WorldWideScience

Sample records for actinium 228

  1. Radium-228 analysis of natural waters by Cherenkov counting of Actinium-228

    The activities of 228Ra in natural waters were determined by the Cherenkov counting of the daughter nuclide 228Ac. The radium was pre-concentrated on MnO2 and the radium purified via ion exchange and, after a 2-day period of incubation to allow for secular equilibrium between the parent-daughter 228Ra(228Ac), the daughter nuclide 228Ac was isolated by ion exchange according to the method of Nour et al. [2004. Radium-228 determination of natural waters via concentration on manganese dioxide and separation using Diphonix ion exchange resin. Appl. Radiat. Isot. 61, 1173-1178]. The Cherenkov photons produced by 228Ac were counted directly without the addition of any scintillation reagents. The optimum Cherenkov counting window, sample volume, and vial type were determined experimentally to achieve optimum Cherenkov photon detection efficiency and lowest background count rates. An optimum detection efficiency of 10.9±0.1% was measured for 228Ac by Cherenkov counting with a very low Cherenkov photon background of 0.317±0.013 cpm. The addition of sodium salicylate into the sample counting vial at a concentration of 0.1 g/mL yielded a more than 3-fold increase in the Cherenkov detection efficiency of 228Ac to 38%. Tests of the Cherenkov counting technique were conducted with several water standards of known activity and the results obtained compared closely with a conventional liquid scintillation counting technique. The advantages and disadvantages of Cherenkov counting compared to liquid scintillation counting methods are discussed. Advantages include much lower Cherenkov background count rates and consequently lower minimal detectable activities for 228Ra and no need for expensive environmentally unfriendly liquid scintillation cocktails. The disadvantages of the Cherenkov counting method include the need to measure 228Ac Cherenkov photon detection efficiency and optimum Cherenkov counting volume, which are not at all required when liquid scintillation analysis is

  2. SCI 228

    http://chosecourses.com/sci-228-nutri-health-amp-wellness-midterm-exam

    2015-01-01

    SCI 228 Nutri, Health & Wellness Midterm Exam Purchase here http://chosecourses.com/sci-228-nutri-health-amp-wellness-midterm-exam     Product Description   SCI 228 Nutri, Health & Wellness Midterm Exam   (TCO 1) Which of the following nutrients is the most energy dense?   TCO 1) Which of the following are examples of carbohydrate-rich foods?   (TCO 1) What element makes protein different from carbohydra...

  3. Extraction of actinium with di-(2-ethylhexyl)phosphoric acid from hydrochloric and nitric acid solutions

    The extraction of actinium with HDEHP from Cl- and NO3- systems has been investigated. It was found that extraction of actinium from HCl solutions is much better than from HNO3 solutions. Stability constants of actinium complexes Ac(X-)+2 with Cl- and NO3- ligands were determined. Our results show that the actinium formed less stable complexes with Cl- than with NO3- ligands. 5 refs., 3 figs., 1 tab. (author)

  4. The sorption of polonium, actinium and protactinium onto geological materials

    This paper describes a combined experimental and modeling program of generic sorption studies to increase confidence in the performance assessment for a potential high-level radioactive waste repository in Japan. The sorption of polonium, actinium and protactinium onto geological materials has been investigated. Sorption of these radioelements onto bentonite, tuff and granodiorite from equilibrated de-ionized water was studied under reducing conditions at room temperature. In addition, the sorption of actinium and protactinium was investigated at 60 C. Thermodynamic chemical modeling was carried out to aid interpretation of the results

  5. Discovery of the actinium, thorium, protactinium, and uranium isotopes

    Fry, C; Thoennessen, M

    2012-01-01

    Currently, 31 actinium, 31 thorium, 28 protactinium, and 23 uranium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  6. Separation of Actinium 227 from the uranium minerals

    The purpose of this work was to separate Actinium 227, whose content is 18%, from the mineral carnotite found in Gomez Chihuahua mountain range in Mexico. The mineral before processing is is pre-concentrated and passed, first through anionic exchange resins, later the eluate obtained is passed through cationic resins. The resins were 20-50 MESH QOWEX and 100-200 MESH 50 X 8-20 in some cased 200-400 MESH AG 50W-X8, 1X8 in other cases. The eluates from the ionic exchange were electrodeposited on stainless steel polished disc cathode and platinum electrode as anode; under a current ODF 10mA for 2.5 to 5 hours and of 100mA for .5 of an hour. it was possible to identify the Actinium 227 by means of its descendents, TH-227 and RA-223, through alpha spectroscopy. Due to the radiochemical purity which the electro deposits were obtained the Actinium 227 was low and was not quantitatively determined. A large majority of the members of the natural radioactive series 3 were identified and even alpha energies reported in the literature with very low percentages of non-identified emissions were observed. We conclude that a more precise study is needed concerning ionic exchange and electrodeposit to obtain an Actinium 227 of radiochemical purity. (Author)

  7. Spectroscopic and computational investigation of actinium coordination chemistry.

    Ferrier, Maryline G; Batista, Enrique R; Berg, John M; Birnbaum, Eva R; Cross, Justin N; Engle, Jonathan W; La Pierre, Henry S; Kozimor, Stosh A; Lezama Pacheco, Juan S; Stein, Benjamin W; Stieber, S Chantal E; Wilson, Justin J

    2016-01-01

    Actinium-225 is a promising isotope for targeted-α therapy. Unfortunately, progress in developing chelators for medicinal applications has been hindered by a limited understanding of actinium chemistry. This knowledge gap is primarily associated with handling actinium, as it is highly radioactive and in short supply. Hence, Ac(III) reactivity is often inferred from the lanthanides and minor actinides (that is, Am, Cm), with limited success. Here we overcome these challenges and characterize actinium in HCl solutions using X-ray absorption spectroscopy and molecular dynamics density functional theory. The Ac-Cl and Ac-OH2O distances are measured to be 2.95(3) and 2.59(3) Å, respectively. The X-ray absorption spectroscopy comparisons between Ac(III) and Am(III) in HCl solutions indicate Ac(III) coordinates more inner-sphere Cl(1-) ligands (3.2±1.1) than Am(III) (0.8±0.3). These results imply diverse reactivity for the +3 actinides and highlight the unexpected and unique Ac(III) chemical behaviour. PMID:27531582

  8. Production of high-purity radium-223 from legacy actinium-beryllium neutron sources.

    Soderquist, Chuck Z; McNamara, Bruce K; Fisher, Darrell R

    2012-07-01

    Radium-223 is a short-lived alpha-particle-emitting radionuclide with potential applications in cancer treatment. Research to develop new radiopharmaceuticals employing (223)Ra has been hindered by poor availability due to the small quantities of parent actinium-227 available world-wide. The purpose of this study was to develop innovative and cost-effective methods to obtain high-purity (223)Ra from (227)Ac. We obtained (227)Ac from two surplus actinium-beryllium neutron generators. We retrieved the actinium/beryllium buttons from the sources and dissolved them in a sulfuric-nitric acid solution. A crude actinium solid was recovered from the solution by coprecipitation with thorium fluoride, leaving beryllium in solution. The crude actinium was purified to provide about 40 milligrams of actinium nitrate using anion exchange in methanol-water-nitric acid solution. The purified actinium was then used to generate high-purity (223)Ra. We extracted (223)Ra using anion exchange in a methanol-water-nitric acid solution. After the radium was separated, actinium and thorium were then eluted from the column and dried for interim storage. This single-pass separation produces high purity, carrier-free (223)Ra product, and does not disturb the (227)Ac/(227)Th equilibrium. A high purity, carrier-free (227)Th was also obtained from the actinium using a similar anion exchange in nitric acid. These methods enable efficient production of (223)Ra for research and new alpha-emitter radiopharmaceutical development. PMID:22697483

  9. Radium-228 determination of natural waters via concentration on manganese dioxide and separation using Diphonix ion exchange resin

    The objective of this work was to establish a new procedure for 228Ra determination of natural waters via preconcentration of radium on MnO2 and separation of its daughter, 228Ac, using Diphonix ion exchange resin. Following removal of potential interferences via passage through an initial Diphonix Resin column, the first daughter of 228Ra, 228Ac, is isolated by chromatographic separation via a second Diphonix column. A holding time of >30 h for 228Ac ingrowth in between the two column separations ensures secular equilibrium. Barium-133 is used as a yield tracer. Actinium-228 is eluted from the second Diphonix Resin with 5 ml 1 M 1-Hydroxyethane-1,1-diphosphonic acid (HEDPA) and quantified by addition of scintillation cocktail and LSC counting. Radium (and 133Ba) from the load and rinse solutions from the 2nd Diphonix column may be prepared for alpha spectrometry (for determination of 223Ra, 224Ra, and 226Ra) by BaSO4 microprecipitation and filtration. Decontamination tests indicate that U, Th, and Ra series nuclides do not interfere with these measurements, although high contents of 90Sr (90Y) require additional treatment for accurate measurement of 228Ra. Addition of stable Sr as a 'hold back' carrier during the initial MnO2 preconcentration step was shown to remove most 90Sr interference

  10. Radium, thorium, and actinium extraction from seawater using an improved manganese-oxide-coated fiber

    Laboratory experiments were conducted to determine the efficiency with which improved manganese-oxide-coated acrylic fibers extract radium, thorium, and actinium from seawater. Tests were made using surface seawater spiked with 227Ac, 227Th and 223Ra. For sample volumes of approximately 30 liters and flow rates up to 0.5 liters per minute, radium and actinium are removed quantitatively. Approximately 80-95% of the thorium is removed under these same conditions. (Auth.)

  11. Groundwater seepage from the Ranger uranium mine tailings dam: radioisotopes of radium, thorium and actinium. Supervising Scientist report 106

    Monitoring of bores near the Ranger uranium mine tailings dam has revealed deterioration in water quality in several bores since 1983. In a group of bores to the north of the dam, increases have been observed of up to 500 times for sulphate concentrations and of up to 5 times for 226Ra concentrations. Results are presented here of measurements of members of the uranium, thorium and actinium decay series in borewater samples collected between 1985 and 1993. In particular, measurements of all four naturally-occurring radium isotopes have been used in an investigation of the mechanism of radium concentration changes. For the most seepage-affected bores the major findings of the study include: 228Ra/226Ra 223Ra /226Ra and 224Ra/228Ra ratios all increased over the course of the study; barium concentrations show high seasonal variability, being lower in November than May, but strontium concentrations show a steady increase with time. Calculations show that the groundwater is probably saturated with respect to barite but not with respect to celestite or anglesite; sulphide concentrations are low in comparison with sulphate, and are higher in November than in May; and 227Ac concentrations have increased with time, but do not account for the high 223Ra/226Ra ratios. It is concluded on the basis of these observations that increases in Ra isotope concentrations observed in a number of seepage-affected bores arise from increases in salinity leading to desorption of radium from adsorption sites in the vicinity of the bore rather by direct transport of radium from the tailings. Increased salinity is also causing the observed increases in 227Ac and strontium concentrations, while formation of a barite solid phase in the groundwater is causing the removal of some radium from solution. This is the cause of the increasing radium isotope ratios noted above

  12. Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232

    Harvey, James T.; Nolen, Jerry; Vandergrift, George; Gomes, Itacil; Kroc, Tom; Horwitz, Phil; McAlister, Dan; Bowers, Del; Sullivan, Vivian; Greene, John

    2011-12-30

    The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces {approx}100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 Ge

  13. Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232

    The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces ∼100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 GeV protons

  14. AAS 228: Day 4

    Kohler, Susanna

    2016-06-01

    Editors Note: Lastweek we were at the 228th AAS Meeting in San Diego, CA. Here is a final post aboutselectedevents on the last day of the meeting, written by authors fromastrobites.com, a grad-student collaborative project with which we recently announced a new partnership! Starting in July,keep an eye out for astrobites postsat AAS Nova in between Highlights(i.e., on Tuesdays and Thursdays).Were excited to be working together to bring you more recent astronomy research from AAS journals!Extrasolar Planets: Detection (by Leonardo dos Santos)Thursdays first session on exoplanets was about detecting these distant worlds, and the opening talk was given by Robert Siverd (Las Cumbres Observatory). He describes the NRES, a network of spectrographs that will look for exoplanets using the radial velocity method. One of the coolest aspects of this instrument is that it will feature an on the fly scheduling system that will perform observations as efficiently as possible. The spectrograph is still being tested, but a unit will be deployed at CTIO later this year.@lcogt contracted by @NASA_TESS for follow up of their candidates. #aas228 Jessie Christiansen (@aussiastronomer) June 16, 2016Measuring the depths of transits and eclipses in Spitzer has been problematic in the past, since the Spitzer instrument IRAC (InfraRed Array Camera) has a non-uniform response in its detectors pixels. But, as reported by James Ingalls (Spitzer Science Center, Caltech), observers are circumventing this issue by using what they call the staring mode (avoiding large pointing jumps) and an algorithm to pick sweet spot pixels. Moreover, the results from the IRAC Data Challenge are helping to better understand its behavior. Giuseppe Morello (University College London), on the other hand, explained how his research group gets rid of instrumental effects from IRAC using machine learning. This method removes systematics from exoplanet transit data no matter if the noise source is from an instrument or

  15. AAS 228: Day 4

    Kohler, Susanna

    2016-06-01

    Editors Note: Lastweek we were at the 228th AAS Meeting in San Diego, CA. Here is a final post aboutselectedevents on the last day of the meeting, written by authors fromastrobites.com, a grad-student collaborative project with which we recently announced a new partnership! Starting in July,keep an eye out for astrobites postsat AAS Nova in between Highlights(i.e., on Tuesdays and Thursdays).Were excited to be working together to bring you more recent astronomy research from AAS journals!Extrasolar Planets: Detection (by Leonardo dos Santos)Thursdays first session on exoplanets was about detecting these distant worlds, and the opening talk was given by Robert Siverd (Las Cumbres Observatory). He describes the NRES, a network of spectrographs that will look for exoplanets using the radial velocity method. One of the coolest aspects of this instrument is that it will feature an on the fly scheduling system that will perform observations as efficiently as possible. The spectrograph is still being tested, but a unit will be deployed at CTIO later this year.@lcogt contracted by @NASA_TESS for follow up of their candidates. #aas228 Jessie Christiansen (@aussiastronomer) June 16, 2016Measuring the depths of transits and eclipses in Spitzer has been problematic in the past, since the Spitzer instrument IRAC (InfraRed Array Camera) has a non-uniform response in its detectors pixels. But, as reported by James Ingalls (Spitzer Science Center, Caltech), observers are circumventing this issue by using what they call the staring mode (avoiding large pointing jumps) and an algorithm to pick sweet spot pixels. Moreover, the results from the IRAC Data Challenge are helping to better understand its behavior. Giuseppe Morello (University College London), on the other hand, explained how his research group gets rid of instrumental effects from IRAC using machine learning. This method removes systematics from exoplanet transit data no matter if the noise source is from an instrument or

