the Fish Sexual Development Test (Organisation for Economic Co-operation and Development TG 234) and a 12 day adult male zebrafish study. In TG 234, exposure from 0 to 60 d posthatch caused a monotone dose-dependent skewing of the phenotypic sex ratio towards less...
Detection of uranium mining activities
International Nuclear Information System (INIS)
Maiorov, V.; Ryjinski, M.; Bragin, V.
2001-01-01
In undisturbed natural uranium ore the 238 U decay chain isotopes appear in secular decay equilibrium with activity ratios equal to one. In the course of ore processing the bulk of the uranium decay products is separated from the uranium product and concentrated in the tails. Therefore the disturbed activity ratios of short-lived daughters to long-lived parents can be indicators of ore processing. Using 234 Th and 238 U activities (the short-lived daughter with T 1/2 =24.1 days and the long- lived parent respectively) one can roughly estimate how much time has elapsed since ore processing occurred. Equilibrium is reached in about three months after processing and the 234 Th and 238 U activity levels are approximately equal (taking into account the error of measurements). Higher or lower 234 Th activity levels, relative to 238 U, indicate the material has been recently processed. Assuming the product is depleted in Th and the tails are enriched, the activity of 234 Th in fresh product should be lower than 238 U and higher in fresh tails. The 234 Th/ 230 Th activity ratio can also be used for age estimations ( 230 Th is a long-lived nuclide). Five samples were taken from the Ranger Uranium Mine and Concentration Plant in Australia, and one sample was taken from the Jabiluka mine (10 km far from the Ranger Mine). The samples included non-processed ore, coarse ore from the stockpile, final crushed ore, fresh and old tails, and fresh product (U 3 O 8 ). All the samples were analyzed by HRGS to measure the activities of gamma emitting nuclides. XRF and IDMS were used to measure uranium content and isotopic composition. The 238 U activity was calculated from these measurement results. The 234 Th activity was measured by HRGS with a planar HPGe detector and a calibrated low activity 241 Am solution as an internal standard. The 234 Th/ 230 Th activity ratio was measured using the 60 keV energy region where both isotopes have gamma lines. Use of gamma lines with close
African Journals Online (AJOL)
Items 201 - 234 of 234 ... Vol 7, No 1 (2005), Surgical treatment of trochanteric fractures: An Ivorian experience, Abstract PDF. JB Sié Essoh, M Kodo, A Traoré, Y Lambin. Vol 6, No 1-2 (2004), Term quadruplet pregnancy: a case report, Abstract PDF. T Ogunnowo, O Oluwole, CO Aimakhu, AO Ilesanmi, AO Omigbodun.
Enhanced export of carbon by salps during the northeast monsoon period in the northern Arabian Sea
Digital Repository Service at National Institute of Oceanography (India)
Ramaswamy, V.; Sarin, M.M.; Rengarajan, R.
of the photic zone was 2300 dpm m sup(-2) d sup(-1) and average POC/ sup(234)Th ratio in trap-derived particles was 0.14 mg/dpm. Average sup(234)Th derived export flux of carbon was about 332 mg m sup(-2) d sup(-1), representing 36% of the daily primary...
International Nuclear Information System (INIS)
Hakam, O.K.; Choukri, A.; Reyss, J.L.; Lferde, M.
2000-01-01
Activities and activity ratios of uranium and radium isotopes ( 234 U, 238 U, 226 Ra, 228 Ra, 234 U/ 238 U, 226 Ra/ 238 U, 228 Ra/ 226 Ra) have been determined, for the first time in Morocco, for 15 well water samples and 12 spring water samples. The obtained results show that, unlike well waters, the thermal spring waters present relatively low 238 U activities and elevated 226 Ra activities and 234 U/ 238 U activity ratios. Uranium and radium activities are similar to those published for other non polluting regions of the world, they are inferior to the Maximum Contaminant Levels and don't present any risk for public health in Morocco. (author) [fr
TRASH TO TREASURE: CONVERTING COLD WAR LEGACY WASTE INTO WEAPONS AGAINST CANCER
International Nuclear Information System (INIS)
Nicholas, R.G.; Lacy, N.H.; Butz, T.R.; Brandon, N.E.
2004-01-01
As part of its commitment to clean up Cold War legacy sites, the U.S. Department of Energy (DOE) has initiated an exciting and unique project to dispose of its inventory of uranium-233 (233U) stored at Oak Ridge National Laboratory (ORNL), and extract isotopes that show great promise in the treatment of deadly cancers. In addition to increasing the supply of potentially useful medical isotopes, the project will rid DOE of a nuclear concern and cut surveillance and security costs. For more than 30 years, DOE's ORNL has stored over 1,200 containers of fissile 233U, originally produced for several defense-related projects, including a pilot study that looked at using 233U as a commercial reactor fuel. This uranium, designated as special nuclear material, requires expensive security, safety, and environmental controls. It has been stored at an ORNL facility, Building 3019A, that dates back to the Manhattan Project. Down-blending the material to a safer form, rather than continuing to store it, will eliminate a $15 million a year financial liability for the DOE and increase the supply of medical isotopes by 5,700 percent. During the down-blending process, thorium-229 (229Th) will be extracted. The thorium will then be used to extract actinium-225 (225Ac), which will ultimately supply its progeny, bismuth-213 (213Bi), for on-going cancer research. The research includes Phase II clinical trials for the treatment of acute myelogenous leukemia at Sloan-Kettering Memorial Cancer Center in New York, as well as other serious cancers of the lungs, pancreas, and kidneys using a technique known as alpha-particle radioimmunotherapy. Alpha-particle radioimmunotherapy is based on the emission of alpha particles by radionuclides. 213Bi is attached to a monoclonal antibody that targets specific cells. The bismuth then delivers a high-powered but short-range radiation dose, effectively killing the cancerous cells but sparing the surrounding tissue. Production of the actinium and
Energy Technology Data Exchange (ETDEWEB)
Silva, Helen S.B. da; Marques, Leila S.; Kawauchi, Roberto K., E-mail: leila@iag.usp.br, E-mail: keiji@iag.usp.br [Instituto de Astronomia, Geofisica e Ciencias Atmosfericas. Universidade de Sao Paulo (USP), SP (Brazil)
2011-07-01
In order to elucidate the mechanisms involved in the process of uranium leaching due to the rock-water interaction in the granitic rocks from Itu Complex (Sao Paulo, Brazil), an experimental arrangement was developed and built. About 2.5kg of crushed rock fragments from Cabreuva and Indaiatuba Intrusions were maintained at room temperature within a glass flask filled with circulating water. The percolating water was removed periodically (from 10 to 30 days) for uranium analysis and then replaced by an equal volume of fresh water. Alpha spectrometry was used to determine the activity concentrations of {sup 234}U and {sup 238}U, and {sup 234}U/{sup 238}U activity ratios, of the waters as well as of the granites. The results for both samples showed that most of the uranium is leached in the first days after the contact between rock and water. The {sup 234}U/{sup 238}U activity ratios were significantly greater than unity, indicating radioactive disequilibrium between those isotopes, probably due to alpha recoil. Although the uranium activity concentrations in the water samples diminished with the increasing of time, it was not observed considerable variations of the {sup 234}U/{sup 238}U activity ratios. It was also noticed that, the amount of leached uranium as well as the {sup 234}U/{sup 238}U activity ratios are characteristics of each sample submitted to leaching, reflecting the differences of the granite facies mineralogy.(author)
Uranium isotopes in groundwaters from Tubarao Group, Parana Basin, Brazil
International Nuclear Information System (INIS)
Bonotto, D.M.; Caprioglio, L.
1999-01-01
The purpose of this work is to characterize the uranium isotopes 238-U and 234-U in some important deep tubular wells drilled at Tubarao Group, with the aim of verifying if the dissolution processes that are taking place within the aquifer can generate enhanced 234-U/238-U activity ratios like those found at the Botucatu-Piramboia aquifer. (author)
Isotopic and hydrochemical study of aquifers from Rio Claro District (Sao Paulo State, Brazil)
International Nuclear Information System (INIS)
Bonotto, D.N.
1992-01-01
An isotopic and hydrochemical study was performed in three aquifers in Rio Claro city area, Sao Paulo State, to establish the chemical facies of the groundwaters and to evaluate the mechanisms of dissolution of the unstable isotope 234 U and 238 U. Mapped groundwater facies were: calcium-bicarbonate for Rio Claro Formation, sodium-nitrate-chloride for fractures in database and sodium-bicarbonate for Tubarao Group. The highest dissolved U contents were measured in groundwaters from the fractured diabase, however, the groundwaters from Tubarao Group showed the highest base-exchange index. Most of the results showed enhancement of 234 U in solution and the highest 234 U/ 238 U activity ratios were measured for groundwaters from Tubarao Group. (author). 33 refs., 5 figs., 1 tab
Publications - GMC 234 | Alaska Division of Geological & Geophysical
following North Slope wells: Itkillik River Unit #1, Nora Fed #1, Toolik Fed #1, Kemik Unit #1, Lupine Unit following North Slope wells: Itkillik River Unit #1, Nora Fed #1, Toolik Fed #1, Kemik Unit #1, Lupine Unit
12 CFR 23.4 - Investment in personal property.
2010-01-01
... this section, if: (1) The acquisition of the property is consistent with the leasing business then conducted by the bank or is consistent with a business plan for expansion of the bank's existing leasing business or for entry into the leasing business; and (2) The bank's aggregate investment in property held...
International Nuclear Information System (INIS)
Chen Honghong; Hu Yuxing; Wang Yinghua; Jin Meiying; Luo Meichu; Sun Meizhen
2003-01-01
The efficacy of prompt single and consecutive administration of chelating agent 7601 and 9501 of catechol amino carboxylic acid for the decorporation of 234 Th in rats and mice was investigated. DTPA was used as positive control. The complexing competitive abilities of 7601 and 9501 to mobilize the thorium with bovine serum albumin were studied with gel chromatography in vitro. The inhibition effect of 7601 and 9501 on superoxide anions radicals (O 2 -. ) were measured with electron spin resonance. The results showed that 7601 and 9501 could increase the excretion of 234 Th in urine and faces by 63%-70% and decrease markedly retention of 234 Th in liver and skeleton, which have been proved to be superior to DTPA. Their different bioactivities for decorporation of 234 Th were consistent with their competitive abilities to mobilize the thorium with bovine serum albumin. 7601 and 9501 could directly scavenge O 2 -. . Their effects as an O 2 -. scavenger were very significant and were similar to the of BESOD. The mechanism of protective effects of 7601 and 9501 for internal exposure injury was close related to decorporation effectiveness and the activity of scavenging oxygen free radical
About local calibration curve of the Black Sea during the period 18000 - 3000 calendar years BP
International Nuclear Information System (INIS)
Slavova, K.
2002-01-01
Understanding the youngest geological Black Sea history requires that the age of the tested samples be accurately determined. The comparison between 234 U/ 230 Th and 14 C ages obtained on the Holocene samples demonstrate that 234 U/ 230 Th ages are accurate because they are in agreement with the dendrochonological calibration. Beyond 9100 calendar year BP it is proved that 14 C ages are systematically younger than 234 U/ 230 Th ages with a maximum difference of about 3000 years reached at about 20000 calendar years. This calls for converting the conventional 14 C ages in calendar ages. The procedure is called calibration. A local calibration Black Sea curve in which features of the Black Sea as a basin to be included is required, videlicet: correction of conventional ages for 'reservoir effect' - 60 years for TOC (Total Organic Carbon), 460 years for TCC (Total Carbonate Carbon) and for 'detrital carbon input - 580 years for TOC, 260 years for TCC. Such local calibration curve is constructed and proved in the article by using and comparing data from different dating methods (carbon 14, 234 U/ 230 Th, dendrochronology)
Development of empirical relation for isotope of uranium in enriched uranium matrix
International Nuclear Information System (INIS)
Srivastava, S.K.; Vidyasagar, D.; Jha, S.K.; Tripathi, R.M.
2018-01-01
Uranium enriched in 235 U is required in commercial light water reactors to produce a controlled nuclear reaction. Enrichment allows the 235 U isotopes to be increased from 0.71% to a range between 2% to 5% depending upon requirement. The enriched uranium in the form of sintered UO 2 pellet is used for any commercially operating boiling light water reactors. The enriched uranium fuel bundle surface swipes sample is being analysed to assess the tramp uranium as a quality control parameter. It is known that the 234 U isotope also enriched along with 235 U isotope in conventional gaseous diffusion enrichment process. The information about enrichment percentage of 234 U helps to characterize isotopic properties of enriched uranium. A few reports provide the empirical equation and graphs for finding out the specific activity, activity percentage, activity ratio of 234 U isotopes for enriched uranium. Most of them have not provided the reference for the data used and their source. An attempt has been made to model the relationship between 234 U and 235 U as a function of uranium enrichment at low level
Probable alpha and 14C cluster emission from hyper Ac nuclei
International Nuclear Information System (INIS)
Santhosh, K.P.
2013-01-01
A systematic study on the probability for the emission of 4 He and 14 C cluster from hyper Λ 207-234 Ac and non-strange normal 207-234 Ac nuclei are performed for the first time using our fission model, the Coulomb and proximity potential model (CPPM). The predicted half lives show that hyper Λ 207-234 Ac nuclei are unstable against 4 He emission and 14 C emission from hyper Λ 217-228 Ac are favorable for measurement. Our study also show that hyper Λ 207-234 Ac are stable against hyper Λ 4 He and Λ 14 C emission. The role of neutron shell closure (N = 126) in hyper Λ 214 Fr daughter and role of proton/neutron shell closure (Z ∼ 82, N = 126) in hyper Λ 210 Bi daughter are also revealed. As hyper-nuclei decays to normal nuclei by mesonic/non-mesonic decay and since most of the predicted half lives for 4 He and 14 C emission from normal Ac nuclei are favourable for measurement, we presume that alpha and 14 C cluster emission from hyper Ac nuclei can be detected in laboratory in a cascade (two-step) process. (orig.)
Enhanced export of carbon by salps during the northeast monsoon period in the northern Arabian Sea
Ramaswamy, V.; Sarin, M. M.; Rengarajan, R.
2005-07-01
A drifting sediment trap was deployed and 234Th activity in the water column was measured to calculate export flux of carbon at a time-series station in the northern Arabian Sea (lat. 21°30' N; long. 64°00' E) during the winter monsoon, 10-23 February 1997. The sampling period was characterised by an extensive salp swarm, and salp faecal pellets were the dominant contributors to the particulate matter in the sediment traps. Average 234Th flux out of the photic zone was 2300 dpm m -2 d -1 and average POC/ 234Th ratio in trap-derived particles was 0.14 mg/dpm. Average 234Th-derived export flux of carbon was about 332 mg m -2 d -1, representing 36% of the daily primary production (PP) (925 mg C m -2 d -1). Export of about one-third of the daily PP during the end of the winter monsoon could be due to the episodic nature of salp swarms. Salp swarms are frequently observed in the Arabian Sea and may be a significant pathway for rapid export of carbon from the euphotic zone.
Uranium geochemistry and dating of Pacific island apatite
Energy Technology Data Exchange (ETDEWEB)
Roe, K K; Burnett, W C [Florida State Univ., Tallahassee (USA). Dept. of Oceanography
1985-07-01
Uranium-series disequilibrium dating of island phosphate deposits is evaluated in terms of known associated coral ages, uranium geochemistry, and stratigraphic sequences as well as the concordance between the geochronometers /sup 234/U//sup 238/U, /sup 230/Th//sup 234/U and /sup 226/Ra//sup 238/U. U(VI) is the predominant oxidation state of uranium in island phosphorites and by analogy to the youngest surficial deposits, most of the uranium initially bound is in the form of U(VI) sorbed by surfaces from seawater. Insular deposits contain more organic matter than even very young ocean floor samples and this leads to a greater probability of reduction of available recoil uranium than occurs in marine deposits. As a consequence, R(VI) <= R(T) <= R(VI), where R represents the /sup 234/U//sup 238/U activity ratio. This situation is completely opposite from that observed for marine-origin phosphorites. We determined that a fraction of U(VI) in ancient insular phosphorites is very labile and lost to alkaline carbonate solutions with a uranium activity ratio even more depleted in /sup 234/U than the bulk R(VI). The results are discussed.
Influence of macrobenthos on chemical diagenesis of marine sediments
Energy Technology Data Exchange (ETDEWEB)
Aller, R.C.
1977-05-01
Diagenetic reactions involving the decomposition of organic matter and the dissolution, mobilization, and reprecipitation of metals sensitive to oxidation-reduction reactions, are most intense and rapid in the upper 1 m and especially the upper 10 cm of marine sediment. It is in this upper zone where most benthic organisms live and interact with sediments and where exchange rates of dissolved and particulate material between sediment and overlying water are largely determined. In Long Island Sound, U.S.A., both spatial and temporal trends in sediment chemistry and the flux of material out of the bottom demonstrate the control of diagenesis by bottom fauna. /sup 234/Th//sup 238/U disequilibrium studies demonstrate that particle reworking rates near the sediment-water interface vary both temporally and spatially in the Sound. The most rapid reworking occurs in protobranch-inhabited bottom areas as do the highest /sup 234/Th inventories. Excess /sup 234/Th profiles in the sediment allow determination of the rates of selected diagenetic reactions, such as Mn/sup + +/ production, near the sediment surface. Both the /sup 234/Th disequilibrium and flux measurements indicate that intra-estuarine redistribution of metals continually takes place.
Directory of Open Access Journals (Sweden)
Martínez Frías, J.
