WorldWideScience

Sample records for actinium 230

  1. Extraction of actinium with di-(2-ethylhexyl)phosphoric acid from hydrochloric and nitric acid solutions

    The extraction of actinium with HDEHP from Cl- and NO3- systems has been investigated. It was found that extraction of actinium from HCl solutions is much better than from HNO3 solutions. Stability constants of actinium complexes Ac(X-)+2 with Cl- and NO3- ligands were determined. Our results show that the actinium formed less stable complexes with Cl- than with NO3- ligands. 5 refs., 3 figs., 1 tab. (author)

  2. The sorption of polonium, actinium and protactinium onto geological materials

    This paper describes a combined experimental and modeling program of generic sorption studies to increase confidence in the performance assessment for a potential high-level radioactive waste repository in Japan. The sorption of polonium, actinium and protactinium onto geological materials has been investigated. Sorption of these radioelements onto bentonite, tuff and granodiorite from equilibrated de-ionized water was studied under reducing conditions at room temperature. In addition, the sorption of actinium and protactinium was investigated at 60 C. Thermodynamic chemical modeling was carried out to aid interpretation of the results

  3. MGT 230 Uop Material - mgt230dotcom

    honey

    2015-01-01

    MGT 230 Entire Course For more course tutorials visit www.mgt230.com   MGT 230 Week 1 Discussion Question 1 MGT 230 Week 1 Discussion Question 2 MGT 230 Week 1 Individual Assignment Decision Making Process Paper MGT 230 Week 2 Discussion Question 1 MGT 230 Week 2 Discussion Question 2 MGT 230 Week 2 Learning Team Reflection Summary MGT 230 Week 2 Learning Team Internal and External Factors Paper MGT 230 Week 3 Discussion Question 1 MGT 230 ...

  4. Discovery of the actinium, thorium, protactinium, and uranium isotopes

    Fry, C; Thoennessen, M

    2012-01-01

    Currently, 31 actinium, 31 thorium, 28 protactinium, and 23 uranium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  5. Separation of Actinium 227 from the uranium minerals

    The purpose of this work was to separate Actinium 227, whose content is 18%, from the mineral carnotite found in Gomez Chihuahua mountain range in Mexico. The mineral before processing is is pre-concentrated and passed, first through anionic exchange resins, later the eluate obtained is passed through cationic resins. The resins were 20-50 MESH QOWEX and 100-200 MESH 50 X 8-20 in some cased 200-400 MESH AG 50W-X8, 1X8 in other cases. The eluates from the ionic exchange were electrodeposited on stainless steel polished disc cathode and platinum electrode as anode; under a current ODF 10mA for 2.5 to 5 hours and of 100mA for .5 of an hour. it was possible to identify the Actinium 227 by means of its descendents, TH-227 and RA-223, through alpha spectroscopy. Due to the radiochemical purity which the electro deposits were obtained the Actinium 227 was low and was not quantitatively determined. A large majority of the members of the natural radioactive series 3 were identified and even alpha energies reported in the literature with very low percentages of non-identified emissions were observed. We conclude that a more precise study is needed concerning ionic exchange and electrodeposit to obtain an Actinium 227 of radiochemical purity. (Author)

  6. Spectroscopic and computational investigation of actinium coordination chemistry.

    Ferrier, Maryline G; Batista, Enrique R; Berg, John M; Birnbaum, Eva R; Cross, Justin N; Engle, Jonathan W; La Pierre, Henry S; Kozimor, Stosh A; Lezama Pacheco, Juan S; Stein, Benjamin W; Stieber, S Chantal E; Wilson, Justin J

    2016-01-01

    Actinium-225 is a promising isotope for targeted-α therapy. Unfortunately, progress in developing chelators for medicinal applications has been hindered by a limited understanding of actinium chemistry. This knowledge gap is primarily associated with handling actinium, as it is highly radioactive and in short supply. Hence, Ac(III) reactivity is often inferred from the lanthanides and minor actinides (that is, Am, Cm), with limited success. Here we overcome these challenges and characterize actinium in HCl solutions using X-ray absorption spectroscopy and molecular dynamics density functional theory. The Ac-Cl and Ac-OH2O distances are measured to be 2.95(3) and 2.59(3) Å, respectively. The X-ray absorption spectroscopy comparisons between Ac(III) and Am(III) in HCl solutions indicate Ac(III) coordinates more inner-sphere Cl(1-) ligands (3.2±1.1) than Am(III) (0.8±0.3). These results imply diverse reactivity for the +3 actinides and highlight the unexpected and unique Ac(III) chemical behaviour. PMID:27531582

  7. Production of high-purity radium-223 from legacy actinium-beryllium neutron sources.

    Soderquist, Chuck Z; McNamara, Bruce K; Fisher, Darrell R

    2012-07-01

    Radium-223 is a short-lived alpha-particle-emitting radionuclide with potential applications in cancer treatment. Research to develop new radiopharmaceuticals employing (223)Ra has been hindered by poor availability due to the small quantities of parent actinium-227 available world-wide. The purpose of this study was to develop innovative and cost-effective methods to obtain high-purity (223)Ra from (227)Ac. We obtained (227)Ac from two surplus actinium-beryllium neutron generators. We retrieved the actinium/beryllium buttons from the sources and dissolved them in a sulfuric-nitric acid solution. A crude actinium solid was recovered from the solution by coprecipitation with thorium fluoride, leaving beryllium in solution. The crude actinium was purified to provide about 40 milligrams of actinium nitrate using anion exchange in methanol-water-nitric acid solution. The purified actinium was then used to generate high-purity (223)Ra. We extracted (223)Ra using anion exchange in a methanol-water-nitric acid solution. After the radium was separated, actinium and thorium were then eluted from the column and dried for interim storage. This single-pass separation produces high purity, carrier-free (223)Ra product, and does not disturb the (227)Ac/(227)Th equilibrium. A high purity, carrier-free (227)Th was also obtained from the actinium using a similar anion exchange in nitric acid. These methods enable efficient production of (223)Ra for research and new alpha-emitter radiopharmaceutical development. PMID:22697483

  8. Radium, thorium, and actinium extraction from seawater using an improved manganese-oxide-coated fiber

    Laboratory experiments were conducted to determine the efficiency with which improved manganese-oxide-coated acrylic fibers extract radium, thorium, and actinium from seawater. Tests were made using surface seawater spiked with 227Ac, 227Th and 223Ra. For sample volumes of approximately 30 liters and flow rates up to 0.5 liters per minute, radium and actinium are removed quantitatively. Approximately 80-95% of the thorium is removed under these same conditions. (Auth.)

  9. Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232

    Harvey, James T.; Nolen, Jerry; Vandergrift, George; Gomes, Itacil; Kroc, Tom; Horwitz, Phil; McAlister, Dan; Bowers, Del; Sullivan, Vivian; Greene, John

    2011-12-30

    The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces {approx}100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 Ge

  10. Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232

    The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces ∼100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 GeV protons

  11. Neutron-Induced Fission of Actinium-227, Protactinium-231 and Neptunium-237: Mass Distribution

    Results of radiochemical studies on the mass distribution in the neutron-induced fission of actinium-227, protactinium-231 and neptunium-237 have been presented. This work has been carried out as part of a programme to determine the mass distribution in the fission of heavy elements as a function of Z and A. All irradiations have been carried out in the core of the swimming-pool type reactor APSARA with cadmium shielding wherever necessary. Relative yields of several fission product nuclides have been obtained by a method involving a comparison of the fission product activities from the respective targets with those formed from uranium-235 simultaneously irradiated. Thermal-neutron fission yields of uranium-235 have been assumed. These results indicate a predominantly asymmetric mass distribution in all the three cases, and also a distinct though small symmetric peak in the case of actinium-227. (author)

  12. HTT230 phoenix Material-htt230dotcom

    sandy

    2015-01-01

    HTT 230 Entire Course (UOP) For more course tutorials visit www.htt230.com HTT 230 Week 1 CheckPoint: Primary Financial Statements HTT 230 Week 2 Assignment: Rosabella and Canyon Hotel Concept Checks HTT 230 Week 2 CheckPoint: The Sarbanes-Oxley Act HTT 230 Week 2 CheckPoint: The CP3 Accounting System HTT 230 Week 3 CheckPoint: Credit Card Research HTT 230 Week 3 CheckPoint: Crescendo Concept Check HTT 230 Week 4 Assignment: Watree Lodge and Greenville Rest...

  13. A new method for the determination of low-level actinium-227 in geological samples

    We developed a new method for the determination of 227Ac in geological samples. The method uses extraction chromatographic techniques and alpha-spectrometry and is applicable for a range of natural matrices. Here we report on the procedure and results of the analysis of water (fresh and seawater) and rock samples. Water samples were acidified and rock samples underwent total dissolution via acid leaching. A DGA (N,N,N',N'-tetra-n-octyldiglycolamide) extraction chromatographic column was used for the separation of actinium. The actinium fraction was prepared for alpha spectrometric measurement via cerium fluoride micro-precipitation. Recoveries of actinium in water samples were 80 ± 8 % (number of analyses n = 14) and in rock samples 70 ± 12 % (n = 30). The minimum detectable activities (MDA) were 0.017-0.5 Bq kg-1 for both matrices. Rock sample 227Ac activities ranged from 0.17 to 8.3 Bq kg-1 and water sample activities ranged from below MDA values to 14 Bq kg-1of 227Ac. From the analysis of several standard rock and water samples with the method we found very good agreement between our results and certified values. (author)

  14. BCOM 230 Course Tutorial / tutorialrank

    welcome1351

    2015-01-01

    For more course tutorials visit www.tutorialrank.com Tutorial Purchased: 4 Times, Rating: A+   BCOM 230 Week 1 Individual Assignment Behavior and Communication Paper (UOP Course) BCOM 230 Week 1 DQ 1 (UOP Course) BCOM 230 Week 1 DQ 2 (UOP Course) BCOM 230 Week 1 DQ 3 (UOP Course) BCOM 230 Week 2 Individual Assignment Memo Review (UOP Course) BCOM 230 Week 2 DQ 1 (UOP Course) BCOM 230 Week 2 DQ 2(UOP Course) BCOM 230 Week 2 DQ 3 (UOP Course) ...

  15. Analysis of the gamma spectra of the uranium, actinium, and thorium decay series

    Momeni, M.H.

    1981-09-01

    This report describes the identification of radionuclides in the uranium, actinium, and thorium series by analysis of gamma spectra in the energy range of 40 to 1400 keV. Energies and absolute efficiencies for each gamma line were measured by means of a high-resolution germanium detector and compared with those in the literature. A gamma spectroscopy method, which utilizes an on-line computer for deconvolution of spectra, search and identification of each line, and estimation of activity for each radionuclide, was used to analyze soil and uranium tailings, and ore.

  16. Analysis of the gamma spectra of the uranium, actinium, and thorium decay series

    This report describes the identification of radionuclides in the uranium, actinium, and thorium series by analysis of gamma spectra in the energy range of 40 to 1400 keV. Energies and absolute efficiencies for each gamma line were measured by means of a high-resolution germanium detector and compared with those in the literature. A gamma spectroscopy method, which utilizes an on-line computer for deconvolution of spectra, search and identification of each line, and estimation of activity for each radionuclide, was used to analyze soil and uranium tailings, and ore

  17. HTT 230 UOP Tutorial/ Uoptutorial

    Moon,, D.H.

    2015-01-01

    For more course tutorials visit www.uoptutorial.com     HTT 230 Week 1 CheckPoint: Primary Financial Statements HTT 230 Week 2 Assignment: Rosabella and Canyon Hotel Concept Checks HTT 230 Week 2 CheckPoint: The Sarbanes-Oxley Act HTT 230 Week 2 CheckPoint: The CP3 Accounting System HTT 230 Week 3 CheckPoint: Credit Card Research HTT 230 Week 3 CheckPoint: Crescendo Concept Check HTT 230 Week 4 Assignment: Watree Lodge and Greenville Restaura...

  18. In-source laser spectroscopy developments at TRILIS—towards spectroscopy on actinium and scandium

    Resonance Ionization Laser Ion Sources (RILIS) have become a versatile tool for production and study of exotic nuclides at Isotope Separator On-Line (ISOL) facilities such as ISAC at TRIUMF. The recent development and addition of a grating tuned spectroscopy laser to the TRIUMF RILIS solid state laser system allows for wide range spectral scans to investigate atomic structures on short lived isotopes, e.g., those from the element actinium, produced in uranium targets at ISAC. In addition, development of new and improved laser ionization schemes for rare isotope production at ISAC is ongoing. Here spectroscopic studies on bound states, Rydberg states and autoionizing (AI) resonances on scandium using the existing off-line capabilities are reported. These results allowed to identify a suitable ionization scheme for scandium via excitation into an autoionizing state at 58,104 cm − 1 which has subsequently been used for ionization of on-line produced exotic scandium isotopes.

  19. HTT 230 UOP Coureses/UOP Help

    royal8

    2015-01-01

    HTT 230 Entire Course For more course tutorials visit www.uophelp.com       HTT 230 Week 1 CheckPoint: Primary Financial Statements HTT 230 Week 2 Assignment: Rosabella and Canyon Hotel Concept Checks HTT 230 Week 2 CheckPoint: The CP3 Accounting System HTT 230 Week 3 CheckPoint: Credit Card Research HTT 230 Week 3 CheckPoint: Crescendo Concept Check HTT 230 Week 4 Assignment: Watree Lodge and Greenville Restaurant Concept Checks ...

  20. Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL

    Raeder, S.; Bastin, B.; Block, M.; Creemers, P.; Delahaye, P.; Ferrer, R.; Fléchard, X.; Franchoo, S.; Ghys, L.; Gaffney, L. P.; Granados, C.; Heinke, R.; Hijazi, L.; Huyse, M.; Kron, T.; Kudryavtsev, Yu.; Laatiaoui, M.; Lecesne, N.; Luton, F.; Moore, I. D.; Martinez, Y.; Mogilevskiy, E.; Naubereit, P.; Piot, J.; Rothe, S.; Savajols, H.; Sels, S.; Sonnenschein, V.; Traykov, E.; Van Beveren, C.; Van den Bergh, P.; Van Duppen, P.; Wendt, K.; Zadvornaya, A.

    2016-06-01

    To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.

  1. BCOM 230 UOP Course Tutorial / Tutorialrank

    charles

    2015-01-01

    For more course tutorials visit www.tutorialrank.com Tutorial Purchased: 4 Times, Rating: A+   BCOM 230 Week 1 Individual Assignment Behavior and Communication Paper (UOP Course) BCOM 230 Week 1 DQ 1 (UOP Course) BCOM 230 Week 1 DQ 2 (UOP Course) BCOM 230 Week 1 DQ 3 (UOP Course) BCOM 230 Week 2 Individual Assignment Memo Review (UOP Course) BCOM 230 Week 2 DQ 1 (UOP Course) BCOM 230 Week 2 DQ 2(UOP Course) BCOM 230 Week 2 DQ 3 (UOP Course) ...

  2. MKT 230 ASH Course Tutorial/ Tutorialrank

    john

    2015-01-01

    For more course tutorials visit www.tutorialrank.com Tutorial Purchased: 5 Times, Rating: A+ ASHFORD MKT 230 Week 1 CheckPoint Marketing Concepts ASHFORD MKT 230 Week 1 DQ 1 and DQ 2 ASHFORD MKT 230 Week 2 CheckPoint Decision Time at Qode ASHFORD MKT 230 Week 2 Assignment Marketing Plan Exercise ASHFORD MKT 230 Week 3 CheckPoint Consumer Decision Making Process ASHFORD MKT 230 Week 3 DQ 1 and DQ 2 ASHFORD MKT 230 Week 4 CheckPoint Customer Relationship Mana...

  3. HTT 230 UOP Course Tutorial / Tutorialoutlet

    kutti

    2015-01-01

    For more course tutorials visit www.tutorialoutlet.com     HTT 230 Week 1 CheckPoint: Primary Financial Statements HTT 230 Week 2 Assignment: Rosabella and Canyon Hotel Concept Checks HTT 230 Week 2 CheckPoint: The CP3 Accounting System HTT 230 Week 3 CheckPoint: Credit Card Research HTT 230 Week 3 CheckPoint: Crescendo Concept Check HTT 230 Week 4 Assignment: Watree Lodge and Greenville Restaurant Concept Checks HTT 230 Week 4 CheckPoint: The...