  16. Neutron-Induced Fission of Actinium-227, Protactinium-231 and Neptunium-237: Mass Distribution

    Results of radiochemical studies on the mass distribution in the neutron-induced fission of actinium-227, protactinium-231 and neptunium-237 have been presented. This work has been carried out as part of a programme to determine the mass distribution in the fission of heavy elements as a function of Z and A. All irradiations have been carried out in the core of the swimming-pool type reactor APSARA with cadmium shielding wherever necessary. Relative yields of several fission product nuclides have been obtained by a method involving a comparison of the fission product activities from the respective targets with those formed from uranium-235 simultaneously irradiated. Thermal-neutron fission yields of uranium-235 have been assumed. These results indicate a predominantly asymmetric mass distribution in all the three cases, and also a distinct though small symmetric peak in the case of actinium-227. (author)

  17. A new method for the determination of low-level actinium-227 in geological samples

    We developed a new method for the determination of 227Ac in geological samples. The method uses extraction chromatographic techniques and alpha-spectrometry and is applicable for a range of natural matrices. Here we report on the procedure and results of the analysis of water (fresh and seawater) and rock samples. Water samples were acidified and rock samples underwent total dissolution via acid leaching. A DGA (N,N,N',N'-tetra-n-octyldiglycolamide) extraction chromatographic column was used for the separation of actinium. The actinium fraction was prepared for alpha spectrometric measurement via cerium fluoride micro-precipitation. Recoveries of actinium in water samples were 80 ± 8 % (number of analyses n = 14) and in rock samples 70 ± 12 % (n = 30). The minimum detectable activities (MDA) were 0.017-0.5 Bq kg-1 for both matrices. Rock sample 227Ac activities ranged from 0.17 to 8.3 Bq kg-1 and water sample activities ranged from below MDA values to 14 Bq kg-1of 227Ac. From the analysis of several standard rock and water samples with the method we found very good agreement between our results and certified values. (author)

  18. 22 CFR 228.40 - Local procurement.

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Local procurement. 228.40 Section 228.40... COMMODITIES AND SERVICES FINANCED BY USAID Conditions Governing Source and Nationality of Local Procurement Transactions for USAID Financing § 228.40 Local procurement. Local procurement in the cooperating...

  19. 49 CFR 228.207 - Training.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Training. 228.207 Section 228.207 Transportation... TRANSPORTATION HOURS OF SERVICE OF RAILROAD EMPLOYEES Electronic Recordkeeping § 228.207 Training. (a) In general. A railroad, or a contractor or subcontractor to a railroad, shall provide its train...

  20. 12 CFR 228.24 - Service test.

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Service test. 228.24 Section 228.24 Banks and... REINVESTMENT (REGULATION BB) Standards for Assessing Performance § 228.24 Service test. (a) Scope of test. The service test evaluates a bank's record of helping to meet the credit needs of its assessment area(s)...

  1. 12 CFR 228.22 - Lending test.

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Lending test. 228.22 Section 228.22 Banks and... REINVESTMENT (REGULATION BB) Standards for Assessing Performance § 228.22 Lending test. (a) Scope of test. (1) The lending test evaluates a bank's record of helping to meet the credit needs of its assessment...

  2. 49 CFR 228.21 - Civil penalty.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Civil penalty. 228.21 Section 228.21..., DEPARTMENT OF TRANSPORTATION HOURS OF SERVICE OF RAILROAD EMPLOYEES Records and Reporting § 228.21 Civil... requirement is subject to a civil penalty of at least $650 and not more than $25,000 per violation,...

  3. 36 CFR 228.62 - Free use.

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Free use. 228.62 Section 228... Mineral Materials Types and Methods of Disposal § 228.62 Free use. (a) Application. An application for a free-use permit must be made with the appropriate District Ranger's office. (b) Term. Permits may...

  4. 48 CFR 228.106 - Administration.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Administration. 228.106 Section 228.106 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE GENERAL CONTRACTING REQUIREMENTS BONDS AND INSURANCE Bonds 228.106 Administration....

  5. 40 CFR 98.228 - Definitions.

    2010-07-01

    ... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Definitions. 98.228 Section 98.228 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) MANDATORY GREENHOUSE GAS REPORTING Nitric Acid Production § 98.228 Definitions. All terms used in this subpart have...

  6. 22 CFR 228.22 - Air transportation.

    2010-04-01

    ... criteria for determining when U.S. flag air carriers are unavailable. See 48 CFR 47.403-1, or USAID... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Air transportation. 228.22 Section 228.22... for USAID Financing § 228.22 Air transportation. (a) The eligibility of air transportation...

  7. 22 CFR 228.21 - Ocean transportation.

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Ocean transportation. 228.21 Section 228.21... for USAID Financing § 228.21 Ocean transportation. (a) The Cargo Preference Act of 1954, Section 901(b... transportation services is determined by the flag registry of the vessel. (1) When the authorized source...

  8. 33 CFR 2.28 - Contiguous zone.

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Contiguous zone. 2.28 Section 2.28 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY GENERAL JURISDICTION Jurisdictional Terms § 2.28 Contiguous zone. (a) For the purposes of the Federal Water Pollution Control Act...

  9. 36 CFR 228.50 - Production records.

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Production records. 228.50 Section 228.50 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE MINERALS Disposal of Mineral Materials General Provisions § 228.50 Production records. At least annually,...

  10. 22 CFR 228.51 - Commodities.

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Commodities. 228.51 Section 228.51 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT RULES ON SOURCE, ORIGIN AND NATIONALITY FOR COMMODITIES AND SERVICES FINANCED BY USAID Waivers § 228.51 Commodities. (a) Waiver criteria. Any waiver must be based...

  11. 49 CFR 228.23 - Criminal penalty.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Criminal penalty. 228.23 Section 228.23..., DEPARTMENT OF TRANSPORTATION HOURS OF SERVICE OF RAILROAD EMPLOYEES Records and Reporting § 228.23 Criminal... criminal penalties of a fine up to $5,000, imprisonment for up to two years, or both, in accordance with...

  12. 22 CFR 228.34 - Joint ventures.

    2010-04-01

    ... Financing § 228.34 Joint ventures. A joint venture or unincorporated association is eligible only if each of... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Joint ventures. 228.34 Section 228.34 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT RULES ON SOURCE, ORIGIN AND NATIONALITY FOR COMMODITIES...

  13. 12 CFR 228.23 - Investment test.

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Investment test. 228.23 Section 228.23 Banks... COMMUNITY REINVESTMENT (REGULATION BB) Standards for Assessing Performance § 228.23 Investment test. (a) Scope of test. The investment test evaluates a bank's record of helping to meet the credit needs of...

  14. 42 CFR 438.228 - Grievance systems.

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Grievance systems. 438.228 Section 438.228 Public... Operation Standards § 438.228 Grievance systems. (a) The State must ensure, through its contracts, that each MCO and PIHP has in effect a grievance system that meets the requirements of subpart F of this...

  15. Analysis of the gamma spectra of the uranium, actinium, and thorium decay series

    Momeni, M.H.

    1981-09-01

    This report describes the identification of radionuclides in the uranium, actinium, and thorium series by analysis of gamma spectra in the energy range of 40 to 1400 keV. Energies and absolute efficiencies for each gamma line were measured by means of a high-resolution germanium detector and compared with those in the literature. A gamma spectroscopy method, which utilizes an on-line computer for deconvolution of spectra, search and identification of each line, and estimation of activity for each radionuclide, was used to analyze soil and uranium tailings, and ore.

  16. Analysis of the gamma spectra of the uranium, actinium, and thorium decay series

    This report describes the identification of radionuclides in the uranium, actinium, and thorium series by analysis of gamma spectra in the energy range of 40 to 1400 keV. Energies and absolute efficiencies for each gamma line were measured by means of a high-resolution germanium detector and compared with those in the literature. A gamma spectroscopy method, which utilizes an on-line computer for deconvolution of spectra, search and identification of each line, and estimation of activity for each radionuclide, was used to analyze soil and uranium tailings, and ore

  17. 21 CFR 173.228 - Ethyl acetate.

    2010-04-01

    ... the specifications of the Food Chemicals Codex, 1 (Ethyl Acetate; p. 372, 3d Ed., 1981), which are... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Ethyl acetate. 173.228 Section 173.228 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR...

  18. 50 CFR 665.228 - Gear identification.

    2010-10-01

    ... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Gear identification. 665.228 Section 665.228 Wildlife and Fisheries FISHERY CONSERVATION AND MANAGEMENT, NATIONAL OCEANIC AND ATMOSPHERIC... Gear identification. (a) The vessel number must be affixed to all fish and crab traps on board...

  19. AAS 228: Day 3 afternoon

    Kohler, Susanna

    2016-06-01

    Editors Note:This week were at the 228th AAS Meeting in San Diego, CA. Along with a team ofauthors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting twiceeach day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Wikipedia Year of Science Editathon (by Meredith Rawls)Whats your first go-to source for an unfamiliar topic on the internet? If you said Wikipedia, youre not alone. For many people, Wikipedia is the primary source of information about astronomy and science. However, many Wikipedia articles about science topics are incomplete or missing, and women are underrepresented among scientists with biographies.To address this, the AAS Astronomy Education Board teamed up with the Wiki Education Foundation to host an edit-a-thon as part of the Wikipedia Year of Science. More than forty attendees spent the better part of three hours working through tutorials, creating new articles, and editing existing ones. The session was generously sponsored by the Simons Foundation.The Year of Science initiative seeks to bring Wikipedia editing skills to the classroom and help new editors find sustainable ways to contribute to Wikipedia in the long term. Anybody can create a free account and start editing!As a first-time Wikipedia contributor, I took the time to go through nearly all the tutorial exercises and familiarize myself with the process of editing a page. I decided to flesh out one section in an existing page about asteroseismology. Others created biography pages from scratch or selected various astronomical topics to write about. To me, the editing process felt like a cross between writing a blog post and a journal article, in a hack day type environment. Working through the tutorial and some examples renewed my empathy for learners who are tackling a new skill set for the first time. A full summary of our

  20. In-source laser spectroscopy developments at TRILIS—towards spectroscopy on actinium and scandium

    Resonance Ionization Laser Ion Sources (RILIS) have become a versatile tool for production and study of exotic nuclides at Isotope Separator On-Line (ISOL) facilities such as ISAC at TRIUMF. The recent development and addition of a grating tuned spectroscopy laser to the TRIUMF RILIS solid state laser system allows for wide range spectral scans to investigate atomic structures on short lived isotopes, e.g., those from the element actinium, produced in uranium targets at ISAC. In addition, development of new and improved laser ionization schemes for rare isotope production at ISAC is ongoing. Here spectroscopic studies on bound states, Rydberg states and autoionizing (AI) resonances on scandium using the existing off-line capabilities are reported. These results allowed to identify a suitable ionization scheme for scandium via excitation into an autoionizing state at 58,104 cm − 1 which has subsequently been used for ionization of on-line produced exotic scandium isotopes.

  1. AAS 228: Day 3 afternoon

    Kohler, Susanna

    2016-06-01

    Editors Note:This week were at the 228th AAS Meeting in San Diego, CA. Along with a team ofauthors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting twiceeach day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Wikipedia Year of Science Editathon (by Meredith Rawls)Whats your first go-to source for an unfamiliar topic on the internet? If you said Wikipedia, youre not alone. For many people, Wikipedia is the primary source of information about astronomy and science. However, many Wikipedia articles about science topics are incomplete or missing, and women are underrepresented among scientists with biographies.To address this, the AAS Astronomy Education Board teamed up with the Wiki Education Foundation to host an edit-a-thon as part of the Wikipedia Year of Science. More than forty attendees spent the better part of three hours working through tutorials, creating new articles, and editing existing ones. The session was generously sponsored by the Simons Foundation.The Year of Science initiative seeks to bring Wikipedia editing skills to the classroom and help new editors find sustainable ways to contribute to Wikipedia in the long term. Anybody can create a free account and start editing!As a first-time Wikipedia contributor, I took the time to go through nearly all the tutorial exercises and familiarize myself with the process of editing a page. I decided to flesh out one section in an existing page about asteroseismology. Others created biography pages from scratch or selected various astronomical topics to write about. To me, the editing process felt like a cross between writing a blog post and a journal article, in a hack day type environment. Working through the tutorial and some examples renewed my empathy for learners who are tackling a new skill set for the first time. A full summary of our

  2. AAS 228: Day 1 morning

    Kohler, Susanna

    2016-06-01

    Editors Note:This week were at the 228th AAS Meeting in San Diego, CA. Along with a team ofauthors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting twiceeach day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Come visit astrobites at the AAS booth we have swag!Things kicked off last night at our undergraduate reception booth. Thanks to all of you who stopped by we were delightedto hear from undergrads who already know and love the site, educators who want to use it in their classrooms, and students who had not yet been introduced to astrobites and were excited about a new resource!For the rest of the meeting we will be stationed at theAAS booth in the exhibit hall (booth #211-213), so drop by if you want to learn more (or pick up swag: weve got lots of stickers and sunglasses)!Mondaymorning was the official start of the meeting. Here are just a few of the talks and workshops astrobiters attended this morning.Opening Address(by Susanna Kohler)AAS President Meg Urry kicked off the meeting this morning at 8am with an overview of some of the great endeavors AAS is supporting. We astrobiters had personal motivation to drag ourselves out of bed that early: during this session, Urryannounced the new partnership between AAS and astrobites!Urry touched on some difficult topics in her welcome, including yesterdays tragedy in Orlando. Shereiteratedthe AASs support fortheCommittee for Sexual-Orientation and Gender Minorities in Astronomy (SGMA). She also reminded meeting attendees about the importance ofkeeping conference interactions professional, and pointed to the meetings anti-harassment policy.Partnership Announcement (by Michael Zevin)This morning, the American Astronomical Society announced the new partnership that it will have with Astrobites! We are beyond excited to embark on this new partnership with the