1988-04-01
Full Text Available Two generations of carbonate sinter deposits of sedimentary origin occur along the shore line of the Ruidera lakes. Both of them were formed during interglaciar type climate conditions. Based on 234 U/238 U and 230 U/234 U activity relationships, two sets of ages were obtained: 10.000 years and 80.000-140.000; tbe former for the lower terraces and sinter dykes, the latter for the upper terraces.En los bordes de las Lagunas de Ruidera, existen dos generaciones fundamentales de depósitos travertínicos. La datación de estos depósitos, mediante relaciones de actividades del 234 U/238 U y 230 Th/234 U permite diferenciar un conjunto de terrazas bajas y diques de edad inferior a 10.000 años, y un conjunto de terrazas altas de edad entre 80.000 y 140.000 años, en las que se distinguen dos episodios principales. Estos periodos de crecimiento de los travertinos, se identifican con condiciones climáticas equivalentes a las de un interglaciar húmedo. Por último, se hace una estimación de la velocidad de encajamiento de las lagunas.
Directory of Open Access Journals (Sweden)
Mi-Sook Lee
2014-01-01
Full Text Available Caffeic acid phenethyl ester (CAPE is an active component of propolis that has a variety of potential pharmacological effects. Although we previously demonstrated that propolis has antidepressant-like activity, the effect of CAPE on this activity remains unknown. The present study assessed whether treatment with CAPE (5, 10, and 20 µmol/kg for 21 days has an antidepressant-like effect in mice subjected to chronic unpredictable stress via tail suspension (TST and forced swim (FST tests. CAPE administration induced behaviors consistent with an antidepressant effect, evidenced by decreased immobility in the TST and FST independent of any effect on serum corticosterone secretion. Western blots, conducted subsequent to behavioral assessment, revealed that CAPE significantly decreased glucocorticoid receptor phosphorylation at S234 (pGR(S234, resulting in an increased pGR(S220/S234 ratio. We also observed negative correlations between pGR(S220/(S234 and p38 mitogen-activated protein kinase (p38MAPK phosphorylation, which was decreased by CAPE treatment. These findings suggest that CAPE treatment exerts an antidepressant-like effect via downregulation of p38MAPK phosphorylation, thereby contributing to enhanced GR function.
238Pu - Comments on Evaluation of Decay Data
International Nuclear Information System (INIS)
Chechev, V. P.
2013-01-01
This evaluation was done originally in March 2003, corrected in June 2004, and then updated in June 2009 with a literature cut-off by the same date. Decay Scheme: The decay scheme is based on 2007Br04. Some expected weak gamma-ray transitions were not observed directly in 238 Pu α-decay but have been adopted from decay of 234 Pa and 234 Np
Directory of Open Access Journals (Sweden)
Fu Dong-Jing
2011-05-01
Full Text Available Abstract Background Paliperidone palmitate is a long-acting injectable atypical antipsychotic for the acute and maintenance treatment of adults with schizophrenia. The recommended initiation dosing regimen is 234 mg on Day 1 and 156 mg on Day 8 via intramuscular (deltoid injection; followed by 39 to 234 mg once-monthly thereafter (deltoid or gluteal. These post-hoc analyses addressed two commonly encountered clinical issues regarding the initiation dosing: the time to onset of efficacy and the associated tolerability. Methods In a 13-week double-blind trial, 652 subjects with schizophrenia were randomized to paliperidone palmitate 39, 156, or 234 mg (corresponding to 25, 100, or 150 mg equivalents of paliperidone, respectively or placebo (NCT#00590577. Subjects randomized to paliperidone palmitate received 234 mg on Day 1, followed by their randomized fixed dose on Day 8, and monthly thereafter, with no oral antipsychotic supplementation. The onset of efficacy was defined as the first timepoint where the paliperidone palmitate group showed significant improvement in the Positive and Negative Syndrome Scale (PANSS score compared to placebo (Analysis of Covariance [ANCOVA] models and Last Observation Carried Forward [LOCF] methodology without adjusting for multiplicity using data from the Days 4, 8, 22, and 36 assessments. Adverse event (AE rates and relative risks (RR with 95% confidence intervals (CI versus placebo were determined. Results Paliperidone palmitate 234 mg on Day 1 was associated with greater improvement than placebo on Least Squares (LS mean PANSS total score at Day 8 (p = 0.037. After the Day 8 injection of 156 mg, there was continued PANSS improvement at Day 22 (p ≤ 0.007 vs. placebo and Day 36 (p Conclusions Significantly greater symptom improvement was observed by Day 8 with paliperidone palmitate (234 mg on Day 1 compared to placebo; this effect was maintained after the 156 mg Day 8 injection, with a trend towards a dose
Aplication of uranium isotopes as tracers in ground water studies (Bambui - Bahia, Brazil)
International Nuclear Information System (INIS)
Gomes, F.V.M.
1978-03-01
Analyses of 234 U/ 238 U activity ratios and the uranium concentration in 42 underground water samples have provided better in formation about the recharge area and the flow direction in the Bambui limestone, Bahia (Brazil). In the main recharge area, the activity ratios were found to range from 3 to 6 and the uranium concentration averaged 1 μg/l. The activity ratio increases northward with the highest values close to 10. The 234 U excess from a basic of ratio of activity (fundamental leaching ratio) also increases northward in agreement with the age of the water, an observation confirmed by C-14. This 234 U excess is attributed to the alpha-recoil process. The system was calibrated and the age of the waters in the calcareous region was determined. (Author) [pt
International Nuclear Information System (INIS)
Hesketh, K.; Porsch, D.; Rimpault, G.; Taiwo, T.; Worrall, A.
2013-01-01
The actinides (or actinoids) are those elements in the periodic table from actinium upwards. Uranium (U) and plutonium (Pu) are two of the principal elements in nuclear fuel that could be classed as major actinides. The minor actinides are normally taken to be the triad of neptunium (Np), americium (Am) and curium (Cm). The combined masses of the remaining actinides (i.e. actinium, thorium, protactinium, berkelium, californium, einsteinium and fermium) are small enough to be regarded as very minor trace contaminants in nuclear fuel. Those elements above uranium in the periodic table are known collectively as the transuranics (TRUs). The operation of a nuclear reactor produces large quantities of irradiated fuel (sometimes referred to as spent fuel), which is either stored prior to eventual deep geological disposal or reprocessed to enable actinide recycling. A modern light water reactor (LWR) of 1 GWe capacity will typically discharge about 20-25 tonnes of irradiated fuel per year of operation. About 93-94% of the mass of uranium oxide irradiated fuel is comprised of uranium (mostly 238 U), with about 4-5% fission products and ∼1% plutonium. About 0.1-0.2% of the mass is comprised of neptunium, americium and curium. These latter elements accumulate in nuclear fuel because of neutron captures, and they contribute significantly to decay heat loading and neutron output, as well as to the overall radio-toxic hazard of spent fuel. Although the total minor actinide mass is relatively small - approximately 20-25 kg per year from a 1 GWe LWR - it has a disproportionate impact on spent fuel disposal, and thus the longstanding interest in transmuting these actinides either by fission (to fission products) or neutron capture in order to reduce their impact on the back end of the fuel cycle. The combined masses of the trace actinides actinium, thorium, protactinium, berkelium and californium in irradiated LWR fuel are only about 2 parts per billion, which is far too low for
Electronic structure and dynamics of ordered clusters with ME or RE ions on oxide surface
Energy Technology Data Exchange (ETDEWEB)
Kulagin, N.A., E-mail: nkulagin@bestnet.kharkov.u [Kharkiv National University for Radio Electronics, Avenue Shakespeare 6-48, 61045 Kharkiv (Ukraine)
2011-03-15
Selected data of ab initio simulation of the electronic structure and spectral properties of either cluster with ions of iron, rare earth or actinium group elements have been presented here. Appearance of doped Cr{sup +4} ions in oxides, Cu{sup +2} in HTSC, Nd{sup +2} in solids has been discussed. Analysis of experimental data for plasma created ordered structures of crystallites with size of about 10{sup -9} m on surface of separate oxides are given, too. Change in the spectroscopic properties of clusters and nano-structures on surface of strontium titanate crystals discussed shortly using the X-ray line spectroscopy experimental results. - Research highlights: External influence and variation of technology induce changes in valence of nl ions in compounds. Wave function of cluster presented as anti-symmetrical set of ions wave functions. The main equation describes the self-consistent field depending on state of all electrons of cluster. Level scheme of Cr{sup 4+} ions in octo- and tetra-site corresponds to doped oxides spectra after treatment. Plasma treatment effects in appearance of systems of unit crystallites with size of about 10{sup -6}-10{sup -9} m.
Electronic structure and dynamics of ordered clusters with ME or RE ions on oxide surface
International Nuclear Information System (INIS)
Kulagin, N.A.
2011-01-01
Selected data of ab initio simulation of the electronic structure and spectral properties of either cluster with ions of iron, rare earth or actinium group elements have been presented here. Appearance of doped Cr +4 ions in oxides, Cu +2 in HTSC, Nd +2 in solids has been discussed. Analysis of experimental data for plasma created ordered structures of crystallites with size of about 10 -9 m on surface of separate oxides are given, too. Change in the spectroscopic properties of clusters and nano-structures on surface of strontium titanate crystals discussed shortly using the X-ray line spectroscopy experimental results. - Research highlights: → External influence and variation of technology induce changes in valence of nl ions in compounds. → Wave function of cluster presented as anti-symmetrical set of ions wave functions. → The main equation describes the self-consistent field depending on state of all electrons of cluster. → Level scheme of Cr 4+ ions in octo- and tetra-site corresponds to doped oxides spectra after treatment. → Plasma treatment effects in appearance of systems of unit crystallites with size of about 10 -6 -10 -9 m.
Review of radionuclide source terms used for performance-assessment analyses
International Nuclear Information System (INIS)
Barnard, R.W.
1993-06-01
Two aspects of the radionuclide source terms used for total-system performance assessment (TSPA) analyses have been reviewed. First, a detailed radionuclide inventory (i.e., one in which the reactor type, decay, and burnup are specified) is compared with the standard source-term inventory used in prior analyses. The latter assumes a fixed ratio of pressurized-water reactor (PWR) to boiling-water reactor (BWR) spent fuel, at specific amounts of burnup and at 10-year decay. TSPA analyses have been used to compare the simplified source term with the detailed one. The TSPA-91 analyses did not show a significant difference between the source terms. Second, the radionuclides used in source terms for TSPA aqueous-transport analyses have been reviewed to select ones that are representative of the entire inventory. It is recommended that two actinide decay chains be included (the 4n+2 ''uranium'' and 4n+3 ''actinium'' decay series), since these include several radionuclides that have potentially important release and dose characteristics. In addition, several fission products are recommended for the same reason. The choice of radionuclides should be influenced by other parameter assumptions, such as the solubility and retardation of the radionuclides
Energy Technology Data Exchange (ETDEWEB)
Schwartz, J; O' Donoghue, J A; Humm, J L [Department of Medical Physics, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); Jaggi, J S [Bristol-Myers Squibb, Plainsboro, NJ (United States); Ruan, S; Larson, S M [Nuclear Medicine Service Department of Radiology, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); McDevitt, M; Scheinberg, D A, E-mail: schwarj1@mskcc.org [Molecular Pharmacology and Chemistry, Sloan-Kettering Institute, 1275 York Avenue, New York, NY 10065 (United States)
2011-02-07
Clinical therapeutic studies using {sup 225}Ac-labeled antibodies have begun. Of major concern is renal toxicity that may result from the three alpha-emitting progeny generated following the decay of {sup 225}Ac. The purpose of this study was to determine the amount of {sup 225}Ac and non-equilibrium progeny in the mouse kidney after the injection of {sup 225}Ac-huM195 antibody and examine the dosimetric consequences. Groups of mice were sacrificed at 24, 96 and 144 h after injection with {sup 225}Ac-huM195 antibody and kidneys excised. One kidney was used for gamma ray spectroscopic measurements by a high-purity germanium (HPGe) detector. The second kidney was used to generate frozen tissue sections which were examined by digital autoradiography (DAR). Two measurements were performed on each kidney specimen: (1) immediately post-resection and (2) after sufficient time for any non-equilibrium excess {sup 213}Bi to decay completely. Comparison of these measurements enabled estimation of the amount of excess {sup 213}Bi reaching the kidney ({gamma}-ray spectroscopy) and its sub-regional distribution (DAR). The average absorbed dose to whole kidney, determined by spectroscopy, was 0.77 (SD 0.21) Gy kBq{sup -1}, of which 0.46 (SD 0.16) Gy kBq{sup -1} (i.e. 60%) was due to non-equilibrium excess {sup 213}Bi. The relative contributions to renal cortex and medulla were determined by DAR. The estimated dose to the cortex from non-equilibrium excess {sup 213}Bi (0.31 (SD 0.11) Gy kBq{sup -1}) represented {approx}46% of the total. For the medulla the dose contribution from excess {sup 213}Bi (0.81 (SD 0.28) Gy kBq{sup -1}) was {approx}80% of the total. Based on these estimates, for human patients we project a kidney-absorbed dose of 0.28 Gy MBq{sup -1} following administration of {sup 225}Ac-huM195 with non-equilibrium excess {sup 213}Bi responsible for approximately 60% of the total. Methods to reduce renal accumulation of radioactive progeny appear to be necessary for the success of {sup 225}Ac radioimmunotherapy.
International Nuclear Information System (INIS)
Koyama, Mutsuo
1989-01-01
Distribution profiles of trace elements in land plants were studied by neutron activation analysis and radioactivity measurements without activation. Number of botanical samples analyzed were more than three thousand in which more than three hundred botanical species were included. New accumulator plants of Co, Cr, Zn, Cd, rare earth elements, Ac, U, etc., were found. Capabilities of accumulating trace elements can be related to the botanical taxonomy. Discussions are given from view points of inorganic chemistry as well as from botanical physiology
International Nuclear Information System (INIS)
Weinberg, J.M.; Levine, B.R.; Cowart, J.B.
1993-01-01
The source of anomalously high concentrations of uranium, characterized by U-234/U-238 activity ratios significantly less than unity, in shallow groundwaters of Lee County, Florida, was investigated. Uranium in cores samples was separated into U(IV) and U(VI) oxidation state fractions, and uranium analyses were conducted by alpha spectrometry. Uranium mobility was also studied in selected leaching experiments. Results indicate that mobilization of unusually soluble uranium, present in uranium enriched phosphate of the Pliocene age Tamiami Formation at determined concentrations of up to 729 ppm, is the source for high uranium concentrations in groundwater. In leaching experiments, approximately one-third of the uranium present in the uranium enriched phosphate was mobilized into the aqueous phase. Results of previous investigations suggest that U-234, produced in rock by U-238 decay, is selectively oxidized to U(VI). The uranium enriched phosphate studied in this investigation is characterized by selective reduction of U-234, with a pattern of increasing isotopic fractionation with core depth. As a consequence, U-234/U-238 activity ratios greater than 1.0 in the U(IV) fraction, and less than 1.0 in the U(VI) fraction have developed in the rock phase. In leaching experiments, the U(VI) fraction from the rock was preferentially mobilized into the aqueous phase, suggesting that U-234/U-238 activity ratios of leaching groundwaters are strongly influenced by the isotopic characteristics of the U(VI) fraction of rock. It is suggested that preferential leaching of U(VI), present in selectivity reduced uranium enriched phosphate, is the source for low activity ratio groundwaters in Lee County
International Nuclear Information System (INIS)
Bonotto, D.M.
1989-01-01
Uranium and thorium isotopic analyses were performed on spoil samples from the saturated zone of a borehole drilled in the main ore body of a high grade thorium/rare earth ore, and on groundwaters from a borehole drilled in the zone. The deposit is located at Morro do Ferro, a hill near the centre of the Pocos de Caldas Plateau (MG), where an aquifer system developed in the weathered mantle due to in situ intense alteration. For extraction of uranium and thorium a long chemical process was applied to the samples; activities of Th-228 and Th-232 isotopes (4n series) and also of U-238, U-234 and Th-230 isotopes (4n+2 series) were determined by the alpha spectrometry method. U-234/U-238 activity ratios in groundwaters were between 1 and 2 but Th-228/Th-232 activity ratios showed marked isotopic fractionation between these nuclides. The mechanism of mobilization of uranium by complexation with humic substances is considered. U-234/U-238, Th-228/Th-232 and Th-230/U-234 activity ratios in soil samples allowed consider action of other possible mechanisms related to the mobilization of uranium, such as, ion-exchange reaction and adsorption by Fe and Mn oxides. (author) [pt
Uranium, radium and 40K isotopes in bottled mineral waters from Outer Carpathians, Poland
International Nuclear Information System (INIS)
Kozlowska, B.; Walencik, A.; Dorda, J.; Przylibski, T.A.
2007-01-01
Radioactivity content in commercially bottled mineral waters from Outer Carpathians was investigated on the basis of 28 samples. Activity concentration results for radium isotopes 226,228 Ra, uranium isotopes 234,238 U and isotopic ratios 234 U/ 238 U were determined. The correlations between investigated isotopes and calculated potassium 40 K ions dissolved in water were carried out. The results show a correlation between TDS (total dissolved solids) values and dissolved radionuclides. High correlation coefficients were observed between total radium content and 40 K. The isotopic ratio of 234 U/ 238 U varies in the range from 1.6 to 7 in all investigated waters which means that there is no radioactive equilibrium between the parent nuclide 238 U and its daughter 234 U. The effective radiation dose coming from studied radium and uranium radionuclides consumed with mineral water from the Outer Carpathians obtained by a statistical Pole is equal to 4.3μSv/year (58 l/year water consumption) and do not exceed the permissible limit equal to 100μSv/year. Assuming 0.5 l consumption per day, i.e. 182.5 l/year, the effective dose is equal to 13.4μSv/year, what is still below the unit
Tritium Facilities Modernization and Consolidation Project Process Waste Assessment (Project S-7726)
Energy Technology Data Exchange (ETDEWEB)
Hsu, R.H. [Westinghouse Savannah River Company, AIKEN, SC (United States); Oji, L.N.