  4. SCI 230 ENTIRE COURSE *INTRODUCTION TO LIFE SCIENCE* UPDATE COURSE

    SCI 230 ENTIRE COURSE

    2016-01-01

    http://www.helperstudy.com/products/sci-230 SCI 230 ALL DQS SCI 230 WEEK 1 ASSIGNMENT THE SCIENTIFIC METHOD SCI 230 WEEK 1 CHECKPOINT LEVELS OF LIFE SCI 230 WEEK 1 CHECKPOINT THEORIES OF BIOLOGY SCI 230 WEEK 2 CHECKPOINT PLANTS VS. ANIMALS SCI 230 WEEK 3 ASSIGNMENT PHOTOSYNTHESIS AND CELLULAR RESPIRATION SCI 230 WEEK 3 CHECKPOINT MITOSIS AND MEIOSIS SCI 230 WEEK 3 EXERCISE UNESCO RESEARCH SCI 230 WEEK 4 CHECKPOINT MENDEL ON PATTERNS OF INHERITANCE SCI 2...

  5. 46 CFR 183.230 - Temperature ratings.

    2010-10-01

    ...) ELECTRICAL INSTALLATION General Requirements § 183.230 Temperature ratings. Temperature ratings of electrical equipment must meet the requirements of 46 CFR 111.01-15. ... 46 Shipping 7 2010-10-01 2010-10-01 false Temperature ratings. 183.230 Section 183.230...

  6. 40 CFR 230.4 - Organization.

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Organization. 230.4 Section 230.4 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) OCEAN DUMPING SECTION 404(b)(1) GUIDELINES FOR SPECIFICATION OF DISPOSAL SITES FOR DREDGED OR FILL MATERIAL General § 230.4 Organization....

  7. 49 CFR 230.39 - Broken staybolts.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Broken staybolts. 230.39 Section 230.39... Staybolts § 230.39 Broken staybolts. (a) Maximum allowable number of broken staybolts. No boiler shall be allowed to remain in service with two broken staybolts located within 24 inches of each other, as...

  8. 49 CFR 230.82 - Fire doors.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Fire doors. 230.82 Section 230.82 Transportation... Signals, Sanders and Lights § 230.82 Fire doors. (a) General provisions. Each steam locomotive shall have a fire door which shall latch securely when closed and which shall be maintained in a safe...

  9. 29 CFR 99.230 - Audit costs.

    2010-07-01

    ... principles circulars, the Federal Acquisition Regulation (FAR)(48 CFR parts 30 and 31), or other applicable... 29 Labor 1 2010-07-01 2010-07-01 true Audit costs. 99.230 Section 99.230 Labor Office of the Secretary of Labor AUDITS OF STATES, LOCAL GOVERNMENTS, AND NON-PROFIT ORGANIZATIONS Audits § 99.230...

  10. 24 CFR 3.230 - Transition plans.

    2010-04-01

    ... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Transition plans. 3.230 Section 3.230 Housing and Urban Development Office of the Secretary, Department of Housing and Urban Development... Coverage § 3.230 Transition plans. (a) Submission of plans. An institution to which § 3.225 applies...

  11. 40 CFR 230.97 - Management.

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Management. 230.97 Section 230.97... Losses of Aquatic Resources § 230.97 Management. (a) Site protection. (1) The aquatic habitats, riparian.... For government property, long-term protection may be provided through federal facility...

  12. 49 CFR 230.69 - Ash pans.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Ash pans. 230.69 Section 230.69 Transportation... TRANSPORTATION STEAM LOCOMOTIVE INSPECTION AND MAINTENANCE STANDARDS Steam Locomotives and Tenders Ash Pans § 230.69 Ash pans. Ash pans shall be securely supported from mud-rings or frames with no part less than...

  13. 32 CFR 230.5 - Responsibilities.

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 230.5 Section 230.5 National... FINANCIAL INSTITUTIONS ON DOD INSTALLATIONS § 230.5 Responsibilities. (a) The Under Secretary of Defense... affect the morale and welfare of DoD personnel. (d) DoD Component responsibilities pertaining to...

  14. 49 CFR 230.76 - Piston travel.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Piston travel. 230.76 Section 230.76... Tenders Brake and Signal Equipment § 230.76 Piston travel. (a) Minimum piston travel. The minimum piston travel shall be sufficient to provide proper brake shoe clearance when the brakes are released....

  15. 49 CFR 230.95 - Guides.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Guides. 230.95 Section 230.95 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION STEAM LOCOMOTIVE INSPECTION AND MAINTENANCE STANDARDS Steam Locomotives and Tenders Driving Gear § 230.95 Guides. Guides shall...

  16. 49 CFR 230.89 - Reverse gear.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Reverse gear. 230.89 Section 230.89 Transportation... Reversing Gear § 230.89 Reverse gear. (a) General provisions. Reverse gear, reverse levers, and quadrants... quadrant. Proper counterbalance shall be provided for the valve gear. (b) Air-operated power reverse...

  17. 49 CFR 230.47 - Boiler number.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Boiler number. 230.47 Section 230.47... Steam Gauges § 230.47 Boiler number. (a) Generally. The builder's number of the boiler, if known, shall be stamped on the steam dome or manhole flange. If the builder's number cannot be obtained,...

  18. 40 CFR 230.44 - Coral reefs.

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Coral reefs. 230.44 Section 230.44... Aquatic Sites § 230.44 Coral reefs. (a) Coral reefs consist of the skeletal deposit, usually of calcareous... by increasing the level of suspended particulates. Coral organisms are extremely sensitive to...

  19. 49 CFR 230.62 - Dry pipe.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Dry pipe. 230.62 Section 230.62 Transportation... TRANSPORTATION STEAM LOCOMOTIVE INSPECTION AND MAINTENANCE STANDARDS Boilers and Appurtenances Steam Pipes § 230.62 Dry pipe. Dry pipes subject to pressure shall be examined at each annual inspection to...

  20. 7 CFR 65.230 - Production step.

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Production step. 65.230 Section 65.230 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards..., PEANUTS, AND GINSENG General Provisions Definitions § 65.230 Production step. Production step means,...

  1. 42 CFR 431.230 - Maintaining services.

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Maintaining services. 431.230 Section 431.230 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES... Applicants and Recipients Procedures § 431.230 Maintaining services. (a) If the agency mails the 10-day or...

  2. 49 CFR 230.22 - Accident reports.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Accident reports. 230.22 Section 230.22... Requirements § 230.22 Accident reports. In the case of an accident due to failure, from any cause, of a steam... persons, the railroad on whose line the accident occurred shall immediately make a telephone report of...

  3. 40 CFR 230.22 - Water.

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Water. 230.22 Section 230.22... Chemical Characteristics of the Aquatic Ecosystem § 230.22 Water. (a) Water is the part of the aquatic... the liquid phase and is contained by the substrate. Water forms part of a dynamic aquatic...

  4. 22 CFR 230.16 - Governing law.

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Governing law. 230.16 Section 230.16 Foreign... SUPPLEMENTAL APPROPRIATIONS ACT OF 2003, PUB. L. 108-11-STANDARD TERMS AND CONDITIONS § 230.16 Governing law. This Guarantee shall be governed by and construed in accordance with the laws of the United States...

  5. 12 CFR 230.4 - Account disclosures.

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Account disclosures. 230.4 Section 230.4 Banks... IN SAVINGS (REGULATION DD) § 230.4 Account disclosures. (a) Delivery of account disclosures—(1) Account opening. (i) General. A depository institution shall provide account disclosures to a...

  6. 22 CFR 230.14 - Arbitration.

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Arbitration. 230.14 Section 230.14 Foreign... SUPPLEMENTAL APPROPRIATIONS ACT OF 2003, PUB. L. 108-11-STANDARD TERMS AND CONDITIONS § 230.14 Arbitration. Any... arbitration to be held in Washington, DC in accordance with the then prevailing rules of the...

  7. 12 CFR 230.8 - Advertising.

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Advertising. 230.8 Section 230.8 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM TRUTH IN SAVINGS (REGULATION DD) § 230.8 Advertising. (a) Misleading or inaccurate advertisements. An...

  8. Dicty_cDB: SSA230 [Dicty_cDB

    Full Text Available SS (Link to library) SSA230 (Link to dictyBase) - - - Contig-U04338-1 SSA230E (Link to Original site) SSA...230F 286 SSA230Z 485 SSA230P 771 SSA230E 683 Show SSA230 Library SS (Link to library) Clone ID SSA...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSA2-B/SSA230Q.Seq.d/ Representative seq. ID SSA...230E (Link to Original site) Representative DNA sequence >SSA230 (SSA230Q) /CSM/SS/SSA2-B/SSA...degsntehsikeiinhvfqkdkdllylisvaedpitfpssaisavvvsetlkaierkhks ilinranlknlgvqnvkallgxgnhvgeavikaar*ksyslsggweg

  9. BCOM 230 UOP Course Tutorial/TutorialRank

    apj

    2015-01-01

    For more course tutorials visit www.tutorialrank.com Tutorial Purchased: 4 Times, Rating: A+   BCOM 230 Week 1 Individual Assignment Behavior and Communication Paper (UOP Course) BCOM 230 Week 1 DQ 1 (UOP Course) BCOM 230 Week 1 DQ 2 (UOP Course) BCOM 230 Week 1 DQ 3 (UOP Course) BCOM 230 Week 2 Individual Assignment Memo Review (UOP Course) BCOM 230 Week 2 DQ 1 (UOP Course) BCOM 230 Week 2 DQ 2(UOP Course)

  10. MKT 230 UOP Course Tutorial/TutorialRank

    apj

    2015-01-01

    ASHFORD MKT 230 Week 1 CheckPoint Marketing Concepts ASHFORD MKT 230 Week 1 DQ 1 and DQ 2 ASHFORD MKT 230 Week 2 CheckPoint Decision Time at Qode ASHFORD MKT 230 Week 2 Assignment Marketing Plan Exercise ASHFORD MKT 230 Week 3 CheckPoint Consumer Decision Making Process

  11. 23 CFR 230.121 - Reports.

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Reports. 230.121 Section 230.121 Highways FEDERAL... Reports. (a) Employment reports on Federal-aid highway construction contracts not subject to “Hometown” or... reporting requirements. FHWA Form PR-1391, Federal-Aid Highway Construction Contractors Annual EEO...

  12. 38 CFR 41.230 - Audit costs.

    2010-07-01

    ..., the Federal Acquisition Regulation (FAR) (48 CFR parts 30 and 31), or other applicable cost principles... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Audit costs. 41.230 Section 41.230 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS (CONTINUED)...

  13. 23 CFR 230.403 - Applicability.

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Applicability. 230.403 Section 230.403 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION CIVIL RIGHTS EXTERNAL PROGRAMS Construction Contract... apply to all nonexempt direct Federal and Federal-aid highway construction contracts and...

  14. 40 CFR 230.32 - Other wildlife.

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Other wildlife. 230.32 Section 230.32 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) OCEAN DUMPING SECTION 404(b)(1) GUIDELINES FOR SPECIFICATION OF DISPOSAL SITES FOR DREDGED OR FILL MATERIAL Potential Impacts on...

  15. 40 CFR 230.43 - Vegetated shallows.

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Vegetated shallows. 230.43 Section 230.43 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) OCEAN DUMPING SECTION 404(b)(1) GUIDELINES FOR SPECIFICATION OF DISPOSAL SITES FOR DREDGED OR FILL MATERIAL Potential Impacts...

  16. 40 CFR 230.42 - Mud flats.

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Mud flats. 230.42 Section 230.42 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) OCEAN DUMPING SECTION 404(b)(1) GUIDELINES FOR SPECIFICATION OF DISPOSAL SITES FOR DREDGED OR FILL MATERIAL Potential Impacts on...

  17. 33 CFR 230.21 - Adoption.

    2010-07-01

    ... FOR IMPLEMENTING NEPA § 230.21 Adoption. See 40 CFR 1506.3. A district commander will normally adopt... recirculated as provided in 40 CFR 1506.3 (b) or (c), the adopted EIS with the supplement, if any, will be... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Adoption. 230.21 Section...

  18. 40 CFR 230.25 - Salinity gradients.

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Salinity gradients. 230.25 Section 230.25 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) OCEAN DUMPING SECTION 404(b)(1) GUIDELINES FOR SPECIFICATION OF DISPOSAL SITES FOR DREDGED OR FILL MATERIAL Potential Impacts...

  19. 40 CFR 230.20 - Substrate.

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Substrate. 230.20 Section 230.20 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) OCEAN DUMPING SECTION 404(b)(1) GUIDELINES FOR SPECIFICATION OF DISPOSAL SITES FOR DREDGED OR FILL MATERIAL Potential Impacts on Physical...

  20. BCOM 230 UOP Course Tutorial/TutotorialRank

    jhoni

    2015-01-01

    For more course tutorials visit www.tutorialrank.com Tutorial Purchased: 4 Times, Rating:A+   BCOM 230 Week 1 Individual Assignment Behavior and Communication Paper (UOP Course) BCOM 230 Week 1 DQ 1 (UOP Course) BCOM 230 Week 1 DQ 2 (UOP Course) BCOM 230 Week 1 DQ 3 (UOP Course) BCOM 230 Week 2 Individual Assignment Memo Review (UOP Course) BCOM 230 Week 2 DQ 1 (UOP Course) BCOM 230 Week 2 DQ 2(UOP Course) BCOM 230 Week 2 DQ 3 (UOP Course) ...

  1. Groundwater seepage from the Ranger uranium mine tailings dam: radioisotopes of radium, thorium and actinium. Supervising Scientist report 106

    Monitoring of bores near the Ranger uranium mine tailings dam has revealed deterioration in water quality in several bores since 1983. In a group of bores to the north of the dam, increases have been observed of up to 500 times for sulphate concentrations and of up to 5 times for 226Ra concentrations. Results are presented here of measurements of members of the uranium, thorium and actinium decay series in borewater samples collected between 1985 and 1993. In particular, measurements of all four naturally-occurring radium isotopes have been used in an investigation of the mechanism of radium concentration changes. For the most seepage-affected bores the major findings of the study include: 228Ra/226Ra 223Ra /226Ra and 224Ra/228Ra ratios all increased over the course of the study; barium concentrations show high seasonal variability, being lower in November than May, but strontium concentrations show a steady increase with time. Calculations show that the groundwater is probably saturated with respect to barite but not with respect to celestite or anglesite; sulphide concentrations are low in comparison with sulphate, and are higher in November than in May; and 227Ac concentrations have increased with time, but do not account for the high 223Ra/226Ra ratios. It is concluded on the basis of these observations that increases in Ra isotope concentrations observed in a number of seepage-affected bores arise from increases in salinity leading to desorption of radium from adsorption sites in the vicinity of the bore rather by direct transport of radium from the tailings. Increased salinity is also causing the observed increases in 227Ac and strontium concentrations, while formation of a barite solid phase in the groundwater is causing the removal of some radium from solution. This is the cause of the increasing radium isotope ratios noted above

  2. Dicty_cDB: SSI230 [Dicty_cDB

    Full Text Available SS (Link to library) SSI230 (Link to dictyBase) - G01247 DDB0187826 Contig-U11777-1 SSI...230E (Link to Original site) SSI230F 521 SSI230Z 583 SSI230P 1104 SSI230E 1071 Show SSI230 Library SS (L...ink to library) Clone ID SSI230 (Link to dictyBase) Atlas ID - NBRP ID G01247 dictyBase ID DDB0187826 Link t...o Contig Contig-U11777-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSI2-B/SSI...230Q.Seq.d/ Representative seq. ID SSI230E (Link to Original site) Representative DNA sequence >SSI230 (SSI

  3. 40 CFR 1042.230 - Engine families.

    2010-07-01

    ....230 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR POLLUTION CONTROLS... aftertreatment (for example, catalytic converter or particulate trap). (5) Combustion chamber design. (6) Nominal... aftertreatment system (oxidation catalyst, particulate trap), and characteristics of the aftertreatment...