  3. AAS 228: Day 1 morning

    Kohler, Susanna

    2016-06-01

    Editors Note:This week were at the 228th AAS Meeting in San Diego, CA. Along with a team ofauthors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting twiceeach day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Come visit astrobites at the AAS booth we have swag!Things kicked off last night at our undergraduate reception booth. Thanks to all of you who stopped by we were delightedto hear from undergrads who already know and love the site, educators who want to use it in their classrooms, and students who had not yet been introduced to astrobites and were excited about a new resource!For the rest of the meeting we will be stationed at theAAS booth in the exhibit hall (booth #211-213), so drop by if you want to learn more (or pick up swag: weve got lots of stickers and sunglasses)!Mondaymorning was the official start of the meeting. Here are just a few of the talks and workshops astrobiters attended this morning.Opening Address(by Susanna Kohler)AAS President Meg Urry kicked off the meeting this morning at 8am with an overview of some of the great endeavors AAS is supporting. We astrobiters had personal motivation to drag ourselves out of bed that early: during this session, Urryannounced the new partnership between AAS and astrobites!Urry touched on some difficult topics in her welcome, including yesterdays tragedy in Orlando. Shereiteratedthe AASs support fortheCommittee for Sexual-Orientation and Gender Minorities in Astronomy (SGMA). She also reminded meeting attendees about the importance ofkeeping conference interactions professional, and pointed to the meetings anti-harassment policy.Partnership Announcement (by Michael Zevin)This morning, the American Astronomical Society announced the new partnership that it will have with Astrobites! We are beyond excited to embark on this new partnership with the

  4. AAS 228: Day 3 morning

    Kohler, Susanna

    2016-06-01

    Editors Note:This week were at the 228th AAS Meeting in San Diego, CA. Along with a team ofauthors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting twiceeach day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Plenary Session 2015 Newton Lacy Pierce Prize Lecture: The Elephant in the Room: Effects of Distant, Massive Companions on Planetary System Architectures (by Leonardo dos Santos)The first session on Wednesday at 228th AAS Meeting was the Newton Lacy Pierce Prize Lecture by Heather Knutson (California Institute of Technology). This talk featured a broad range of research efforts on exoplanets, with the main focus on how we study the composition of their atmospheres, and how multi-body interactions carve the structure of the planetary systems we observe.One of her first points is the well-known idea that the Solar System is an oddball, compared to the exoplanet systems we have found so far: most of these systems contain hot Jupiters and mini-Neptunes at very close-in orbits around their host stars. Moreover, even when studying their transmission spectra, it is difficult to know the exact composition of their atmospheres.Knutson: it is difficult to constrain atmospheric composition of exoplanets (H-poor or H-rich+clouds?) #aas228pic.twitter.com/LdyN4o9RC7 astrobites (@astrobites) June 15, 2016The main proposal on how these systems formed is the migration scenario. In order to validate this idea, Dr. Knutson and her group The Friends of Hot Jupiters study systems with close-in gas giants and their frequency of binary companions, which are supposed to be the main culprits causing gas-giant migration. They found that approximately half of the observed systems have long-distance companions, providing strong validation of the migration scenario. Moreover, Dr. Knutson speculates that wide binaries have more

  5. AAS 228: Day 1 afternoon

    Kohler, Susanna

    2016-06-01

    Editors Note:This week were at the 228th AAS Meeting in San Diego, CA. Along with a team ofauthors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting twiceeach day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Plenary Session: From Space Archeology to Serving the World Today: A 20-year Journey from the Jungles of Guatemala to a Network of Satellite Remote Sensing Facilities Around the World(by Michael Zevin)In the conferences second plenary session, NASAs Daniel Irwin turned the eyes of the conference back to Earth by highlighting the huge impact that NASA missions play in protecting and developing our own planet.Daniel Irwin: using satellite imagery to detect differences in vegetation and find ancient Mayan cities. #aas228 pic.twitter.com/9LFPQdCHTM astrobites (@astrobites) June 13, 2016Irwin came to be involved in NASA through his work mapping Guatemalan jungles, where he would spend 22 days at a time exploring the treacherous jungles on foot armed with a 1st generation GPS, a compass, and a machete. A colleague introduced Irwin to the satellite imagery thathe was exploring, demonstratinghow these images are a strong complement to field work. The sharing of this satellite data with nearby villages helped to show the encroachment of agriculture and the necessity of connecting space to the village. Satellite imagery also played a role in archeological endeavors, uncovering dozens of Mayan cities that have been buried for over a millennia by vegetation, and it provided evidence that the fall of the Mayan civilization may have been due to massive deforestation that ledto drought.Glacial retreat in Chile imaged by ISERV.Irwin displayed the constellation of NASAs Earth-monitoring satellites that have played an integral role in conserving our planet and alerting the world of natural disasters. He also showed

  6. AAS 228: Day 2 afternoon

    Kohler, Susanna

    2016-06-01

    Editors Note:This week were at the 228th AAS Meeting in San Diego, CA. Along with a team ofauthors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting twiceeach day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.The Limits of Scientific Cosmology: Setting the Stage: Accepted Facts, and Testing Limitations in Theory and Data (by Gourav Khullar)With a stellar lineup of speakers to talk about current and future prospects of cosmology and its limits (or lack thereof), the first session kicked off with talks by Risa Wechsler, Joseph Silk, and Sean Carroll (his talk on Multiverses is described below, by Nathan Sanders). Risa set the stage with an elaborate description of the current accepted facts in the era of precision cosmology including the standard model of concordance cosmology, described by seven parameters and an accepted Lambda-CDM paradigm (with a cosmological constant and cold dark matter). The talk stressed on the fact that all these parameters are understood to a percent order precision, which is a remarkable deviation from the time in 1990s when according to Risa, Alan Guth never thought that any of these numbers could be measured precisely!Risa Wechsler describing our current constraints on what Dark Matter could constitute.Joseph Silk discussing limits on cosmological parameters.The CMB measurements, Big Bang Nucleosynthesis estimates and galaxy clustering statistics all contribute to locking down the description of our universe. She emphasized on the tensions between different probes to measure expansion rate H0 of the universe, and small scale predictions of cold dark matter simulations, but she is hopeful that these shall be resolved eventually. Joe Silk followed this up with his interpretation of trying to understand our place in the universe and placing limits on different parameters and

  7. FK228 from Burkholderia thailandensis MSMB43

    Xiang-Yang Liu

    2012-09-01

    Full Text Available FK228 [systematic name: (1S,4S,7Z,10S,16E,21R-7-ethylidene-4,21-di(propan-2-yl-2-oxa-12,13-dithia-5,8,20,23-tetrazabicyclo[8.7.6]tricos-16-ene-3,6,9,19,22-pentone], C24H36N4O6S2, also known as FR901228, depsipeptide, NSC 630176, romidepsin, and marketed as Istodax by Celgene Corporation, is crystallized from ethyl acetate in P21 as compared to the absolute configuration of FK228, first crystallized from methanol in P212121 [Shigematsu et al. (1994. J. Antibiot. 47, 311–314]. A slight difference is observed between the absolute configuration of FK228 and the present structure. The molecular structure is stabilized by intramolecular N—H...O hydrogen bonds. In the crystal, molecules are linked via N—H...O hydrogen bonds.

  8. Preparation of (228)Ra standard solution.

    Havelka, Miroslav

    2016-03-01

    For the preparation of a standard solution of (228)Ra, (228)Ra was isolated from (232)Th salt. Two simple methods were developed for Th-Ra separation. Both are based on a very good solubility of thorium nitrate in organic solvents. The first one used Ra co-precipitation with Pb in the form of Pb(NO3)2 from acetic acid solution. The second method was based on solvent extraction, remaining Th in the organic phase, while Ra was concentrated in the aqueous phase. The activity of (228)Ra (up to 20kBq) in the standard solution was related to the (232)Th standard by means of gamma ray spectrometry measurement. The obtained uncertainty was less than 0.7% (k=1). The standard solution was free of (232)Th and contained the carrier in the usual concentration (1gL(-1) BaCl2, 10gL(-1) HCl). PMID:26651171

  9. AAS 228: Day 2 morning

    Kohler, Susanna

    2016-06-01

    Editors Note:This week were at the 228th AAS Meeting in San Diego, CA. Along with a team ofauthors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting twiceeach day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Plenary Session (Day 1) The Galaxy Zoo(by Benny Tsang)Galaxy Zoo was so hot that the servers hosting the galaxy images got melted down soon after being launched.Kevin Schawinski from ETH Zurich took us on a tour ofhis wonderful Galaxy Zoo. It is a huge zoo with about a quarter million zookeepers, they are citizen astronomers who collaboratively classify galaxies by their looks as an attempt to understand galaxy evolution. The big question that is being answered is: how do blue, actively star-forming galaxies evolve into red, quiescent (non-star-forming) galaxies? The Zoo helped reveal that blue galaxies turn into red galaxies via two possible paths galaxies might run out of supply of gas and shut off star formation slowly; or they could merge with one another and turn off star formation by destroying the gas reservoir rapidly!The Galaxy Zoo project also led to the discoveries of:Green Peas: they are the living fossils of galaxy evolution; compact, bright, green galaxies that are actively forming starsOverlapping galaxies: they are pairs of galaxies that are separated physically but happen to lie on the same line of sight; they provide excellent laboratories for studying dust extinctionHannys Voorwerp: an unusual object named after Hanny the discoverer, which is believed to be the first detection of quasar light echoThe idea of Galaxy Zoo in getting help from citizen scientists was further extended into an award-winningproject known as the Zooniverse, which is an online platform for streamlined crowd-sourcing for scientific research that requires human input. The future of astronomy is going to be

  10. AAS 228: Day 2 afternoon

    Kohler, Susanna

    2016-06-01

    Editors Note:This week were at the 228th AAS Meeting in San Diego, CA. Along with a team ofauthors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting twiceeach day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.The Limits of Scientific Cosmology: Setting the Stage: Accepted Facts, and Testing Limitations in Theory and Data (by Gourav Khullar)With a stellar lineup of speakers to talk about current and future prospects of cosmology and its limits (or lack thereof), the first session kicked off with talks by Risa Wechsler, Joseph Silk, and Sean Carroll (his talk on Multiverses is described below, by Nathan Sanders). Risa set the stage with an elaborate description of the current accepted facts in the era of precision cosmology including the standard model of concordance cosmology, described by seven parameters and an accepted Lambda-CDM paradigm (with a cosmological constant and cold dark matter). The talk stressed on the fact that all these parameters are understood to a percent order precision, which is a remarkable deviation from the time in 1990s when according to Risa, Alan Guth never thought that any of these numbers could be measured precisely!Risa Wechsler describing our current constraints on what Dark Matter could constitute.Joseph Silk discussing limits on cosmological parameters.The CMB measurements, Big Bang Nucleosynthesis estimates and galaxy clustering statistics all contribute to locking down the description of our universe. She emphasized on the tensions between different probes to measure expansion rate H0 of the universe, and small scale predictions of cold dark matter simulations, but she is hopeful that these shall be resolved eventually. Joe Silk followed this up with his interpretation of trying to understand our place in the universe and placing limits on different parameters and

  11. AAS 228: Day 2 morning

    Kohler, Susanna

    2016-06-01

    Editors Note:This week were at the 228th AAS Meeting in San Diego, CA. Along with a team ofauthors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting twiceeach day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Plenary Session (Day 1) The Galaxy Zoo(by Benny Tsang)Galaxy Zoo was so hot that the servers hosting the galaxy images got melted down soon after being launched.Kevin Schawinski from ETH Zurich took us on a tour ofhis wonderful Galaxy Zoo. It is a huge zoo with about a quarter million zookeepers, they are citizen astronomers who collaboratively classify galaxies by their looks as an attempt to understand galaxy evolution. The big question that is being answered is: how do blue, actively star-forming galaxies evolve into red, quiescent (non-star-forming) galaxies? The Zoo helped reveal that blue galaxies turn into red galaxies via two possible paths galaxies might run out of supply of gas and shut off star formation slowly; or they could merge with one another and turn off star formation by destroying the gas reservoir rapidly!The Galaxy Zoo project also led to the discoveries of:Green Peas: they are the living fossils of galaxy evolution; compact, bright, green galaxies that are actively forming starsOverlapping galaxies: they are pairs of galaxies that are separated physically but happen to lie on the same line of sight; they provide excellent laboratories for studying dust extinctionHannys Voorwerp: an unusual object named after Hanny the discoverer, which is believed to be the first detection of quasar light echoThe idea of Galaxy Zoo in getting help from citizen scientists was further extended into an award-winningproject known as the Zooniverse, which is an online platform for streamlined crowd-sourcing for scientific research that requires human input. The future of astronomy is going to be

  12. Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL

    Raeder, S.; Bastin, B.; Block, M.; Creemers, P.; Delahaye, P.; Ferrer, R.; Fléchard, X.; Franchoo, S.; Ghys, L.; Gaffney, L. P.; Granados, C.; Heinke, R.; Hijazi, L.; Huyse, M.; Kron, T.; Kudryavtsev, Yu.; Laatiaoui, M.; Lecesne, N.; Luton, F.; Moore, I. D.; Martinez, Y.; Mogilevskiy, E.; Naubereit, P.; Piot, J.; Rothe, S.; Savajols, H.; Sels, S.; Sonnenschein, V.; Traykov, E.; Van Beveren, C.; Van den Bergh, P.; Van Duppen, P.; Wendt, K.; Zadvornaya, A.

    2016-06-01

    To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.

  13. 48 CFR 3052.228-70 - Insurance.

    2010-10-01

    ... of Provisions and Clauses 3052.228-70 Insurance. As prescribed in (HSAR) 48 CFR 3028.310-70 and 3028... liability. The contractor shall, as a minimum, meet the requirements specified at (FAR) 48 CFR 28.307-2(a...) 48 CFR 28.307-2(b). (c) Automobile liability. The contractor shall, as a minimum, meet...

  14. 36 CFR 228.12 - Access.

    2010-07-01

    ... Minerals § 228.12 Access. An operator is entitled to access in connection with operations, but no road... other means of access, including but not limited to off-road vehicles, be used until the operator has... forest surface resources, including measures to protect scenic values and to insure against erosion...

  15. Dicty_cDB: SFI228 [Dicty_cDB

    Full Text Available SF (Link to library) SFI228 (Link to dictyBase) - - - Contig-U16243-1 SFI228P (Link to Original ... ygywssrcnssrlktswshh*ryrrf*nq*sfcfssilql*gfgfgyeqs*skw ... lwyrfrssircywcpsngyhfkritss*r*iwcnxxmcigta*gaa Hom ...

  16. 32 CFR 228.10 - Prohibition on alcohol.