1997-11-14
Under the Tritium Facility Modernization {ampersand} Consolidation (TFM{ampersand}C) Project (S-7726) at the Savannah River Site (SS), all tritium processing operations in Building 232-H, with the exception of extraction and obsolete/abandoned systems, will be reestablished in Building 233-H. These operations include hydrogen isotopic separation, loading and unloading of tritium shipping and storage containers, tritium recovery from zeolite beds, and stripping of nitrogen flush gas to remove tritium prior to stack discharge. The scope of the TFM{ampersand}C Project also provides for a new replacement R&D tritium test manifold in 233-H, upgrading of the 233- H Purge Stripper and 233-H/234-H building HVAC, a new 234-H motor control center equipment building and relocating 232-H Materials Test Facility metallurgical laboratories (met labs), flow tester and life storage program environment chambers to 234-H.
Uranium isotopes in groundwater: their use in prospecting for sandstone-type uranium deposits
International Nuclear Information System (INIS)
Cowart, J.B.; Osmond, J.K.
1977-01-01
The relative abundances of dissolved 238 U and its daughter 234 U appear to be greatly affected as the uranium is transported downdip in sandstone aquifers. In an actively forming uranium accumulation at a reducing barrier, an input of 234 U occurs in proximity to the isotopically non-selective precipitation of uranium from the water. The result is a downdip water much lower in uranium concentration but relatively enriched in 234 U. The measurement of isotopic as well as concentration changes may increase the effectiveness of hydrogeochemical exploration of uranium. The investigation includes the uranium isotopic patterns in aquifers associated with known uranium orebodies in the Powder River and Shirley Basins, Wyoming, and Karnes County, Texas, USA. In addition, the Carrizo sandstone aquifer of Texas was studied in detail and the presence of an uranium accumulation inferred
International Nuclear Information System (INIS)
Arevalo R, D. L.; Hernandez M, H.; Romero G, E. T.; Lara A, N.; Alfaro de la T, M. C.
2016-09-01
The present work deals with the methodology established for the quantification of "2"3"2Th, "2"3"4U, "2"3"8U and "2"3"5U in the shell of gastropod mollusks collected in the rivers Valles, Coy and Axtla of San Luis Potosi, Mexico, which belong to the Panuco River basin; these rivers have as main source of pollution the discharge of municipal sewage, waste from small industries, agricultural and cattle residues and from natural sources. Conventional methods for measuring radio-nuclides are confronted with certain conditions related to the requirement in measurement, basically in the characterization that is related to the concepts of precision and accuracy. The analysis of the gastropod mollusk shell was performed by the Icp-SFMS technique; the main advantages of this technique lie in the isotope quantification capacity, the high precision and the low limits of detection, in this study are very important because these elements are in concentrations between ppb and ppt. This technique allowed the analysis of the samples having a complex matrix by the presence CaCO_3 minimizing the interferences thanks to the ionization efficiency of the Ar plasma. For the species Pachychilus monachus were found concentrations of "2"3"2Th of 0.16-5.37 μg/g and of total U of 0.101-4.081 μg/g being this species where the highest values of total U were found. For Thiara (melanoids) tuberculata the lowest values were found among the different species ("2"3"2Th 0.61-3.61 μg/g and total U 0.006-0.042 μg/g), for Pachychilus suturalis, values of "2"3"2Th of 0.58-6.4 μg/g and for Pachychilus sp. were found between 0.26-7.62 μg/g and for total U values between 0.28-3.33 μg/g. The method offers several advantages: speed, good precision, low values of quantification limits and high sensitivity in the measurement of radio-nuclides and heavy metals. (Author)
International Nuclear Information System (INIS)
Ganesan, S.; McLaughlin, P.K.
1992-02-01
Since 1990, one of the most interesting developments in the field of nuclear data for nuclear technology applications is that several new evaluated data files have been finalized and made available to the International Atomic Energy Agency (IAEA) for distribution to its Member States. Improved evaluated nuclear data libraries such as ENDF/B-VI from the United States and JENDL-3 from Japan were developed over a period of 10-15 years. This report is not an evaluation of the evaluations. The report as presented here gives a first look at the cross section line shapes of the isotopes that are important to the thorium fuel cycle derived from the two recently evaluated data files: JENDL-3 and ENDF/B-VI. The basic evaluated data files JENDL-3 and ENDF/B-VI were point-processed successfully using the codes LINEAR and RECENT. The point data were multigrouped in three different group structures using the GROUPIE code. Graphs of intercomparisons of cross section line shapes of JENDL-3 and ENDF/B-VI are presented in this paper for the following isotopes of major interest to studies of the thorium fuel cycle: 230 Th, 232 Th, 231 Pa, 233 Pa, 232 U, 233 U and 234 U. Comparisons between JENDL-3 and ENDF/B-VI which were performed at the point and group levels show large discrepancies in various cross sections. We conclude this report with a general remark that it is necessary to perform sensitivity studies to assess the impacts of the discrepancies between the two different sets of data on calculated reactor design and safety parameters of specific reactor systems and, based on the results of such sensitivity studies, to undertake new tasks of evaluations. (author). 2 refs, 245 figs, 8 tabs
Radiological contamination by depleted uranium in the Al-Tahreer tower building
International Nuclear Information System (INIS)
Al-Ataby, N.R.; Aisa, B.H.; Jebir, H.M.; Hatem, J.N.
2011-01-01
The research plan included assessment of the radioactivity of the Al-Tahreer Tower Building (the Turkish restaurant recent) through direct measurements and sampling of soil for the four floors (1th,2th,3th,4th) of the building, which contains fourteen floor in addition to the basement, by using portable radiation detection equipment to know the increasing in the levels of exposure and contamination resulting from the bombing a Al-Tahreer Tower building by depleted uranium bullets, the results of radiological surveys by using the portable contamination radiation detection (CAB) indicated readings of contaminated soil reached to 60 c/sec, and parts of shells of depleted uranium reached to 90 c/ sec , while the natural contamination rate in the area is (0.5 c/sec), the natural exposure rate in the area is 9 μR/ hr but the higher exposure rate reached to 60 μR / hr when the device (Ludlum) putting on the contaminated regions(distance about 0.5 cm). The radiological analyses of the collected soil samples were done in the laboratory of the center of Radiological Researches in the Ministry of sciences and Technology by using gamma spectrometry (which contains High-purity Germanium Detector) with a efficiency of 40% and resolution 2 keV for Energy, 1.33 Mev,collection,preparations and tests of soil samples were all done according to IAEA.The normal concentration for Th 234 and Pa 234 m in the soil samples taken from areas near to the building (can consider as background radiation region) is in range 41 Bq /Kg for Th 234 ,and nil for pa 234 m ,while higher concentration of Th 234 in contaminated soil is 1194 Bq/kg,and 1664 Bq/kg for pa 234 m which is a clear indication of the presence of high concentrations an isotope of uranium 238 as they are supposed to be in equilibrium radiation. The major aim of this study include removal the contaminated regions in the building, to protect the population and the environment from the effect of radiological contamination which
Operationalizing Mobile Applications for Humanitarian Assistance/Disaster Relief Missions
2014-03-01
the Samsung Galaxy SII (i9100) if it is the Unlocked GSM International Version that runs Gingerbread 2.3.4 OS; the 8 Samsung Nexus S if it is the...runs Gingerbread 2.3.4 OS (Naval Postgraduate School, 2013). Likewise he software can also be run on tablets, including the Samsung Galaxy Tab 7...Concept of FIST The FIST application was created to function in numerous diverse environments to support various possible missions, such as
1978-01-01
1.0 5.0 Wavelength dim) 10.0 15.0 (b) Orange tank lining no. SCI 1720, standard varnish works; and enamel, white ex- terior, no. 175, Walter Boysen...Oraevsky, "Spectra of Stimulated Emission in the Hydrogen Fluorine Reaction Process and Energy Transfer from DF to CO2," Applied Optics, Optical...Oraevsky, "Spectra of Stimulated Emission in the Hydrogen- Fluorine Reac- tion Process and Energy Transfer from DF to CO2," Applied Optics, Optical
International Nuclear Information System (INIS)
Bonotto, D.M.
1991-01-01
Uranium and thorium isotopic analysis were performed on well spoils of the main ore body at Morro do Ferro, Pocos de Caldas (MG), using groundwater from several boreholes in the area and surface water from a steam that originates at the base of the hill. For extraction of uranium and thorium a long chemical process was applied to samples; activities of 228Th and 232 Th isotopes (4n series) and also of 238U, 234U and 230Th isotopes (4n+2 series)were determined by the alpha spectrometry method. The ratios 234U?238U determined for well spoils did not show marked disequilibria between these isotopes. However, the ratios 228Th/232Th and 230Th/234U obtained in some samples showed a high disequilibrium between these isotopes, associated with the presence of possible zones of removal of uranium and precipitation of radium.(author)
Tritium Facilities Modernization and Consolidation Project Process Waste Assessment (Project S-7726)
International Nuclear Information System (INIS)
Hsu, R.H.; Oji, L.N.
1997-01-01
Under the Tritium Facility Modernization ampersand Consolidation (TFM ampersand C) Project (S-7726) at the Savannah River Site (SS), all tritium processing operations in Building 232-H, with the exception of extraction and obsolete/abandoned systems, will be reestablished in Building 233-H. These operations include hydrogen isotopic separation, loading and unloading of tritium shipping and storage containers, tritium recovery from zeolite beds, and stripping of nitrogen flush gas to remove tritium prior to stack discharge. The scope of the TFM ampersand C Project also provides for a new replacement R ampersand D tritium test manifold in 233-H, upgrading of the 233- H Purge Stripper and 233-H/234-H building HVAC, a new 234-H motor control center equipment building and relocating 232-H Materials Test Facility metallurgical laboratories (met labs), flow tester and life storage program environment chambers to 234-H
Uranium and radium geochemistry. Radioactive disequilibrium in natural waters
International Nuclear Information System (INIS)
Beaucaire, C.
1987-09-01
Rock-water interactions play a primary part in uranium-series disequilibrium either by different chemical behavior or by recoiling alpha emitting nuclei in solution. Three series of thermal water containing CO 2 (Vichy, Vals and Cezallier) and one from Lodeve uranium deposit are studied to define parameters (pH, Eh, pCO 2 , T,...) controlling studied nuclei. For U complexation by carbonates is in competition with redox conditions. Ra is coprecipitated by barium. For thermal waters keeping their deep characteristics there is a low disequilibriums 234 U- 238 U between 1 and 2. On the contrary important disequilibrium (up to 12) in Vichy Saint Yorre water are due to secondary remobilization. In the same way for these waters 234 U and 226 Ra are correlated. Then leaching is essential for the radioactive disequilibrium but alpha recoil of 234 Th is of secondary importance in this case [fr
Rosales-Loaiza, Néstor; Guevara, Miguel; Lodeiros, César; Morales, Ever
2008-06-01
Changes in salinity, temperature and irradiance during wet and dry seasons have induced metabolic versatility in cyanobacteria from saline environments. Cyanobacteria from these environments have biotechnological potential for the production of metabolites with pharmaceutical and industrial interest. We studied the growth, dry mass and metabolite production of the cyanobacterium Synechococcus sp. MOF-03 in function of irradiance (78, 156 and 234 micromol q m(-2) s(-1)). All batch cultures were maintained by triplicate in constant aeration, 12:12 h photoperiod, 30 +/- 2 degrees C and 35% per hundred. Maximum values of protein, carbohydrates and lipids, of 530.19 +/- 11.16, 408.94 +/- 4.27 and 56.20 +/- 1.17 microg ml(-1), respectively, were achieved at 78 micromol q m(-2) s(-1). Pigments, analyzed by HPLC, showed maximum values at 78 micromol q m(-2) s(-1) for chlorophyll a with 7.72 +/- 0.16 microg ml(-1), and at 234 micromol q m(-2) s(-1) for beta-carotene and zeaxanthin with 0.70 +/- 0.01 and 0.67 +/- 0.05 microg ml(-1). Chlorophyll a:beta-carotene ratio decreased from 17.15 to 6.91 at 78 and 234 micromol q m(-2) s(-'1); whereas beta-carotene:zeaxanthin ratio showed no changes between 78 and 156 micromol q m(-2) s(-1), around 1.21, and decreased at 234 micromol q m(-2) s(-1), to 1.04. Also, this cyanobacterium produced the greatest cell density and dry mass at 156 micromol q m(-2) s(-1), with 406.13 +/- 21.74 x l0(6) cell ml(-1) and 1.49 +/- 0.11 mg ml(-1), respectively. Exopolysaccharide production was stable between 156 y 234 micromol q m(-2) s(-1), around 110 microg ml(-1). This Synechococcus strain shows a great potential for the production of enriched biomass with high commercial value metabolites.
International Nuclear Information System (INIS)
Hamilton, T.; Heilmann, J.; Fowler, S.; Miquel, J.C.
1996-04-01
Dissolved and particulate concentrations of 234 Th, 210 Pb and 210 Po were measured in surface waters of the central and northern Adriatic Sea. The half-lives and biogeochemistry of 234 Th (t 1/2 = 24.1 days), 210 Po (t 1/2 = 138.4 days) and 210 Pb (t 1/2 = 22.3 years) are ideal for studying particle dynamics in the upper water column. It has been observed that the residence time of dissolved 234 Th with respect to removal on biogenic particles is inversely proportional to primary productivity and may be used to predict export from or new production in the euphotic zone. Model-derived 234 Th fluxes can also be used to help validate sediment trap collections in the upper water column. The aim of the present study was to gain an insight into the intensity and variability of active scavenging and particle removal processes in the central and northern Adriatic Sea. This semi-enclosed sea is strongly influenced by fresh water runoff from rivers carrying large quantities of dissolved nutrients and suspended particles. These inputs of nutrients and suspended particles are expected to give rise to large biological and biogeochemical gradients across the Continental Shelf and offer a range of environments for studying particle scavenging and removal processes. The authors have examined the relationships between 234 Th scavenging rates and residence times of dissolved and particulate phases as a function of other physical and biological parameters (primary productivity, POC, chlorophyll, C/N and total suspended matter). Particular reference is made to the two contrasting environments of the Adriatic--a eutrophic zone near the Po River outflow and in the largely oligotrophic waters of the Jabuka Pit
Mobilization of uranium isotopes in Brazilian aquifers
International Nuclear Information System (INIS)
Bonotto, Daniel Marcos
1994-01-01
The uranium isotopes 234 U and 238 U have been extensively used to study geochemical problems, mainly related to the hydrological medium. Active dissolution of these isotopes is occurring in groundwaters from several aquifers at southeastern region of Brazil. The dissolved uranium concentration showed variability related to the rainwater infiltration with the U content of groundwaters increasing during wet periods. The amount of uranium mobilized during rainwater infiltration showed an inverse correlation with the thickness of unsaturated silty clay at Morro do Ferro area. The experimental data favour the possibility of formation of soluble complexes of U and dissolved organic compounds at Morro do Ferro area, and also some absorption of U by clays during rainwater infiltration. Enhanced 234 U/ 238 U activity ratios for dissolved uranium have been found and explained in terms of combined chemical etch and leach processes for groundwaters of the Pocos de Caldas alkaline complex. These processes are considered responsible for the bulk dissolution of rock matrix rather then alpha-recoil effects. Several direct correlations have been found for groundwaters of Agua da Prata, which supported the effectiveness of etch/lead mechanisms, for example, between 234 U/ 238 U activity ratio and dissolved solids, ionic strength, C O 2 partial pressure, 'traditional' index of base exchange and 'new' index of base exchange (involving the anion fluoride). A higher 234 U/ 238 U activity ratio was found to be directly related to a higher value of dissolution rate and a higher value of 222 Rn content was found to be related with a higher value of specific surface area. These relationships explained a good inverse logarithmic correlation between 234 U/ 238 U activity ratio and 222 Rn content of the spring waters of Aguas da Prata. (author)
Complications of close interlock nailing in the management of close tibial fracture
International Nuclear Information System (INIS)
Saeed, M.; Inam, M.; Khan, I.; Satar, A.; Arif, M.
2015-01-01
Objective: The objective of this study is to find out the frequency of complications of locally made interlock nailing in tibia after nine months of surgery. Material and Method:. This case series study was done from March 2004 to February 14 in the Department of Orthopedic and Trauma Postgraduate Medical Institute Hayatabad Medical Complex Peshawar. A total of 58 adults ( after the closure of epiphysis) patients were randomly selected provided that they have; Close diaphysial fracture of tibia which is located 7 cm below the knee joint and 4 cm above the ankle joint and fracture less than one week old. Results: Total numbers of patients were 58. Anterior Knee pain was observed in 14(24.1%), delayed union in 10(17.2%), external of 100 rotation in 4(6.9%) and internal rotation of 50 in 1(1.7%), non union in 4(6.9%), intramedullay infection in 3(5.2%), shortening of 1 centimeter (cm) in 2(3.4), 2 cm in 1(1.7%) and 1.5 cm in 3(5.2%) cases, distal screw broken in 2(3.4%), proximal screw broken in 1(1.7%), Nail broken in 2(3.4), infection at proximal screw in 2(3.4%) and at distal screw was 2(3.4%), Restriction of knee flexion in 1(1.7%), Restricted ankle movements in 1(1.7%), varus angulation of 100 in 1(1.7%), valgus angulation of 100 in 1(1.7%), Ankle pain in 1(1.7%) and deep vein thrombosis in 1(1.7%). Conclusion: interlocking nail is considered to be the gold standard for management of tibial fracture but it is not free of complication especially knee pain and angular rotation. (author)
Implications of groundwater weathered profile interactions to the mobilization of radionuclides
International Nuclear Information System (INIS)
Bonotto, D.M.