  4. β-delayed fission from 230Ac

    ThO2 is irradiated with 60 MeV/u 18O beams. 230Ra is produced via the multi-nucleon transfer and dissipative fragmentation reactions of the target. 230Ra is radio-chemical separated from ThO2 and the other reaction products. The thin Ra sources are prepared. The mica fission track detectors are exposed to the Ra sources. γ-rays of Ra decay in the sources are measured by a HPGe detector. The mica foil is etched in HF solution. The etched mica foil is scanned with an optical microscope. The fission tracks that should come from β-delayed fission of 230Ac are observed. The β-delayed fission probability of 230Ac is determined to be (1.19 +- 0.85) x 10-8

  5. HTT 230 uop course tutorial/uop helP

    john

    2015-01-01

    For more course tutorials visit www.uophelp.com       HTT 230 Week 1 CheckPoint: Primary Financial Statements HTT 230 Week 2 Assignment: Rosabella and Canyon Hotel Concept Checks HTT 230 Week 2 CheckPoint: The CP3 Accounting System HTT 230 Week 3 CheckPoint: Credit Card Research HTT 230 Week 3 CheckPoint: Crescendo Concept Check HTT 230 Week 4 Assignment: Watree Lodge and Greenville Restaurant Concept Checks HTT 230 Week 4 CheckPoint:...

  6. Surface segregation in HAYNES 230 alloy

    The surface segregation in the Ni-based alloy HAYNES 230 was studied by Auger Electron Spectroscopy and X-ray Photoelectron Spectroscopy between 400 and 1100 deg. C. The qualitative variations of the surface contents of S, P, W, Mo, N, Si, and Mn were determined as a function of annealing temperature and time. It was found that at 925 deg. C the maximum coverage of sulphur at the alloy surface is in the range 0.06-0.15 monolayers. Chromium evaporation from the HAYNES 230 surface under UHV conditions is clearly evidenced for annealing at 1100 deg. C

  7. Surface segregation in HAYNES 230 alloy

    Pop, D.; Wolski, K.

    2006-12-01

    The surface segregation in the Ni-based alloy HAYNES 230 was studied by Auger Electron Spectroscopy and X-ray Photoelectron Spectroscopy between 400 and 1100 °C. The qualitative variations of the surface contents of S, P, W, Mo, N, Si, and Mn were determined as a function of annealing temperature and time. It was found that at 925 °C the maximum coverage of sulphur at the alloy surface is in the range 0.06-0.15 monolayers. Chromium evaporation from the HAYNES 230 surface under UHV conditions is clearly evidenced for annealing at 1100 °C.

  8. 2 CFR 230.50 - Information contact.

    2010-01-01

    ... Grants and Agreements OFFICE OF MANAGEMENT AND BUDGET CIRCULARS AND GUIDANCE Reserved COST PRINCIPLES FOR NON-PROFIT ORGANIZATIONS (OMB CIRCULAR A-122) § 230.50 Information contact. Further information concerning this part may be obtained by contacting the Office of Federal Financial Management,...

  9. Linn 230 miljoni krooni paines / Priit Rajalo

    Rajalo, Priit, 1975-

    2000-01-01

    Riik on nõus võtma enne tähtaega tagasi Tartu soojalaenu. Tartu linn loodab saada laenu põhiosa ja seni tasumata intresside maksmiseks vajaliku 230 miljonit krooni, müües Tartu Keskatlamaja aktsiad

  10. 49 CFR 230.46 - Badge plates.

    2010-10-01

    ... TRANSPORTATION STEAM LOCOMOTIVE INSPECTION AND MAINTENANCE STANDARDS Boilers and Appurtenances Steam Gauges § 230.46 Badge plates. A metal badge plate showing the allowed steam pressure shall be attached to the boiler backhead in the cab. If boiler backhead is lagged, the lagging and jacket shall be cut away...

  11. 49 CFR 230.43 - Gauge siphon.

    2010-10-01

    ... TRANSPORTATION STEAM LOCOMOTIVE INSPECTION AND MAINTENANCE STANDARDS Boilers and Appurtenances Steam Gauges § 230.43 Gauge siphon. The steam gauge supply pipe shall have a siphon on it of ample capacity to prevent steam from entering the gauge. The supply pipe shall directly enter the boiler and be maintained...

  12. 49 CFR 230.35 - Pressure testing.

    2010-10-01

    ..., DEPARTMENT OF TRANSPORTATION STEAM LOCOMOTIVE INSPECTION AND MAINTENANCE STANDARDS Boilers and Appurtenances Pressure Testing of Boilers § 230.35 Pressure testing. The temperature of the steam locomotive boiler shall be raised to at least 70 deg. F any time hydrostatic pressure is applied to the boiler....

  13. 23 CFR 230.105 - Applicability.

    2010-04-01

    ... HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION CIVIL RIGHTS EXTERNAL PROGRAMS Equal Employment Opportunity on Federal and Federal-Aid Construction Contracts (Including Supportive Services) § 230.105 Applicability. (a) Federal-aid highway construction projects. This subpart applies to all Federal-aid...

  14. 23 CFR 230.107 - Policy.

    2010-04-01

    ... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION CIVIL RIGHTS EXTERNAL PROGRAMS Equal Employment Opportunity on Federal and Federal-Aid Construction Contracts (Including Supportive Services) § 230.107 Policy. (a) Direct Federal and Federal-aid highway construction projects. It is the policy of the FHWA to...

  15. 23 CFR 230.101 - Purpose.

    2010-04-01

    ... HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION CIVIL RIGHTS EXTERNAL PROGRAMS Equal Employment Opportunity on Federal and Federal-Aid Construction Contracts (Including Supportive Services) § 230.101...-aid highway construction contracts, except for those contracts awarded under 23 U.S.C. 117, and to...

  16. 9 CFR 2.30 - Registration.

    2010-01-01

    ... shall file an annual report of its status (active or inactive). A research facility shall notify the AC... intends to use live animals for research, tests, experiments, or teaching, the university or college... WELFARE REGULATIONS Research Facilities § 2.30 Registration. (a) Requirements and procedures. (1)...

  17. 50 CFR 230.2 - Definitions.

    2010-10-01

    ..., DEPARTMENT OF COMMERCE WHALING WHALING PROVISIONS § 230.2 Definitions. Aboriginal subsistence whaling means whaling authorized by paragraph 13 of the Schedule annexed to and constituting a part of the Convention... the Whaling Convention Act; or (4) Any Coast Guard personnel accompanying and acting under...

  18. 50 CFR 230.3 - General prohibitions.

    2010-10-01

    ..., DEPARTMENT OF COMMERCE WHALING WHALING PROVISIONS § 230.3 General prohibitions. (a) No person shall engage in whaling in a manner that violates the Convention, any regulation of the Commission, or this part. (b) No person shall engage in whaling without first having obtained a license or scientific research...

  19. 36 CFR 230.7 - Program practices.

    2010-07-01

    ... PRIVATE FORESTRY ASSISTANCE Stewardship Incentive Program § 230.7 Program practices. (a) Practices for... to each are as follows: (1) Landowner Forest Stewardship Plan Development (SIP1), which identifies... regeneration, planting, or direct seeding for conservation purposes and sustainable timber production....

  20. 40 CFR 230.11 - Factual determinations.

    2010-07-01

    ... possible loss of environmental values (§ 230.20) and actions to minimize impact (subpart H) shall also be... impact of a particular discharge may constitute a minor change in itself, the cumulative effect of... surface runoff from residential or commercial developments on fill, and leachate and runoff from...

  1. 17 CFR 230.459 - Calculation of effective date.

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Calculation of effective date. 230.459 Section 230.459 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION GENERAL RULES AND REGULATIONS, SECURITIES ACT OF 1933 Filings; Fees; Effective Date § 230.459 Calculation...

  2. 40 CFR 230.76 - Actions affecting human use.

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Actions affecting human use. 230.76 Section 230.76 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) OCEAN DUMPING SECTION... Minimize Adverse Effects § 230.76 Actions affecting human use. Minimization of adverse effects on human...

  3. 15 CFR 230.5 - Terms and shipping.

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Terms and shipping. 230.5 Section 230.5 Commerce and Foreign Trade Regulations Relating to Commerce and Foreign Trade NATIONAL INSTITUTE... MATERIALS Purchase Procedure § 230.5 Terms and shipping. (a) Prices are given in the SP 260...

  4. 40 CFR 230.74 - Actions related to technology.

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Actions related to technology. 230.74 Section 230.74 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) OCEAN DUMPING SECTION... Minimize Adverse Effects § 230.74 Actions related to technology. Discharge technology should be adapted...

  5. 49 CFR 230.93 - Pistons and piston rods.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Pistons and piston rods. 230.93 Section 230.93... Tenders Driving Gear § 230.93 Pistons and piston rods. (a) Maintenance and testing. Pistons and piston rods shall be maintained in safe and suitable condition for service. Piston rods shall be inspected...

  6. 49 CFR 230.52 - Water glass valves.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Water glass valves. 230.52 Section 230.52... Water Glasses and Gauge Cocks § 230.52 Water glass valves. All water glasses shall be equipped with no more than two valves capable of isolating the water glass from the boiler. They shall also be...

  7. 49 CFR 230.56 - Water glass lamps.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Water glass lamps. 230.56 Section 230.56... Water Glasses and Gauge Cocks § 230.56 Water glass lamps. All water glasses must be supplied with a suitable lamp properly located to enable the engine crew to easily see the water in the glass....

  8. 49 CFR 230.77 - Foundation brake gear.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Foundation brake gear. 230.77 Section 230.77... Tenders Brake and Signal Equipment § 230.77 Foundation brake gear. (a) Maintenance. Foundation brake gear...) Distance above the rails. No part of the foundation brake gear of the steam locomotive or tender shall...

  9. 49 CFR 230.71 - Orifice testing of compressors.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Orifice testing of compressors. 230.71 Section 230... Locomotives and Tenders Brake and Signal Equipment § 230.71 Orifice testing of compressors. (a) Frequency of testing. The compressor or compressors shall be tested for capacity by orifice test as often as...

  10. 49 CFR 230.60 - Time of washing.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Time of washing. 230.60 Section 230.60... Washing Boilers § 230.60 Time of washing. (a) Frequency of washing. All boilers shall thoroughly be washed... inspection. The date of the boiler wash shall be noted on the FRA Form No. 1 or FRA Form No. 3. (See...

  11. 33 CFR 110.230 - Puget Sound Area, Wash.

    2010-07-01

    ... citations affecting § 110.230, see the List of CFR Sections Affected, which appears in the Finding Aids... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Puget Sound Area, Wash. 110.230... ANCHORAGE REGULATIONS Anchorage Grounds § 110.230 Puget Sound Area, Wash. (a) The anchorage...

  12. 33 CFR 162.230 - Columbia River, Wash.

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Columbia River, Wash. 162.230 Section 162.230 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) PORTS AND WATERWAYS SAFETY INLAND WATERWAYS NAVIGATION REGULATIONS § 162.230 Columbia River, Wash....

  13. 49 CFR 230.32 - Time and method of inspection.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Time and method of inspection. 230.32 Section 230... Appurtenances Inspection and Repair § 230.32 Time and method of inspection. (a) Time of inspection. The entire... other components interfering with the provision of inspection access shall be removed at this...

  14. 49 CFR 230.24 - Maximum allowable stress.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Maximum allowable stress. 230.24 Section 230.24... Allowable Stress § 230.24 Maximum allowable stress. (a) Maximum allowable stress value. The maximum allowable stress value on any component of a steam locomotive boiler shall not exceed 1/4 of the...

  15. 50 CFR 230.5 - Licenses for aboriginal subsistence whaling.

    2010-10-01

    ... whaling. 230.5 Section 230.5 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE WHALING WHALING PROVISIONS § 230.5 Licenses for aboriginal subsistence whaling. (a) A license is hereby issued to whaling captains identified by the...

  16. 49 CFR 230.115 - Feed water tanks.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Feed water tanks. 230.115 Section 230.115... Tenders Steam Locomotive Tanks § 230.115 Feed water tanks. (a) General provisions. Tanks shall be... water. Feed water tanks shall be equipped with a device that permits the measurement of the quantity...

  17. 33 CFR 104.230 - Drill and exercise requirements.

    2010-07-01

    ... the substantial and active participation of relevant company and vessel security personnel, and may.... 104.230 Section 104.230 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY MARITIME SECURITY MARITIME SECURITY: VESSELS Vessel Security Requirements § 104.230 Drill and...

  18. 49 CFR 230.107 - Tender frame and body.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Tender frame and body. 230.107 Section 230.107... Tenders Trucks, Frames and Equalizing System § 230.107 Tender frame and body. (a) Maintenance. Tender frames shall be maintained in a safe and suitable condition for service. (b) Height difference....

  19. 49 CFR 230.106 - Steam locomotive frame.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Steam locomotive frame. 230.106 Section 230.106... Tenders Trucks, Frames and Equalizing System § 230.106 Steam locomotive frame. (a) Maintenance and inspection. Frames, decks, plates, tailpieces, pedestals, and braces shall be maintained in a safe...

  20. 29 CFR 779.230 - Franchise and other arrangements.

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Franchise and other arrangements. 779.230 Section 779.230... Coverage Leased Departments, Franchise and Other Business Arrangements § 779.230 Franchise and other.... The quotation in § 779.229 from the Senate Report shows that Congress recognized that some...

  1. 17 CFR 230.135a - Generic advertising.

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Generic advertising. 230.135a Section 230.135a Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION GENERAL RULES AND REGULATIONS, SECURITIES ACT OF 1933 General § 230.135a Generic advertising. (a) For the purposes only...

  2. 17 CFR 230.425 - Filing of certain prospectuses and communications under § 230.135 in connection with business...

    2010-04-01

    ... and communications under § 230.135 in connection with business combination transactions. 230.425... and communications under § 230.135 in connection with business combination transactions. (a) All... use except as provided in paragraph (d)(1) of this section. A communication limited to the...

  3. Observation of β-delayed fission from 230Ac

    β-delayed fission for 230Ac was searched. 230Ra was produced via multinucleon transfer reaction by 60 MeV/u 18O ion irradiation of 232Th target. Thin 230Ra→230Ac sources of 108 atoms were acquired through radiochemical separations. The mica track detectors were used to record the fission events. The β-delayed fission nucleus 230Ac was identified via the observed two fission events and the measured γ-ray spectra. Its β-delayed fission probability was obtained to be (1.19 +- 0.85) x 10-8

  4. Determination of Th-230 in water

    On of the current goals of the Radiochemistry Division of CDTN is to acquire capability in determining contaminants of high radiotoxicity in different matrixes. The method described here was developed in order to determine Th-230 in water, one of the decay products of the uranium series, belongs to the most restrictive class of radionuclides, on account of its alpha emission and half-life of 8 x 104 years. The method conesists of two radiochemical steps, one electrodeposition step and alpha spectrometry with the use of a surface-barrier detector. Water samples with internal Th-230 standards were analysed and the results showed good reproducibility with erros a around 10% and alfa detection efficiency of 12%. The lower detection limit is around 0,4 Bq/l. (author)

  5. A precursor of β-delayed fission:230Ac

    2002-01-01

    The 230Ra has been produced via multinucleon transfer and dissipativefragmentation of heavy target in the 60 MeV/u 18O ion reaction with natural thorium.The radium was radiochemically separated from irradiated thorium targets. 230Acwas obtained by 230Ra β-→ 230Ac. Thin Ra sources were prepared for observing fissionfragments from β-delayed fission of 230Ac. The sources were exposed to the micafission track detectors and measured by a HPGe γ detector. The two fission eventswere obtained and could been assigned to theβ-delayed fission of 230Ac. The β-delayedfission probability of 230Ac was determined to be (1.19+0.85) × 10-8.

  6. Determination for β-delayed fission probability of 230Ac

    袁双贵; 杨维凡; 徐岩冰; 肖永厚; 罗亦孝

    2002-01-01

    The 230Ra has been produced via 232Th-2p reaction induced by 60 MeV/u 18O ion irradia-tion of natural thorium. The radium was radiochemically separated from the mixture of thorium andreaction products. Thin Ra sources in which 230Ac was got through 230Ra β- → 230Ac were pre-pared for observing fission fragments from β-delayed fission of 230Ac. The sources were exposedto the mica fission track detectors and measured by the HPGe γ detector. The precursor 230Ac wasidentified by means of observed two fission events as well as γ spectra, and the β-delayed fissionprobability of 230Ac was obtained to be (1.19±0.85) × 10-8.