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Prohibition on alcohol. 228.10 Section 228.10 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS SECURITY PROTECTIVE FORCE § 228.10 Prohibition on alcohol. Entering or being on protected...

  17. 32 CFR 228.14 - Prohibition on gambling.

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Prohibition on gambling. 228.14 Section 228.14...) MISCELLANEOUS SECURITY PROTECTIVE FORCE § 228.14 Prohibition on gambling. Participating in games for money or other personal property, or the operating of gambling devices, the conduct of a lottery, or the...

  18. 48 CFR 52.228-14 - Irrevocable Letter of Credit.

    2010-10-01

    ... Credit. 52.228-14 Section 52.228-14 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION....228-14 Irrevocable Letter of Credit. As prescribed in 28.204-4, insert the following clause: Irrevocable Letter of Credit (DEC 1999) (a) “Irrevocable letter of credit” (ILC), as used in this...

  19. 32 CFR 228.15 - Restriction regarding animals.

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Restriction regarding animals. 228.15 Section 228.15 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS SECURITY PROTECTIVE FORCE § 228.15 Restriction regarding animals. No animals...

  20. 22 CFR 228.52 - Suppliers of commodities.

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Suppliers of commodities. 228.52 Section 228.52... COMMODITIES AND SERVICES FINANCED BY USAID Waivers § 228.52 Suppliers of commodities. Geographic code changes authorized by waiver with respect to the source of commodities automatically apply to the nationality...

  1. Search for β-delayed fission of 228Ac

    Radium was radiochemically separated from natural thorium. Thin 228Ra→β-228Ac sources were prepared and exposed to mica fission track detectors, and measured by an HPGe γ-ray detector. The β-delayed fission events of 228Ac were observed and its β-delayed fission probability was found to be (5±2)x10-12

  2. 36 CFR 223.228 - Contents of advertisement.

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Contents of advertisement. 223.228 Section 223.228 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE SALE AND DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER Special Forest Products Advertisement and Bids § 223.228 Contents of advertisement. The...

  3. 228Ra and 228Th concentrations in GEOSECS Atlantic surface waters

    An average 228Ra flux of 0.6 +- 0.1 dpm cm-2yr-1 from continental shelf sediments can maintain the estimated total 228Ra inventory of about 5x1017 dpm in Atlantic surface waters. By fitting 228Ra and potential temperature data to Munk's vertical advection-diffusion model, upwelling rates of 17 +- 10 m yr-1 and vertical eddy diffusion coefficients of 0.4 +- 0.2 cm2s-1 were obtained in the upper water column of the equatorial Atlantic. The downward fluxes of particulate 228Th across the 350-m water depth are about 0.01 to 0.04 dpm cm-2 yr-1 in the Sargasso Sea and in the regions south of 120N and about 0.06 to 0.11 dpm cm-2 yr-1 in the northern temperate region (excluding the Sargasso Sea). The shorter half-removal time of 228Th in the equatorial (100S to 200N) and the northern region (350 to 650N) are related to higher biological productivity there. (author)

  4. Purification of selenium from thorium, uranium, radium, actinium and potassium impurities for low background measurements

    A technique of selenium purification from 232Th, 238U, 226,228Ra, 227Ac and 40K was developed. This technique is simple to perform and employs a minimum number of highly pure reagents (bidistilled water, nitric acid). Operations carried out during purification (elution, evaporation) practically exclude losses of the target product (chemical yields of Se > 99%). A test purification of 100 g of selenium was carried out using this technique. The efficiency of this technique was confirmed by low background gamma spectrometry of the purified selenium sample. Distribution coefficients of Th, U, Ra and Ac on DOWEX 50W- x 8 cation-exchange resin at different concentrations of selenium and nitric acid were experimentally determinated. Instrumental neutron activation analysis of bidistilled water, deionized water and nitric acid was performed. (orig.)

  5. Purification of selenium from thorium, uranium, radium, actinium and potassium impurities for low background measurements

    Rakhimov, A.V. [Joint Institute for Nuclear Research (JINR), Dubna (Russian Federation); Uzbek Academy of Sciences, Tashkent (Uzbekistan). Inst. of Nuclear Physics (INP AS RUz); Warot, G. [CEA-CNRS, Modane (France). Laboratoire Souterrain de Modane (LSM); Karaivanov, D.V. [Joint Institute for Nuclear Research (JINR), Dubna (Russian Federation); Institute for Nuclear Research and Nuclear Energy (INRNE), Sofia (Bulgaria); Kochetov, O.I.; Lebedev, N.A.; Filosofov, D.V. [Joint Institute for Nuclear Research (JINR), Dubna (Russian Federation); Mukhamedshina, N.M.; Sadikov, I.I. [Uzbek Academy of Sciences, Tashkent (Uzbekistan). Inst. of Nuclear Physics (INP AS RUz)

    2013-07-01

    A technique of selenium purification from {sup 232}Th, {sup 238}U, {sup 226,228}Ra, {sup 227}Ac and {sup 40}K was developed. This technique is simple to perform and employs a minimum number of highly pure reagents (bidistilled water, nitric acid). Operations carried out during purification (elution, evaporation) practically exclude losses of the target product (chemical yields of Se > 99%). A test purification of 100 g of selenium was carried out using this technique. The efficiency of this technique was confirmed by low background gamma spectrometry of the purified selenium sample. Distribution coefficients of Th, U, Ra and Ac on DOWEX 50W- x 8 cation-exchange resin at different concentrations of selenium and nitric acid were experimentally determinated. Instrumental neutron activation analysis of bidistilled water, deionized water and nitric acid was performed. (orig.)

  6. Transfer of radium-228, thorium-228 and radium-226 from forage to cattle and reindeer

    Concentrations of radium-228, thorium-228 and radium-226 were measured in different natural forage materials and in feed supplements. The activity concentrations of these nuclides were then determined in the bones of domestic farm animals, with emphasis on their distributions within the skeleton and humerus. Feeds added in recent years to the forage of domestic animals alter the concentrations of the naturally occurring radionuclides. The modified daily radium uptakes associated with the various feeds are reflected in the radium concentrations observed in the different layers of the humerus. Radium uptake and retention are highly dependent on calcium metabolism. We propose a method for calculation of nuclide retention coefficients via an approach which simplifies their assessment and provides important information on radium metabolism. The data obtained here are of value in dosimetric assessments related to these natural radionuclides. (author)

  7. 22 CFR 228.23 - Eligibility of marine insurance.

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Eligibility of marine insurance. 228.23 Section...-Related Services for USAID Financing § 228.23 Eligibility of marine insurance. The eligibility of marine... a cooperating country discriminates against marine insurance companies authorized to do business...

  8. 48 CFR 752.228-9 - Cargo insurance.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Cargo insurance. 752.228-9... insurance. As prescribed in 728.313(a), the following preface is to be used preceding the text of the clause at FAR 52.228-9: Preface: To the extent that marine insurance is necessary or appropriate under...

  9. 42 CFR 414.228 - Prosthetic and orthotic devices.

    2010-10-01

    ... 42 Public Health 3 2010-10-01 2010-10-01 false Prosthetic and orthotic devices. 414.228 Section 414.228 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICARE PROGRAM PAYMENT FOR PART B MEDICAL AND OTHER HEALTH SERVICES Payment...

  10. 50 CFR 228.18 - Cross-examination.

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Cross-examination. 228.18 Section 228.18...-examination. (a) The presiding officer may: (1) Require the cross-examiner to outline the intended scope of the cross-examination; (2) Prohibit parties from cross-examining witnesses unless the...

  11. 20 CFR 228.15 - Reduction for age.

    2010-04-01

    ... multiplied by the number of months before the annuitant attains full retirement age (presently age 65... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Reduction for age. 228.15 Section 228.15 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT COMPUTATION...

  12. Dicty_cDB: SSD228 [Dicty_cDB

    Full Text Available SS (Link to library) SSD228 (Link to dictyBase) - G20270 DDB0206164 Contig-U04309-1 SSD228F (Lin ... mlvlm*meliivsnnhyhtllhhlkd*smsvisn*vqfnvicf q*iqvi*vtl --- Frame B: tnkikkkknkqkkkkkkkneiiiifnfsndncikll*i ...

  13. 20 CFR 228.18 - Reduction for public pension.

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Reduction for public pension. 228.18 Section... COMPUTATION OF SURVIVOR ANNUITIES The Tier I Annuity Component § 228.18 Reduction for public pension. (a) The... receipt of a public pension. (b) When reduction is required. Unless the survivor annuitant meets one...

  14. 22 CFR 228.14 - Nationality of suppliers of commodities.

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Nationality of suppliers of commodities. 228.14... NATIONALITY FOR COMMODITIES AND SERVICES FINANCED BY USAID Conditions Governing Source and Nationality of Commodity Procurement Transactions for USAID Financing § 228.14 Nationality of suppliers of commodities....

  15. 22 CFR 228.11 - Source and origin of commodities.

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Source and origin of commodities. 228.11... NATIONALITY FOR COMMODITIES AND SERVICES FINANCED BY USAID Conditions Governing Source and Nationality of Commodity Procurement Transactions for USAID Financing § 228.11 Source and origin of commodities. (a)...

  16. 48 CFR 252.228-7001 - Ground and flight risk.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Ground and flight risk... of Provisions And Clauses 252.228-7001 Ground and flight risk. As prescribed in 228.370(b), use the following clause: Ground and Flight Risk (JUN 2010) (a) Definitions. As used in this clause— (1)...

  17. 40 CFR 795.228 - Oral/dermal pharmacokinetics.

    2010-07-01

    ... 40 Protection of Environment 31 2010-07-01 2010-07-01 true Oral/dermal pharmacokinetics. 795.228 Section 795.228 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) TOXIC SUBSTANCES... sex. If feasible, the same low dose should be used for intravenous, oral, and dermal studies. (B)...

  18. Determination of radium-228 in foods and water

    A procedure was developed for the rapid determination of 228Ra by measuring its decay product 228Ac. The method is applicable to a variety of types of samples such as food and water. Food samples can be prepared by dry- or wet-ashing techniques. The 228Ac is precipitated with lanthanum carrier, dissolved, purified by solvent extraction, and finally decontaminated on anion and cation exchange resins. The 228Ac is counted in a thin-window, low-level gas flow beta counter. It may be necessary to count the sample several times to follow the 6 h half-life of 228Ac so that its purity is ensured. The method is sensitive to 1 pCi/sample of food ash and to 1 pCi/L of water. (author)

  19. Determination of 228Th, 232Th, and228Ra in wild mushroom from a naturally high radioactive region in Brazil

    Mushrooms are fungi which efficiently accumulate radionuclides, as verified by radiochemistry analyses of specimens collected in contaminated areas, specifically after the Chernobyl nuclear accident. Many studies have demonstrated that mushrooms can be used in monitoring of ecosystem contamination and quality. The present paper is part of a broader study conducted in the Pocos de Caldas plateau region in Minas Gerais, Brazil, investigating assimilation of natural Uranium and Thorium radionuclide series by mushrooms. This region has elevated natural radioactivity due to the presence of radiological anomalies of volcanic origin. These anomalies are ore bodies containing Uranium and Thorium, the later being highly predominant. Many researchers have been conducted concerning radionuclide incorporation by agricultural products on the plateau. The present paper aims to determine 232Th, 228Th, and 228Ra radionuclides in wild mushrooms collected at different locations in the plateau region. 228Ra was determined by radiochemical separation using sulphate coprecipitation followed by beta radiometry. 232Th and 228Th were determined using anion exchange resin purification followed by alpha spectrometry. Higher values were obtained to 228Th than to 232Th. This is due to higher 228Ra mobility, which decays to 228Th. The accuracy of the analytical methods employed was evaluated using the reference sample IAEA Soil 327. These methods had high chemical recovery and high sensitivity. It was possible to confirm that mushrooms accumulate radionuclide and so can be used in environmental contamination and quality assessment. (author)

  20. Assessment of the equilibrium of Th-228 and Ra-228 by gamma-ray spectrometry in mangrove soils

    Paiva, Jose Daniel S.; Farias, Emerson E.G.; Franca, Elvis J. De, E-mail: paivajds@gmail.com, E-mail: emersonemiliano@yahoo.com.br, E-mail: ejfranca@cnen.gov.br [Centro Regional de Ciencias Nucleares do Nordeste (CRCN-NE/CNEN-PE), Recife, PE (Brazil)

    2015-07-01

    The mangrove environment consists of soil containing high organic matter, characterized by the influence of continental and oceanic waters, relatively high concentrations of salts and exuberant vegetation. Mangroves also present high dynamics of chemical compound cycling, in which soils become quite relevant due to the influence of continental and oceanic sediments. Taking into account the different sources and transport of radionuclides within the mangrove environment, this study focused at the radioactive equilibrium of Thorium-232 series radionuclides, especially the Ra-228 and Thorium-228. For this, soil samples were collected in the crown projection of tree species from two mangroves located in the municipalities of Olinda/Recife and Rio Formoso, Pernambuco State, Brazil. The material was oven-dried and milled and test portions of 38 g were transferred to cylindrical vials and sealed. After 30 days, the natural radioactivity was measured during 80,000 seconds using High Resolution Gamma-Ray Spectrometry with a germanium detector of 2.2 keV of resolution at the 1,332 keV Co-60 photopeak. For Ra-228 determination, 911 keV gamma-ray line (Ac-228) were employed, while 238 keV (Pb-212) and 727 keV (Bi-212) were considered for estimating activity concentrations of Th-228. As a result, Ra-228 and Th 228 were in equilibrium since the activity concentrations (ranging from 35 Bq/kg to 50 Bq/kg) were not significantly different at the 95% confidence level. The results have confirmed that, even for environments of high dynamics such as mangroves, radioactive equilibrium of Th-228 and Ra-228 was kept, corroborating Th-232 determination in mangrove soils. (author)

  1. Assessment of the equilibrium of Th-228 and Ra-228 by gamma-ray spectrometry in mangrove soils

    The mangrove environment consists of soil containing high organic matter, characterized by the influence of continental and oceanic waters, relatively high concentrations of salts and exuberant vegetation. Mangroves also present high dynamics of chemical compound cycling, in which soils become quite relevant due to the influence of continental and oceanic sediments. Taking into account the different sources and transport of radionuclides within the mangrove environment, this study focused at the radioactive equilibrium of Thorium-232 series radionuclides, especially the Ra-228 and Thorium-228. For this, soil samples were collected in the crown projection of tree species from two mangroves located in the municipalities of Olinda/Recife and Rio Formoso, Pernambuco State, Brazil. The material was oven-dried and milled and test portions of 38 g were transferred to cylindrical vials and sealed. After 30 days, the natural radioactivity was measured during 80,000 seconds using High Resolution Gamma-Ray Spectrometry with a germanium detector of 2.2 keV of resolution at the 1,332 keV Co-60 photopeak. For Ra-228 determination, 911 keV gamma-ray line (Ac-228) were employed, while 238 keV (Pb-212) and 727 keV (Bi-212) were considered for estimating activity concentrations of Th-228. As a result, Ra-228 and Th 228 were in equilibrium since the activity concentrations (ranging from 35 Bq/kg to 50 Bq/kg) were not significantly different at the 95% confidence level. The results have confirmed that, even for environments of high dynamics such as mangroves, radioactive equilibrium of Th-228 and Ra-228 was kept, corroborating Th-232 determination in mangrove soils. (author)

  2. Dicty_cDB: CHI228 [Dicty_cDB

    Full Text Available CH (Link to library) CHI228 (Link to dictyBase) - - - Contig-U16517-1 - (Link to Original site) ... *edmqvqv* ekviy*elkiffhlqevllnvvykvfqifilninhyymif*ivf *rtn*kkplihtyqql nqerdhkm*lylwlvvslmkrh*pftllil*ilv ...