1994-01-01
Full text: This study reports the nature and extent of open-system interaction between groundwater and a weathered profile developed in the high grade thorium and rare earth elements ore body in Morro do Ferro, Pocos de Caldas plateau. The radioelement mobility in the shallow oxidizing environment was considered on using chemical data in conjunction with U-234/U-238, Th-228/Th-232, Ra-226/Th-230 and Th-230/U-234 activity rations for borehole spoil and groundwater samples. Recharging groundwater from the studied borehole has low salinity values, with total dissolved solids content of 14.7 mg/l and total ionic strength of 0.00018. The ratio of the weight of dissolved radioelement per unit volume of solution to the weight of radioelement in solid phase per unit weight of solid phase showed that the radioelement solubility in the studied waters varied according to the following order: radium >> uranium > thorium. U-234/U-238 activity rations less than 1 were measured in solid phase and can justify the enhancement of U-234 in solution. Th-228/Th-232 activity ratio greater than 1 was found at about 18.75 m depth and is related with ingrowth of Th-228 from Ra-228 held in this site. Ra-226/Th-230 activity ratios greater than 1 and Th-230/U-234 activity ratios less than were evaluated between 20 and 27 m depth, where a 2.1-m thick magnetite dike was intersected. These ratios could be justified by deposition of U and Ra associated with ferric oxyhydroxides and kaolinite. Typical adsorption coefficient values for these phases and minerals saturation indices evaluated from the available data confirm this possibility
International Nuclear Information System (INIS)
Long, M.P.; Carbaugh, E.H.; Fairrow, N.L.
1994-11-01
Workers at two Department of Energy facilities, the Pantex Plant in Texas and the Hanford Site in Washington, are potentially exposed to class Y depleted or natural uranium. Since trace amounts of uranium are naturally present in urine excretion, site bioassay programs must be able to discern occupational exposure from naturally occurring uranium exposure. In 1985 Hanford established a 0.2-μg/d environmental screening level for elemental uranium in urine; the protocol was based on log-normal probability analysis of unexposed workers. A second study of background uranium levels commenced in 1990, and experiences in the field indicated that there seemed to be an excessive number of urine samples with uranium above the screening level and that the environmental screening level should be reviewed. Due to unforeseen problems, that second study was terminated before the complete data could be obtained. Natural uranium in rock (by weight, 99.27% 288 U, 0.72% 235 U, and 0.006% 234 U) has approximately equal activity concentrations of 238 U and 234 U. Earlier studies, summarized by the U.S. Environmental Protection Agency in 51 FR 32068, have indicated that 234 U (via 234 Th) has a greater environmental mobility than 238 U and may well have a higher concentration in ground water. By assuming that the 238 U-to 234 U ratio in the urine of nonoccupationally exposed persons should reflect the ratio of environmental levels, significant occupational exposure to depleted uranium would shift that ratio in favor of 238 U, allowing use of the ratio as a co-indicator of occupational exposure in addition to the isotope-specific screening levels. This approach has been adopted by Pantex. The Pacific Northwest Laboratory is studying the feasibility of applying this method to the natural and recycled uranium mixtures encountered at Hanford. The Hanford data included in this report represent work-in-progress
32 CFR 234.13 - Soliciting, vending, and debt collection.
2010-07-01
... advertising, collecting private debts or soliciting alms upon the Pentagon Reservation is prohibited. This..., advertising to sell or rent property of Pentagon Reservation employees or their immediate families. (c... or for the benefit of welfare funds for their members, after compliance with the requirements of...
24 CFR 234.270 - Condition of the multifamily structure.
2010-04-01
.... (b) If the property has been damaged by fire and such property was not covered by fire insurance at... Commissioner without deduction from the insurance benefits for any loss occasioned by such fire if the following conditions are met: (1) The property shall have been covered by fire insurance at the time the...
All projects related to | Page 234 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Region: China, Far East Asia, Central Asia, South Asia. Program: Food, Environment, and Health ... countries has become increasingly sophisticated and the evidence base has expanded. ... Region: Belarus, Europe, Russia, Ukraine.
Airline Service Quality Performance 234 (On-Time performance data).
2011-04-01
This CD presents data reported by U.S. certificated air carriers so that information on the air carriers' quality of service can be made available to consumers of air transportation. Carriers within 1% or more of the total domestic scheduled service ...
27 CFR 70.234 - Protection for obligatory disbursement agreements.
2010-04-01
... bank, in good faith, relies upon that letter of credit in making advances. The provisions of this... law against a judgment lien arising, as of the time of tax lien filing, out of an unsecured obligation... performance of a contract of the taxpayer and another person, the term “qualified property” shall be treated...
Airline Service Quality Performance 234 (On-Time performance data).
2011-07-01
This CD presents data reported by U.S. certificated air carriers so that information on the air carriers' quality of service can be made available to consumers of air transportation. Carriers within 1% or more of the total domestic scheduled service ...
Gillis, James R.; Blatherwick, Ronald D.; Bonomo, Francis S.
1985-11-01
The infrared spectrum of ν2 of D 2S was recorded from 740 to 1100 cm -1 on the University of Denver 50-cm FTIR spectrometer system. We have assigned 655 transitions from D 232S and 129 from D 234S, and have analyzed them using Watson's A-reduced Hamiltonian evaluated in the I r representation. We used the recently published D 232S and D 234S ground state Hamiltonian constants [C. Camy-Peyret, J. M. Flaud, L. Lechuga-Fossat and J. W. C. Johns, J. Mol. Spectrosc.109, 300-333 (1985)]. Upper state Hamiltonian constants were obtained from a fit of the ν2 transitions, keeping the ground state constants fixed while varying the upper state constants. The standard deviation of the D 232S ν2 fit is 0.0025 cm -1. The standard deviation of the D 234S ν2 fit is 0.0041 cm -1.
Fitriastuti, Dhina; Jumina, Priatmoko
2017-03-01
Xanthone is a phenolic secondary metabolite of Garcinia and Calophyllum herbs which has been clinically proven to display anti malaria activity. In the present paper, 2,3,4-trihydroxy-5-methyl xanthone which has been synthesized from gallic acid and o-cresol in Eaton's reagent was tested for its activity as antimalarial. Thus, HPIA assay of the synthesized xanthones was successfully conducted. The HPIA assay was carried out towards the xanthone, chloroquine diphosphate as positive control and distilled water as negative control in various concentration. The samples were reacted with hematin (ferriprotoporphyrin IX hydroxide) and the absorbance of the precipitate was observed by using Elisa reader. The results of HPIA assay showed that 2,3,4-trihydroxy-5-methyl xanthone and chloroquine have IC50 values of 0.755 and 1.462 mg/mL or 2.92 and 4.57 mM, respectively. 2,3,4-Trihydroxy-5-methyl xanthone displayed better antimalarial activity than chloroquine.
DEFF Research Database (Denmark)
Tagmose, Tina Møller
-5-hydroxymethyl-piperidine was synthesised. Swern oxidation of methyl 2,3,4-tri-O-benzyl-6-deoxy-alfa-D-glucoheptopyranoside gave methyl 2,3,4-tri-O-benzyl-6-deoxy-alfa-D-glucoheptodialdo-1,5-pyranoside which was coupled with the piperidine 9 by reductive amination. This gave methyl 2,3,4-tri...... and periodate cleavage of the carbon chain gave 4-O-benzyl-2-C-deoxy-hydroxymethyl-D-xylo-pentodialdose. Reductive amination with ammonia resulted in (3R,4R,5R)-4-benzyloxy-3-hydroxy-5-hydroxymethyl-piperidine (9). By catalytic hydrogenation under acidic conditions the hydrochloride of (3R,4R,5R)-3,4-dihydroxy......-peroxide resulted in stereoselective formation of the methyl 6,7-dideoxy-7-[(1'S,3'R,4'R,5'R)-3',4'-dihydroxy-5'-hydroxymethylp iperidinyl]-alfa-D-glucoheptopyranoside N-oxide a 2'-deoxy-gentiobiose analogue. N-Alkylation of 1 with methyliodide resulted in two isomers of methyl 6,7-dideoxy-7-[3'R,4'R,5'R...
International Nuclear Information System (INIS)
Toulhoat, P.
1987-09-01
The behavior in ground water of uranium, daughter products with long half life (U 234 , Th 230 , Ra 226 ) and stable (radiogenic lead) and lanthanides is studied by two complementary methods: 1) In situ multielement tracing in fracturated granitic rocks and porous sedimentary rocks of low permeability allowing to understand interactions between hydrodynamics and geochemistry. 2) Study of the properties of U 234 and Pb 236 which are mineralization tracers and are relatively independent of redox conditions, on the contrary U 238 has a low solubility in reducing medium. Three areas are studied: Bazois and Lodeve basin (France) and Cigar Lake (Canada). Radioactive disequilibriums are thoroughly studied when required by ore/rock interaction. Adsorption-desorption phenomena are of great importance in proposed prospection models. If prospection models based on alpha activity ratio U 234 /U 238 and lead isotope ratio in ground water can be applied, an integrated prospection model requires more in situ and laboratory experiments [fr
Positron Annihilation Study of Defects in Succinonitrile
DEFF Research Database (Denmark)
Eldrup, Morten Mostgaard; Pedersen, Niels Jørgen; Sherwood, J. N.
1979-01-01
Positron lifetime and angular correlation measurements have been made on the plastic crystal succinonitrile. They confirm the phase transition at 234 ± 1 K. In the plastic phase the average orthopositronium lifetime increases with temperature and saturates at the highest temperatures. This is int......Positron lifetime and angular correlation measurements have been made on the plastic crystal succinonitrile. They confirm the phase transition at 234 ± 1 K. In the plastic phase the average orthopositronium lifetime increases with temperature and saturates at the highest temperatures...
Photoneutron and Photonuclear Cross Sections According to Packed cluster Model
International Nuclear Information System (INIS)
El-Mekkawi, L.S.; El-Bakty, O.M.
1998-01-01
Photonuclear gross sections have been estimated for 232 Th, 237 Np, 239 Pu, 233 U, 234 U, 235 U, 238 U in the energy range from threshold up to 20 MeV, by perturbation balance in Packed Cluster. The Packed Cluster (gamma, f) and (gamma, n) cross sections require complete absence of any (gamma,2n) or (gamma,nf) cross sections for 233 U and 234 U as in experiment. It also explains the early (gamma,n) and gamma,nf) reactions in 235 U
A device for uranium series leaching from glass fiber in HEPA filter
International Nuclear Information System (INIS)
Gye-Nam Kim; Hye-Min Park; Wang-Kyu Choi; Jei-Kwon Moon
2012-01-01
For the disposal of a high efficiency particulate air (HEPA) glass filter into the environment, the glass fiber should be leached to lower its radioactive concentration to the clearance level. To derive an optimum method for the removal of uranium series from a HEPA glass fiber, five methods were applied in this study. That is, chemical leaching by a 4.0 M HNO 3 -0.1 M Ce(IV) solution, chemical leaching by a 5 wt% NaOH solution, chemical leaching by a 0.5 M H 2 O 2 -1.0 M Na 2 CO 3 solution, chemical consecutive chemical leaching by a 4.0 M HNO 3 solution, and repeated chemical leaching by a 4.0 M HNO 3 solution were used to remove the uranium series. The residual radioactivity concentrations of 238 U, 235 U, 226 Ra, and 234 Th in glass after leaching for 5 h by the 4.0 M HNO 3 -0.1 M Ce(IV) solution were 2.1, 0.3, 1.1, and 1.2 Bq/g. The residual radioactivity concentrations of 238 U, 235 U, 226 Ra, and 234 Th in glass after leaching for 36 h by 4.0 M HNO 3 -0.1 M Ce(IV) solution were 76.9, 3.4, 63.7, and 71.9 Bq/g. The residual radioactivity concentrations of 238 U, 235 U, 226 Ra, and 234 Th in glass after leaching for 8 h by a 0.5 M H 2 O 2 -1.0 M Na 2 CO 3 solution were 8.9, 0.0, 1.91, and 6.4 Bq/g. The residual radioactivity concentrations of 238 U, 235 U, 226 Ra, and 234 Th in glass after consecutive leaching for 8 h by the 4.0 M HNO 3 solution were 2.08, 0.12, 1.55, and 2.0 Bq/g. The residual radioactivity concentrations of 238 U, 235 U, 226 Ra, and 234 Th in glass after three repetitions of leaching for 3 h by the 4.0 M HNO 3 solution were 0.02, 0.02, 0.29, and 0.26 Bq/g. Meanwhile, the removal efficiencies of 238 U, 235 U, 226 Ra, and 234 Th from the waste solution after its precipitation-filtration treatment with NaOH and alum for reuse of the 4.0 M HNO 3 waste solution were 100, 100, 93.3, and 100%. (author)
Alpha spectrometry enriched uranium urinalysis results from IPEN
International Nuclear Information System (INIS)
Lima, Marina Ferreira
2008-01-01
Full text: IPEN (Instituto de Pesquisas Energeticas e Nucleares) manufactures the nuclear fuel to its research reactor, the IEA-R1. The CCN (Centro do Ciclo do Combustivel) facility produces the fuel cermets from UF 6 (uranium hexafluoride) enriched to 19.75% in 235 U. The production involves the transformation of the gaseous form in oxides and silicates by ceramic and metallurgical processing. The workers act in more than one step that involves exposition to types F, S and M compounds of uranium. Until 2003, only fluorimetric analysis was carried out by the LRT (Laboratorio de Radiotoxicologia - IPEN) in order to evaluate the intake of uranium, in spite of the sub estimation of the 234 U contribution to the internal doses. Isotopic uranium determination in urine by alpha spectrometry is the current method to monitoring the contribution of 234 U, 235 U and 238 U. Alpha spectrometry data of 164 samples from 84 individuals separate in three categories of workers: routinely work group; special operation group and control group - were analyzed how the isotopic composition excreted by urinary tract corresponds with the level of enrichment and isotopic composition of the plant products. Results show that is hard to estimate these intakes of 234 U and 235 U since these isotopes alpha activities are below the limit of detection or minimum detectable activity (MAD) of this method in the most part of the samples. Only in 22 samples it was possibly to measure the three radionuclides. Not expected high contribution of 234 U activity was found in samples of the control group. No one result over the 234 U and 235 U MAD was found in the samples from the special operation group. Only in 5 samples from the routinely group the levels of 235 U was higher than the levels of others groups. In a complementary study, 3 solid samples of UF 6 , U 2 O 8 and U 3 Si 2 from CCN plant were analyzed to determinate the isotopic uranium composition in these salts, since this composition varies
Directory of Open Access Journals (Sweden)
Xinjian Peng
2015-12-01
Full Text Available Uranium (U concentration and the activities of 238U, 234U, and 230Th were determined for groundwaters, spring waters, and lake water collected from the Shihongtan sandstone-hosted U ore district and in the surrounding area, NW China. The results show that the groundwaters from the oxidizing aquifer with high dissolved oxygen concentration (O2 and oxidation-reduction potential (Eh are enriched in U. The high U concentration of groundwaters may be due to the interaction between these oxidizing groundwaters and U ore bodies, which would result in U that is not in secular equilibrium. Uranium is re-precipitated as uraninite on weathered surfaces and organic material, forming localized ore bodies in the sandstone-hosted aquifer. The 234U/238U, 230Th/234U, and 230Th/238U activity ratios (ARs for most water samples show obvious deviations from secular equilibrium (0.27–2.86, indicating the presence of water-rock/ore interactions during the last 1.7 Ma and probably longer. The 234U/238U AR generally increases with decreasing U concentrations in the groundwaters, suggesting that mixing of two water sources may occur in the aquifer. This is consistent with the fact that most of the U ore bodies in the deposit have a tabular shape originati from mixing between a relatively saline fluid and a more rapidly flowing U-bearing meteoric water.
International Nuclear Information System (INIS)
1992-09-01
An aerial radiological survey was conducted from July 11--20, 1990, over an 83-square-kilometer (32-square-mile) area surrounding the Portsmouth Gaseous Diffusion Plant located near Portsmouth, Ohio. The survey was conducted at a nominal altitude of 91 meters (300 feet) with line spacings of 122 meters (400 feet). A contour map of the terrestrial gamma exposure rate extrapolated to 1 meter above ground level (AGL) was prepared and overlaid on an aerial photograph and a set of United States Geological Survey (USGS) topographic maps of the area. The terrestrial exposure rates varied from about 7 to 14 microroentgens per hour (μR/h) at 1 meter above the ground. Analysis of the data for man-made sources and for the uranium decay product, protactinium-234m ( 234m Pa), showed five sites within the boundaries of the Portsmouth Gaseous Diffusion Plant with elevated readings. Spectra obtained in the vicinity of the buildings at the Portsmouth Gaseous Diffusion Plant showed the presence of 234m Pa, a uranium-238 ( 238 U) decay product. In addition, spectral analysis of the data obtained over the processing plant facility showed gamma activity indicative of uranium-235 ( 234 U). No other man-made gamma ray emitting radioactive material was detected, either on or off the Portsmouth Gaseous Diffusion Plant property. Soil samples and pressurized ion chamber measurements were obtained at five different locations within the survey boundlaries to support the aerial data
Emanations and 'induced' radioactivity: from mystery to (mis)use
International Nuclear Information System (INIS)
Kolar, Z.I.