  7. 40 CFR 1033.230 - Grouping locomotives into engine families.

    2010-07-01

    ...) AIR POLLUTION CONTROLS CONTROL OF EMISSIONS FROM LOCOMOTIVES Certifying Engine Families § 1033.230... exhaust aftertreatment system (oxidation catalyst, particulate trap), and characteristics of...

  8. 49 CFR 230.36 - Hydrostatic testing of boilers.

    2010-10-01

    ... Appurtenances Pressure Testing of Boilers § 230.36 Hydrostatic testing of boilers. (a) Time of test. The... following any hydrostatic test where the pressure exceeds MAWP. ... 49 Transportation 4 2010-10-01 2010-10-01 false Hydrostatic testing of boilers. 230.36 Section...

  9. 23 CFR 230.409 - Contract compliance review procedures.

    2010-04-01

    ... on previous PR-1391's (23 CFR part 230, subpart A, appendix C) Review Reports and Hometown Plan... 230.409 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION CIVIL RIGHTS EXTERNAL... female labor forces within a reasonable recruitment area; (3) Working on projects that include...

  10. 49 CFR 230.101 - Steam locomotive driving journal boxes.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Steam locomotive driving journal boxes. 230.101... Locomotives and Tenders Running Gear § 230.101 Steam locomotive driving journal boxes. (a) Driving journal boxes. Driving journal boxes shall be maintained in a safe and suitable condition for service. Not...

  11. 49 CFR 230.103 - Tender roller bearing journal boxes.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Tender roller bearing journal boxes. 230.103... Locomotives and Tenders Running Gear § 230.103 Tender roller bearing journal boxes. Tender roller bearing journal boxes shall be maintained in a safe and suitable condition....

  12. 49 CFR 230.102 - Tender plain bearing journal boxes.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Tender plain bearing journal boxes. 230.102... Locomotives and Tenders Running Gear § 230.102 Tender plain bearing journal boxes. Plain bearing journal boxes... expected to damage the bearing; or have a detrimental effect on the lubrication of the journal and...

  13. 20 CFR 637.230 - Use of incentive bonuses.

    2010-04-01

    ... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Use of incentive bonuses. 637.230 Section 637... TITLE V OF THE JOB TRAINING PARTNERSHIP ACT Program Planning and Operation § 637.230 Use of incentive... information collection and compilation, recordkeeping, or the preparation of applications for...

  14. Dicty_cDB: VSG230 [Dicty_cDB

    Full Text Available VS (Link to library) VSG230 (Link to dictyBase) - - - Contig-U05201-1 VSG230P (Link to Original ... nmvetkf*tipfsiysfsyn*tkrm*kticcyps*km*iccfk*fkfncc vtl *nl**fskiwccnfkyscth**IYFRLSQCRLDIKKK--- ---HXSGKXV ... nmvetkf*tipfsiysfsyn*tkrm*kticcyps*km*iccfk*fkfncc vtl *nl**fskiwccnfkyscth**IYFRLSQCRLDIKKK--- ---prvrkxs ... lsptgtpvsd apweigdhvstwwrpnfepslfpyipshitkpkeckklfvvtl pekckfavsnnlsliav slyeiynnsqrygavissipalisrytfvylnv ...

  15. 49 CFR 230.26 - Tensile strength of shell plates.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Tensile strength of shell plates. 230.26 Section... Appurtenances Strength of Materials § 230.26 Tensile strength of shell plates. When the tensile strength of steel or wrought-iron shell plates is not known, it shall be taken at 50,000 psi for steel and...

  16. 17 CFR 230.156 - Investment company sales literature.

    2010-04-01

    ... 10b-5 thereunder (17 CFR part 240), it is unlawful for any person, directly or indirectly, by the use... literature. 230.156 Section 230.156 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION... literature. (a) Under the federal securities laws, including section 17(a) of the Securities Act of 1933...

  17. 6 CFR 27.230 - Risk-based performance standards.

    2010-01-01

    ... 6 Domestic Security 1 2010-01-01 2010-01-01 false Risk-based performance standards. 27.230 Section 27.230 Domestic Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY CHEMICAL FACILITY... the facility and that discourages abuse through established disciplinary measures; (4) Deter,...

  18. 33 CFR 2.30 - Exclusive Economic Zone.

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Exclusive Economic Zone. 2.30... JURISDICTION Jurisdictional Terms § 2.30 Exclusive Economic Zone. (a) With respect to the United States... States exercises sovereignty, exclusive economic zone means the zone seaward of and adjacent to...

  19. 36 CFR 230.3 - National program administration.

    2010-07-01

    ... STATE AND PRIVATE FORESTRY ASSISTANCE Stewardship Incentive Program § 230.3 National program... Program funding to be made available for landowner forest stewardship plan development (§ 230.7(a)(1) of... Program participant information, the management of accounting ledgers, and the disbursement of payment...

  20. 40 CFR 230.52 - Water-related recreation.

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Water-related recreation. 230.52... Effects on Human Use Characteristics § 230.52 Water-related recreation. (a) Water-related recreation... or fill disposal is to impair or destroy the resources which support recreation activities....

  1. 50 CFR 230.4 - Aboriginal subsistence whaling.

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Aboriginal subsistence whaling. 230.4... ADMINISTRATION, DEPARTMENT OF COMMERCE WHALING WHALING PROVISIONS § 230.4 Aboriginal subsistence whaling. (a) No person shall engage in aboriginal subsistence whaling, except a whaling captain licensed pursuant...

  2. 50 CFR 230.8 - Reporting by whaling captains.

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Reporting by whaling captains. 230.8... ADMINISTRATION, DEPARTMENT OF COMMERCE WHALING WHALING PROVISIONS § 230.8 Reporting by whaling captains. (a) The relevant Native American whaling organization shall require each whaling captain licensed pursuant to §...

  3. Dicty_cDB: AFG230 [Dicty_cDB

    Full Text Available AF (Link to library) AFG230 (Link to dictyBase) - - - Contig-U16287-1 AFG230F (Link to Original ... gfememerk*ketr*ti**tkhcnwsssnlla*vctil*y*ikrst ngt*pvt **hqrkp*nvvmkiplv*f--- Homology vs CSM-cDNA Score E ...

  4. 40 CFR 230.5 - General procedures to be followed.

    2010-07-01

    ... components which characterize the non-living environment of the candidate site, the substrate and the water... 40 Protection of Environment 24 2010-07-01 2010-07-01 false General procedures to be followed. 230.5 Section 230.5 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) OCEAN...

  5. 36 CFR 230.4 - State program administration.

    2010-07-01

    ...) State Foresters may use existing resource inventories, landowner surveys, and other relevant planning... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false State program administration. 230.4 Section 230.4 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF...

  6. Determination of specific activity of 230Th in uranium ore samples

    2000-01-01

    A new method suitable for determining specific activity of 230Th in uranium ore samples is built. The method is characterized by adding the 230Th/ 232Th standard dilution agent with lower activity ratio (Its 230Th/ 232Th activity ratio and 230Th have been known) to the samples and using isotopic dilution analysis. The method can be applied to analyses of 230Th specific activity in various 230Th/ 232Th activity ratio samples. The precision can also be improved.

  7. 49 CFR 230.30 - Lap-joint seam boilers.

    2010-10-01

    ..., DEPARTMENT OF TRANSPORTATION STEAM LOCOMOTIVE INSPECTION AND MAINTENANCE STANDARDS Boilers and Appurtenances Inspection and Repair § 230.30 Lap-joint seam boilers. Every boiler having lap-joint longitudinal...

  8. 49 CFR 230.51 - Number and location.

    2010-10-01

    ..., DEPARTMENT OF TRANSPORTATION STEAM LOCOMOTIVE INSPECTION AND MAINTENANCE STANDARDS Boilers and Appurtenances Water Glasses and Gauge Cocks § 230.51 Number and location. Every boiler shall be equipped with at...

  9. 49 CFR 230.42 - Location of gauges.

    2010-10-01

    ..., DEPARTMENT OF TRANSPORTATION STEAM LOCOMOTIVE INSPECTION AND MAINTENANCE STANDARDS Boilers and Appurtenances Steam Gauges § 230.42 Location of gauges. Every boiler shall have at least one steam gauge which...

  10. 49 CFR 230.44 - Time of testing.

    2010-10-01

    ..., DEPARTMENT OF TRANSPORTATION STEAM LOCOMOTIVE INSPECTION AND MAINTENANCE STANDARDS Boilers and Appurtenances Steam Gauges § 230.44 Time of testing. Steam gauges shall be tested prior to being installed or...

  11. 23 CFR 230.113 - Implementation of supportive services.

    2010-04-01

    ... 230.113 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION CIVIL RIGHTS EXTERNAL PROGRAMS Equal Employment Opportunity on Federal and Federal-Aid Construction Contracts (Including... construction contractors, subcontractors, and trainees, for recruiting, counseling, remedial...

  12. 40 CFR 230.45 - Riffle and pool complexes.

    2010-07-01

    ... 404(b)(1) GUIDELINES FOR SPECIFICATION OF DISPOSAL SITES FOR DREDGED OR FILL MATERIAL Potential Impacts on Special Aquatic Sites § 230.45 Riffle and pool complexes. (a) Steep gradient sections...

  13. 40 CFR 230.21 - Suspended particulates/turbidity.

    2010-07-01

    ... SECTION 404(b)(1) GUIDELINES FOR SPECIFICATION OF DISPOSAL SITES FOR DREDGED OR FILL MATERIAL Potential Impacts on Physical and Chemical Characteristics of the Aquatic Ecosystem § 230.21 Suspended...

  14. 40 CFR 230.40 - Sanctuaries and refuges.

    2010-07-01

    ... 404(b)(1) GUIDELINES FOR SPECIFICATION OF DISPOSAL SITES FOR DREDGED OR FILL MATERIAL Potential Impacts on Special Aquatic Sites § 230.40 Sanctuaries and refuges. (a) Sanctuaries and refuges consist...

  15. 46 CFR 172.230 - Character of damage.

    2010-10-01

    ... PERTAINING TO BULK CARGOES Special Rules Pertaining to Great Lakes Dry Bulk Cargo Vessels § 172.230 Character... transverse watertight bulkhead spaced closer than the longitudinal extent of collision penetration...

  16. Schweizer Gesetze das Wesentliche der Schweizer Gesetzgebung in 230 Gesetztexten

    Suisse

    1999-01-01

    Ce CD-Rom contient 230 textes représentant les plus importantes lois et ordonnances du Recueil systématique fédéral (RS) : Constitution fédérale, Code civil, Code des obligations, Code pénal ...

  17. 49 CFR 230.31 - Flues to be removed.

    2010-10-01

    ... inspecting the entire interior of the boiler and its bracing. After removing the flues, the steam locomotive..., DEPARTMENT OF TRANSPORTATION STEAM LOCOMOTIVE INSPECTION AND MAINTENANCE STANDARDS Boilers and Appurtenances Inspection and Repair § 230.31 Flues to be removed. (a) Inspection of the boiler interior. During the...

  18. 49 CFR 230.64 - Leaks under lagging.

    2010-10-01

    ..., DEPARTMENT OF TRANSPORTATION STEAM LOCOMOTIVE INSPECTION AND MAINTENANCE STANDARDS Boilers and Appurtenances Steam Leaks § 230.64 Leaks under lagging. The steam locomotive owner and/or operator shall take out of service at once any boiler that has developed a leak under the lagging due to a crack in the shell, or...

  19. 49 CFR 230.45 - Method of testing.

    2010-10-01

    ..., DEPARTMENT OF TRANSPORTATION STEAM LOCOMOTIVE INSPECTION AND MAINTENANCE STANDARDS Boilers and Appurtenances Steam Gauges § 230.45 Method of testing. Steam gauges shall be compared with an accurate test gauge or dead weight tester. While under test load at the MAWP of the boiler to which the gauge will be...

  20. 50 CFR 230.6 - Quotas and other restrictions.

    2010-10-01

    ... ADMINISTRATION, DEPARTMENT OF COMMERCE WHALING WHALING PROVISIONS § 230.6 Quotas and other restrictions. (a) Quotas for aboriginal subsistence whaling shall be set in accordance with the regulations of the Commission. Quotas shall be allocated to each whaling village or captain by the appropriate Native...

  1. 17 CFR 230.405 - Definitions of terms.

    2010-04-01

    ...: For Federal Register citations affecting § 230.405, see the List of CFR Sections Affected, which... to or purchase such a security; or any such warrant or right; or any put, call, straddle, or other..., or the average of the bid and asked prices of common equity, in the principal market for the...

  2. Dicty_cDB: VFM230 [Dicty_cDB

    Full Text Available VF (Link to library) VFM230 (Link to dictyBase) - - - Contig-U12300-1 - (Link to Original site) ... ( DV435461 ) NADD187TR Aedes aegypti infected with Dengue ... viru... 50 0.100 1 dna update 2009. 3.30 Homology ...

  3. Production of U-230/Th-226 for targeted alpha therapy

    Morgenstern, A.; Abbas, K.; Bruchertseifer, F.; Lebeda, Ondřej; Simonelli, F.; Štursa, Jan; Apostolidis, C.

    2007-01-01

    Roč. 34, Suppl. 2 (2007), S260-S260. ISSN 1619-7070. [20th Annual Congress of the European-Association-of- Nuclear - Medicine . 13.10.2007–17.10.2007, Copenhagen] Institutional research plan: CEZ:AV0Z10480505 Keywords : U-230/Th-226 * alpha therapy Subject RIV: BG - Nuclear , Atomic and Molecular Physics, Colliders

  4. 50 CFR 230.1 - Purpose and scope.

    2010-10-01

    ..., DEPARTMENT OF COMMERCE WHALING WHALING PROVISIONS § 230.1 Purpose and scope. The purpose of the regulations in this part is to implement the Whaling Convention Act (16 U.S.C. 916 et seq.) by prohibiting whaling except for aboriginal subsistence whaling allowed by the International Whaling...

  5. 40 CFR 230.30 - Threatened and endangered species.

    2010-07-01

    ... Impacts on Biological Characteristics of the Aquatic Ecosystem § 230.30 Threatened and endangered species. (a) An endangered species is a plant or animal in danger of extinction throughout all or a... the U.S. Fish and Wildlife Service of the Department of the Interior (codified annually at 50 CFR...

  6. 46 CFR 16.230 - Random testing requirements.

    2010-10-01

    ... under the reporting requirements of 46 CFR 16.500 for two consecutive calendar years indicate that the... is 25 percent, and the data received under the reporting requirements of 46 CFR 16.500 for any... 46 Shipping 1 2010-10-01 2010-10-01 false Random testing requirements. 16.230 Section...

  7. 36 CFR 230.21 - Implementation of the program.

    2010-07-01

    ... STATE AND PRIVATE FORESTRY ASSISTANCE Urban and Community Forestry Assistance Program § 230.21 Implementation of the program. (a) The Urban and Community Forestry Assistance Program is implemented through the..., Cooperative Agreements, and Other Agreements Handbook (FSH 1509.11). The Forest Service Manual and...

  8. 24 CFR 235.230 - Condition of multifamily structure.

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Condition of multifamily structure... Involving Condominium Units § 235.230 Condition of multifamily structure. (a) When a family unit is conveyed... principal rating organization doing business in the state. If the property is located in a state which...

  9. 36 CFR 230.9 - Payment to landowners.

    2010-07-01

    ... Section 230.9 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE STATE AND... certification by the Service Representative that a practice has been completed in accordance with specifications... needed to meet the objectives of the landowner forest stewardship plan; or (2) The landowner...

  10. 40 CFR 170.230 - Pesticide safety training for handlers.

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Pesticide safety training for handlers...) PESTICIDE PROGRAMS WORKER PROTECTION STANDARD Standard for Pesticide Handlers § 170.230 Pesticide safety... of restricted-use pesticides under part 171 of this chapter. (2) A handler who satisfies the...

  11. 40 CFR 1065.230 - Raw exhaust flow meter.