  3. 40 CFR 228.6 - Specific criteria for site selection.

    2010-07-01

    ... with shipping, fishing, recreation, mineral extraction, desalination, fish and shellfish culture, areas... statement is required by EPA policy. By publication of a notice in accordance with this part 228,...

  4. 36 CFR 228.61 - Preference right negotiated sales.

    2010-07-01

    ... commercial production occurs during any continuous 2-year period after the award of the contract or if the... AGRICULTURE MINERALS Disposal of Mineral Materials Types and Methods of Disposal § 228.61 Preference...

  5. Dicty_cDB: SFC228 [Dicty_cDB

    Full Text Available SF (Link to library) SFC228 (Link to dictyBase) - G01768 DDB0218080 Contig-U03237-1...brary) Clone ID SFC228 (Link to dictyBase) Atlas ID - NBRP ID G01768 dictyBase ID DDB0218080 Link to Contig ...Contig-U03237-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SF/SFC2-...LTGCFHKRVVCDDND KCTDNICNPETGTCXFRRRICTDNNDCTMD--- ---ICTDNNDCTMDWCNQLTGECVYQPVLVC...KIKLCQIKMMIILLFIIFIQLGNCQLENKTNATTTTTTR YCNNDESCNDENLCTNEMCDPVIGCIYENISCDDDNGCTKDFCDPLTGCFHKRVVCDDND KCTDNICNPETGTCXFRRRICT

  6. 48 CFR 252.228-7000 - Reimbursement for war-hazard losses.

    2010-10-01

    ...-hazard losses. 252.228-7000 Section 252.228-7000 Federal Acquisition Regulations System DEFENSE... CLAUSES Text of Provisions And Clauses 252.228-7000 Reimbursement for war-hazard losses. As prescribed in 228.370(a), use the following clause: Reimbursement for War-Hazard Losses (DEC 1991) (a) Costs...

  7. New method for large scale production of medically applicable Actinium-225 and Radium-223

    Alpha-emitters (211At, 212Bi, 213Bi, 223Ra, 225Ac) are promising for targeted radiotherapy of cancer. Only two alpha decays near a cell membrane result in 50% death of cancer cell and only a single decay inside the cell is required for this. 225Ac may be used either directly or as a mother radionuclide in 213Bi isotope generator. Production of 225Ac is provided by three main suppliers - Institute for Transuranium Elements in Germany, Oak Ridge National Laboratory in USA and Institute of Physics and Power Engineering in Obninsk, Russia. The current worldwide production of 225Ac is approximately 1.7 Ci per year that corresponds to only 100-200 patients that could be treated annually. The common approach for 225Ac production is separation from mother 229Th or irradiation of 226Ra with protons in a cyclotron. Both the methods have some practical limitations to be applied routinely. 225Ac can be also produced by irradiation of natural thorium with medium energy protons . Cumulative cross sections of 225Ac, 227Ac, 227Th, 228Th formations have been obtained recently. Thorium targets (1-9 g) were irradiated by 114-91 MeV proton beam (1-50 μA) at INR linear accelerator. After dissolution in 8 M HNO3 + 0.004 M HF thorium was removed by double LLX by HDEHP in toluene (1:1). Ac and REE were pre-concentrated and separated from Ra and most fission products by DGA-Resin (Triskem). After washing out by 0.01 M HNO3 Ac was separated from REE by TRU Resin (Triskem) in 3 M HNO3 media. About 6 mCi 225Ac were separated in hot cell with chemical yield 85%. The method may be upscaled for production of Ci amounts of the radionuclide. The main impurity is 227Ac (0.1% at the EOB) but it does not hinder 225Ac from being used for medical 225Ac/213Bi generators. (author)

  8. 226Ra i 228Ra in Croatian Rivers

    Results of 226Ra and 228Ra in Croatian river waters are presented in this paper. The presence of natural radionuclides in the Croatian rivers emphasizes the need for continuous monitoring. 226Ra and 228Ra were chosen as a possible source of human exposure to radioactivity due to their high radio-toxicity. River water samples (50 L) were collected from the Danube, Drava, Sava, Krka and Neretva rivers twice a year from 2002 to 2006. Activity concentrations of 226Ra ranged from 6.54 mBq L-1 to 59.44 mBq L-1 and 228Ra activity concentrations ranged from 2.57 mBq L-1 to 20.76 mBq L-1. The highest values of both 226Ra and 228Ra were measured in the Drava river, and the lowest values in the Sava river. Statistically significant differences were not observed between radium concentrations from two watersheds (the Black Sea and the Adriatic Sea watershed), nor between 226Ra/228Ra ratio in rivers individually. The number of collected samples is insufficient to make statistically significant conclusions. Further investigation is necessary to obtain larger number of samples. However, the data obtained in this study could be the baseline for evaluating possible future changes.(author)

  9. Light output of EJ228 scintillation neutron detectors

    Stevanato, L., E-mail: luca.stevanato@pd.infn.i [Dipartimento di Fisica dell' Universita di Padova, Via Marzolo 8, I-35131 Padova (Italy); Fabris, D. [INFN Sezione di Padova, Via Marzolo 8, I-35131 Padova (Italy); Hao, Xin [Dipartimento di Fisica dell' Universita di Padova, Via Marzolo 8, I-35131 Padova (Italy); Lunardon, M.; Moretto, S. [Dipartimento di Fisica dell' Universita di Padova, Via Marzolo 8, I-35131 Padova (Italy); INFN Sezione di Padova, Via Marzolo 8, I-35131 Padova (Italy); Nebbia, G.; Pesente, S. [INFN Sezione di Padova, Via Marzolo 8, I-35131 Padova (Italy); Sajo-Bohus, L. [Universidad Simon-Bolivar, Laboratorio Fisica Nuclear, Apartado 8900, 1080 A. Caracas (Venezuela, Bolivarian Republic of); Viesti, G. [Dipartimento di Fisica dell' Universita di Padova, Via Marzolo 8, I-35131 Padova (Italy); INFN Sezione di Padova, Via Marzolo 8, I-35131 Padova (Italy)

    2011-02-15

    The light output of neutron detectors based on the plastic scintillator EJ228 is studied as a function of neutron energy using a time tagged {sup 252}Cf source. Calibration of the light output scale is performed by fitting the experimental distribution of Compton scattering events of photons from a {sup 22}Na source with a response function obtained by Gaussian smearing of the predicted line-shape. The light output curve as well as the pulse height resolution for the EJ228 scintillators is very close (within 5%) to those recently reported for NE213 type organic liquid scintillators.

  10. Gamma spectrometry used for analysis of 228Ra in water

    A methodology for determination of the natural isotope 228Ra in water by using the characterization of the underground and superficial waters from thorium an rare earths mineralization at Morro do Ferro, Pocos de Caldas, state of Minas Gerais, Brazil. The values determined for the 228Ra in water from 5 logging holes ranged from 0.5 to 391.2 pCi/l and the superficial waters presented a variation of 1.0 to 13.9 pCi/l

  11. 48 CFR 52.228-11 - Pledges of Assets.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Pledges of Assets. 52.228... Pledges of Assets. As prescribed in 28.203-6, insert the following clause: Pledges of Assets (SEP 2009) (a... bond, or a payment bond— (1) Pledge of assets; and (2) Standard Form 28, Affidavit of Individual...

  12. 48 CFR 52.228-9 - Cargo Insurance.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Cargo Insurance. 52.228-9... Insurance. As prescribed in 28.313(a), insert the following clause: Cargo Insurance (MAY 1999) (a) The..., cargo insurance of $_____ per vehicle to cover the value of property on each vehicle and of $_____...

  13. 48 CFR 452.228-71 - Insurance Coverage.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Insurance Coverage. 452... FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and Clauses 452.228-71 Insurance Coverage. As prescribed in 428.310, insert the following clause: Insurance Coverage (NOV 1996) Pursuant...

  14. 48 CFR 3452.228-70 - Required insurance.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Required insurance. 3452... 3452.228-70 Required insurance. As prescribed in 3428.370, insert the following clause in all solicitations and resultant cost-reimbursement contracts: Required Insurance (AUG 1987) (a) The contractor...

  15. 32 CFR 228.16 - Soliciting, vending, and debt collection.

    2010-07-01

    ... Raising Within the Federal Service,” issued by the U.S. Office of Personnel Management under Executive Order 12353, 47 FR 12785, 3 CFR, 1982 Comp., p. 139, or by other federal laws or regulations; and (b... (CONTINUED) MISCELLANEOUS SECURITY PROTECTIVE FORCE § 228.16 Soliciting, vending, and debt...

  16. 36 CFR 228.108 - Surface use requirements.

    2010-07-01

    ...) Control water runoff; (iii) Remove, or control, solid wastes, toxic substances, and hazardous substances... resources. The operator shall treat or dispose of produced water, drilling fluid, and other waste generated... MINERALS Oil and Gas Resources Authorization of Occupancy within A Leasehold § 228.108 Surface...

  17. 48 CFR 1352.228-70 - Insurance coverage.

    2010-10-01

    ... FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 1352.228-70 Insurance coverage. As prescribed in 48 CFR 1328.310-70(a), insert the following clause: Insurance Coverage (APR 2010... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Insurance coverage....

  18. 36 CFR 228.48 - Appraisal and measurement.

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Appraisal and measurement... MINERALS Disposal of Mineral Materials General Provisions § 228.48 Appraisal and measurement. (a) Appraisal... weight equivalent. In all cases the units of measurement must correspond to the units used in...

  19. 48 CFR 1852.228-71 - Aircraft flight risks.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Aircraft flight risks. 1852... 1852.228-71 Aircraft flight risks. (a) As prescribed in 1828.311-2, insert the following clause: Aircraft Flight Risks (DEC 1988) (a) Notwithstanding any other provision of this contract...

  20. Separation of 228Ra (Ms Th 1) from thorium nitrate

    Treatment of 135 kg of thorium nitrate (purified and recrystallized in 1958) has been made for extraction of 228Ra in equilibrium. Elimination of the preponderant part of thorium by solvent extraction (TBP) and last purification by chromatography (Dowex 50 W X 8 and 1 X 8). Total yield was about (38 ± 4) per cent. (authors)

  1. 4 CFR 22.8 - General Discovery Procedures [Rule 8].

    2010-01-01

    ... OFFICE CONTRACT APPEALS BOARD § 22.8 General Discovery Procedures . (a) General policy and methods of... admissions; and requests for production of documents, electronically stored information, other tangible..., electronically stored information, or other tangible things, and the identity and location of persons...

  2. 36 CFR 228.11 - Prevention and control of fire.

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Prevention and control of... AGRICULTURE MINERALS Locatable Minerals § 228.11 Prevention and control of fire. Operator shall comply with... prevent and suppress fires on the area of operations and shall require his employees, contractors...

  3. 40 CFR 228.9 - Disposal site monitoring.

    2010-07-01

    ... that changes in frequency or scope are necessary or desirable, trend assessment and baseline surveys... FOR THE MANAGEMENT OF DISPOSAL SITES FOR OCEAN DUMPING § 228.9 Disposal site monitoring. (a) The... appropriate, may include baseline or trend assessment surveys by EPA, NOAA, other Federal agencies,...

  4. Unexpectedly high activity of 228Th in excretion samples following consumption of Brazil nuts

    A worker provided a routine faecal sample for plutonium and americium analysis. In the course of this analysis 500 mBq of 228Th was discovered. There seemed no credible occupational route for intake of thorium. Further investigation revealed that the worker consumed ∼25 g d-1 of nuts, including Brazil nuts. A sample of these nuts was analysed and found to contain activities of 228Th in sufficient quantity to account for the faecal activity. However, follow-up urine samples taken from the worker showed 0.6-0.7 mBq of 228Th. The intake of 228Th via nuts is insufficient to account for this activity in urine. However, it is likely that the intake of 228Th was accompanied by similar activity of the parent 228Ra, and biokinetic calculations show that decay of 228Ra in vivo would produce sufficient 228Th to account for the observed urine activity. (authors)

  5. BIPM comparison BIPM.RI(II)-K1.Th-228 of activity measurements of the radionuclide 228Th

    Michotte, C.; Ratel, G.; Courte, S.; Lucas, L.; Kossert, K.; Nähle, O.; Ott, O.

    2016-01-01

    Since 1986, two national metrology institutes (NMI) have submitted two samples of known activity of 228Th to the International Reference System (SIR) for activity comparison at the Bureau International des Poids et Mesures (BIPM), with comparison identifier BIPM.RI(II)-K1.Th-228. The values of the activity submitted were about 300 kBq and 2 MBq. A key comparison reference value (KCRV) has been evaluated for the first time for 228Th. There is only one result remaining in the BIPM.RI(II)-K1.Th-228 comparison, the 1986 NIST result being outdated. The degrees of equivalence between each equivalent activity measured in the SIR and the KCRV have been calculated and the results are given in the form of a table. A graphical presentation is also given. Main text To reach the main text of this paper, click on Final Report. Note that this text is that which appears in Appendix B of the BIPM key comparison database kcdb.bipm.org/. The final report has been peer-reviewed and approved for publication by the CCRI, according to the provisions of the CIPM Mutual Recognition Arrangement (CIPM MRA).