1999-01-01
The natural Rn isotopes were discovered within the period 1899-1902 and at that time referred to as emanations because they came out (emanated) of sources/materials containing actinium, thorium and radium, respectively. The (somewhat mysterious) emanations appeared to disintegrate into radioactive decay products which by depositing at solid surfaces gave rise to 'induced' radioactivity i.e. radioactive substances with various half-lives. Following the discovery of the emanations the volume of the research involving them and their disintegration products grew steeply. The identity of a number of these radioactive products was soon established. Radium emanation was soon used as a source of RaD ( 210 Pb) to be applied as an 'indicator' (radiotracer) for lead in a study on the solubility of lead sulphide and lead chromate. Moreover, radium and its emanation were introduced into the medical practice. Inhaling radon and drinking radon-containing water became an accepted medicinal use (or misuse?) of that gas. Shortly after the turn of the century, the healing (?) action of natural springs (spas) was attributed to their radium emanation, i.e. radon. Bathing in radioactive spring water and drinking it became very popular. Even today, bathing in radon-containing water is still a common medical treatment in Jachymov, Czech Republic. (author)
Study of Soil Decontamination Method Using Supercritical Carbon Dioxide and TBP
International Nuclear Information System (INIS)
Park, Jihye; Park, Kwangheon; Jung, Wonyoung
2014-01-01
The result of this study means that we have a possible new method for cheap and less wasteful nuclear waste decontamination. When severe accidents such as the incident at the Fukushima nuclear site occur, the soil near the power plant is contaminated with fission products or the activation metal structure of the power plant. The soil pollution form depends on the environment and soil characteristics of the contaminated areas. Thus, a- single-decontamination method is not effective for site cleanup. In addition, some soil decontamination methods are expensive and large amounts of secondary waste are generated. Therefore, we need new soil decontamination methods. In this study, instead of using a conventional solvent method that generates secondary waste, supercritical carbon dioxide was used to remove metal ions from the soil. Supercritical carbon dioxide is known for good permeation characteristics. We expect that we will reduce the cost of soil pollution management. Supercritical carbon dioxide can decontaminate soil easily, as it has the ability to penetrate even narrow gaps with very good moisture permeability. We used TBP, which is a known for extractant of actinium metal. TBP is usually used for uranium and strontium extraction. Using TBP-HNO 3 complex and supercritical carbon dioxide, we did extraction experiments for several heavy metals in contaminated soil
Study of Soil Decontamination Method Using Supercritical Carbon Dioxide and TBP
Energy Technology Data Exchange (ETDEWEB)
Park, Jihye; Park, Kwangheon; Jung, Wonyoung [Kyunghee Univ., Yongin (Korea, Republic of)
2014-05-15
The result of this study means that we have a possible new method for cheap and less wasteful nuclear waste decontamination. When severe accidents such as the incident at the Fukushima nuclear site occur, the soil near the power plant is contaminated with fission products or the activation metal structure of the power plant. The soil pollution form depends on the environment and soil characteristics of the contaminated areas. Thus, a- single-decontamination method is not effective for site cleanup. In addition, some soil decontamination methods are expensive and large amounts of secondary waste are generated. Therefore, we need new soil decontamination methods. In this study, instead of using a conventional solvent method that generates secondary waste, supercritical carbon dioxide was used to remove metal ions from the soil. Supercritical carbon dioxide is known for good permeation characteristics. We expect that we will reduce the cost of soil pollution management. Supercritical carbon dioxide can decontaminate soil easily, as it has the ability to penetrate even narrow gaps with very good moisture permeability. We used TBP, which is a known for extractant of actinium metal. TBP is usually used for uranium and strontium extraction. Using TBP-HNO{sub 3} complex and supercritical carbon dioxide, we did extraction experiments for several heavy metals in contaminated soil.
Hydroxyzine induced pancytopenia and petechial rashes: a rare complication
Directory of Open Access Journals (Sweden)
Ihsan Ates
2016-09-01
Full Text Available Hydroxyzine is used as an additional treatment both in symptomatic treatment of anxiety and stress caused by psychoneurosis and in organic diseases which anxiety appeared. It is used to treat pruritis caused by histamine and such allergic cases like chronic urticaria because of antihistaminic effect, atopic and contact dermatitis. In this case report, that widespread milimetric petechial rashes in all body and deep pancytopnia development is seen in a patient using hydroxyzine tablet because of pruritis at joints is disscussed. [J Contemp Med 2016; 6(3.000: 234-234
Uranium series disequilibrium studies at the Broubster analogue site
International Nuclear Information System (INIS)
Longworth, G.; Ivanovich, M.; Wilkins, M.A.
1990-11-01
Uranium series measurements at a natural analogue site at Broubster, Caithness have been used to investigate radionuclide migration over periods ranging from several hundred to 10 6 years. The measured values for the uranium concentration and activity values 234 U/ 238 U and 230 Th/ 234 U indicate that the geochemical system is more complicated than that originally proposed of uranium dispersion and water transport into a peat bog. There appears to be little thorium mobility although there is evidence for an appreciable fraction of thorium on the colloidal phase. (author)
Uranium series disequilibrium studies at the Broubster analogue site
International Nuclear Information System (INIS)
Longworth, G.; Ivanovich, M.; Wilkins, M.A.
1989-09-01
Uranium series measurements at a natural analogue site at Broubster, Caithness have been used to investigate radionuclide migration over a period of several hundred to 10 6 years. The measured values for the uranium concentration and activity ratios 234 U/ 238 U and 230 Th/ 234 U indicate that the geochemical system is more complicated than that originally proposed of uranium dispersion and water transport into a peat bog. There appears to be little thorium mobility although there is evidence for an appreciable fraction of thorium on the colloidal phases. (author)
Microscopic structure of superdeformed states in Th, U, Pu and Cm isotopes with Gogny force
International Nuclear Information System (INIS)
Girod, M.; Delaroche, J.P.; Romain, P.; Libert, J.
2002-01-01
The structure properties of the even-even nuclei 226, 228, 230, 232, 234 Th, 230, 232, 234, 236, 238, 240 U, 240, 242, 244, 246 Pu, and 242, 244, 246, 248 Cm have been investigated at normal and superdeformed shapes in microscopic mean-field calculations based on Gogny force. Collective levels are predicted from constrained Hartree-Fock-Bogoliubov and configuration mixing calculations. Two quasiparticle states are also predicted from blocking calculations for neutron and proton configurations. Predictions are shown and compared with experimental data at superdeformed shapes. (orig.)
1998-05-08
34Cosmos-84" and "Cosmos-90" there were used RTGs on polonium - 210 with the conditional name "Orion-1" and "Orion-2". In 1969 and 1971 for heating the...compartment with "Lunokhod-1" and "Lunokhod-2" equipment there were used radionuclide heat units on polonium - 210 with the power of 800 W. As is known...of TE being the absence of the noise of a compressor. These refrigerators that contain food and drink are quite sophisticated in that they are
Methods for obtaining sorption data from uranium-series disequilibria
International Nuclear Information System (INIS)
Finnegan, D.L.; Bryant, E.A.
1987-12-01
Two possible methods have been identified for obtaining in situ retardation factors from measurements of uranium-series disequilibria at Yucca Mountain. The first method would make use of the enhanced 234 U/ 238 U ratio in groundwater to derive a signature for exchangeable uranium sorbed on the rock; the exchangeable uranium would be leached and assayed. The second method would use the ratio of 222 Rn to 234 U in solution, corrected for weathering, to infer the retardation factor for uranium. Similar methods could be applied to thorium and radium
International Nuclear Information System (INIS)
Porcelli, D.; Wasserburg, G.J.; Andersson, P.S.
1997-01-01
The importance of colloids and organic deposits for the transport of uranium isotopes from continental source regions and through the estuarine environment was investigated in the mire-rich Kalix River drainage basin in northern Sweden and the Baltic Sea. Ultrafiltration techniques were used to separate uranium and other elements associated with colloids > 10 kD and >3 kD from open-quotes soluteclose quotes uranium and provided consistent results and high recovery rates for uranium as well as for other elements from large volume samples. Uranium concentrations in 0.45 μm-filtered Kalix River water samples increased by a factor of 3 from near the headwaters in the Caledonides to the river mouth while major cation concentrations were relatively constant. 234 U 238 U ratios were high (δ 234 U = 770-1500) throughout the basin, without showing any simple pattern, and required a supply of 234 U-rich water. Throughout the Kalix River, a large fraction (30-90%) of the uranium is carried by >10 kD colloids, which is compatible with uranium complexation with humic acids. No isotopic differences were found between colloid-associated and solute uranium. Within the Baltic Sea, about half of the uranium is removed at low salinities. The proportion that is lost is equivalent to that of river-derived colloid-bound uranium, suggesting that while solute uranium behaves conservatively during estuarine mixing, colloid-bound uranium is lost due to rapid flocculation of colloidal material. The association of uranium with colloids therefore may be an important parameter in determining uranium estuarine behavior. Mire peats in the Kalix River highly concentrate uranium and are potentially a significant source of recoil 234 U to the mirewaters and river waters. However, mirewater data clearly demonstrate that only small 234 U/ 238 U shifts are generated relative to inflowing groundwater. 63 refs., 8 figs., 3 tabs. groundwater. 63 refs., 8 figs., 3 tabs
Li, Lu; Yuan, Yuxiang; Chen, Liwen; Li, Mu; Ji, Pingting; Gong, Jieling; Zhao, Yin; Zhang, Hong
2017-09-01
The goal of this study was to calculate the anterior chamber volume and assess aqueous inflow in rat eyes in vivo, under anesthetic condition. Gadolinium-contrast agent (Gd-DTPA, 234.5 mg/ml) was administered to Sprague-Dawley rat eyes via anterior chamber injection or instillation of 234.5 or 117.25 mg/ml Gd-DTPA in 0.2% azone as eye drops, and changes of Gd signal visualized by 7.0 T magnetic resonance imaging (MRI). The safety of local application of Gd-DTPA and azone were performed after MRI scanning. The anterior chamber injection of Gd-DTPA (234.5 mg/ml) group was used for anterior chamber volume and aqueous inflow calculating. Serial changes in Gd-DTPA relative concentration in the anterior chamber was determined based on the initial Gd signal gray values and the initial relative concentration of Gd-DTPA after anterior chamber Gd-DTPA injection. The mean aqueous inflow in rat eyes in vivo was assessed based on changes in Gd-DTPA relative concentration and the anterior chamber volume. Eye drops of Gd-DTPA (234.5 mg/ml) in 0.2% azone readily allowed safe assessment of the aqueous inflow by 7.0 T MRI. Under anesthetic condition in vivo, the mean anterior chamber volume (ACV) in rats was 8493.6 ± 657.4 μm 3 , no differences were observed in the aqueous inflow measured by topical instillation of 234.5 mg/ml Gd-DTPA in 0.2% azone (0.182 ± 0.011 μl/min) between that measured by anterior chamber injection (0.165 ± 0.041 μl/min, P > 0.05), Timolol reduced aqueous inflow to 0.124 ± 0.020 μl/min (P DTPA can be assessed by the variability of relative concentration of Gd-DTPA in anterior chamber and ACV in vivo, under anesthetic condition. Copyright © 2017 Elsevier Ltd. All rights reserved.
Analysis of lanthanides and actinides in sea sediments from the Gulf of Tehuantepec
International Nuclear Information System (INIS)
Eduardo Ordonez-Regil; Genoveva Garcia-Rosales; Omar Eduardo Gutierrez-Muniz
2011-01-01
Seawater contains trace elements in solution, such as lanthanides and uranium, which can act as natural tracers when they flocculate to form the sediments of the seabed. Uranium is a special case because it is a radioactive element with isotopic ratio close to 1.14 ( 234 U/ 238 U) in sea water. Uranium is also present in all fractions of sediments, although the isotopic ratio in each fraction takes a specific value depending on its origin and surrounding environment. This work has been conducted in order to analyze lanthanides and uranium in a core of sea sediments. It is focused on separating the fractions forming the layers along the depth profile of the core sample so as to determine the 234 U/ 238 U activity ratios in fractions of organic matter, aquatic life skeletons and dissolved minerals. The Neutron Activation Analysis showed the presence of U, Lu, Hf, Eu, Ce and Yb ranging up to 50 ppm while alpha spectrometry gave a series of 234 U/ 238 U activity ratios which are discussed on the basis of statistical analysis. (author)
Leaching of uranium and thorium from monazite: III. Leaching of radiogenic daughters
International Nuclear Information System (INIS)
Olander, D.; Eyal, Y.
1990-01-01
The solid-state diffusion model of actinide leaching developed in Part II of this series is applied to leaching of radiogenic daughters of the actinide decay chains. For an untreated natural monazite, the direct leaching component of 228 Th release is larger than that for 232 Th because of enhanced solid-state mobility for 228 Th provided by 228 Ra-recoil tracks. A significant portion of the 228 Th which appears in the leachate, however, is attributed to decay of insoluble 228 Ra which is continually released from the mineral by matrix dissolution and recoil ejection. For a monazite sample that was annealed at 800 degree C prior to leaching, the bulk of the 228 Th in solution was supplied by decay of 228 Ra rejected from the mineral matrix during annealing. The radiogenic 234 U daughter of the 238 U decay chain did not exhibit similarly enhanced leaching because the long half-life of 234 U permitted local radiation damage to be annealed out at ambient temperature prior to 234 U decay
Barbecot, Florent; Ghaleb, Bassam; Hillaire-Marcel, Claude
2015-04-01
In carbonate rich soils, C-isotopes (14C, 13C) and carbonate mass budget may inform on centennial to millennial time scale dissolution/precipitation processes and weathering rates, whereas disequilibria between in the U- and Th-decay series provide tools to document high- (228Ra-228Th-210Pb) to low- (234U, 230Th, 231Pa, 226Ra) geochemical processes rate, covering annual to ~ 1Ma time scales, governing both carbonate and silicate soil fractions. Because lithology constitutes a boundary condition, we intend to illustrate the behavior of such isotopes in soils developed over Astian sands formation (up to ~ 30% carbonate) from the Béziers area (SE France). A >20 m thick unsaturated zone was sampled firstly along a naturally exposed section, then in a cored sequence. Geochemical and mineralogical analyses, including stable isotopes and 14C-measurements, were complemented with 228U, 234U, 230Th, 226Ra, 210Pb and 228Th, 232Th measurements. Whereas the upper 7 m depict geochemical and isotopic features forced by dissolution/precipitation processes leading to variable radioactive disequilibria, but overall deficits in more soluble elements of the decay series, the lower part of the sequence shows strong excesses in 234U and 230Th over parent isotopes (i.e., 238U and 234U, respectively). These features might have been interpreted as the result of successive phases of U-loss and gains. However, 226Ra and 230Th are in near-equilibrium, thus leading to conclude at a more likely slow enrichment process in both 234Th(234U) and 230Th, which we link to dissolved U-decay during groundwater recharge events. In addition, 210Pb deficits (vs parent 226Ra) are observed down to 12 m along the natural outcropping section and below the top-soil 210Pb-excess in the cored sequence, due to gaseous 222Rn-diffusion over the cliff outcrop. Based on C-isotope and chemical analysis, reaction rates at 14C-time scale are distinct from those estimates at the short- or long-lived U-series isotopes
Isolating the Lyman alpha forest BAO anomaly
Energy Technology Data Exchange (ETDEWEB)
Evslin, Jarah, E-mail: jarah@impcas.ac.cn [Institute of Modern Physics, Chinese Academy of Sciences, NanChangLu 509, Lanzhou 730000 (China)
2017-04-01
A 2.5-3σ discrepancy has been reported between the baryonic acoustic oscillation peak (BAO) in the Lyman α forest at z ∼ 2.34 and the best fit Planck ΛCDM cosmology. To isolate the origin of the tension, we consider unanchored BAO, in which the standard BAO ruler is not calibrated, eliminating any dependence on cosmology before redshift z ∼ 2.34. We consider BOSS BAO measurements at z ∼ 0.32, 0.57 and 2.34, using the full 2-dimensional constraints on the angular and line of sight BAO scale, as well as isotropic BAO measurements by 6dF and SDSS at z ∼ 0.106 and z ∼ 0.15. We find that the z >0.43 data alone is in 2.9σ of tension with ΛCDM with or without the Planck best fit values of the mass fraction Ω {sub m} and the BAO scale r {sub d} H {sub 0}, indicating that the tension arises not from the ΛCDM parameters but from the dark energy evolution itself at 0.57< z <2.34. This conclusion is supported when the acoustic scale measured by the CMB is included, which further increases the tension and excludes a solution with a constant dark energy equation of state. Including the low z BAO data, which is itself consistent with ΛCDM, reduces the tension to just over 2σ, however in this case a CPL parametrization of the dark energy evolution yields only a modest improvement.
Uptake of uranium from drinking water
International Nuclear Information System (INIS)
Singh, N.P.; Wrenn, M.E.