    2010-07-01

    ... specifications in Table 1 of § 1065.205. This may involve using an ultrasonic flow meter, a subsonic venturi, an... 40 Protection of Environment 32 2010-07-01 2010-07-01 false Raw exhaust flow meter. 1065.230... flow meter. (a) Application. You may use measured raw exhaust flow, as follows: (1) Use the...

  12. 24 CFR 964.230 - Audit and administrative requirements.

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Audit and administrative... Program § 964.230 Audit and administrative requirements. (a) TOP grant recipients. The HUD Inspector... purpose of audit or other examinations. (1) Grant recipients must comply with the requirements of...

  13. 49 CFR 230.48 - Number and capacity.

    2010-10-01

    ...) Determination of capacity. Safety relief valve capacity may be determined by making an accumulation test with the fire in good, bright condition and all steam outlets closed. Additional safety relief valve... Safety Relief Valves § 230.48 Number and capacity. (a) Number and capacity. Every boiler shall...

  14. 49 CFR 230.49 - Setting of safety relief valves.

    2010-10-01

    ... safety relief valve shall be set to open at a pressure not exceeding the MAWP. Safety relief valves shall... glass. (d) Labeling of lowest set pressure. The set pressure of the lowest safety relief valve shall be... 49 Transportation 4 2010-10-01 2010-10-01 false Setting of safety relief valves. 230.49...

  15. 40 CFR 230.50 - Municipal and private water supplies.

    2010-07-01

    ... concentration, in such a way as to reduce the fitness of the water for consumption. Water can be rendered... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Municipal and private water supplies... Potential Effects on Human Use Characteristics § 230.50 Municipal and private water supplies. (a)...

  16. 33 CFR 96.230 - What objectives must a safety management system meet?

    2010-07-01

    ... management system meet? 96.230 Section 96.230 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF... management system meet? The safety management system must: (a) Provide for safe practices in vessel operation... management system....

  17. Construction of recombinant ZNF230/GFP fused plasmids and their expression and cellular localization

    Xu, Wen-Ming; Zhang, Si-Zhong; Qiu, Wei-Min;

    2004-01-01

    cutting, the mutated human and mouse ZNF230(znf230) were inserted into mammalian expression plasmid pEGFP-N1. Thus we constructed the plasmid with fusion gene of ZNF230 and green fluorescent protein(GFP). Then the Cos cell was transfected with the fused gene by liposome. Fluorescence microscopy showed...

  18. 39 CFR 230.3 - Cooperation with the Office of Inspector General.

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Cooperation with the Office of Inspector General. 230.3 Section 230.3 Postal Service UNITED STATES POSTAL SERVICE ORGANIZATION AND ADMINISTRATION OFFICE OF INSPECTOR GENERAL General Policy and Authority § 230.3 Cooperation with the Office of...

  19. 46 CFR 8.230 - Minimum standards for a recognized classification society.

    2010-10-01

    ... society. 8.230 Section 8.230 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY PROCEDURES APPLICABLE TO THE PUBLIC VESSEL INSPECTION ALTERNATIVES Recognition of a Classification Society § 8.230 Minimum standards for a recognized classification society. (a) In order to receive recognition by the Coast Guard...

  20. 49 CFR 230.17 - One thousand four hundred seventy-two (1472) service day inspection.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false One thousand four hundred seventy-two (1472) service day inspection. 230.17 Section 230.17 Transportation Other Regulations Relating to Transportation... MAINTENANCE STANDARDS General General Inspection Requirements § 230.17 One thousand four hundred...

  1. 33 CFR 209.230 - Use of reservoir areas for recreation.

    2010-07-01

    ... in 36 CFR parts 311 to 326. Licenses and leases are granted under the law containing conditions and... recreation. 209.230 Section 209.230 Navigation and Navigable Waters CORPS OF ENGINEERS, DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE ADMINISTRATIVE PROCEDURE § 209.230 Use of reservoir areas for...

  2. 46 CFR 128.230 - Penetrations of hulls and watertight bulkheads-materials and pressure design.

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Penetrations of hulls and watertight bulkheads-materials and pressure design. 128.230 Section 128.230 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OFFSHORE SUPPLY VESSELS MARINE ENGINEERING: EQUIPMENT AND SYSTEMS Materials and Pressure Design § 128.230 Penetrations of hulls...

  3. 36 CFR 230.42 - Cost-share assistance application and payment procedures.

    2010-07-01

    ... application and payment procedures. 230.42 Section 230.42 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE STATE AND PRIVATE FORESTRY ASSISTANCE Forest Land Enhancement Program § 230.42 Cost... time period specified in the State priority plan, not to exceed 12 months. (f) Upon certification...

  4. 28 CFR 2.30 - False information or new criminal conduct: Discovery after release.

    2010-07-01

    ... Prisoners and Parolees § 2.30 False information or new criminal conduct: Discovery after release. If... 28 Judicial Administration 1 2010-07-01 2010-07-01 false False information or new criminal conduct: Discovery after release. 2.30 Section 2.30 Judicial Administration DEPARTMENT OF JUSTICE PAROLE,...

  5. 38 CFR 17.230 - Contingency backup to the Department of Defense.

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Contingency backup to the Department of Defense. 17.230 Section 17.230 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS MEDICAL Sharing of Medical Facilities, Equipment, and Information § 17.230 Contingency backup...

  6. 17 CFR 230.462 - Immediate effectiveness of certain registration statements and post-effective amendments.

    2010-04-01

    .... (e) An automatic shelf registration statement, including an automatic shelf registration statement... certain registration statements and post-effective amendments. 230.462 Section 230.462 Commodity and... Filings; Fees; Effective Date § 230.462 Immediate effectiveness of certain registration statements...

  7. SPRINT RA 230: Methodology for knowledge based developments

    SPRINT RA 230: A Methodology for Knowledge Based Developments, funded by the European Commission, was set up to investigate the use of KBS in the engineering industry. Its aim was to find out low KBS were currently used and what people's conceptions of them was, to disseminate current knowledge and to recommend further research into this area. A survey (by post and face to face interviews) was carried out under SPRINT RA 230 to investigate requirements for more intelligent software. In the survey we looked both at how people think about Knowledge Based Systems (KBS), what they find useful and what is not useful, and what current expertise problems or limitations of conventional software might suggest KBS solutions. (orig./DG)

  8. 49 CFR Appendix D to Part 230 - Civil Penalty Schedule

    2010-10-01

    ... minimum piston travel 1,000 1,500 (b) Excessive piston travel when steam locomotive is stationary 1,000 2..., fastened 1,000 1,500 230.93Pistons and piston rods: (a) Failure to properly inspect, maintain, renew 1,000... prior to welding 1,000 2,000 (c) Bearings and bushings 1,000 1,500 (d) Rod side motion: Excessive...

  9. Dicty_cDB: AFL230 [Dicty_cDB

    Full Text Available im test: 0 Number of HSP's gapped (non-prelim): 0 length of query: 247 length of database: 80,480,566 effective HSP length: 17 effect...ive length of query: 230 effective length of database: 78,821,179 effective search space: 18128871170 effect...h of database: Z,316,359,891 effective HSP length: 22 effective length of query: 225 effective length of database: Y,489,630,911 effe...ctive search space: 9335166954975 effective search space used: 9335166954975 T: 0 A...ive search space used: 18128871170 T: 0 A: 0 X1: 6 (11.9

  10. Shielding measurements for a 230 MeV proton beam

    Energetic secondary neutrons produced as protons interact with accelerator components and patients dominate the radiation shielding environment for proton radiotherapy facilities. Due to the scarcity of data describing neutron production, attenuation, absorbed dose, and dose equivalent values, these parameters were measured for 230 MeV proton bombardment of stopping length Al, Fe, and Pb targets at emission angles of 0 degree, 22 degree, 45 degree, and 90 degree in a thick concrete shield. Low pressure tissue-equivalent proportional counters with volumes ranging from 1 cm3 to 1000 cm3 were used to obtain microdosimetric spectra from which absorbed dose and radiation quality are deduced. Does equivalent values and attenuation lengths determined at depth in the shield were found to vary sharply with angle, but were found to be independent of target material. Neutron dose and radiation length values are compared with Monte Carlo neutron transport calculations performed using the Los Alamos High Energy Transport Code (LAHET). Calculations used 230 MeV protons incident upon an Fe target in a shielding geometry similar to that used in the experiment. LAHET calculations overestimated measured attenuation values at 0 degree, 22 degree, and 45 degree, yet correctly predicted the attenuation length at 90 degree. Comparison of the mean radiation quality estimated with the Monte Carlo calculations with measurements suggest that neutron quality factors should be increased by a factor of 1.4. These results are useful for the shielding design of new facilities as well as for testing neutron production and transport calculations

  11. Corona performance of a compact 230-kV line

    Permitting requirements and the acquisition of new rights-of-way for transmission facilities has in recent years become increasingly difficult for most utilities, including Puget Sound Power and Light Company. In order to maintain a high degree of reliability of service while being responsive to public concerns regarding the siting of high voltage (HV) transmission facilities, Puget Power has found it necessary to more heavily rely upon the use of compact lines in franchise corridors. Compaction does, however, precipitant increased levels of audible noise (AN) and radio and TV interference (RI and TVI) due to corona on the conductors and insulator assemblies. Puget Power relies upon the Bonneville Power Administration (BPA) Corona and Field Effects computer program to calculate AN and RI for new lines. Since there was some question of the program's ability to accurately represent quiet 230-kV compact designs, a joint project was undertaken with BPA to verify the program's algorithms. Long-term measurements made on an operating Puget Power 230-kV compact line confirmed the accuracy of BPA's AN model; however, the RI measurements were much lower than predicted by the BPA computer and other programs. This paper also describes how the BPA computer program can be used to calculate the voltage needed to expose insulator assemblies to the correct electric field in single test setups in HV laboratories

  12. 40 CFR 436.230 - Applicability; description of the magnesite subcategory.

    2010-07-01

    ... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Applicability; description of the magnesite subcategory. 436.230 Section 436.230 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS MINERAL MINING AND PROCESSING POINT SOURCE CATEGORY...

  13. 24 CFR 990.230 - PHAs that will experience a subsidy reduction.

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false PHAs that will experience a subsidy reduction. 990.230 Section 990.230 Housing and Urban Development Regulations Relating to Housing and Urban Development (Continued) OFFICE OF ASSISTANT SECRETARY FOR PUBLIC AND INDIAN HOUSING, DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT THE...

  14. 49 CFR 230.65 - Steam blocking view of engine crew.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Steam blocking view of engine crew. 230.65 Section... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION STEAM LOCOMOTIVE INSPECTION AND MAINTENANCE STANDARDS Boilers and Appurtenances Steam Leaks § 230.65 Steam blocking view of engine crew. The steam locomotive owner...

  15. 17 CFR 230.497 - Filing of investment company prospectuses-number of copies.

    2010-04-01

    ... citations affecting § 230.497, see the List of CFR Sections Affected, which appears in the Finding Aids... copies. (a) Five copies of every form of prospectus sent or given to any person prior to the effective... investment company advertisement under § 230.482 shall be filed under this paragraph (a) (but not as part...

  16. 42 CFR 414.230 - Determining a period of continuous use.

    2010-10-01

    ... 42 Public Health 3 2010-10-01 2010-10-01 false Determining a period of continuous use. 414.230 Section 414.230 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICARE PROGRAM PAYMENT FOR PART B MEDICAL AND OTHER HEALTH SERVICES Payment...

  17. 5 CFR 230.401 - Agency authority to take personnel actions in a national emergency disaster.

    2010-01-01

    ... actions in a national emergency disaster. 230.401 Section 230.401 Administrative Personnel OFFICE OF... personnel actions in a national emergency disaster. (a) Upon an attack on the United States, agencies are... organizations during a period of disaster without regard to any regulation or instruction of OPM, except...

  18. 40 CFR 230.54 - Parks, national and historical monuments, national seashores, wilderness areas, research sites...

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Parks, national and historical monuments, national seashores, wilderness areas, research sites, and similar preserves. 230.54 Section 230.54 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) OCEAN DUMPING SECTION 404(b)(1) GUIDELINES FOR SPECIFICATION OF...

  19. 49 CFR 230.40 - Time and method of staybolt testing.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Time and method of staybolt testing. 230.40... Appurtenances Staybolts § 230.40 Time and method of staybolt testing. (a) Time of hammer testing—(1) General... bearers are removed for any other reason, however, the bolts shall be inspected at that time. (b)...

  20. 46 CFR 122.230 - Report of accident to aid to navigation.

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Report of accident to aid to navigation. 122.230 Section... Marine Casualties and Voyage Records § 122.230 Report of accident to aid to navigation. Whenever a vessel collides with a buoy, or other aid to navigation under the jurisdiction of the Coast Guard, or is...

  1. 46 CFR 185.230 - Report of accident to aid to navigation.

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Report of accident to aid to navigation. 185.230 Section 185.230 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) SMALL PASSENGER VESSELS... aid to navigation. Whenever a vessel collides with a buoy, or other aid to navigation under...

  2. 49 CFR 230.63 - Smoke box, steam pipes and pressure parts.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Smoke box, steam pipes and pressure parts. 230.63... Appurtenances Steam Pipes § 230.63 Smoke box, steam pipes and pressure parts. The smoke box, steam pipes and pressure parts shall be inspected at each annual inspection, or any other time that conditions warrant....

  3. 23 CFR 230.117 - Reimbursement procedures (Federal-aid highway construction projects only).

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Reimbursement procedures (Federal-aid highway construction projects only). 230.117 Section 230.117 Highways FEDERAL HIGHWAY ADMINISTRATION, DEPARTMENT OF... construction projects only). (a) On-the-job special training provisions. State highway agencies will...

  4. 10 CFR 72.230 - Procedures for spent fuel storage cask submittals.

    2010-01-01

    ... 10 Energy 2 2010-01-01 2010-01-01 false Procedures for spent fuel storage cask submittals. 72.230... STORAGE OF SPENT NUCLEAR FUEL, HIGH-LEVEL RADIOACTIVE WASTE, AND REACTOR-RELATED GREATER THAN CLASS C WASTE Approval of Spent Fuel Storage Casks § 72.230 Procedures for spent fuel storage cask...

  5. 30 CFR 285.230 - May I request a lease if there is no Call?

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false May I request a lease if there is no Call? 285.230 Section 285.230 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE... Call? You may submit an unsolicited request for a commercial lease or a limited lease under this...

  6. 17 CFR 230.136 - Definition of certain terms in relation to assessable stock.

    2010-04-01

    ... relation to assessable stock. 230.136 Section 230.136 Commodity and Securities Exchanges SECURITIES AND... certain terms in relation to assessable stock. (a) An offer, offer to sell, or offer for sale of... shall not be deemed to include the offering or sale of assessable stock, at public auction or...

  7. 36 CFR 230.36 - State priority plan-purpose and scope.

    2010-07-01

    ... forest inventory and analysis reports on the forest resources found within the State; (2) A description... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false State priority plan-purpose and scope. 230.36 Section 230.36 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT...

  8. 49 CFR 1544.230 - Fingerprint-based criminal history records checks (CHRC): Flightcrew members.

    2010-10-01

    ... 49 Transportation 9 2010-10-01 2010-10-01 false Fingerprint-based criminal history records checks (CHRC): Flightcrew members. 1544.230 Section 1544.230 Transportation Other Regulations Relating to Transportation (Continued) TRANSPORTATION SECURITY ADMINISTRATION, DEPARTMENT OF HOMELAND SECURITY CIVIL AVIATION SECURITY AIRCRAFT OPERATOR...

  9. 40 CFR 230.61 - Chemical, biological, and physical evaluation and testing.

    2010-07-01

    ... for adverse environmental impact at the proposed disposal site, a comparison of the biological... evaluation and testing. 230.61 Section 230.61 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... environmental effects. If the General Evaluation indicates the presence of a sufficiently large number...

  10. 21 CFR 107.230 - Elements of an infant formula recall.

    2010-04-01

    ... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Elements of an infant formula recall. 107.230... (CONTINUED) FOOD FOR HUMAN CONSUMPTION INFANT FORMULA Infant Formula Recalls § 107.230 Elements of an infant formula recall. A recalling firm shall conduct an infant formula recall with the following elements:...