  6. Marine radioactivity concentration in the Exclusive Economic Zone of Peninsular Malaysia. 226Ra, 228Ra and 228Ra/226Ra

    The present occurrence of 226Ra and 228Ra in marine sediment core and fish from the Exclusive Economic Zone in the east coast of Peninsular Malaysia were studied. Sediment core and biota in respectively was collected using multicorer device and purchased from local fishermen at identified stations during the cruise expedition conducted in 2008. The purpose of this study was to determine and to make available an inventory of activity concentration levels and activity ratio for these radionuclides in this region. The activity concentrations of 226Ra and 228Ra in sediment core and edible part of fish were ranged between 15.9-46.5 and 27.7-87.1 Bq/kg dry wt and; 0.80-2.13 and 228Ra/226Ra in sediment core and fish were varied with the range between 1.63-2.09 and 0.45-2.38, respectively. Refer to those ranges the activity concentrations of radium isotopes were comparable with other region. Thus, it can be concluded that the occurrence of radium isotopes mainly supplied from terrestrial sources and the factors of assimilation efficiency and transfer coefficient of radium may probably effect to the variation activity concentration of 226Ra and 228Ra and its activity ratio in edible part of pelagic and demersal fish obtained in this study. (author)

  7. 48 CFR 1452.228-72 - Liability for Loss or Damage-Department of the Interior.

    2010-10-01

    ... Damage-Department of the Interior. 1452.228-72 Section 1452.228-72 Federal Acquisition Regulations System DEPARTMENT OF THE INTERIOR CONTRACT MANAGEMENT SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 1452.228-72 Liability for Loss or Damage—Department of the Interior. As prescribed...

  8. 226Ra and 228Ra activities in French foodstuffs

    The activities of 228Ac and 214Bi in French foodstuffs acquired during the last 15 years allow one to obtain reference values of 228Ra and 226Ra activities which are usable to assess the dose to the French population due to the intake of these two natural radionuclides. As expected, because of similar 238U and 232Th activities in French soils (around 40 Bq.kg-1), the 226Ra/228Ra activity ratio in French terrestrial foodstuffs is close to 1. Most kinds of foodstuffs present similar mean activities: from 0.1 to 0.2 Bq.kg-1 fresh for cereals, leafy vegetables, root vegetables, eggs and fishes (marine and freshwater). The activity in fruits is lower, around 0.05 Bq.kg-1, similar to that of meat calculated on the basis of the numerous grass measurement results. The lowest activities are noticeable for milk: around 0.015 Bq.L-1. All these values are in good agreement with the data from various countries, but most often 2 to 3 times higher than the reference values proposed by UNSCEAR. This study also shows that due to the large variability of foodstuff activities reported by a large amount of data, it is not possible to distinguish the activities of samples from regions with a gap of only a factor of 2 between their soil activities. (authors)

  9. Determination of shell deposition rates of Arctica islandica from the New York Bight using natural 228Ra and 228Th and bomb-produced 14C

    Shell deposition rates of specimens of Arctica islandica (Mollusca: Bivalvia) from the New York Bight were determined using natural 228Ra and 228Th and bomb 14C. The specimens from deep (>55 m) offshore waters show annual growth banding. A shell obtained from the inner bight at <30-m depth seems to be younger than indicated by band counting

  10. Determination of {sup 228}Th, {sup 232}Th, and{sup 228}Ra in wild mushroom from a naturally high radioactive region in Brazil

    Rosa, Mychelle M.L.; Taddei, Maria Helena T.; Silva, Marco A.; Ferreira, Marcelo T., E-mail: mychelle@cnen.gov.b, E-mail: mhtaddei@cnen.gov.b, E-mail: masilva@cnen.gov.b, E-mail: ferreira@cnen.gov.b [Brazilian Nuclear Energy Commission (LAPOC/CNEN-MG), Pocos de Caldas, MG (Brazil). Lab. of Pocos de Caldas; Maihara, Vera A., E-mail: vmaihara@ipen.gov.b [Nuclear and Energy Research Institute (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2011-07-01

    Mushrooms are fungi which efficiently accumulate radionuclides, as verified by radiochemistry analyses of specimens collected in contaminated areas, specifically after the Chernobyl nuclear accident. Many studies have demonstrated that mushrooms can be used in monitoring of ecosystem contamination and quality. The present paper is part of a broader study conducted in the Pocos de Caldas plateau region in Minas Gerais, Brazil, investigating assimilation of natural Uranium and Thorium radionuclide series by mushrooms. This region has elevated natural radioactivity due to the presence of radiological anomalies of volcanic origin. These anomalies are ore bodies containing Uranium and Thorium, the later being highly predominant. Many researchers have been conducted concerning radionuclide incorporation by agricultural products on the plateau. The present paper aims to determine {sup 232}Th, {sup 228}Th, and {sup 228}Ra radionuclides in wild mushrooms collected at different locations in the plateau region. {sup 228}Ra was determined by radiochemical separation using sulphate coprecipitation followed by beta radiometry. {sup 232}Th and {sup 228}Th were determined using anion exchange resin purification followed by alpha spectrometry. Higher values were obtained to {sup 228}Th than to {sup 232}Th. This is due to higher {sup 228}Ra mobility, which decays to {sup 228}Th. The accuracy of the analytical methods employed was evaluated using the reference sample IAEA Soil 327. These methods had high chemical recovery and high sensitivity. It was possible to confirm that mushrooms accumulate radionuclide and so can be used in environmental contamination and quality assessment. (author)

  11. Low-level deterrmination of skeletal 228Ra and 228Th in the presence of gross amounts of 226Ra

    A method is described for determining 228Th (and hence 228Ra) in small samples of human bone when accompanied by many times as much 226Ra. Such determinations are needed for the radiation dosimetry of skeletally-deposited radium 30-50 years after intake of mixtures in unknown proportions of the two isotopes of radium. The only preparation of the bone sample is ashing and dissolution in nitric acid. The short-lived radioactive gas, 220Rn (54.5 seconds), is de-emanated from the solution with nitrogen, which carries it into a 3.8-litre collection chamber. Positively charged ions of 216Po and 212Pb produced by the decay of the 220Rn during its stay in the chamber are collected on a negatively charged electrode in the form of a copper disk, to which is cemented a zinc sulphide phosphor-coated Mylar disk. De-emanation and ion collection continue for up to 24 hours. The electrode is then removed and presented to a second phosphor disk on the window of a photo-multiplier tube. Alpha particles from the collected radioactivity are thus counted with almost 4π geometry, and an initial efficiency is obtained of about 0.3 count per disintegration of 228Th in the solution. Positively charged ions of 218Po and 214Pb from the decay of some 222Rn in the chamber are also collected. The overall efficiency for this is much lower than for the collection of the daughters of 220Rn but, because of the much higher activity of the 226Ra, the initial counting rate is primarily due to its daughters. To make maximum use of all the counting data, they are analysed by a computer method of least squares. In routine use, de-emanation for 1400 minutes, followed by counting for 1400 minutes, permits the measurement of a few tens of fCi of 228Th. The need for correct weighting of very low counting rates is demonstrated. (author)

  12. An implanted $^{228}$Ra source for response characterization of bolometers

    TeO$_{2}$ crystals are used as bolometers in experiments searching for $\\beta-\\beta$- decay without emission of neutrinos. One of the most important issues in this extremely delicate kind of experiments is the discrimination of the background from the real signal. A deep knowledge of the bolometric response to $\\alpha$-particles is therefore needed to recognize and discard them, since it has been proven that $\\alpha$-contamination could be a major contribution in our background budget. We would like to use ISOLDE’s capability of implanting $^{228}$Ra to make a long-lived source feeding several monochromatic $\\alpha$- and recoiling nuclei, with little or no $\\alpha$-peak broadening due to the source itself, for tests of our detectors in Milano and Gran Sasso INFN National Lab

  13. 48 CFR 228.307 - Insurance under cost-reimbursement contracts.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Insurance under cost-reimbursement contracts. 228.307 Section 228.307 Federal Acquisition Regulations System DEFENSE ACQUISITION....307 Insurance under cost-reimbursement contracts....

  14. 49 CFR 1544.228 - Access to cargo and cargo screening: Security threat assessments for cargo personnel in the...

    2010-10-01

    ... threat assessments for cargo personnel in the United States. 1544.228 Section 1544.228 Transportation... COMMERCIAL OPERATORS Operations § 1544.228 Access to cargo and cargo screening: Security threat assessments... paragraph (b) of this section— (1) Each individual must successfully complete a security threat...

  15. Activity concentrations of 226Ra and 228Ra in drilled well water in Finland

    The activity concentrations of 226Ra and 228Ra in drinking water were determined in water samples from 176 drilled wells. 226Ra activity concentrations were in the range of -1 and 228Ra activity concentrations in the range of -1. The mean activity concentration of 226 Ra and 228 Ra were 0.041 and 0.034 Bq l-1, respectively. High radium activity concentrations in drinking water were rare. Only 2-4% of the drilled wells exceeded a 226Ra concentration of 0.5 Bq l-1 and 1-2% of the wells exceeded a 228Ra concentration of 0.2 Bq l-1. These are the activity concentrations that cause a 0.1 mSv annual effective dose for users of drinking water. The maximum annual effective doses from 226Ra and 228Ra for users of drilled wells were 0.21 mSv, and 0.16 mSv respectively. The elevated activity concentrations of 226Ra and 228Ra did not occur simultaneously in the same groundwaters and the correlation between 226Ra and 228Ra was small. (authors)

  16. 228Ra and 226Ra measurement on a BaSO4 co-precipitation source

    One of the most commonly-used methods for determination of 226Ra, particularly in water samples, utilises co-precipitation of Ra with BaSO4, followed by microfiltration to produce a source for alpha counting. This paper describes two extensions to BaSO4 co-precipitation methods which enable determination of 228Ra using the same source. The adaptations presented here do not introduce any contaminants that will affect the separation of radium or alpha counting for 226Ra, and can be used for re-analysis of already existing sources prepared by BaSO4 co-precipitation. The first adaptation uses detection of 228Ac on the source by gamma spectrometry. The detection efficiency is high, allowing analysis of water samples at sufficiently low activity to be suitable in testing for compliance with drinking water quality standards. As 228Ac grows in quickly, taking less than 2 days to reach equilibrium with the 228Ra parent, this can also be useful in radiological emergency response situations. The second adaptation incorporates a method for the digestion of BaSO4 sources, allowing separation of thorium and subsequent determination of 228Th activity. Although ingrowth periods for 228Th can be lengthy, very low detection limits for 228Ra can be achieved with this technique. - Highlights: • We developed two methods for 228Ra measurement on Ba(Ra)SO4 co-precipitation sources. • Measurement by gamma spectrometry using the daughter 228Ac is rapid. • Detection limits are suitable for assessment of drinking water quality. • The second approach uses alpha spectrometry on a separated Th fraction. • This is more sensitive than gamma spectrometry after an ingrowth period greater than about 1 month

  17. 228Ra/226Ra activity ratio in groundwater around Mount Fuji, Japan

    Tagami Keiko

    2012-04-01

    Full Text Available We estimated the groundwater age from 228Ra/226Ra ratios in young groundwater and relevant rocks in the volcanic area of the Kakitagawa River around Mount Fuji, Japan, and compared our results with those from 3H/3He age determination. The groundwater residence time estimated from the 228Ra/226Ra activity ratio in groundwater and relevant rocks agreed well with the 3H/3He age, suggesting that the 228Ra/226Ra ratio of groundwater can be used to estimate residence time of young groundwater in volcanic areas.

  18. Daily intake of /sup 234,235,238/U, /sup 228,230,232/Th and /sup 226,228/Ra by New York City residents

    The daily intake of long-lived alpha-emitting members of the U, Th and Ac series by New York City residents has been estimated from measurements of diet, water and air samples. The total daily intakes from inhalation, food and water consumption in mBq are 18 (234U), 0.7 (235U), 16 (238U), 6 (230Th), 4 (232Th) and 52 (226Ra). From this, we infer that the total daily intakes of 228Th and 228Ra are 4 and 35 mBq, respectively

  19. 29 CFR 779.228 - Types of arrangements contemplated by exception.

    2010-07-01

    ... Coverage Leased Departments, Franchise and Other Business Arrangements § 779.228 Types of arrangements... section 3(s) would not otherwise apply: (a) Any arrangement, whether by agreement, franchise or...

  20. Multipolarity of the 228.5-keV transition in 80Y

    We have unambiguously characterized the deexcitation of the 228.5-keV T1/2=4.7-s isomer in 80Y as an M3 transition. This result determines, in conjunction with other experimental data, the spin and parity of the 228.5-keV isomer and the 80Y ground state as 1- and 4-, respectively. (c) 2000 The American Physical Society

  1. Normal dietary levels of 226Ra, 228Ra, 210Pb, and 210Po for man

    A review of the literature and the results of some recent measurements were presented on the levels in man's diet of the naturally-occurring radionuclides 226Ra, 228Ra, 210Pb, and 210Po. The mean intakes for standard U.S. diets for these nuclides are tabulated. Intakes in other countries are similar to those in the U.S., but in localized populations the 226Ra intake may be 8 or more pCi/day. The contents of 226Ra in diets chosen by individuals ranged from 0.4 to 7 pCi/day. The few data on 228Ra show intake of this nuclide to be about 80% that of 226Ra, except in monazite areas where intakes of up to 160 pCi/day 228Ra are reported, which may be 50 to 100 times that of 226Ra. Drinking water contributes less than 5% of the daily intake, except in special areas

  2. 226Ra and 228Ra in consumable marine organisms from different coastal regions of India

    Marine organism samples were collected from different regions of India. The edible portions after drying and homogenizing kept for 1 month to achieve equilibrium between Radium and its daughter products, were analysed by gamma spectrometry using 50 % HPGe. 226Ra activity was found to be in the range of <0.07-0.736 Bq kg-1 (wet) and 228Ra in the range of <0.082-2.5 Bq kg-1. 228Ra and 226Ra concentrations in different species of organism were different even in the same marine environment. To assess the impact of this activity to human, ingestion dose due to consumption of organisms was calculated and the maximum dose of 2.8 μSv year-1 due to 226Ra and 25.24 μSv year-1 due to 228Ra was observed. (author)

  3. Distribution and flux of 226Ra and 228Ra in the Amazon River estuary

    Measurements of 226Ra and 228Ra in the Amazon River estuary show that desorption from riverborne suspended particulate matter in the estuary increases the riverine flux of both isotopes to the ocean by a factor of approximately 5 over the flux attributable to radium dissolved in the river water alone. The total Amazon flux supplies approximately 0.20% of the 226Ra and approximately 2.6% of the 228Ra standing crops in the near-surface Atlantic (0-200 m). Diffusive flux from estuarine and shelf sediments and desorption from resuspended sediments in the region of the estuary approximately double the estuarine 226Ra concentration and quadruple the estuarine 228Ra concentration above that caused by the dissolved and desorbed river components alone

  4. Measurement of the thorium-228 activity in solutions cavitated by ultrasonic sound

    Ford, R.; Gerbier-Violleau, M. [SNOLAB, 1039 RR-24, Lively ON, P3Y 1N2 (Canada); Vazquez-Jauregui, E., E-mail: ericvj@snolab.c [SNOLAB, 1039 RR-24, Lively ON, P3Y 1N2 (Canada)

    2010-01-18

    We show that cavitation of a solution of thorium-228 in water does not induce its transformation at a faster rate than the natural radioactive decay. We measured the activity of a thorium-228 solution in water before, and after, it was subjected to a cavitation at 44 kHz and 250 W for 90 min in order to observe any change in the thorium half-life. The results were compared to the original activity of the sample and we observed no change. Our results and conclusions conflict with those in a recent paper by F. Cardone et al.