1987-01-01
The gastrointestinal absorption (G.I.) of uranium in man from drinking water was determined by measuring urinary and fecal excretion of 234 U and 238 U in eight subjects. In order to establish their normal backgrounds of uranium intake and excretion the subjects collected 24 hour total output of both urine and feces for seven days prior to drinking water. During the next day they drank, at their normal rate of drinking water intake, 900 ml of water containing approximately 90 pCi 238 U and 90 pCi 234 U (274 μg U) and continued to collect their urine and feces for seven additional days. Utilizing one technique for analyzing data, the G.I. absorption of 234 U ranged from -0.07% to 1.88% with an average of 0.51% and G.I. absorption of 238 U ranged from -0.07% to 1.79% with an average of 0.50%. Employing another technique for analyzing the data, the G.I. absorption ranged from -0.04 to 1.46% with a mean of 0.53% for 234 U and from 0.03% to 1.43% with a mean of 0.52 for 238 U. The dietary intake of U was also estimated from measurements of urinary and fecal excretion of U in eight subjects prior to drinking water containing U. The estimated average dietary intake of U for these subjects is 3.30 +/- 0.65 or 4.22 +/- 0.65 μg/day. These averages are two to four times higher than the values reported in the literature for dietary intake
International Nuclear Information System (INIS)
Gourgiotis, A.
2008-06-01
The element uranium with the particular oxido-reducing properties is often associated with environments rich in organic matter; this is why several authors have proposed to use it as tracer of paleo-productivity in marine sediments. This work describes the distribution of the uranium natural families' radionuclides in organic rich Mediterranean sediments: the sapropels. Several techniques of measurements were used such as mass spectrometry (TIMS, ICP-QMS), alpha and gamma spectrometry. Activity ratios 234 U/ 238 U as well as the ages U-Th of the sapropels present irregular profiles which do not correspond to the assumptions which had been made to explain their formation. Using an 1D diffusion model we have showed that these profiles result from the migration of the radionuclides out of the sapropels. We validated these observations by analyzing several levels of sapropels presenting a spatio-temporal variability. Our study confirms the migration of radiogenic uranium 234 U rad , which is produced in situ by his father the 238 U, as well as the migration of the 226 Ra. However the mobility of radiogenic uranium ( 234 U rad ) is not sufficient to explain the drift of the 230 Th/ 238 U and 231 Pa/ 235 U activity ratios in the S5 sapropel. An important result is that authigenic uranium also migrates, but with lower effective diffusion coefficients than those of the 234 U rad . Because of this mobility, the use of U authigenic of the sediments as an indicator of paleo-productivity must thus be used with precaution. (author)
International Nuclear Information System (INIS)
Rezzoug, S.; Michel, H.; Barci-Funel, G.; Barci, V.; Fernex, F.
2009-01-01
Four cores were collected in weathered rocks and soils in the Boreon forest area (1765 m, Mercantour Massif, France). The samples were analyzed for the isotopes 230 Th, 232 Th, 234 U and 238 U. The activity and isotopic ratio profiles suggest that uranium was mobilized (leaching and precipitation) during the weathering process, as well as thorium but in a much less proportion. A model was drawn up to evaluate the U leaching rate and the time that some levels of the weathered rocks have been subjected to weathering. It utilizes LATHAM and SCHWARCZ's two equations,15 expressed as 234 U/ 238 U and 230 Th/ 238 U activity ratios, which assume that the alpha recoil effect allows easier leaching for 234 U than 238 U and no Th mobility. But this last assumption does not correspond to the observations made in the Boreon area, since it appears that in some soil deeper layers 230 Th and 228 Th are in radioactive deficit relatively to their parents. As there are four unknown quantities (the time, the leaching rates of 238 U, 234 U, 230 Th), the problem to be solved requires two more equations; these can be obtained utilizing the U activity ratio in water, and taking into account the 232 Th behavior. In some sites the 238 U leaching rate is high in deeper soil levels (near the fresh rocks); this would correspond to a loss of half the U amount in less than 24 000 years. (author)
Jahn-Teller effect versus Hund's rule coupling in C60N-
Wehrli, S.; Sigrist, M.
2007-09-01
We propose variational states for the ground state and the low-energy collective rotator excitations in negatively charged C60N- ions (N=1,…,5) . The approach includes the linear electron-phonon coupling and the Coulomb interaction on the same level. The electron-phonon coupling is treated within the effective mode approximation which yields the linear t1u⊗Hg Jahn-Teller problem whereas the Coulomb interaction gives rise to Hund’s rule coupling for N=2,3,4 . The Hamiltonian has accidental SO(3) symmetry which allows an elegant formulation in terms of angular momenta. Trial states are constructed from coherent states and using projection operators onto angular momentum subspaces which results in good variational states for the complete parameter range. The evaluation of the corresponding energies is to a large extent analytical. We use the approach for a detailed analysis of the competition between Jahn-Teller effect and Hund’s rule coupling, which determines the spin state for N=2,3,4 . We calculate the low-spin-high-spin gap for N=2,3,4 as a function of the Hund’s rule coupling constant J . We find that the experimentally measured gaps suggest a coupling constant in the range J=60-80meV . Using a finite value for J , we recalculate the ground state energies of the C60N- ions and find that the Jahn-Teller energy gain is partly counterbalanced by the Hund’s rule coupling. In particular, the ground state energies for N=2,3,4 are almost equal.
Uranium in open ocean: concentration and isotopic composition
International Nuclear Information System (INIS)
Ku, T.L.; Knauss, K.G.; Mathieu, G.G.
1977-01-01
Uranium concentrations and 234 U/ 238 U activity ratios have been determined in 63 seawater samples (nine vertical profiles) from the Atlantic, and Pacific, and Arctic, and the Antarctic oceans, using the alpha-spectrometric method for their determinations. Correlation between uranium and salinity is well manifested by the data from the Arctic and the Antarctic oceans, but such a relation cannot be clearly defined with the +-(1 to 2)% precision of uranium measurements for the Atlantic and Pacific data. At the 95% confidence level: (1) the uranium/salinity ratio is (9.34 + - 0.56) x 10 -8 g/g for the seawater analyzed with salinity ranging from 30.3 to 36.2 per thousand; the uranium concentration of seawater of 35 per thousand salinity is 3.3 5 + - 0.2 μ g l -1 ; (2) the 234 U/ 238 U activity ratio is 1.14 +- 0.03. Uranium isotopes in interstitial waters of the Pacific surface sediments analyzed do not show large concentration differences across the sediment-water interface as suggested by previous measurements. Current estimations of the average world river uranium concentration (0.3 to 0.6 μ g l -1 ) and 234 U/ 238 U ratio (1.2 to 1.3) and of the diffusional 234 U influx from sediments 0.3 dpm cm -2 10 -3 yr -1 ) are essentially consistent with a model which depicts a steady state distribution of uranium in the ocean. However, the 0.3 to 0.6 μ g l -1 value for river uranium may be an upper limit estimate. (author)
Directory of Open Access Journals (Sweden)
Grazielle Cardoso da Graça
2012-08-01
Full Text Available In this study, PCR assays targeting different Leishmania heat-shock protein 70 gene (hsp70 regions, producing fragments ranging in size from 230-390 bp were developed and evaluated to determine their potential as a tool for the specific molecular diagnosis of cutaneous leishmaniasis (CL. A total of 70 Leishmania strains were analysed, including seven reference strains (RS and 63 previously typed strains. Analysis of the RS indicated a specific region of 234 bp in the hsp70 gene as a valid target that was highly sensitive for detection of Leishmania species DNA with capacity of distinguishing all analyzed species, after polymerase chain reaction-restriction fragment length polymorfism (PCR-RFLP. This PCR assay was compared with other PCR targets used for the molecular diagnosis of leishmaniasis: hsp70 (1400-bp region, internal transcribed spacer (ITS1 and glucose-6-phosphate dehydrogenase (G6pd. A good agreement among the methods was observed concerning the Leishmania species identification. Moreover, to evaluate the potential for molecular diagnosis, we compared the PCR targets hsp70-234 bp, ITS1, G6pd and mkDNA using a panel of 99 DNA samples from tissue fragments collected from patients with confirmed CL. Both PCR-hsp70-234 bp and PCR-ITS1 detected Leishmania DNA in more than 70% of the samples. However, using hsp70-234 bp PCR-RFLP, identification of all of the Leishmania species associated with CL in Brazil can be achieved employing a simpler and cheaper electrophoresis protocol.
Complexing properties of α-iso-saccharinate: thorium
International Nuclear Information System (INIS)
Allard, S.; Ekberg, C.
2005-01-01
Full text of publication follows: In the alkaline conditions of the intended Swedish repository for long-lived, low to intermediate level waste, SFL3-5, cellulose based items will degrade with iso-saccharinate being the dominant end-product. Iso-saccharinate is a strong complexing agent for tetravalent actinides, as well as for trivalent lanthanides, and its complexation properties are of interest for the long-term repository assessment. In the presented study, the complexation of 234 Th-α-iso-saccharinate is examined using liquid-liquid- extraction and radioanalytical techniques. An organic phase consisting of 0.1 M acetylacetone in toluene was used with a 1.0 M NaClO 4 aqueous phase kept at pH 8 in a thermostated AKUFVE unit. Since the α-iso-saccharinic system consists of three species - the carboxylic α-iso-saccharinic acid, α-iso-saccharinate and α-D-iso-saccharino-1,4-lactone - care must be taken when choosing the operational pH. Keeping the aqueous phase at pH 8 results in negligible concentrations of all but the α-iso-saccharinate form while at the same time being an excellent pH for the 234 Th-acetylacetone complexation with very limited hydrolysis effect. The α- iso-saccharinate concentration was incrementally increased, and samples of equal volumes were taken from the two phases and analyzed in a liquid scintillation detector once the radioactive equilibrium between 234 Th and 234 Pa had been reached. Two complexation constants were used to fit a distribution equation to the experimental data. (authors)
checkCIF/PLATON report Datablock: shelxl
Indian Academy of Sciences (India)
4 Do ! C1 -C2 -C3 -CE1 3.00 6.00 1.555 1.555 1.555 6.556. PLAT710_ALERT_4_G Delete 1-2-3 or 2-3-4 Linear Torsion Angle ... #. 7 Do ! CE1 -C4 -C5 -C6 72.00 10.00 1.555 1.555 1.555 1.555. PLAT710_ALERT_4_G Delete 1-2-3 or 2-3-4 Linear Torsion Angle ... #. 12 Do ! C6 -C7 -C8 -CE1 85.00 4.00 1.555 1.555 1.555 ...
Gclust Server: 199999 [Gclust Server
Lifescience Database Archive (English)
Full Text Available 199999 Eba_ebB234 Cluster Sequences - 474 hypothetical protein 1 1.00e-99 0.0 0.0 0.0 0.0 3.23 0.0 Show 199...999 Cluster ID 199999 Sequence ID Eba_ebB234 Link to cluster sequences Cluster Seque...f Sequences 1 Homologs 1 Clustering threshold 1.00e-99 Plants and algae (7species...S: 0 Ter: 0 Ana: 0 Ava: 0 Npun: 0 Syn: 0 Glv: 0 Tel: 0 YelA: 0 YelB: 0 S63: 0 S79: 0 S81: 0 S93: 0 S96: 0 S99
Radiation risk assessment of reprocessed uranium
International Nuclear Information System (INIS)
Cardenas, Hugo R.; Perez, Aldo E.; Luna, Manuel F.; Becerra, Fabian A.
1999-01-01
Reprocessed uranium contains 232 U, which is not found in nature, as well as 234 U which is present in higher proportion than in natural uranium. Both isotopes modify the radiological properties of the material. The paper evaluates the increase of the internal and external radiation risk on the base of experimental data and theoretical calculations. It also suggests measures to be taken in the production of fuel elements with slightly enriched uranium.The radiation risk of reprocessed uranium is directly proportional to the content of 232 U and 234 U as well as to the aging time of the material
Uranium isotopes in El hamraween harbour sediments
International Nuclear Information System (INIS)
Salahel Din, K.
2009-01-01
Isotopes of uranium in marine sediments collected from El Hamraween harbour and Ras El-Bhar areas on the Egyptian coast of the Red Sea have been studied using radiochemical separation procedures and alpha-particle spectrometry. Activity concentrations of 238 U, 235 U, 234 U were calculated. The activities observed indicating the enhancement of radioactivity level in El Hamraween harbor area due to the activities of phosphate shipment operation. Secular equilibrium between 234 U and 238 U was found in the analyzed samples. The average activity ratio of 235 U/ 238 U was close to the value 0.046 for uranium in nature
Experimental consequences of SU(3) symmetry in an sdg boson model
International Nuclear Information System (INIS)
Akiyama, Y.; Brentano, P. von; Gelberg, A.
1987-01-01
Energies of collective levels in 178 Hf and 234 U are compared wth predictions of the SU(3) limiz of the sdg interacting boson model. All known positive parity states of 178 Hf below 1.8 MeV (with the expection of a 0 + band) have been satisfactorily reproduced. Most of the bands in 234 U are also described by the model. However, a few predicted states have no experimental counterpart. The introduction of the g-basons strongly reduces the previously observed discrepancies between experimental B(E2)'s in 238 U and the sd-IBM calculation. (orig.)
International Nuclear Information System (INIS)
Turekian, K.K.
1979-01-01
Results of estuarine and coastal studies in the Long Island Sound and the New York Bight areas are summarized briefly. 234 Th and 228 Th were used to determine the residence time of thorium in the water column as a function of distance from the Long Island-New Jersey coast. Results indicate that virtually all of the 234 Th is taken to the sediment column on a very short time scale. Paths for the redistribution of metals in the sediment column are outlined. Studies on the sources and properties of organic carbon delivered to the estuarine systems are reviewed briefly
Comparison of fission and capture cross sections of minor actinides
International Nuclear Information System (INIS)
Nakagawa, Tsuneo; Iwamoto, Osamu
2003-01-01
The fission and capture cross sections of minor actinides given in JENDL-3.3 are compared with other evaluated data and experimental data. The comparison was made for 32 nuclides of Th-227, 228, 229, 230, 233, 234, Pa-231, 232, 233, U-232, 234, 236, 237, Np-236, 237, 238, Pu-236, 237, 238, 242, 244, Am-241, 242, 242m, 243, Cm-242, 243, 244, 245, 246, 247 and 248. Given in the present report are figures of these cross sections and tables of cross sections at 0.0253 eV and resonance integrals. (author)
High density crystalline boron prepared by hot isostatic pressing in refractory metal containers
Hoenig, C.L.
1993-08-31
Boron powder is hot isostatically pressed in a refractory metal container to produce a solid boron monolith with a bulk density at least 2.22 g/cc and up to or greater than 2.34 g/cc. The refractory metal container is formed of tantalum, niobium, tungsten, molybdenum or alloys thereof in the form of a canister or alternatively plasma sprayed or chemical vapor deposited onto a powder compact. Hot isostatic pressing at 1,800 C and 30 PSI (206.8 MPa) argon pressure for four hours produces a bulk density of 2.34 g/cc. Complex shapes can be made.
Genetic variation in GIPR influences the glucose and insulin responses to an oral glucose challenge
DEFF Research Database (Denmark)
Saxena, Richa; Hivert, Marie-France; Langenberg, Claudia
2010-01-01
Glucose levels 2 h after an oral glucose challenge are a clinical measure of glucose tolerance used in the diagnosis of type 2 diabetes. We report a meta-analysis of nine genome-wide association studies (n = 15,234 nondiabetic individuals) and a follow-up of 29 independent loci (n = 6,958-30,620)......Glucose levels 2 h after an oral glucose challenge are a clinical measure of glucose tolerance used in the diagnosis of type 2 diabetes. We report a meta-analysis of nine genome-wide association studies (n = 15,234 nondiabetic individuals) and a follow-up of 29 independent loci (n = 6...
49 CFR 234.205 - Operating characteristics of warning system apparatus.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Operating characteristics of warning system... characteristics of warning system apparatus. Operating characteristics of electromagnetic, electronic, or... limits within which the system is designed to operate. ...
00001:Airline Service Quality Performance 234 (On-Time performance data).
2011-11-01
00001:This CD presents data reported by U.S. certificated air carriers so that information on the air carriers' quality of service can be made available to consumers of air transportation. Carriers within 1% or more of the total domestic scheduled se...
00001:Airline Service Quality Performance 234 (On-Time performance data).
2014-02-01
00001:This CD presents data reported by U.S. certificated air carriers so that information on the air carriers' quality of service can be made available to consumers of air transportation. Carriers within 1% or more of the total domestic scheduled se...