  11. Dicty_cDB: SLD230 [Dicty_cDB

    Full Text Available alue N ( AU052384 ) Dictyostelium discoideum slug cDNA, clone SLD230. 268 6e-68 2 ( AU052130 ) Dictyostelium discoideum slug... cDNA, clone SLA579. 268 7e-68 2 ( AU033673 ) Dictyostelium discoideum slug cDNA, clone SLB2...96. 268 7e-68 2 ( AU034239 ) Dictyostelium discoideum slug cDNA, clone SLC311. 26...8 7e-68 2 ( AU052966 ) Dictyostelium discoideum slug cDNA, clone SLF396. 268 7e-68 2 ( AU053398 ) Dictyostelium discoideum slug... cDNA, clone SLI557. 268 7e-68 2 ( AU034057 ) Dictyostelium discoideum slug cDNA, clone S

  12. Calculation of 230Th U isochrons, ages, and errors

    Ludwig, K. R.; Titterington, D.M.

    1994-01-01

    If analytical errors are responsible for the scatter of points on a 230Th-234U-238U isochron diagram, the isochron should be fitted by a technique that 1. (1) weights the points according to their analytical errors and error correlations, and 2. (2) either takes into account the presence of some of the same data in two coupled XY isochrons or (equivalently) uses a single, three-dimensional XYZ isochron. A method based on maximum-likelihood estimation is presented that fulfills these requirements, and the relevant equations for errors in age and initial 234U 238U are given. Equations for estimating the necessary isotope-ratio errors and error-correlations for both alpha-spectrometric and mass-spectrometric data are also developed. ?? 1994.

  13. Genome-wide patterns of selection in 230 ancient Eurasians

    Mathieson, Iain; Lazaridis, Iosif; Rohland, Nadin; Mallick, Swapan; Patterson, Nick; Roodenberg, Songül Alpaslan; Harney, Eadaoin; Stewardson, Kristin; Fernandes, Daniel; Novak, Mario; Sirak, Kendra; Gamba, Cristina; Jones, Eppie R.; Llamas, Bastien; Dryomov, Stanislav; Pickrel, Joseph; Arsuaga, Juan Luís; de Castro, José María Bermúdez; Carbonell, Eudald; Gerritsen, Fokke; Khokhlov, Aleksandr; Kuznetsov, Pavel; Lozano, Marina; Meller, Harald; Mochalov, Oleg; Moiseyev, Vayacheslav; Rojo Guerra, Manuel A.; Roodenberg, Jacob; Vergès, Josep Maria; Krause, Johannes; Cooper, Alan; Alt, Kurt W.; Brown, Dorcas; Anthony, David; Lalueza-Fox, Carles; Haak, Wolfgang; Pinhasi, Ron; Reich, David

    2016-01-01

    Ancient DNA makes it possible to directly witness natural selection by analyzing samples from populations before, during and after adaptation events. Here we report the first scan for selection using ancient DNA, capitalizing on the largest genome-wide dataset yet assembled: 230 West Eurasians dating to between 6500 and 1000 BCE, including 163 with newly reported data. The new samples include the first genome-wide data from the Anatolian Neolithic culture whose genetic material we extracted from the DNA-rich petrous bone and who we show were members of the population that was the source of Europe’s first farmers. We also report a complete transect of the steppe region in Samara between 5500 and 1200 BCE that allows us to recognize admixture from at least two external sources into steppe populations during this period. We detect selection at loci associated with diet, pigmentation and immunity, and two independent episodes of selection on height. PMID:26595274

  14. MFTF 230 kV pulsed power substation

    The Mirror Fusion Test Facility (MFTF) currently under construction at the Lawrence Livermore Laboratory includes a Sustaining Neutral Beam Power Supply System (SNBPSS) consisting of 24 power-supply sets. The System will operate in long pulses (initially .5 seconds and eventually 30 seconds) at high power (200 MW), which will necessitate a large source of ac power. To meet this requirement, a new 230-kV substation is also being built at LLL. The constraints of cost, equipment protection, short operating lifetime (10 years), and reliability dictated a unique substation design. Its unusual features include provisions for fast fault detection and tripping, a capability for limiting ground fault current, low impedance, and economical design

  15. 17 CFR 230.166 - Exemption from section 5(c) for certain communications in connection with business combination...

    2010-04-01

    ...) Communications. In a registered offering involving a business combination transaction, any communication made in...) for certain communications in connection with business combination transactions. 230.166 Section 230... in connection with business combination transactions. Preliminary Note: This section is...

  16. 232Th(d,4n)230Pa cross-section measurements at ARRONAX facility for the production of 230U

    Introduction: 226Th (T1/2 = 31 min) is a promising therapeutic radionuclide since results, published in 2009, showed that it induces leukemia cells death and activates apoptosis pathways with higher efficiencies than 213Bi. 226Th can be obtained via the 230U α decay. This study focuses on the 230U production using the 232Th(d,4n)230Pa(β−)230U reaction. Methods: Experimental cross sections for deuteron-induced reactions on 232Th were measured from 30 down to 19 MeV using the stacked-foil technique with beams provided by the ARRONAX cyclotron. After irradiation, all foils (targets as well as monitors) were measured using a high-purity germanium detector. Results: Our new 230Pa cross-section values, as well as those of 232Pa and 233Pa contaminants created during the irradiation, were compared with previous measurements and with results given by the TALYS code. Experimentally, same trends were observed with slight differences in orders of magnitude mainly due to the nuclear data change. Improvements are ongoing about the TALYS code to better reproduce the data for deuteron-induced reactions on 232Th. Conclusions: Using our cross-section data points from the 232Th(d,4n)230Pa reaction, we have calculated the thick-target yield of 230U, in Bq/μA·h. This value allows now to a full comparison between the different production routes, showing that the proton routes must be preferred

  17. 29 CFR 553.230 - Maximum hours standards for work periods of 7 to 28 days-section 7(k).

    2010-07-01

    ...-section 7(k). 553.230 Section 553.230 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR... Compensation Rules § 553.230 Maximum hours standards for work periods of 7 to 28 days—section 7(k). (a) For... 28 consecutive days, no overtime compensation is required under section 7(k) until the number...

  18. 17 CFR 230.506 - Exemption for limited offers and sales without regard to dollar amount of offering.

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Exemption for limited offers and sales without regard to dollar amount of offering. 230.506 Section 230.506 Commodity and... Securities Act of 1933 § 230.506 Exemption for limited offers and sales without regard to dollar amount...

  19. 17 CFR 230.139 - Publications or distributions of research reports by brokers or dealers distributing securities.

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Publications or distributions of research reports by brokers or dealers distributing securities. 230.139 Section 230.139 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION GENERAL RULES AND REGULATIONS, SECURITIES ACT OF 1933 General § 230.139 Publications...

  20. 77 FR 38838 - Compliance Policy Guide Sec. 230.110-Registration of Blood Banks, Other Firms Collecting...

    2012-06-29

    ... HUMAN SERVICES Food and Drug Administration Compliance Policy Guide Sec. 230.110--Registration of Blood... Administration (FDA) is announcing the withdrawal of the compliance policy guide (CPG) entitled ``Sec. 230.110.... FOR FURTHER INFORMATION CONTACT: Robert L. Hummel, Division of Compliance Policy (HFC-230), Food...

  1. Remeasurement of thorium-230 in the pore water of Lacnor tailings

    A resampling of the Lacnor tailings management area was undertaken under a comprehensive quality assurance programme to establish levels of thorium 230 in pore water. A quality assurance programme was established for field sampling, sample handling and transport, and laboratory procedures and reporting. The external audit was used to evaluate analytical bias (on synthetic and field samples) and precision (by comparison of duplicate-duplicate results). Accuracy was assessed using synthetic samples. The external audit indicates that thorium 230 measurements by the main laboratory are not significantly different from the interlaboratory average within standard statistical limits. The results of the audit are based on measurement of environmental samples and known synthetic samples. This shows that present and previous measurements of thorium 230 varying from 0,1 to 150 Bq/L are valid data. A qualitative interpretation of the controls on thorium 230 geochemistry is provided in terms of control by thorium 232 and thorium dioxide(c) solid phase. Generic dose estimates for consumption of water containing thorium 230 are made but require refinement ot account for the actual pH of the drinking water and the degree of dilution of the pore water. The results of this project indicate that the performance of the laboratory that will conduct future thorium 230 measurements can be assessed satisfactorily with a smaller scale external laboratory assurance programme. The programme should include replicate samples sent to each laboratory and interlaboratory comparison on samples having high and low values of thorium 230

  2. Sedimentation rates and age modeling of Late Quaternary marine sediments with unsupported 230Th

    230Th is a radionuclide of the 238U decay series, characterized by natural abundance in sediments and a half-life of 75,380 years, suitable for direct evaluation of sedimentation rates and sediment ages in a time scale of 700,000 years before the present. 230Th cycle creates a contrast between supported and unsupported 230Th in the sedimentary matrix due to the different geochemical behaviors of 230Th and its parent, 234U. This study aimed at establishing and validating a mathematical model that evaluates sedimentation rates and age modeling based on 230Th data retrieved from a sediment core sampled in the southeastern Brazilian continental margin. The validation of the age modeling of this method was made through a statistical comparison between its results and those of benthic foraminifera δ 18O record technique, widely used for sediment dating and determination of sedimentation rates. It was observed that the model of unsupported 230Th was successful in determining Late Quaternary sedimentation rates and ages in a confidence level of 95 %. It was possible to determine several breaking points in unsupported 230Th vertical profile, and it was shown that those divides correspond to some major intervals between glacial and interglacial periods when compared with the benthic foraminifera record. (author)

  3. 基于TCS230便携式颜色测量系统设计%Design of Portable Color Measurement System Based on TCS230

    季峰

    2015-01-01

    介绍了TCS230可编程颜色测量芯片的工作原理。基于TCS230的工作原理,以89c51单片机为控制单元,设计出便携式颜色测量系统。系统采用24c02存储器存放TCS230的白平衡调整因子,避免了每次开机时的白平衡调试,颜色测量结果通过LCD1602显示。所设计的系统具有使用元器件少、体积小、成本低等优点。%The working principle of TCS230 programmable color measuring chip is introduced.Based on the working principle,a design of portable color measurement system is proposed by using 89c51 single-chip mi-crocomputer as control unit.The system uses the 24c02 memory to store the white balance adjustment factor of TCS230,which avoids the white balance adjustment when the system starts every time.And the measured results are displayed by LCD1602.The designed system has the advantages of less components,smal size and low cost.

  4. Mechanisms of TL for production of the 230 {sup o}C peak in natural sodalite

    Cano, Nilo F., E-mail: nilocano@dfn.if.usp.b [Institute of Physics, University of Sao Paulo, Rua do Matao, Travessa R, 187, CEP 05508-090, Sao Paulo (Brazil); Professional School of Physics, University of San Agustin of Arequipa, Av. Independencia S/N, Arequipa (Peru); Blak, Ana R. [Institute of Physics, University of Sao Paulo, Rua do Matao, Travessa R, 187, CEP 05508-090, Sao Paulo (Brazil); Ayala-Arenas, Jorge S. [Professional School of Physics, University of San Agustin of Arequipa, Av. Independencia S/N, Arequipa (Peru); Watanabe, Shigueo [Institute of Physics, University of Sao Paulo, Rua do Matao, Travessa R, 187, CEP 05508-090, Sao Paulo (Brazil)

    2011-02-15

    The thermoluminescence (TL) peak in natural sodalite near 230 {sup o}C, which appears only after submitted to thermal treatments and to gamma irradiation, has been studied in parallel with electron paramagnetic resonance (EPR) spectrum appearing under the same procedure. This study revealed a full correlation between the 230 {sup o}C TL peak and the eleven hyperfine lines from EPR spectrum. In both case, the centers disappear at the same temperature and are restored after gamma irradiation. A complete model for the 230 {sup o}C TL peak is presented and discussed. In addition to the correlation and TL model, specific characteristics of the TL peaks are described.

  5. Separation of 230Th (ionium) from uranium ores sulfuric acid and in nitric acid solutions

    230Th (ionium) is of interest for production of 231Pa, the Pa isotope with the longest half life, and for production of 232U which can be used in radionuclide batteries. Two procedures are presented which have been worked out for separation of 230Th from sulfuric acid and from nitric acid solutions. In the first case the effluents from the anion exchange resins are the starting material for recorvery of 230Th, in the second case the cation exchange resins which are for purification of U. The procedures selected are simple, economic and can be performed in any uranium mill or uranium purification plant without additional investments. (orig.)

  6. Search for β-delayed fission of the heavy neutron-rich isotope 230Ac

    The 230Ra has been produced via multinucleon transfer reaction and dissipative fragmentation by 60 MeV/u 18O ion irradiation of 232Th targets. The radium was radiochemically separated from the mixture of thorium and reaction products. Thin Ra sources were prepared and exposed to the mica fission track detectors, and measured by a HPGe gamma detector. It is likely that the β-delayed fission of 230Ac was observed for the first time and the β-delayed fission probability of 230Ac was tentatively found to be (1.19±0.40) x 10-8. (orig.)

  7. Search for {beta}-delayed fission of the heavy neutron-rich isotope {sup 230}Ac

    Shuanggui Yuan; Weifan Yang; Yanbing Xu; Qiangyan Pan; Bing Xiong; Jianjun He; Dong Wang; Yingjun Li; Taotao Ma; Zhenguo Yang [Academia Sinica, Lanzhou, GS (China). Inst. of Modern Physics

    2001-01-01

    The {sup 230}Ra has been produced via multinucleon transfer reaction and dissipative fragmentation by 60 MeV/u {sup 18}O ion irradiation of {sup 232}Th targets. The radium was radiochemically separated from the mixture of thorium and reaction products. Thin Ra sources were prepared and exposed to the mica fission track detectors, and measured by a HPGe gamma detector. It is likely that the {beta}-delayed fission of {sup 230}Ac was observed for the first time and the {beta}-delayed fission probability of {sup 230}Ac was tentatively found to be (1.19{+-}0.40) x 10{sup -8}. (orig.)

  8. Therapeutic Effect of 131I for 230 Patients with Hyperthyroidism

    To evaluate the therapeutic effect of 131I in treatment of patients with hyperthyroidism and analysis the factors that influence the effect, 230 cases of hyperthyroidism were treated with 131I, and were followed-up at 1.5, 3, 6, 12 months and even longer time after 131I radiotherapy. The serum levels of FT3, FT4 and TSH were detected in all cases. The results showed that 181 patients were cured (78.6%), 22 patients were improved (9.5%), 23 cases developed early hypothyroidism(10.0%),and 4 cases developed later hypothyroidism. 12 cases in 27 patients with hypothyroidism treated with thyroxin were recovered, but the other 15 cases need to be given permanent treatment. The factors which influence 131I radiotherapeutic effect include the patient age, course of disease,application of ATD, size and quality of thyroid, and the level of thyroid hormone. The patients should be followed up to prevent occurrence of hypothyroidism. The early hypothyroidism should be treated in order to decrease the permanent hypothyroidism rate. (authors)

  9. Relationship between ISO 230-2/-6 Test Results and Positioning Accuracy of Machine Tools Using LaserTRACER

    Hau-Wei Lee; Jr-Rung Chen; Shan-Peng Pan; Hua-Chung Liou; Po-Er Hsu

    2016-01-01

    To test the positioning accuracy and repeatability of the linear axes of machine tools, ISO (International Standards Organization) 230-2 and ISO 230-6 are usually adopted. Auto-tracking laser interferometers (ATLI) can perform the testing for the positioning accuracy and the repeatability including x-, y- and z-axes according to ISO 230-2 as well as xy, xz, yz, and xyz diagonal lines following ISO 230-6. LaserTRACER is a kind of ATLI. One of the steps of the ISO 230-2 and -6 tests using Laser...

  10. 238U-230Th-226Ra radioactive disequilibria in the products from 1707 eruption of Fuji volcano, Japan

    Time scale of magmatic processes in the 1707 eruptive activity of Fuji volcano, Japan, was estimated by the 238U-230Th-226Ra disequilibria observed in the 1707 volcanic products. The activity ratios of 226Ra/230Th in the products were larger than unity, being enriched in 226Ra relative to 230Th. The decay-corrected 226Ra/230Th activity ratio to the time of the eruption versus 238U/230Th activity ratio diagram for the 1707 volcanic products showed a positive correlation, suggesting that the 238U/230Th-226Ra disequilibria occurred during the magma genesis of Fuji volcano. The 230Th-226Ra disequilibria in the 1707 volcanic products suggested that the time scale from the magma genesis to the eruption, including the melting of the mantle wedge, magma storage and magmatic differentiation from basalt to andesite, was less than 8000 years. (author)

  11. 34 CFR 230.1 - What is the Troops-to-Teacher program?