  5. Measurement of the thorium-228 activity in solutions cavitated by ultrasonic sound

    We show that cavitation of a solution of thorium-228 in water does not induce its transformation at a faster rate than the natural radioactive decay. We measured the activity of a thorium-228 solution in water before, and after, it was subjected to a cavitation at 44 kHz and 250 W for 90 min in order to observe any change in the thorium half-life. The results were compared to the original activity of the sample and we observed no change. Our results and conclusions conflict with those in a recent paper by F. Cardone et al.

  6. Measurement of the thorium-228 activity in solutions cavitated by ultrasonic sound

    Ford, R; Vazquez-Jauregui, E

    2009-01-01

    We show that cavitation of a solution of thorium-228 in water does not induce its transformation at a faster rate than the natural radioactive decay. We measured the activity of a thorium-228 solution in water before, and after, it was subjected to a cavitation at 44 kHz and $250 $W for 90 minutes in order to observe any change in the thorium half-life. The results were compared to the original activity of the sample and we observed no change. Our results and conclusions conflict with those in a recent paper by F. Cardone et. al. [Phys. Lett. A 373 (2009) 1956-1958].

  7. 48 CFR 228.311 - Solicitation provision and contract clause on liability insurance under cost-reimbursement...

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Solicitation provision and contract clause on liability insurance under cost-reimbursement contracts. 228.311 Section 228.311 Federal... liability insurance under cost-reimbursement contracts....

  8. 48 CFR 1452.228-7 - Insurance-Liability to Third Persons.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Insurance-Liability to... INTERIOR CONTRACT MANAGEMENT SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 1452.228-7 Insurance—Liability to Third Persons. (a) As prescribed in 1428.311-2, the clause at FAR...

  9. 48 CFR 1352.228-71 - Deductibles under required insurance coverage-cost reimbursement.

    2010-10-01

    ... Provisions and Clauses 1352.228-71 Deductibles under required insurance coverage—cost reimbursement. As prescribed in 48 CFR 1328.310-70(c), insert the following clause: Deductibles Under Required Insurance..., Insurance Coverage, the contractor's deductible is not allowable as a direct or indirect cost under...

  10. The nature of hydrogen bonding in R-2(2)(8) crystal motifs - a computational exploration

    Deepa, Palanisamy; Solomon, R. V.; Vedha, S. A.; Kolandaivel, P.; Venuvanalingam, P.

    2014-01-01

    Roč. 112, č. 24 (2014), s. 3195-3205. ISSN 0026-8976 Institutional support: RVO:61388963 Keywords : NCI plot * hydrogen bonds * R-2(2)(8) motif * organic crystals * NBO * QTAIM analysis Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 1.720, year: 2014

  11. 47 CFR 22.228 - Cellular rural service area licenses subject to competitive bidding.

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Cellular rural service area licenses subject to... Procedures § 22.228 Cellular rural service area licenses subject to competitive bidding. Mutually exclusive initial applications for Cellular Rural Service Area licenses are subject to competitive bidding....

  12. 19 CFR 10.228 - Additional requirements for preferential treatment of brassieres.

    2010-04-01

    ... and other production records, and inventory control records; and (v) Accounting books and documents to..., column 34), or its electronic equivalent, the distinct and unique identifier assigned by CBP to the... percent (or 85 percent, if applicable under 19 CFR 10.228(b)(1)(ii)) of the aggregate declared...

  13. 78 FR 69928 - First Meeting: RTCA Special Committee 228-Minimum Operational Performance Standards for Unmanned...

    2013-11-21

    ... Standards for Unmanned Aircraft Systems AGENCY: Federal Aviation Administration (FAA), U.S. Department of... Unmanned Aircraft Systems. SUMMARY: The FAA is issuing this notice to advise the public of a meeting of RTCA Special Committee 228--Minimum Operational Performance Standards for Unmanned Aircraft...

  14. 78 FR 38093 - First Meeting: RTCA Special Committee 228-Minimum Operational Performance Standards for Unmanned...

    2013-06-25

    ... Standards for Unmanned Aircraft Systems AGENCY: Federal Aviation Administration (FAA), U.S. Department of... Unmanned Aircraft Systems. SUMMARY: The FAA is issuing this notice to advise the public of a meeting of RTCA Special Committee 228--Minimum Operational Performance Standards for Unmanned Aircraft...

  15. 48 CFR 1252.228-71 - Fair market value of aircraft.

    2010-10-01

    ....228-71 Fair market value of aircraft. As prescribed in (TAR) 48 CFR 1228.306-70(a) and (c), insert the following clause: Fair Market Value of Aircraft (OCT 1994) For purposes of the clause entitled “Loss of or... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Fair market value...

  16. 48 CFR 3052.228-92 - Fair market value of aircraft (USCG).

    2010-10-01

    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Fair market value of... PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 3052.228-92 Fair market value of aircraft (USCG). As prescribed in USCG guidance at (HSAR) 48 CFR 3028.306-90(a) and (c), insert the...

  17. 226Ra and 228Ra in consumable marine organisms from different coastal regions of India

    Marine organism samples were collected from different collection centers of eastern and western coastal regions of India. Edible and non edible portions of the organisms were separated. The edible portions were freeze dried, ground, homogenized and filled in air tight plastic boxes and kept for one month to achieve equilibrium between Radium and it daughter products. Later the samples were gamma counted using 50% HPGe and 226Ra and 228Ra activity concentration in the samples were calculated. 226Ra activity was found to be in the range of 0.001 to 0.69 Bq.kg-1 (wet) and 228Ra in the range of 0.001 to 2.5 Bq.kg-1 (wet). 228Ra concentration was observed to be more than 226Ra concentration in the organisms. To follow the impact of this activity to human, dose due to ingestion by consuming the organisms was calculated and was observed as the maximum dose due to 226Ra as 1.93X10-1 μSvy-1 and 1.73 μSvy-1 due to 228Ra. (author)

  18. 40 CFR 228.15 - Dumping sites designated on a final basis.

    2010-07-01

    ... Ocean Dumping Regulations in 40 CFR part 227. (9) Jacksonville, FL Dredged Material Site. (i) Location... practicable alternatives (as defined in 40 CFR 227.16(b)) to open-water disposal in Long Island Sound and that...) Restrictions: See 40 CFR 228.15(b)(4)(vi). (c) Region I Final Other Wastes Sites. (1) No final sites. (2)...

  19. UAS Integration in the NAS Project Overview: RTCA SC-228 Plenary DAA Working Group 5

    Randall, Debra K.

    2014-01-01

    The presentation is intended to allow the public to know and understand NASA's plans for integrated test to allow them the opportunity to provide feedback and suggestions. The integrated testing will support verification and validation of the RTCA SC-228 UAS minimum operation performance standard requirements.

  20. Use of nuclear recoil for separating 228Ra, 224Ra, and 233Pa from colloidal thorium

    By using α-recoil it is possible to separate by dialysis the α disintegration products (224 Ra; 228 Ra) of thorium from colloidal thorium hydroxide.The use of n, γ recoil allows the separation of 233Pa produced by the neutron irradiation of thorium, on condition that the colloidal thorium hydroxide is irradiated in the presence of a dispersing. (author)

  1. 22 CFR 228.03 - Identification of principal geographic code numbers.

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Identification of principal geographic code... § 228.03 Identification of principal geographic code numbers. The USAID Geographic Code Book sets forth the official description of all geographic codes used by USAID in authorizing or...

  2. Development of a low neutron emission 228Th source for the calibration of GERDA

    GERDA (GERmanium Detector Array) is a very-low background experiment under construction at LNGS (Laboratori Nazionali del Gran Sasso, 3400 m.w.e.) in Italy. It is designed to search for the neutrinoless double-β decay using an array of enriched 76Ge detectors. A limit of T1/2=15.1025 y in Phase II of GERDA can be achieved by limiting the background rate to B ≤ 1.10-3 cts/(keV.kg.y). This requires a good understanding and suppression of the background produced by cosmic rays and natural radioactivity. Furthermore neutrons from spontaneous fission and (α,n) reactions in adjacent materials can contribute considerably to the background rate. 228Th has been established as a good calibration source candidate for GERDA due to its γ-emission in the region of interest around Qββ=2.04 MeV. The calibration setup requires that the 228Th source is permanently installed in the setup during data taking in a parking position at 3.5 m above the germanium detector array. Monte Carlo simulations have shown that the γ-background from the calibration source located in its parking position can be suppressed by a Ta absorber. This work investigates the significance of the neutron background induced by (α,n) reactions within the intrinsic components of a commercialy available 228Th calibration source. Furthermore a new type of a 228Th source has been developed in order to reduce the n-rate approximately by two orders of magnitude compared to a commercial 228Th source.

  3. A comparison of the natural survival of beagle dogs injected intravenously with low levels of 239Pu, 226Ra, 228Ra, 228Th, or 90Sr

    The natural survival, relative to properly chosen controls, of 26 beagle dogs injected once intravenously with an average of 0.58 +/- 0.04 kBq 239Pu/kg, 23 dogs injected with 2.31 +/- 0.43 kBq 226Ra/kg, 13 dogs injected with 1.84 +/- 0.26 kBq 228Ra/kg, 12 dogs injected with 0.56 +/- 0.030 kBq 228Th/kg, and 12 dogs injected with 21.13 +/- 1.74 kBq 90Sr/kg was evaluated statistically. The amounts of these radionuclides are related directly to the estimated maximum permissible body burdens for humans suggested in ICRP II (1959). They constitute a level of exposure that initially was assumed to cause no deleterious effects in dogs. This study had two objectives: (1) identification of homogeneous control groups against which to evaluate the survival of the irradiated groups and (2) comparison of the survival characteristics and estimation of mortality or hazard rate ratios for control dogs vs dogs injected with the baseline dosages given above. It was shown, by goodness-of-fit plots, that the Cox proportional hazards model was an appropriate method of analysis. Therefore, covariates that possibly could influence survival were tested for significance. Only the effects of grand mal seizure, which is caused in epileptic dogs by an external stimulus and can be fatal if untreated, were significant (P less than 0.0001). Consequently, in the final model, death from grand mal seizure was considered as accidental. After censoring the dogs dying from grand mal seizure, it was established that the data for the control groups from previous and contemporary experiments could be pooled. The change in hazard rates relative to controls resulting from exposure to the baseline radionuclide level was modest, 1.6 times for 239Pu (P = 0.033), 1.0(4) for 226Ra (P = 0.86), 1.9 for 228Ra (P = 0.035), 2.5 for 228Th (P less than 0.001), and 0.52 for 90Sr (P = 0.041)

  4. Effects of Pseudoalteromonas sp. BC228 on digestive enzyme activity and immune response of juvenile sea cucumber ( Apostichopus japonicus)

    Ma, Yuexin; Sun, Feixue; Zhang, Congyao; Bao, Pengyun; Cao, Shuqing; Zhang, Meiyan

    2014-12-01

    A marine bacterium, Pseudoalteromonas sp. BC228 was supplemented to feed in a feeding experiment aiming to determine its ability of enhancing the digestive enzyme activity and immune response of juvenile Apostichopus japonicus. Sea cucumber individuals were fed with the diets containing 0 (control), 105, 107 and 109 CFU g-1 diet of BC228 for 45 days. Results showed that intestinal trypsin and lipase activities were significantly enhanced by 107 and 109 CFU g-1 diet of BC228 in comparison with control ( P < 0.01). The phagocytic activity in the coelomocytes of sea cucumber fed the diet supplemented with 107 CFU g-1 diet of BC228 was significantly higher than that of those fed control diet ( P < 0.05). In addition, 105 and 107 CFU g-1 diet of BC228 significantly enhanced lysozyme and phenoloxidase activities in the coelomic fluid of sea cucumber, respectively, in comparison with other diets ( P < 0.01). Sea cucumbers, 10 each diet, were challenged with Vibrio splendidus NB13 after 45 days of feeding. It was found that the cumulative incidence and mortality of sea cucumber fed with BC228 containing diets were lower than those of animals fed control diet. Our findings evidenced that BC228 supplemented in diets improved the digestive enzyme activity of juvenile sea cucumber, stimulated its immune response and enhanced its resistance to the infection of V. splendidus.