ORF Alignment: NT_033778 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available r) ... Length = 206 ... Query: 114 AWCKLFECLHRYPLVTKPAVNSMHLCEAPGAFIASLNHYLHSKYEKDEIKWRWRSTTLNP 173 ... ... ... AWCKLFECLHRYPLVTKPAVNSMHLCEAPGAFIASLNHYLHSKYEKDEIKWRWRSTTLNP Sbjct: 1 ... AW...CKLFECLHRYPLVTKPAVNSMHLCEAPGAFIASLNHYLHSKYEKDEIKWRWRSTTLNP 60 ... Query: 234 DGSIDCAAQPDCQEEIVVRLFFAEVLSALRILSS
Directory of Open Access Journals (Sweden)
Néstor Rosales-Loaiza
2008-06-01
Full Text Available Las cianobacterias de ambientes salinos presentan una versatilidad metabólica inducida por los cambios de salinidad, temperatura e irradiancia, durante los períodos de sequía y lluvias. Por ello es importante la búsqueda en estos ambientes de cianobacterias con potencial biotecnológico para la producción de metabolitos de interés farmacéutico e industrial. Se reporta el crecimiento, masa seca y producción de metabolitos de la cianobacteria Synechococcus sp. MOF-03 en función de la irradiancia (78, 156 y 234 µmol q m-2 s-1. Los cultivos discontinuos por triplicado, fueron mantenidos con aireación constante, fotoperiodo 12:12 h, 30 ±2ºC y a 35‰. Los máximos valores de proteínas, carbohidratos y lípidos de 530.19 ±11.16, 408.94 ±4.27 y 56.20 ±1.17 µg ml-1 respectivamente, fueron obtenidos a 78 µmol q m-2 s-1. Los pigmentos, analizados por HPLC, mostraron los máximos a 78 µmol q m-2 s-1 para clorofila a con 7.72 ±0.16 µg ml-1; y a 234 µmol q m-2 s-1 para ß-caroteno y zeaxantina con 0.70 ±0.01 and 0.67 ±0.05 µg ml-1. La relación clorofila a:ß-caroteno disminuyó de 17.15 hasta 6.91 a 78 y 234 µmol q m-2 s-1; mientras que la relación ß-caroteno:zeaxantina se mantuvo sin cambios entre 78 y 156 µmol q m-2 s-1, con cerca de 1.21 y disminuyó a 234 µmol q m-2 s-1 a 1.04. La cianobacteria produjo la mayor densidad celular y masa seca a 156 µmol q m-2 s-1, con 406.13 ±21.74 x106 cel ml-1 y 1.49 ±0.11 mg ml-1 respectivamente. La producción de exopolisacáridos se mantuvo alrededor de 110 µg ml-1 entre 156 y 234 µmol q m-2 s-1. Así, esta cepa de Synechococcus muestra un gran potencial para la producción de biomasa enriquecida con metabolitos de alto valor comercial.Growth and metabolite production of the marine cyanobacterium Synechococcus sp. (Chroococcales in function to irradiance. Changes in salinity, temperature and irradiance during wet and dry seasons have induced metabolic versatility in cyanobacteria
International Nuclear Information System (INIS)
Guerrero, José Luis; Vallejos, Ángela; Cerón, Juan Carlos; Sánchez-Martos, Francisco; Pulido-Bosch, Antonio; Bolívar, Juan Pedro
2016-01-01
Sierra de Gádor is a karst macrosystem with a highly complex geometry, located in southeastern Spain. In this arid environment, the main economic activities, agriculture and tourism, are supported by water resources from the Sierra de Gádor aquifer system. The aim of this work was to study the levels and behaviour of some of the most significant natural radionuclides in order to improve the knowledge of the hydrogeochemical processes involved in this groundwater system. For this study, 28 groundwater and 7 surface water samples were collected, and the activity concentrations of the natural U-isotopes ("2"3"8U, "2"3"5U and "2"3"4U) and "2"2"6Ra by alpha spectrometry were determined. The activity concentration of "2"3"8U presented a large variation from around 1.1 to 65 mBq L"−"1. Elevated groundwater U concentrations were the result of oxidising conditions that likely promoted U dissolution. The PHREEQC modelling code showed that dissolved U mainly existed as uranyl carbonate complexes. The "2"3"4U/"2"3"8U activity ratios were higher than unity for all samples (1.1–3.8). Additionally, these ratios were in greater disequilibrium in groundwater than surface water samples, the likely result of greater water-rock contact time. "2"2"6Ra presented a wide range of activity concentrations, (0.8 up to about 4 × 10"2 mBq L"−"1); greatest concentrations were detected in the thermal area of Alhama. Most of the samples showed "2"2"6Ra/"2"3"4U activity ratios lower than unity (median = 0.3), likely the result of the greater mobility of U than Ra in the aquifer system. The natural U-isotopes concentrations were strongly correlated with dissolution of sulphate evaporites (mainly gypsum). "2"2"6Ra had a more complex behaviour, showing a strong correlation with water salinity, which was particularly evident in locations where thermal anomalies were detected. The most saline samples showed the lowest "2"3"4U/"2"3"8U activity ratios, probably due to fast uniform bulk
Kiro, Y.; Goldstein, S. L.; Kushnir, Y.; Lazar, B.; Stein, M.
2017-12-01
Marine Isotope Stage (MIS) 5e was a warm interglacial with where with significantly varying insolation and hence varied significantly throughout this time suggesting highly variable climate. The ICDP Dead Sea Deep Drilling Project recovered a 460m record of the past 220ka, reflecting the variable climate along MIS 5e. This time interval is reflected by alternating halite and detritus sequences, including 20m of halite-free detritus during the peak insolation at 125 ka. The Dead Sea salt budget indicates that the Levant climate was extremely arid when halite formed, reaching 20% of the present runoff. The halite-free detritus layer reflects increased precipitation to levels similar to present day, assuming similar spatial and temporal rainfall patterns. However, the 234U/238U activity ratio in the lake, reflected by authigenic minerals (aragonite, gypsum and halite), shifts from values of 1.5 (reflecting the Jordan River, the present main water source) down to 1.3 at 125-122ka during the MIS5e insolation peak and 1.0 at 118-116ka. The low 234U/238U reflects increased flash floods and eastern water sources (234U/238U 1.05-1.2) from the drier part of the watershed in the desert belt. The intermediate 234U/238U of 1.3 suggests that the Jordan River, fed from Mediterranean-sourced storm tracks, continued to flow along with an increase in southern and eastern water sources. NCAR CCSM3 climate model runs for 125ka indicate increases in both Summer and Winter precipitation. The drastic decrease to 234U/238U 1.0 occurs during the driest period, indicating a near shutdown of Jordan River flow, and water input only through flash floods and southern and eastern sources. The 120ka climate model runs shows a decrease in Winter and increase in Fall precipitation as a result of an increased precipitation in the tropics. The extreme aridity, associated with increased flooding is similar to patterns expected due to future warming. The increase in aridity is the result of expansion
Vinyoles, E; Camafort, M; Domenech, M; Coca, A; Sobrino, J
2015-11-01
The reported prevalence of masked uncontrolled hypertension (MUCH) varies because many studies are not comparable as they use different measurement methodologies. To evaluate the influence of the number of office blood pressure readings on the prevalence of MUCH we conducted a cross-sectional, multicenter study in treated hypertensive patients. We carried out an observational, cross-sectional, multicenter study in 33 Spanish hospital-based hypertension units, involving 35 investigators and 12 Autonomous Communities. Six blood pressure readings and a 24-h ambulatory blood pressure monitoring were performed in treated hypertensive patients. The means of the first 3 readings (P123), the 2nd, 3rd and 4th readings (P234), the 3rd, 4th and 5th readings (P345) and the last 3 readings (P456) were compared with mean 24-h blood pressure. MUCH was defined as office blood pressure <140/90mmHg and 24-h blood pressure ≥130/80mmHg, considering the first 3 readings (MUCH123), the 2nd, 3rd and 4th readings (MUCH234), the 3rd, 4th and 5th readings (MUCH345) and the last 3 readings (MUCH456). We included 498 hypertensive patients. Mean (standard deviation) office blood pressure measurements were: (P123) 141(18)/82(11); (P234) 139(17)/81(11); (P345) 138(17)/81(11) and (P456) 137(16)/80(10) mmHg. Mean 24-h blood pressure was 127(13.8)/75(9.5) mmHg. The correlation coefficients between ambulatory and office systolic/diastolic blood pressure were (P123):0.48/0.50; (P234):0.50/0.52; (P345):0.50/0.54; and (P456):0.50/0.55 (p<0.001, all). The prevalences of MUCH123, MUCH234, MUCH345 and MUCH456 were 14.5%, 18.9%, 19.5% and 21.1%, respectively. The prevalence of MUCH diagnosis depends on the serial office blood pressure readings, being much higher for the last three blood pressure readings. Discarding the first and second office blood pressure measures seems to be the most accurate method for diagnosing MUCH. Copyright © 2015 Elsevier España, S.L.U. y Sociedad Española de Medicina
Prospects of Using Reprocessed Uranium in CANDU Reactors, in the U.S. GNEP Program
International Nuclear Information System (INIS)
Ellis, Ronald James
2007-01-01
Current Global Nuclear Energy Partnership (GNEP) plans envision reprocessing spent fuel (SF) with view to minimizing high-level waste (HLW) repository use and recovering actinides (U, Np, Pu, Am, and Cm) for transmutation in reactors as fuel and targets. The reprocessed uranium (RU), however, is to be disposed of. This paper presents a limited-scope analysis of possible reuse of RU in CANDU (Canada Deuterium Uranium) Reactors, within the context of the US GNEP program. Other papers on this topic submitted to this conference discuss the possibility of RU reuse in light-water reactors (LWRs) (with enrichment) and offer an independent economic analysis of RU reuse. A representative RU uranium 'vector', from reprocessed spent LWR fuel, comprises 98.538 wt% 238U, 0.46 wt% 236 U, 0.986 wt% 235 U, and 0.006 wt% 234 U. After multiple recyclings, the concentration of 234 U can approach 0.02 wt%. The presence of 234 U and 236 U in RU reduces the reactivity and fuel lifetime (exit burnup), which is particularly an issue in LWRs. While in PWR analyses, the burnup penalty caused by the concentration of 236 U in RU needs to be offset by additional 235 U enrichment in the amount of ∼25% to 30% of the weight percentage of the 236 U; however, the effect in CANDU is much smaller. Furthermore, since the 235 U content in RU exceeds that of natural uranium, CANDU offers the advantageous option of uranium recycling without reenrichment. The exit burnup of CANDU RU-derived fuel is considerably larger than that for natural uranium-fueled scenario, despite the presence of 234 U and 236 U.
Directory of Open Access Journals (Sweden)
Xiaolin Liao
2014-07-01
Full Text Available Half-smooth tongue sole (Cynoglossus semilaevis is one of the most important flatfish species for aquaculture in China. To produce a monosex population, we attempted to develop a marker-assisted sex control technique in this sexually size dimorphic fish. In this study, we identified a co-dominant sex-linked marker (i.e., CyseSLM by screening genomic microsatellites and further developed a novel molecular method for sex identification in the tongue sole. CyseSLM has a sequence similarity of 73%–75% with stickleback, medaka, Fugu and Tetraodon. At this locus, two alleles (i.e., A244 and A234 were amplified from 119 tongue sole individuals with primer pairs CyseSLM-F1 and CyseSLM-R. Allele A244 was present in all individuals, while allele A234 (female-associated allele, FAA was mostly present in females with exceptions in four male individuals. Compared with the sequence of A244, A234 has a 10-bp deletion and 28 SNPs. A specific primer (CyseSLM-F2 was then designed based on the A234 sequence, which amplified a 204 bp fragment in all females and four males with primer CyseSLM-R. A time-efficient multiplex PCR program was developed using primers CyseSLM-F2, CyseSLM-R and the newly designed primer CyseSLM-F3. The multiplex PCR products with co-dominant pattern could be detected by agarose gel electrophoresis, which accurately identified the genetic sex of the tongue sole. Therefore, we have developed a rapid and reliable method for sex identification in tongue sole with a newly identified sex-linked microsatellite marker.
International Nuclear Information System (INIS)
Laul, J.C.; Smith, M.R.
1988-05-01
The concentrations of natural radionuclides of the 238 U and /232/Th series are reported in several cores and in ten deep and five shallow briny groundwaters from various formations in the Palo Duro Basin. The formations include Granite Wash, Pennsylvanian Granite Wash, Wolfcamp Carbonate, Pennsylvanian Carbonate, Seven River, Queen Grayburg, San Andres, Yates and Salado. The natural radionuclide data in cores suggest that the radionuclides have not migrated or been leached for at least a period of about 1 million years. Relative to the U and Th concentrations in cores, the brines are depleted by a factor of 10 4 to 10 5 , indicating extremely low solubility of U and Th in brines. The natural radionuclide data in brines suggest that radium is not sorbed significantly and thus not retarded in nine deep brines. Radium is somewhat sorbed in one deep brine of Wolfcamp Carbonate and significantly sorbed in shallow brines. Relative to radium, the U, Th, Pb, Bi, and Po radionuclides are highly retarded by sorption. The retardation factors for 228 Th range from 10 2 to 10 3 , whereas those for 230 Th and 234 U range from 10 3 to 10 5 , depending on the formation. The 234 U/ 238 U ratios in these brines are constant at about 1.5. The magnitude of the 234 U/ 230 Th ratio appears to reflect the degree of redox state of the aquifer's environment. The 234 U/ 230 Th ratio in nine deep brines is about unity, suggesting that U, like Th +4 , is in the +4 state, which in turn suggests a reduced environment. 49 refs., 23 figs., 18 tabs
International Nuclear Information System (INIS)
Peng Zicheng; Nie Baofu; Chen Tegu
2004-01-01
The techniques of thermal ionization mass spectrometry (TIMS) and multicollector-inductively coupled plasma-mass spectrometry (MC-ICP-MS) were used for the high-precision timing of the domestic stalagmite standard (GBW04412), international coral standard (RKM-4) and the Nanhai corals. The results of uranium contents and the ratios of 234 U/ 238 U and 230 Th/ 234 U in the two standards measured by using two techniques were consistent within the error range. Most of the Nanhai corals have less than 3 μg/g of the uranium contents and 150 ± 5 of the δ 234 U(T) values, which means that the corals have not been subjected to the alternation since they were brought up 7000 years ago, therefore, they preserve the original environmental signals. The age sequence of the corals shows that three events of the high sea level happened in Nanhai area in the periods corresponding to 6799-6307 a B.P., 4472-4285 a B.P. and 1279-1012 a B.P. respectively. The above-mentioned three stages were relative to the Megathermal and Medieval Warm Periods in our country. (authors)
Evaluation on operation of liquid relief valves for steam line break accidents by RELAP5/CANDU+ code
International Nuclear Information System (INIS)
Yang, C. Y.; Bang, Y. S.; Kim, H. J.
2001-01-01
A development of RELAP5/CANDU+ code for regulatory audits of accident analysis of CANDU nuclear power plants is on progress. This paper is undertaken in a procedure of a verification and validation for RELAP5/CANDU+ code by analyzing main steam line break accidents of WS 2/3/4. Following the ECC injection in sequence of the steam line breaks, the mismatch in heat transfer between the primary and the secondary systems makes pressure of the primary system instantly peaked to the open setpoint of liquid relief valves. The event sequence follows the result of WS 2/3/4 FSAR, but there is a difference in pressure transient after ECC injection. Sensitivity analysis for main factors dependent on the peak pressure such as control logics of liquid relief valves. ECC flow path and feedwater flow is performed. Because the pressure increase is continued for a long time and its peaking is high, open and close of the liquid relief valves are repeated several times, which is obviously different from those of WS 2/3/4 FSAR. As a result, it is evaluated that conservative modeling for the above variables is required in the analysis
International Nuclear Information System (INIS)
Aguado, J.L.; Bolivar, J.P.; San-Miguel, E.G.; Garcia-Tenorio, R.
2003-01-01
A radiochemical sequential extraction procedure has been developed in our laboratory to determine 226 Ra and 234,238 U by alpha spectrometry in environmental samples. This method has been validated for both radionuclides by comparing in selected samples the values obtained through its application with the results obtained by applying alternative procedures. Recoveries obtained, counting periods applied and background levels found in the alpha spectra give suitable detection limits to allow the Ra and U determination in operational forms defined in riverbed contaminated sediments. Results obtained in these speciation studies show that 226 Ra and 234,238 U contamination tend to be associated to precipitated forms of the sediments. (author)
Design and Production of Damage-Resistant Tray Pack Containers
1985-07-01
No COMMENT ,34.5 ýX .7.. . , . 35.0 x 36.0 x " 36.5 x • - . ,- 37.0 x 37.5 X 22 Ma after failure .4 J L,. Local Red stain...VACUUM-TRAY PACK SAMPLE 90#-BASELINE !4 TEST LEVEL PANEL VACUUM YES NO COMMENT I S2"X - 3" X 4ŕ x 4.5" X 27 Ma with Red spot @ S1 - wrinkle. * i...44 i 63 DATE 8-29-84 * SAMPLE # 3 TEST TYPE VACUUM-TRAY PACK SAMPLE 90#/0.050" REINFORCED TEST LEVEL PAN] VACUUM YES NO COMMENT i ", 2" X 2 1 V - I
Microscopic structure of superdeformed states in Th, U, Pu and Cm isotopes with Gogny force
Energy Technology Data Exchange (ETDEWEB)
Girod, M.; Delaroche, J.P.; Romain, P. [CEA/DIF, DPTA/SPN, Boite Postale 12, 91680 Bruyeres-le-Chatel (France); Libert, J. [Institut de Physique Nucleaire Centre National de la Recherche Scientifique-IN2P3, F-91406 Orsay (France)
2002-10-01
The structure properties of the even-even nuclei {sup 226,} {sup 228,} {sup 230,} {sup 232,} {sup 234}Th, {sup 230,} {sup 232,} {sup 234,} {sup 236,} {sup 238,} {sup 240}U, {sup 240,} {sup 242,} {sup 244,} {sup 246}Pu, and {sup 242,} {sup 244,} {sup 246,} {sup 248}Cm have been investigated at normal and superdeformed shapes in microscopic mean-field calculations based on Gogny force. Collective levels are predicted from constrained Hartree-Fock-Bogoliubov and configuration mixing calculations. Two quasiparticle states are also predicted from blocking calculations for neutron and proton configurations. Predictions are shown and compared with experimental data at superdeformed shapes. (orig.)
Experimental consequences of SU(3) symmetry in an sdg boson model
Energy Technology Data Exchange (ETDEWEB)
Akiyama, Y.; Brentano, P. von; Gelberg, A.
1987-05-01
Energies of collective levels in /sup 178/Hf and /sup 234/U are compared wth predictions of the SU(3) limiz of the sdg interacting boson model. All known positive parity states of /sup 178/Hf below 1.8 MeV (with the expection of a 0/sup +/ band) have been satisfactorily reproduced. Most of the bands in /sup 234/U are also described by the model. However, a few predicted states have no experimental counterpart. The introduction of the g-basons strongly reduces the previously observed discrepancies between experimental B(E2)'s in /sup 238/U and the sd-IBM calculation.