    2010-07-01

    ... SECONDARY EDUCATION, DEPARTMENT OF EDUCATION INNOVATION FOR TEACHER QUALITY Troops-to-Teachers Program § 230... lieu of a stipend, DANTES may pay a bonus of $10,000 to a participant who agrees to teach in a...

  12. 17 CFR 230.236 - Exemption of shares offered in connection with certain transactions.

    2010-04-01

    ... stock dividend, stock split, reverse stock split, conversion, merger or similar transaction, shall be... Exemptions § 230.236 Exemption of shares offered in connection with certain transactions. Shares of stock...

  13. Seismic upgrading of WWER 440-230 structures, units 1/2, Kozloduy NPP

    The purpose of this paper is to present final results from a big amount of computational work in connection with the investigations of the possibilities for upgrading of WWER 440-230 structures, units 1/2, Kozloduy NPP. (author)

  14. Incipient corrosion behavior of Haynes 230 under a controlled reducing atmosphere at high temperatures

    Tung, Hsiao-Ming; Stubbins, James F.

    2012-08-01

    In situ thermogravimetry analysis (TGA) was used to investigate the incipient corrosion behavior of alloy 230 exposed under a reducing environment in a temperature range of 850-1000 °C. Both oxidation and loss of alloying elements of alloy 230 were observed to occur concurrently in these conditions. The surface oxide which formed on the substrate does not appear to be as effective in providing a protective layer during the incipient corrosion period.

  15. Automatic Color Sorting Machine Using TCS230 Color Sensor And PIC Microcontroller

    Kunhimohammed C K; Muhammed Saifudeen K K; Sahna S; Gokul M S; Shaeez Usman Abdulla

    2015-01-01

    Sorting of products is a very difficult industrial process. Continuous manual sorting creates consistency issues. This paper describes a working prototype designed for automatic sorting of objects based on the color. TCS230 sensor was used to detect the color of the product and the PIC16F628A microcontroller was used to control the overall process. The identification of the color is based on the frequency analysis of the output of TCS230 sensor. Two conveyor belts were used, each ...

  16. Performance analysis of WWER-440/230 nuclear power plants

    This report examines one particular design, the WWER-440/230, the first generation of commercial WWERs, essentially comparable to the western PWR. This design was installed widely in eastern Europe with a total of 16 unites being completed in what are now Armenia, Bulgaria, Germany (the former German Democratic Republic) the Slovak Republic and Russia. The plants in Armenia and Germany (the former German Democratic Republic) have been closed down, but particularly in Bulgaria and to a lesser extent the Slovak Republic the remaining plants supply a significant proportion of the electricity of the country and decisions to close them could not be taken lightly. The aim of this report is twofold: first to determine whether the impression given by these good overall performance indicators is confirmed using more detailed indicators covering a wide range of factors; second, to see to what extent good performance can be attributed to the industrial and institutional environment in which these plants were designed, built and operated. Particular attention is paid to identifying factors that may impact the quality of the service provided, especially those factors under management control which can be strongly influenced by current and future policy changes and those factors that are beyond the plant management control but could have influenced the performance of the power plants. Issues concerning the safety of these plants are of considerable importance, but they remain outside the scope of this report. Conclusions and recommendations formulated by the IAEA related to WWER safety are contained in the series of reports prepared in the framework of the Extrabudgetary Programme on WWER Safety. A programme progress report was published in 1994 (IAEA-TECDOC-773). Refs, figs, tabs

  17. Treatment of sarcoids in equids: 230 cases (2008-2013).

    Haspeslagh, Maarten; Vlaminck, Lieven E M; Martens, Ann M

    2016-08-01

    OBJECTIVE To evaluate outcomes following treatment of sarcoids in equids and to identify risk factors for treatment failure in these patients. DESIGN Retrospective case series. ANIMALS 230 equids with 614 sarcoids. PROCEDURES Records were searched to identify equids treated for ≥ 1 sarcoid between 2008 and 2013. A standardized protocol was used to determine treatment choice (electrosurgery, electrosurgery with intralesional placement of cisplatin-containing beads, topical administration of imiquimod or acyclovir, cryosurgery, bacillus Calmette-Guerin vaccine injection, or intralesional injection of platinum-containing drugs). Data regarding animal, tumor, treatment, and outcome variables were collected. Complete tumor regression without recurrence for ≥ 6 months was considered a successful outcome. Success rates were calculated; binary logistic regression analysis was used to identify risk factors for treatment failure and to compare effects of the 2 topical treatments. A χ(2) test was used to compare effects of the number of Bacillus Calmette-Guerin vaccine or cisplatin-containing drug injections on outcome. RESULTS The overall success rate was 460 of 614 (74.9%). Electrosurgical excision resulted in the highest treatment success rate (277/319 [86.8%]); odds of treatment failure were significantly greater for intralesional injection of platinum-containing drugs, cryosurgery, and topical acyclovir treatment. Odds of treatment failure were also significantly greater for sarcoids on equids with multiple tumors than for solitary lesions, and significantly lower for sarcoids on equids that received concurrent immunostimulating treatment for another sarcoid than for those on patients that did not receive such treatment. CONCLUSIONS AND CLINICAL RELEVANCE Selection bias for treatments was inherent to the study design; however, results may assist clinicians in selecting treatments and in determining prognosis for equids with sarcoids treated according to the

  18. Two types of adakites revealed by 238U-230Th disequilibrium from Daisen volcano, southwestern Japan

    Daisen volcano is located on the Quaternary volcanic front in southwestern Japan. The volcano is composed mainly of andesite and dacite, which chemically resemble adakites, with high Al2O3 and Sr/Y, steep REE patterns, and no negative Eu anomaly. (238U/230Th) disequilibrium (herein, a ratio in parentheses denotes the activity ratio) and trace element analyses of adakites from two volcanic domes, Karasugasen and Misen, indicate two adakite types. Adakite from Karasugasen is characterized by excess (230Th) over (238U), typical of most adakites, whereas adakite from Misen is characterized by excess (238U) over (230Th). The latter is consistent with enrichment in fluid-mobile elements relative to fluid immobile elements compared to rocks from Karasugasen. The values of (230Th/232Th) of adakites from Karasugasen and Misen are, respectively, around 0.75 and 0.81. These low (230Th/232Th) ratios result from the incorporation of subducted sedimentary material. The ratios, nevertheless, are higher than that for the estimate of lower crustal material suggesting significant incorporation of lower crust is unlikely. As adakites from Misen have (238U) excess over (230Th), adakite magma must have interacted with wedge mantle metasomatized by a slab-derived fluid, confirming the presence of a fluid-metasomatized mantle beneath Daisen volcano. (author)

  19. Cross sections of the reaction Pa-231(d,3n)U-230 for the production of U-230/Th-226 for targeted alpha therapy

    Morgenstern, A.; Lebeda, Ondřej; Štursa, Jan; Capote, R.; Sin, M.; Bruchertseifer, F.; Zielinska, B.; Apostolidis, C.

    2009-01-01

    Roč. 80, č. 5 (2009), 054612/1-054612/6. ISSN 0556-2813 Institutional research plan: CEZ:AV0Z10480505 Keywords : Pa-231 * U-230 * Th-226 * reaction cross section * targeted alpha therapy Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 3.477, year: 2009

  20. 232Th(d,4n)230Pa cross-section measurements at ARRONAX facility

    Full text of publication follows. The ARRONAX cyclotron [Ref.1], acronym for 'Accelerator for Research in Radiochemistry and Oncology at Nantes Atlantique' is a new facility installed in Nantes, France. A dedicated program has been launched on production of innovative radionuclides for PET imaging and for β- and α- targeted radiotherapy using proton or α particle. Since the accelerator is also able to deliver deuteron beams up to 35 MeV, we have reconsidered the possibility to use them to produce medical isotopes. In this study, we have focused on cross section measurements using the stacked-foil technique [Ref. 2] of one isotope dedicated to alpha radio-immunotherapy (α RIT) [Ref.3], 226Th which can be produced through different routes. It's of great interest since it has been found to be a more potent alpha particle emitter for leukemia therapies than Bi213 [Ref.4]. Indeed, the 226Th decay produced a cascade of four α particles with a cumulated energy of 27.7 MeV. An additional interest is the possible use of a radionuclide generator system 230U/226Th. 230U could be produced directly via 231Pa(p, 2n)230U, and indirectly via 230Pa using proton or deuteron beams through 232Th(p, 3n)230Pa → 230U, 232Th(d, 4n)230Pa → 230U. Twelve data sets are published concerning the 230Pa cross section induced by proton [Ref 5], only one by deuteron [Ref.6]. As sometimes deuteron induced reaction gives higher cross section values, it seems interesting to focus our study on their use as projectile on 232Th target to produce 230Pa. Contaminants created during irradiation are also measured since a good optimization of the process is supposed to find the best compromise between production yield and purity of the final product. Our new sets of data are compared with the existing data [Refs.5,6] on other existing production routes and with results given by TALYS code calculations [Ref.7]. References: 1] F. Haddad and al., Eur. J. Med. Mol. Imaging (2008) 35

  1. In-beam spectroscopy of the Kπ = 0- bands in 230-236U

    The Kπ = 0- bands in even uranium nuclei were studied in the compound reactions 231Pa(p,2n)230U, 230,232Th(α,2n)232,234U and 236U(d,pn)236U. In-beam γ-rays were measured in coincidence with conversion-electrons, which were detected with an iron-free orange spectrometer. The negative-parity levels are observed up to intermediate spins (I-). In addition, the 1- and 3- levels in 230U were confirmed by a decay study with an isotope separated 230Pa source. For the heavier isotopes (A > or approx. 232) the properties of the Kπ = 0- bands (energies and γ-branchings) are consistent with a vibrational character of these bands. For 230U the Kπ = 0- band lies at rather low energy (E(1-) = 367 keV), and the level spacings within this band are very similar to those of the isotones 228Th and 226Ra, which might indicate the onset of a stable octupole deformation. (orig.)

  2. 230Th/U-dating of a late Holocene low uranium speleothem from Cuba

    We present 22 U-series ages for a stalagmite from north-western Cuba based on multi-collector inductively coupled plasma mass spectrometry (MC-ICPMS) and thermal ionisation mass spectrometry (TIMS). Our results reveal that the stalagmite continuously grew within the last ∼1400a. Low uranium content of the sample and thus, extremely low 230Th concentrations limit the precision and accuracy of 230Th/U-dating by TIMS. Samples measured by MC-ICPMS show a high variability of 232Th content along the growth axis with some sections significantly affected by initial 230Th from a detrital phase. An a-priori bulk earth ratio for (238U/232Th) cannot be used to accurately account for this initial 230Th. Using an age model based on the 230Th/U ages determined on samples with low or negligible 232Th concentration, we find that the (238U/232Th) activity ratio of the detrital phase is an order of magnitude larger than the bulk earth value, indicating the importance of an accurately determined correction factor.

  3. Dissolution behaviour of 238U, 234U and 230Th deposited on filters from personal dosemeters

    Kinetics of dissolution of 238U, 234U and 230Th dust deposited on filters from personal alpha dosemeters was studied by means of a 26-d in vitro dissolution test with a serum ultra-filtrate simulant. Dosemeters had been used by miners at the uranium mine 'Dolni Rozinka' at Rozna, Czech Republic. The sampling flow-rate as declared by the producer is 4 l h-1 and the sampling period is typically 1 month. Studied filters contained 125 ± 6 mBq 238U in equilibrium with 234U and 230Th; no 232Th series nuclides were found. Half-time of rapid dissolution of 1.4 d for 238U and 234U and slow dissolution half-times of 173 and 116 d were found for 238U and 234U, respectively. No detectable dissolution of 230Th was found. (authors)

  4. SLUDGE PARTICLE SEPAPATION EFFICIENCIES DURING SETTLER TANK RETRIEVAL INTO SCS-CON-230

    DEARING JI; EPSTEIN M; PLYS MG

    2009-07-16

    The purpose of this document is to release, into the Hanford Document Control System, FA1/0991, Sludge Particle Separation Efficiencies for the Rectangular SCS-CON-230 Container, by M. Epstein and M. G. Plys, Fauske & Associates, LLC, June 2009. The Sludge Treatment Project (STP) will retrieve sludge from the 105-K West Integrated Water Treatment System (IWTS) Settler Tanks and transfer it to container SCS-CON-230 using the Settler Tank Retrieval System (STRS). The sludge will enter the container through two distributors. The container will have a filtration system that is designed to minimize the overflow of sludge fines from the container to the basin. FAI/09-91 was performed to quantify the effect of the STRS on sludge distribution inside of and overflow out of SCS-CON-230. Selected results of the analysis and a system description are discussed. The principal result of the analysis is that the STRS filtration system reduces the overflow of sludge from SCS-CON-230 to the basin by roughly a factor of 10. Some turbidity can be expected in the center bay where the container is located. The exact amount of overflow and subsequent turbidity is dependent on the density of the sludge (which will vary with location in the Settler Tanks) and the thermal gradient between the SCS-CON-230 and the basin. Attachment A presents the full analytical results. These results are applicable specifically to SCS-CON-230 and the STRS filtration system's expected operating duty cycles.

  5. Procurement and Initial Characterization of Alloy 230 and CMS Alloy 617

    Material for initial testing of alloy 230 and a controlled-chemistry variant of alloy 617 has been procured in the form of plates. 3/4-inch thick alloy 230 plate was commercially procured from Haynes International, and 2-inch thick CCA 617, an existing controlled-chemistry variant of alloy 617, was obtained from Alstom Power through the ultra-supercritical fossil energy program. This report describes the procurement of these plates and their characteristics in terms of vendor-supplied chemistry and mechanical properties. Further detailed characterization tests are planned for this fiscal year, and this report will be updated in September 2006 to include the results of these tests

  6. Vectorization of diffusion code VENTURE using CRAY-1 and FACOM 230-75 APU

    Three-dimensional neutron-diffusion code VENTURE has been vectorized to run on the vector processors, CRAY-1 and FACOM 230-75 APU (Array Processor Unit). Vector processing effect is observed as the CPU time reduction of about 50% to the scalar processing case for CRAY-1, and about 70% for FACOM 230-75 APU. The whole process of converting the code from scalar-oriented programming to vector-oriented one is described in some detail with emphasizing the importance of changing the code structure. (author)

  7. Alat Pemisah Benda Berdasarkan Warna Menggunakan Sensor TCS230 Berbasis Mikrokontroler AT89S51.

    Victor Chandra S

    2011-01-01

    Was design an instrumental for differentiate and then separate an object. Separation was done by the color. To differentiated the color was used a TCS230 color sensor. The TCS230 color sensor output is a frequency. Frequency of this sensor was get from reflected light by the object. To reflect the light was use a white LED (Light Emitting Diode), without other light source. A good frequency output was get by positioning the object right in front of the sensor with range 1 milimeter. To get a ...

  8. First 230 GHz VLBI Fringes on 3C 279 using the APEX Telescope

    J. Wagner; Roy, A L; Krichbaum, T. P.; Alef, W.; Bansod, A.; Bertarini, A.; Güsten, R.; Graham, D.; HODGSON, J; Märtens, R.; Menten, K.; Muders, D.; Rottmann, H.; TUCCARI, G.; Weiss, A

    2015-01-01

    We report about a 230 GHz very long baseline interferometry (VLBI) fringe finder observation of blazar 3C 279 with the APEX telescope in Chile, the phased submillimeter array (SMA), and the SMT of the Arizona Radio Observatory (ARO). We installed VLBI equipment and measured the APEX station position to 1 cm accuracy (1 sigma). We then observed 3C 279 on 2012 May 7 in a 5 hour 230 GHz VLBI track with baseline lengths of 2800 M$\\lambda$ to 7200 M$\\lambda$ and a finest fringe spacing of 28.6 mic...

  9. Leaching of radionuclides from uranium ore and mill tailings ( Ra- 226, Tn-230).

    Landa, E.R.

    1982-01-01

    The major part of the extractable uranium is associated with a readily acid-soluble fraction in both ore and tailings. The major part of the extractable 226Ra was associated with an iron, manganese hydrous-oxide fraction in the ore and tailings. Thorium-230 was the least leachable of the radionuclides studied. The major portion of the extractable 230Th was associated with alkaline-earth sulphate precipitates, organic matter, or both. The specific effects of milling on each of the nuclides are discussed.-Author

  10. Safety and upgrading of nuclear power plants with WWER-440/V-230

    Modernization of WWER-440/V-230 reactors is considered according to the WANO project 'Proposal for reconstruction of WWER-440/V-230 reactors' (1990). The main technical measures to be taken relate to: 1. Expanding the considered spectrum of design basis accidents; 2. Provision of first loop integrity; 3. Safety system structure and components reliability enhancement; 4. Reduction o initiating events probability; 5. Enhancement of hermeticity and integrity of the area surrounding the first loop; 6. Fire fighting system upgrade; 7. Radiation control system upgrade; 8. Provision of seismic resistance. Details of the recommended technical steps for some NPPs are presented. 1 tab

  11. 77 FR 514 - Notice of Availability of the Record of Decision for the North Steens 230 Kilovolt Transmission...

    2012-01-05

    ... Project was published in the Federal Register on October 21, 2011 (76 FR 65509). Because this decision is... Bureau of Land Management Notice of Availability of the Record of Decision for the North Steens 230... Record of Decision (ROD) for the North Steens 230 kilovolt (kV) Transmission Line Project. The...

  12. 39 CFR 230.16 - Is there a prohibition on presenting Office of Inspector General reports or records during an...

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Is there a prohibition on presenting Office of Inspector General reports or records during an employee's testimony? 230.16 Section 230.16 Postal Service UNITED STATES POSTAL SERVICE ORGANIZATION AND ADMINISTRATION OFFICE OF INSPECTOR GENERAL Rules...

  13. 39 CFR 230.14 - Who owns the written or recorded notes, memoranda, reports, and transcriptions made pursuant to...

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Who owns the written or recorded notes, memoranda, reports, and transcriptions made pursuant to an official investigation, audit, or review conducted by an employee of the Office of Inspector General? 230.14 Section 230.14 Postal Service UNITED STATES...

  14. Some aspects on the variations in depositional flux of excess thorium-230 in the central Indian basin during late quaternary

    Examined in this paper is the tentative history of the depositional flux of 230Thxs (the unsupported fraction of 230Th scavenged from the overlying water column), for the late quaternary period from a sediment core of the central Indian basin (CIB). The measured depositional flux of 230Thxs is found to be substantially higher than that of the possible theoretical flux from the overlying water column. The average ratio of the measured depositional flux to that of the predicted flux from the overlying water column, indicates that the core site acts as a sink for 230Thxs and based on the existence of bottom current activity; the 230Thxs could be the result of focusing of younger sediments. (author). 29 refs., 2 figs., 2 tabs

  15. Spatial variability of initial 230Th/ 232Th in modern Porites from the inshore region of the Great Barrier Reef

    Clark, Tara R.; Zhao, Jian-xin; Feng, Yue-xing; Done, Terry J.; Jupiter, Stacy; Lough, Janice; Pandolfi, John M.

    2012-02-01

    The main limiting factor in obtaining precise and accurate uranium-series (U-series) ages of corals that lived during the last few hundred years is the ability to constrain and correct for initial thorium-230 ( 230Th 0), which is proportionally much higher in younger samples. This is becoming particularly important in palaeoecological research where accurate chronologies, based on the 230Th chronometer, are required to pinpoint changes in coral community structure and the timing of mortality events in recent time (e.g. since European settlement of northern Australia in the 1850s). In this study, thermal ionisation mass spectrometry (TIMS) U-series dating of 43 samples of known ages collected from living Porites spp. from the far northern, central and southern inshore regions of the Great Barrier Reef (GBR) was performed to spatially constrain initial 230Th/ 232Th ( 230Th/ 232Th 0) variability. In these living Porites corals, the majority of 230Th/ 232Th 0 values fell within error of the conservative bulk Earth 230Th/ 232Th atomic value of 4.3 ± 4.3 × 10 -6 (2 σ) generally assumed for 230Th 0 corrections where the primary source is terrestrially derived. However, the results of this study demonstrate that the accuracy of 230Th ages can be further improved by using locally determined 230Th/ 232Th 0 values for correction, supporting the conclusion made by Shen et al. (2008) for the Western Pacific. Despite samples being taken from regions adjacent to contrasting levels of land modification, no significant differences were found in 230Th/ 232Th 0 between regions exposed to varying levels of sediment during river runoff events. Overall, 39 of the total 43 230Th/ 232Th 0 atomic values measured in samples from inshore reefs across the entire region show a normal distribution ranging from 3.5 ± 1.1 to 8.1 ± 1.1 × 10 -6, with a weighted mean of 5.76 ± 0.34 × 10 -6 (2 σ, MSWD = 8.1). Considering the scatter of the data, the weighted mean value with a more

  16. Relationship between ISO 230-2/-6 Test Results and Positioning Accuracy of Machine Tools Using LaserTRACER

    Hau-Wei Lee

    2016-04-01

    Full Text Available To test the positioning accuracy and repeatability of the linear axes of machine tools, ISO (International Standards Organization 230-2 and ISO 230-6 are usually adopted. Auto-tracking laser interferometers (ATLI can perform the testing for the positioning accuracy and the repeatability including x-, y- and z-axes according to ISO 230-2 as well as xy, xz, yz, and xyz diagonal lines following ISO 230-6. LaserTRACER is a kind of ATLI. One of the steps of the ISO 230-2 and -6 tests using LaserTRACER is to determine the coordinate of the LaserTRACER with respect to the home point of the machine tool. Positioning accuracy of the machine tool causes the coordinate determined error, which might influence the test result. To check on this error, this study performs three experiments. The experiment results show that the positioning error appears on the testing results.

  17. 230,232Th in milk, meat, and grain in Korea

    The concentrations of natural radioisotopes 230Th and 232Th in Korean foods were measured by the method of calcium oxalate co-precipitation in addition to the conventional anion-exchange method and alpha spectroscopic measurement. The 230Th concentrations (mBq/kg-fresh) in Korean foods were found to be as follows: milk 0.14-2.45, pork 2.98-8.97, beef 1.94-9.80, chicken 1.22-13.0, rice 0.43-2.35, wheat 0.53-14.4, and soybeans, 8.44-91.6. The 232Th concentrations (mBq/kg-fresh) in Korean foods were found to be as follows: milk 0.01-2.46, pork 0.28-9.32, beef 1.02-5.34, chicken 0.56-4.98, rice 0.32-2.54, wheat 0.53-20.0, and soybeans, 2.30-42.2. The annual internal dose of Th was also estimated. The annual internal dose of 230Th and 232Th in milk was about 0.006 μSv/yr and much lower than that of other countries because of the low intake of milk in Korea compared to other countries. The annual internal dose of 230Th and 232Th in the rice was about 0.043 μSv/yr and highest because rice is the staple food of Koreans. (author)

  18. Biaxial thermal creep of Inconel 617 and Haynes 230 at 850 and 950 °C

    The biaxial thermal creep behavior of Inconel 617 and Haynes 230 at 850 and 950 °C was investigated. Biaxial stresses were generated using the pressurized tube technique. The detailed creep deformation and fracture mechanism have been studied. Creep curves for both alloys showed that tertiary creep accounts for a greater portion of the materials’ life, while secondary creep only accounts for a small portion. Fractographic examinations of the two alloys indicated that nucleation, growth, and coalescence of creep voids are the dominant micro-mechanisms for creep fracture. At 850 °C, alloy 230 has better creep resistance than alloy 617. When subjected to the biaxial stress state, the creep rupture life of the two alloys was considerably reduced when compared to the results obtained by uniaxial tensile creep tests. The Monkman–Grant relation proves to be a promising method for estimating the long-term creep life for alloy 617, whereas alloy 230 does not follow the relation. This might be associated with the significant changes in the microstructure of alloy 230 at high temperatures

  19. 230 noort leidis hõiveprojektiga töökoha / Villy Paimets

    Paimets, Villy, 1972-

    2004-01-01

    Sotsiaalministeeriumi ja tööturuameti ühise noorte tööhõiveprojekti partneritest, teostajast, eesmärkidest ja tulemustest. Projekti tulemusena leidis töö- või praktikakoha 230 16-24 aastast noort Ida-Virumaalt, Kagu-Eestist ning Saare- ja Hiiumaalt

  20. Biaxial thermal creep of Inconel 617 and Haynes 230 at 850 and 950 °C

    Tung, Hsiao-Ming, E-mail: hmtung2@gmail.com [Institute of Nuclear Energy Research, Longtan, Taoyuan 32546, Taiwan, ROC (China); Mo, Kun; Stubbins, James F. [Department of Nuclear, Plasma, and Radiological Engineering, University of Illinois at Urbana-Champaign, 104 South Wright Street, Urbana, IL 61801 (United States)

    2014-04-01

    The biaxial thermal creep behavior of Inconel 617 and Haynes 230 at 850 and 950 °C was investigated. Biaxial stresses were generated using the pressurized tube technique. The detailed creep deformation and fracture mechanism have been studied. Creep curves for both alloys showed that tertiary creep accounts for a greater portion of the materials’ life, while secondary creep only accounts for a small portion. Fractographic examinations of the two alloys indicated that nucleation, growth, and coalescence of creep voids are the dominant micro-mechanisms for creep fracture. At 850 °C, alloy 230 has better creep resistance than alloy 617. When subjected to the biaxial stress state, the creep rupture life of the two alloys was considerably reduced when compared to the results obtained by uniaxial tensile creep tests. The Monkman–Grant relation proves to be a promising method for estimating the long-term creep life for alloy 617, whereas alloy 230 does not follow the relation. This might be associated with the significant changes in the microstructure of alloy 230 at high temperatures.

  1. Biaxial thermal creep of Inconel 617 and Haynes 230 at 850 and 950 °C

    Tung, Hsiao-Ming; Mo, Kun; Stubbins, James F.

    2014-04-01

    The biaxial thermal creep behavior of Inconel 617 and Haynes 230 at 850 and 950 °C was investigated. Biaxial stresses were generated using the pressurized tube technique. The detailed creep deformation and fracture mechanism have been studied. Creep curves for both alloys showed that tertiary creep accounts for a greater portion of the materials' life, while secondary creep only accounts for a small portion. Fractographic examinations of the two alloys indicated that nucleation, growth, and coalescence of creep voids are the dominant micro-mechanisms for creep fracture. At 850 °C, alloy 230 has better creep resistance than alloy 617. When subjected to the biaxial stress state, the creep rupture life of the two alloys was considerably reduced when compared to the results obtained by uniaxial tensile creep tests. The Monkman-Grant relation proves to be a promising method for estimating the long-term creep life for alloy 617, whereas alloy 230 does not follow the relation. This might be associated with the significant changes in the microstructure of alloy 230 at high temperatures.

  2. Carbide Transformation in Haynes 230 during Long-term Exposure at High Temperature

    Lee, Ho Jung; Kim, Hyunmyung; Hong, Sunghoon; Jang, Changheui [Korea Advanced Institute of Science and Technology, Daejeon (Korea, Republic of)

    2014-05-15

    Long-term aging behaviors of a solid solution hardened Ni-base superalloy, Haynes 230 at high temperature have not been fully investigated yet. In this study, long-term aging tests of Haynes 230 was carried out to evaluate microstructure changes especially in carbide evolution. In addition, its consequential effects on tensile property such as tensile strength and elongation were discussed. In Haynes 230, a nucleation of the secondary carbides was dominant at 800 .deg. C ageing while growth at 900 .deg. C ageing. In addition, after aging at 800 .deg. C, transition of primary W-rich M{sub 6}C carbides (break down) were observed and it showed high W content (up to 70 at.% W) compared to un-aged W-rich M{sub 6}C carbides (around 30 at.% W). Coarsened Cr- and Ni-rich phase surrounded by carbide depleted region and high W-rich M{sub 6}C carbide along the grain boundary were formed only at 900 .deg. C after long-term exposure above 10000 h. Tensile strength of aged Haynes 230 increased at 800 .deg. C while decreased at 900 .deg. C due to the formation of secondary carbide within the grains at 800 .deg. C. Decrease in elongation would be resulted from the coarsened and continuous carbides at the grain boundary as well as Cr- and Ni-rich phase along the grain boundary.

  3. Carbide Transformation in Haynes 230 during Long-term Exposure at High Temperature

    Long-term aging behaviors of a solid solution hardened Ni-base superalloy, Haynes 230 at high temperature have not been fully investigated yet. In this study, long-term aging tests of Haynes 230 was carried out to evaluate microstructure changes especially in carbide evolution. In addition, its consequential effects on tensile property such as tensile strength and elongation were discussed. In Haynes 230, a nucleation of the secondary carbides was dominant at 800 .deg. C ageing while growth at 900 .deg. C ageing. In addition, after aging at 800 .deg. C, transition of primary W-rich M6C carbides (break down) were observed and it showed high W content (up to 70 at.% W) compared to un-aged W-rich M6C carbides (around 30 at.% W). Coarsened Cr- and Ni-rich phase surrounded by carbide depleted region and high W-rich M6C carbide along the grain boundary were formed only at 900 .deg. C after long-term exposure above 10000 h. Tensile strength of aged Haynes 230 increased at 800 .deg. C while decreased at 900 .deg. C due to the formation of secondary carbide within the grains at 800 .deg. C. Decrease in elongation would be resulted from the coarsened and continuous carbides at the grain boundary as well as Cr- and Ni-rich phase along the grain boundary

  4. 49 CFR 230.37 - Steam test following repairs or alterations.

    2010-10-01

    ... test of the boiler with steam pressure raised to between 95 percent and 100 percent of the MAWP. At... 49 Transportation 4 2010-10-01 2010-10-01 false Steam test following repairs or alterations. 230... RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION STEAM LOCOMOTIVE INSPECTION AND MAINTENANCE...

  5. 17 CFR 230.154 - Delivery of prospectuses to investors at the same address.

    2010-04-01

    ...): The notice should be written in plain English. See § 230.421(d)(2) of this chapter for a discussion of plain English principles. (3) You have not received the reply form or other notification indicating that... it is a business. (c) Revocation of consent. If an investor, orally or in writing, revokes consent...

  6. 50 CFR 660.230 - Fixed gear fishery-management measures.

    2010-10-01

    ... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Fixed gear fishery-management measures... West Coast Groundfish-Limited Entry Fixed Gear Fisheries § 660.230 Fixed gear fishery-management... apply to vessels participating in the limited entry groundfish fixed gear fishery and may not...

  7. 20 CFR 405.230 - Effect of the Federal reviewing official's decision.

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Effect of the Federal reviewing official's... PROCESS FOR ADJUDICATING INITIAL DISABILITY CLAIMS Review of Initial Determinations by a Federal Reviewing Official § 405.230 Effect of the Federal reviewing official's decision. The Federal reviewing...

  8. 17 CFR 230.801 - Exemption in connection with a rights offering.

    2010-04-01

    ... thereto, in English, to the Commission on Form CB (§ 239.800 of this chapter) by the first business day..., Exchange Offers and Business Combinations § 230.801 Exemption in connection with a rights offering. A... document to U.S. holders, including any amendments thereto, in English, on a comparable basis to...

  9. 17 CFR 230.484 - Undertaking required in certain registration statements.

    2010-04-01

    ... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Undertaking required in... Development Companies § 230.484 Undertaking required in certain registration statements. If a registration... and an undertaking in substantially the following form: Insofar as indemnification for...

  10. 24 CFR 572.230 - Cash and Management Information (C/MI) System.

    2010-04-01

    ... HOMES PROGRAM (HOPE 3) Grants § 572.230 Cash and Management Information (C/MI) System. Disbursement of HOPE 3 grant funds is managed through HUD's Cash and Management Information (C/MI) System for the HOPE... 24 Housing and Urban Development 3 2010-04-01 2010-04-01 false Cash and Management Information...