Uranium isotopic disequilibrium in ground water as an indicator of anomalies
International Nuclear Information System (INIS)
Osmond, J.K.; Cowart, J.B.; Ivanovich, M.
1983-01-01
Because of the unique elemental and isotopic properties of uranium, ground water surveys are a most appropriate approach to prospecting for surficial and secondary uranium deposits. Uranium4+ is generally immobile, but in oxidising and carbonate bearing waters U 6 + is mobile and conservative. Uranium 234 is the radiogenic daughter of 238 U. The intervening α-decay event causes recoil displacements and radioactive disequilibrium between the two isotopes in open systems such as surficial aquifers. Extreme variations in dissolved uranium composition of ground waters combined with significant variations in the ratio 234 U/ 238 U are indicative of the proximity and stage of evolution of secondary deposits. (author)
DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS
Energy Technology Data Exchange (ETDEWEB)
NA
2004-11-22
The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) important to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are in the form of tabulated functions with pH and log (line integral) CO{sub 2} as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. The output data from this report are fundamental inputs for Total System Performance Assessment for the License Application (TSPA-LA) to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for all of the actinides. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or otherwise addressed.
International Nuclear Information System (INIS)
Johansson, B.; Rosengren, A.
1975-01-01
A ''generalized'' phase diagram is constructed empirically for the lanthanides. This diagram makes it possible, not only in one picture, to assemble a lot of information but also to predict phase transitions not yet experimentally accessible. Further, it clearly illustrates the close relation between the members of the lanthanide group. To account for some of its features, the pseudopotential method is applied. The trend in crystal structure through the lanthanide series can thereby be qualitatively accounted for, as can the trend in crystal structure for an individual element, when compressed. A scaling procedure makes it possible to extend the treatment to elements neighboring the lanthanides in the Periodic Table. In total 25 elements are considered. An atomic parameter f (relatable to the pseudopotential) is introduced, by means of which different phase transitions, both for an individual rare-earth element and intra-rare-earth alloys, can be correlated to certain critical values of this parameter. A nonmagnetic rare-earth series (Sc, Lu, Y, La, and Ac) is introduced and the occurrence of superconductivity is discussed with special emphasis on the pressure dependence of the transition temperature. This temperature can be correlated to the above-mentioned parameter f, both for intra-rare-earth alloys and pure elements at different pressures. The correlation implies that actinium is a superconductor with a critical temperature which could be as high as (11--12) degree K
ORF Alignment: NC_003366 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available otein recO (Recombination protein O) ... Length = 234 ... Query: 1 ... MLWIFTEXXXXXXXXXXXXXXXXXXLFSLTHPLCY...GDYLLFKGKGLYRLSEGKIRTSFQT 60 ... +LWIFTE ... LFSLTHPLCYGDYLLFKGKGLYRLSEGKIRTSFQT Sbjct: ...15 ... LLWIFTEKMGKITAIAKGAKKSKSKLFSLTHPLCYGDYLLFKGKGLYRLSEGKIRTSFQT 74 ... Query: 121 L
International Nuclear Information System (INIS)
Ameen, N.H; Al-ghirrawy, M.A; Kadhim, H.H
2014-01-01
The goals of this study include measuring the increase in radioactivity and removal the contamination regions to protect the population and the environment resulting from bombing the Al-Tahreer Tower Building (the Turkish restaurant previously) by the depleted uranium bullets through direct measurement and sampling of soil from five floors (Fifth,Sixth,Seventh,Eighth,and Ninth) of the building, which contains fourteen floors in addition to basement by using different types of portable monitoring equipment s.The results of radiological surveys by using the portable monitor (CAB) indicated the presence of contaminated soil reached to 55 c/sec, and small particles of depleted uranium shells has very high levels of contamination reached to 70 c /sec ,while the background level is (0.5 c/sec) ,and the higher exposure rates is 55 μR/hr when the portable monitor (Ludlum) put on the contaminated regions approximately on distance 0.5 cm), where the natural background level is 9 μR/hr in the floors of the building.The radiological analyses of the collected soil samples were done in the laboratory of the center of Radiological Researches in the Ministry of sciences and Technology by using gamma spectrometry (which contains High- purity Germanium Detector) with a efficiency of 40% and resolution 2 keV for Energy, 1.33Mev, collection, preparations and tests of soil samples were all done according to IAEA.The laboratory results indicated the presence of high concentrations of the isotopes Th-234 (1550.1) Bq/kg, and Pa-234 m (1394.8) in the soil samples taken from the floors while the concentrations of Th-234 and Pa-234 m in natural background levels are (nearly 40, nil) Bq/Kg respectively which is a clear indication of the presence of high concentrations an isotope of uranium - 238 as they are supposed to be in equilibrium radiation.
Poths, J.; Koepf, A.; Boulyga, S. F.
2008-12-01
The minor isotopes of uranium (U-233, U-234, U-236) are increasingly useful for tracing a variety of processes: movement of anthropogenic nuclides in the environment (ref 1), sources of uranium ores (ref 2), and nuclear material attribution (ref 3). We report on improved accuracy for U-234/238 and U-236/238 by supplementing total evaporation protocol TIMS measurement on Faraday detectors (ref 4)with multiplier measurement for the minor isotopes. Measurement of small signals on Faraday detectors alone is limited by noise floors of the amplifiers and accurate measurement of the baseline offsets. The combined detector approach improves the reproducibility to better than ±1% (relative) for the U-234/238 at natural abundance, and yields a detection limit for U-236/U-238 of <0.2 ppm. We have quantified contribution of different factors to the uncertainties associated with these peak jumping measurement on a single detector, with an aim of further improvement. The uncertainties in the certified values for U-234 and U-236 in the uranium standard NBS U005, if used for mass bias correction, dominates the uncertainty in their isotopic ratio measurements. Software limitations in baseline measurement drives the detection limit for the U-236/U-238 ratio. This is a topic for discussion with the instrument manufacturers. Finally, deviation from linearity of the response of the electron multiplier with count rate limits the accuracy and reproducibility of these minor isotope measurements. References: (1) P. Steier et al(2008) Nuc Inst Meth(B), 266, 2246-2250. (2) E. Keegan et al (2008) Appl Geochem 23, 765-777. (3) K. Mayer et al (1998) IAEA-CN-98/11, in Advances in Destructive and Non-destructive Analysis for Environmental Monitoring and Nuclear Forensics. (4) S. Richter and S. Goldberg(2003) Int J Mass Spectrom, 229, 181-197.
Zmora, Nilli; Stubblefield, John David; Wong, Ten-Tsao; Levavi-Sivan, Berta; Millar, Robert Peter; Zohar, Yonathan
2015-09-01
The importance of kisspeptin in regulating vertebrate reproduction has been well established, but the exact mechanism continues to unfold. Unlike mammals, many lower vertebrates possess a dual kisspeptin system, Kiss1 and Kiss2. To decipher the roles of the kisspeptins in fish, we identified two potential kisspeptin antagonists, pep 234 and pep 359, by screening analogs for their ability to inactivate striped bass Kiss1 and Kiss2 receptors expressed in COS7 cells. Pep 234 (a mammalian KISS1 antagonist) antagonizes Kiss1r signaling activated by Kiss1 and Kiss2, and pep 359 (a novel analog) antagonizes Kiss2 activation of both receptors. In vitro studies using brain slices demonstrated that only Kiss2 can upregulate the expression of the hypophysiotropic gnrh1, which was subsequently diminished by pep 234 and pep 359. In primary pituitary cell cultures, the two antagonists revealed a complex network of putative endogenous and exogenous regulation by kisspeptin. While both kisspeptins stimulate Fsh expression and secretion, Kiss2 predominately induces Lh secretion. Pep 234 and 359 treatment of spawning males hindered sperm production. This effect was accompanied with decreased brain gnrh1 and gnrh2 mRNA levels and peptide content in the pituitary, and increased levels of pituitary Lh, probably due to attenuation of Lh release. Strikingly, the mRNA levels of arginine-vasotocin, the neurons of which in the preoptic area coexpress kiss2r, were dramatically reduced by the antagonists. Our results demonstrate differential actions of Kiss1 and Kiss2 systems along the hypothalamic-pituitary axis and interactions with other neuropeptides, and further reinforce the importance of kisspeptin in the execution of spawning. © 2015 by the Society for the Study of Reproduction, Inc.
Almazán-Torres, María Guadalupe; Ordóñez-Regil, Eduardo; Ruiz-Fernández, Ana Carolina
2016-11-01
The uranium (U) and plutonium (Pu) content with depth in a sediment core collected in the continental shelf off the mouth of the Santiago River in the Mexican Pacific was studied to evaluate the contamination effects of the effluent of the Santiago-Lerma River as it moves into the sea. The large mass of terrestrial detritus delivered by the river influences the physicochemical and geochemical processes in the seafloor. Abnormal concentrations of U and Pu in sediments were examined as indicative of the effects of anoxic conditions. One of the indicators of pollution of seawater is the bacterial activity of the shallow seabed layer; and among the prevailing bacteria, the magnetotactic ones induce the formation of euhedral and framboidal shapes (pyrite). These pyrite entities are by-products of anoxic environments loaded with decomposing detrital material and are very abundant in the surface layers of the sediment core analyzed. The pyrite formation is the result of a biochemical reaction between iron and organic sulphur reduced by bacteria, and the pyrite entities precipitate to the seafloor. In the same upper zone of the profile, 238 U is readily immobilized, while 234 U is oxidized and dissolved in seawater by the effect of hot atom chemistry. This may cause the activity ratio (AR) 234 U/ 238 U disequilibrium (near 0.41). Furthermore, in the shallow layer of the sediment core, an abnormally high concentration of 239+240 Pu was detected. In this upper layer, the activity concentrations found were 3.19 Bq kg -1 for 238 U, 1.32 kg -1 for 234 U and 2.78 Bq kg -1 for 239+240 Pu. In the lower fractions of the sediment core, normal values of AR 234 U/ 238 U (≈1) were found, with traces of 239+240 Pu. Copyright © 2016 Elsevier Ltd. All rights reserved.
Air and radon pathways screenings methodologies for the next revision of the E-area PA
Energy Technology Data Exchange (ETDEWEB)
Dyer, J. A. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)
2017-10-31
The strategic plan for the next E-Area Low-Level Waste Facility Performance Assessment includes recommended changes to the screening criteria used to reduce the number of radioisotopes that are to be considered in the air and radon pathways incorporated into the GoldSim® atmospheric release model (ARM). For the air pathway, a revised screening methodology was developed based on refinement of previous E-Area PA screening approaches and consideration of the strategic plan recommendations. The revised methodology has three sequential screening steps for each radioisotope: (1) volatility test using the Periodic Table of the Elements, (2) stability test based on half-life, and (3) stability test based on volatility as measured by the Henry’s Law constant for the assumed dominant gaseous species or vapor pressure in the case of tritiated water. Of the 1252 radioisotopes listed in the International Commission on Radiological Protection Publication 107, only the 10 that satisfied all three steps of the revised screening methodology will be included in the ARM. They are: Ar-37, Ar-39, Ar-42, C-14, H-3, Hg-194, Hg-203, Kr-81, Kr-85, and Xe-127. For the radon pathway, a revised screening methodology was developed that also has three sequential steps: (1) identify all decay chains that terminate at Rn-222, (2) screen out parents that decay through U-238 because of its 4.5-billion-year primordial half-life, and (3) eliminate remaining parents whose half-life is shorter than one day. Of the 86 possible decay chains leading to Rn-222, six decay chains consist of 15 unique radioisotopes that will be incorporated into the ARM. The 15 radioisotopes are: U-238, Th-234, Pa-234m, Pu-238, U-234, Th-230, Ra-226, Cf-246, Cm-242, Am-242m, Am-242, Np-238, Np-234, Pa-230, and Rn-222.
International Nuclear Information System (INIS)
Mendez-Garcia, Carmen Grisel; Solis-Rosales, Corina; Rafael Chavez-Lomeli, Efrain
2017-01-01
This is one of the first studies in small particulate matter (PM 2.5 ) by inductively coupled plasma sector field mass spectrometry to measure the activity concentrations of isotopic uranium ( 234 , 235 and 238 U) and thorium ( 232 Th) in these fine particulates, to know their origin and their impact on human health in Mexico City. A different isotopic composition from the natural uranium composition was found. The 235 U/ 238 U atom ratio values are considered as low enrichment uranium, around 2% of 235 U enrichment. Both 235 U/ 238 U and 234 U/ 238 U ratios suggested anthropological rather natural source is impacting the composition of uranium in PM 2.5 . (author)
Radioisotopic composition of yellowcake: an estimation of stack release rates
International Nuclear Information System (INIS)
Momeni, M.H.; Kisieleski, W.E.; Rayno, D.R.; Sabau, C.S.
1979-12-01
Uranium concentrate (yellowcake) composites from four mills (Anaconda, Kerr-McGee, Highland, and Uravan) were analyzed for U-238, U-235, U-234, Th-230, Ra-226, and Pb-210. The ratio of specific activities of U-238 to U-234 in the composites suggested that secular radioactive equilibrium exists in the ore. The average activity ratios in the yellowcake were determined to be 2.7 x 10 -3 (Th-230/U-238), 5 x 10 -4 (Ra-226/U-238) and 2 x 10 -4 (Pb-210/U-238). Based on earlier EPA measurements of the release rates from the stacks, the amount of yellowcake released was determined to be 0.1% of the amount processed
Migration of U-series radionuclides around the Bangombe natural fission reactor (Gabon)
International Nuclear Information System (INIS)
Bros, R.; Yanase, N.; Isobe, H.; Sato, T.; Iida, Y.; Ohnuki, T.; Roos, P.; Holm, E.
1999-01-01
The Bangombe natural fission reactors has undergone extensive weathering phenomena and continues to be affected by the penetration of meteoric waters. Hence this system provides a model for studying the stability of spent fuel uraninite and the influence of various rock matrices on the mobilization/retardation of various actinides and fission products. The Bangombe uranium deposit has been investigated by drilling on a grid. Radiochemical analysis by alpha- and gamma-spectroscopy of the obtained rocks show significant disequilibria of the 234 U/ 238 U, 230 Th/ 234 U, and 226 Ra/ 230 Th parent-daughter pairs. In this paper, a conceptual model for spatio/temporal evolution of the Bangombe system is proposed. (J.P.N.)
International Nuclear Information System (INIS)
Szabo, B.J.
1982-01-01
Uranium-series dating ussumes that fossil bones rapidly takes up uranium, although no thorium or protactinium, soon after burial, and that the bone neither gains nor loses uranium and 230 Th, and 231 Pa. The report analyses elephant molar-tooth fragments for uranium series dating. Three samples were heated for eight hours, the concentrations were determined on a solid-source mass spectrometer, and the 234 U/ 238 U, 230 Th/ 234 U and 231 Pa/ 235 U activivy ratios were determined by alpha spectrometric analyses using chemical and instrumental procedures. There is no firm radiometric age estimate of the prehistoric site of Ternifine, Algeria but is believe to be between 200 000 and 1 100 000 years
U-series dating using thermal ionisation mass spectrometry (TIMS)
International Nuclear Information System (INIS)
McCulloch, M.T.
1999-01-01
U-series dating is based on the decay of the two long-lived isotopes 238 U(τ 1/2 =4.47 x 10 9 years) and 235 U (τ 1/2 0.7 x 10 9 years). 238 U and its intermediate daughter isotopes 234 U (τ 1/2 = 245.4 ka) and 230 Th (τ 1/2 = 75.4 ka) have been the main focus of recently developed mass spectrometric techniques (Edwards et al., 1987) while the other less frequently used decay chain is based on the decay 235 U to 231 Pa (τ 1/2 = 32.8 ka). Both the 238 U and 235 U decay chains terminate at the stable isotopes 206 Pb and 207 Pb respectively. Thermal ionization mass spectrometry (TIMS) has a number of inherent advantages, mainly the ability to measure isotopic ratios at high precision on relatively small samples. In spite of these now obvious advantages, it is only since the mid-1980's when Chen et al., (1986) made the first precise measurements of 234 U and 232 Th in seawater followed by Edwards et al., (1987) who made combined 234 U- 230 Th measurements, was the full potential of mass spectrometric methods first realised. Several examples are given to illustrate various aspects of TIMS U-series
Energy Technology Data Exchange (ETDEWEB)
Legendre, J.M.; Cledes, J.; Morin, J.F.; Morin, P.P. [Centre Hospitalier Regional Augustin-Morvan, 29 - Brest (France)
1997-08-01
169 glomerular filtration rate (GFR) measurements, performed in clinical practice, were analysed for estimation of GFR by several common methods. In one half of patients, we observed that early (2-3-4 hours) and tardive (3-4-5 hours) three point plasma methods were highly correlated, r = 0,998 (n = 82). Even if regression line significantly differed from identify, differences between methods were low (-6, 1 to + 4,4 mL/min/1,73 m{sup 2}). Method with urinary collection was also correlated to plasma methods (r = 0,920 in both cases). Plasma based mean values were higher than that for urinary by 3,6 mL/min/1,73 m{sup 2} (2-3-4 hours) and 3, 1 (3-4-5 hours). Using plasma GFR values and distribution volume, linear and quadratic regressions were tested for GFR = f (V) and GFR = f (In (V)). The lowest observed standard deviation (3,6 mL/min; n = 82) was for GFR{sub 234} = f (V{sub 4h}) using a quadratic equation. This was applied to the second patient group for GFR estimation with 4 hours single point plasma method. Estimations were compared to GFR plasma values. For comparison, GFR estimations were also obtained using the Christensen`s equation. (authors). 17 refs.