  5. The use of Pb-210/Ra-226 and Th-228/Ra-228 dis-equilibria in the ageing of otoliths of marine fish

    Naturally-occurring isotopes of radium are ideally suited as tracers for chemical uptake in the calcified tissues of marine organisms since radium is a water soluble, bio-geochemical analogue for calcium. Assays designed to exploit this uptake mechanism can be used to determine the longevity of certain species of fish. Measurements of Pb-210/Ra-226 disequilibria in the otoliths of redfish have revealed that this species of fish can live to ages in excess of 75 years in coastal waters off Nova Scotia, Canada. Measurements of the Th-228/Ra-228 disequilibria in the otoliths of the much shorter-lived silver hake and flying fish may provide estimates of longevity on time scales of 0-10 years, which could then be used to evaluate the accuracy of currently-used ageing models based on otolith annulus counts. Age determinations of fish based on natural radioisotopes can result in significant improvements in the assessment and management of certain fisheries resources. (author)

  6. Determination of 232Th, 230Th and 228Th in liquid effluents from uranium mining

    A liquid scintillator αlpha spectrometer was built for the determination of Th-228, Th-230 and Th-232 in liquid effluents from Uranium mines and mills. The resolution of the αlpha spectrometer was found to be 200-300 KeV, when the scintillator was 8% T0P0, 0,77% scintimix-4 (91% PP0 and 9% Dimetil-P0P0P) and 10% of naphthalene in toluene. Aliquat-336 in xylene (30% v/v) was used to separate the thorium isotopes from other interfering radionuclides (U-238, U-234, Ra-226, Po-210). Under the extraction experimental conditions, the detection limits were 1,2 pCi/1 for Th-232, 1,2 pCi/1 for Th-230 and 0,9 pCi/1 for Th-228, for 1000 minutes of counting time. (author)

  7. Distribution of 14C, 90Sr and 228Th in an elephant tusk

    The period of date of death of an elephant can be assessed by analyzing four different radionuclides, 14C, 90Sr, 228Th and 232Th in its ivory. These nuclides are supposed to have variing concentrations at different parts of a tusk. The reason is the procedure of growth which takes place at the butt-site of a tusk. Therefore the site of sampling could have a big influence on the assessed date of death. However, to find out if the position of sampling is important a complete tusk was analyzed regarding the distribution of these nuclides. Results show that the concentration activity of 14C and 228Th varies in different parts of a tusk. The activity concentration of 90Sr is very similar in all analyzed parts. The conclusion is that sampling at the butt of a tusk is recommended for age assessment. (author)

  8. 226Ra, 228Ra and 40K in scales from boilers of industrial installations

    The purpose of this work was to determine concentrations of 226Ra, 228Ra and 40K in scales generated inside industrial boilers. Radionuclide activities were determined by high resolution gamma-ray spectrometry. Activity concentrations of 226Ra were in the range of 3.0 (22) to 1300 (6) Bq kg-1 and 228Ra activity concentrations varied from /2.0 Bq kg-1 (Minimum detectable activity concentration) to 266 (3) Bq kg-1. Activity concentrations of 40K were in the range of /15 Bq kg-1 (Minimum detectable activity concentration) to 290 (5) Bq kg-1. Activity concentrations were lower than the limits established by the Brazilian Commission of Nuclear Energy. (author)

  9. Study for 228Th reduction in thermal reactor with Th-U fuel cycls

    1999-01-01

    By using computercode WIMS/CENDL, the effects of some parameters, core configuration such as fuel element structure, neutron flux and burn-up, are discussed in thispaper.It is shown that high neutron flux, small fuel rod diameter,large volume ratio of coolant to fuel, seed-blank heterogeneous corearrangement and 231Pa chemical separation are necessary for reducing 228Th production in reactor.

  10. THE REMOVAL OF REACTIVE RED 228 DYE FROM AQUEOUS SOLUTIONS BY CHITOSAN-MODIFIED FLAX SHIVE

    Hao Feng; Jian Li; Lijuan Wang

    2011-01-01

    Flax shive (FS) is a byproduct from flax fiber separation. The use of absorbent prepared from chitosan-modified flax shive (CFS) has been studied for removal of reactive red dye (RR228) from aqueous solutions. CFS was characterized by the Brunauer-Emmett-Teller (BET) method, Scanning Electron Microscopy (SEM), Fourier Transform Infrared spectrometry (FTIR), and X-ray photoelectron spectroscopy (XPS). A batch adsorption study was conducted under various contact time, initial concentration, sol...

  11. 22.8 GHz Substrate Integrated Waveguide Analog Frequency Divide-by-3 Circuit

    Georgiadis, Apostolos; Collado, Ana; Niotaki, Kyriaki

    2015-01-01

    A 22.8 GHz analog frequency divide-by-3 circuit is presented based on an injection locked oscillator. Substrate integrated waveguide (SIW) technology is used to implement the input and output sections of the frequency divider circuit. The input SIW section at the gate of the active device permits the introduction of the injection signal at the third harmonic frequency of the oscillator, while the output section is designed to maximize the DC-RF conversion efficiency of the oscillator circuit....

  12. 226Ra and 228Ra activity measurement on soil surface in Bagan Lalang, Selangor

    Six stations had selected from Sungai Sepang Kechil, Selangor during Mac, September and October 2004 for sediment analysis. The results showed a significant difference among the 226Ra and 228Ra activities (P 226Ra and 228Ra have obtained during the sampling on Mac, which show the average activities 161.30 Bq kg-1 and 466.88 Bq kg-1, respectively. Meanwhile, 226Ra activities obtained on September and October are in the average of 24.77 Bq kg-1 and 69.22 Bq kg-1, respectively. Average activities of 228Ra are 73.13 Bq kg-1 and 1284.58 Bq kg-1, respectively for September and October. Northeast Monsoon effect might cause the higher activities of radium isotopes during sampling on Mac. Sediments from Bagan Lalang are sandy type with a limited size variation. Furthermore, radium isotopes are more adsorbed on the particles sediments between size 63 - 125 μm, which usually rich in alkaline feldspar.(author)

  13. Concentration Of 228Th, 226Ra, And 40K Radionuclides In Drinking Water In Southern Sumatera

    Measurements of 228 Th, 226 Ra, and 40 K concentrations in drinking water on several places in Southern Sumatera (1997-1999) have been carried out. The sample were collected from the Province of Lampung (Kalianda, Bandar Lampung, Kotabumi, Talangpadang, Kotaagung, Liwa, Manggala, and Pakuanratu), and the Province of Southern Sumatera (Palembang-1, Palembang-2, Plaju, Lahat, and Sekayu). Measurements of 228 Th, 226 Ra, and 40 K concentrations in drinking water using the gamma spectrometer with the HP-Ge detector. The results of measurement showed that the concentration was the range of undetectable (228 Th concentration, the range of undetectable (226 Ra, radionuclide and the range of undetectable (< 128.96 mBq/l) to (880.54 n 22.75) mBq/l with average of (412.12 n 5.02) mBq/l, and the data mentioned above were still far under the maximum permissible concentration. The estimated of annual dose equivalent effective in drinking water was 0.03 mSv/year for public (5 mSv/year)

  14. Development of sequential analytical method for the determination of U-238, U-234, Th-232, Th-230, Th-228, Ra-226 and Ra-228 and its application in mineral waters

    A sequential analytical method for the determination of U-238, U-234, Th-232, Th-230, Th-228, Ra-226 and Ra-228 in environmental samples and applied to the analysis of mineral waters is studied. Thorium isotopes are coprecipitated with lanthanium fluoride before counting in alpha spectrometer, the uranium isotopes are determined by alpha spectrometry following extraction with TOPO onto a polymenic membrane. Radium-226 is determined with the radom emanation technique. (M.J.C.)

  15. Development of an analytical method for the determination of U-238, U-234, Th-232, Th-230, Th-228, Ra-228, Ra-226, Pb-210 and Po-210 and its application on environmental samples

    A comparison between the environmental impact by nuclear facilities with the burden suffered from natural radioactivity calls for studying the long-lived radionuclides of the U-238 and Th-232 decay series U-238, U-234, Th-232, Th-230, Th-228, Ra-228, Ra-226, Pb-210 and Po-210. This work describes the development of a fast isotope dilution analysis method allowing to separate with one sample solution U, Th, Ra, Pb and Po both from each other and, at the same time, from the matrix. To test its applicability, the method was used with samples consisting of soil, sediments, plants, water, carbon and air dust filter. The detection limit for the chemical yield attained of approx. 70% was 0.27 mBq per sample for Th-232, Th-230, Th-228, U-238, U-234 and Po-210. The detection limit for Pb-210 was 10 mBq per sample. On account of the influence by Ra-226 in the Ra-228 measurement and vice versa the detection limit is a function of the Ra-226 and Ra-228 concentrations, respectively, in the sample. The detection limits for the pure nuclides are 0.9 mBq per sample and 10 mBq per sample, respectively, for Ra-226 and Ra-228. (orig./HP)

  16. Normal dietary levels of radium-226, radium-228, lead-210, and polonium-210 for man

    A review of the literature and the results of some recent measurements on the levels in man's diet of the naturally occurring radionuclides 226Ra, 228Ra, 210Pb, and 210Po are presented. Intakes in other countries are similar to those in the United States, but in localized populations the 226Ra intake can be 8 or more pCi/day. The few data on 228Ra show that intake of this nuclide is about 80% that of 226Ra except in monazite areas where intakes of up to 160 pCi 228Ra/day are reported. Drinking water contributes less than 5% to daily intake except in special areas. For 210Pb, higher levels have been noted for Germany and the Union of Soviet Socialist Republics than for the United States. Persons in the Arctic who consume reindeer or caribou meat may ingest 210Pb at the rate of 10 to 40 pCi/day. Normal dietary levels of 210Po are about 20 to 30% higher than those of 210Pb, except in the Arctic. The levels of these nuclides in classes of foods are compared to show that the higher levels observed in certain diets are due to the levels in particular foods. Because of the high levels of 210Pb intake in Japan, total skeletal dose rates in that country are estimated to be more than twice those in the United States. The use of dietary intake for estimating metabolic parameters, such as intestinal absorption of 226Ra and 210Pb, is discussed

  17. Non-stochastic effects of 226Ra and 228Ra in the human skeleton

    Results are reported of a comparative evaluation of the non-neoplastic changes that have been observed radiographically in the bones of two groups of former radium dial workers, one comprising 201 women exposed predominantly to 226Ra and the other comprising 159 women exposed predominantly to 228Ra at a median age of 18 years. The characteristic changes range through progressively larger and more frequent foci of both decreased and increased bone density (radiolucent and dense bone necrosis). Criteria developed in earlier studies were used to assign a numerical score to the changes seen in each individual. The score was used as a quantitative measure of bone necrosis. The long bones contributed the major portion of the total score for the skeleton, with the radii and ulnae showing the highest score on the basis of relative bone mass. The ribs and vertebrae, which account for 20% of the total bone mass, contributed 25 advanced degree of severity. At intakes of either radium isotope below 10 μCi, no changes above minimal were observed, and the mean score was about the same as the mean of about 0.2 observed in a group of 120 matched control subjects. At intakes below 100 μCi, mean scores per year post exposure were predicted by 0.0016 I, where I is the systemic intake in μCi of either 226Ra or 228Ra. For 50 year 226Ra or 228Ra workers with annual systemic intakes at the ICRP limit of about 0.4 μCi, the predicted mean score at about 50 years is 1.0. (author)

  18. Migration of 226 Ra, 228 Ra, 210 Pb, U and Th from phosphogypsum

    The physico-chemical availability of radioactive elements (210 Pb, 226 Ra, 228 Ra, Th and U) in Brazilian phosphogypsum was investigated in a large scale leaching experiment carried out in lysimeters, using phosphogypsum samples (approximately 1.2 tons) from two phosphoric acid industries. Lysimeters were built using cylindrical concrete containers with 0.9 m inner diameter and 2 m depth. The bottom of the lysimeter was filled with a 10 cm layer of gravel covered with geomembrane sheet. Under this layer a pipe was designed to drain the percolated water. Three lysimeters were filled with phosphogypsum from each industry and a mixture of both. As percolated water comes exclusively from the rain, sample was collected daily when available. Samples were then pooled weekly, carefully prepared and submitted to radiochemical analysis. Radiochemical characterization of phosphogypsum and percolated water was performed by radiochemical separation followed by gross alpha and beta counting (226 Ra, 228 Ra and 210 Pb) and UV-Vis spectrophotometry with Arsenazo III (U and Th). This experiment was carried out from 12/01/1999 to 01/22/2001, with a precipitation of 2,732 mm. It was observed that approximately 40% (534 L) of the rain fall percolated through the lysimeter 1. The analysis of 22 samples of percolated water from lysimeter 1 showed mean radionuclides activities of 70±30 mBqL-1, 70±50 mBqL-1, 100±60 mBqL-1 and 110±55 mBqL-1 for U, 226 Ra, 228 Ra and 210 Pb, respectively. Thorium activities were below detection limit. (author)

  19. Distribution of Th-230 and Th-228 in foods(II)

    Kang, Hee Dong; Kim, Wan; Lim, S. K.; Lee, S. A.; Choi, M. S.; Zheng, Y. C. [Kyungpook National Univ., Daegu (Korea, Republic of); Kim, Do Sung [Daegu Univ., Daegu (Korea, Republic of)

    2004-02-15

    Natural radioisotopes contained in foods can enter the human body by ingestion and contribute to internal doses to the population. It is necessary to measure the concentration of natural radioisotopes especially thorium in Korean foods and estimate the internal doses. In this study, we have established the thorium measuring process based on the thorium extraction chemical process and alpha spectroscopic method. The concentration of Th-228, Th-230 and Th-232 in Korean vegetables (potato, sweet potato, radish, cabbage, hot pepper, garlic, onion and pumpkin) and fruits(apple, persimmon, orange, pear, grape) are measured and their internal doses are estimated.

  20. Surface water mixing estimated from {sup 228}Ra and {sup 226}Ra in the northwestern North Pacific

    Kawakami, Hajime [Mutsu Institute for Oceanography, Japan Agency for Marine-Earth Science and Technology, 690 Aza-kitasekine Oaza-sekine, Mutsu, Aomori 035-0022 (Japan)], E-mail: kawakami@jamstec.go.jp; Kusakabe, Masashi [Department of Ocean Research, Japan Agency for Marine-Earth Science and Technology, 2-15 Natsushimacho, Yokosuka 237-0061 (Japan)], E-mail: masashi@nirs.go.jp

    2008-08-15

    We investigated the horizontal distributions of {sup 228}Ra and {sup 226}Ra in surface waters of the northwestern North Pacific Ocean and Okhotsk Sea. Ratios of {sup 228}Ra/{sup 226}Ra were relatively large in the Tsugaru Current (0.6-0.8) and Okhotsk Sea (0.4-0.5), and small in the Western Subarctic Gyre (<0.2) and the Oyashio (0.25-0.3). {sup 228}Ra/{sup 226}Ra ratios in western Subarctic Water (SAW) rose slightly upon mixing with Okhotsk Water (OKW), before becoming the Oyashio Water (OYW). Also, ratios in the OYW increased during mixing with Tsugaru Current Water (TCW). Estimating from {sup 228}Ra/{sup 226}Ra ratios and {sup 226}Ra activities with a simple two-end members-mixing model, we assumed that approximately 23% of the OYW originated from the OKW and the coastal region off northern Honshu (Japan) was strongly influenced by the TCW. From a diagram of {sup 228}Ra activities against salinity, we could roughly divide surface seawater in the study area into the five water masses, which were SAW, OYW, OKW, TCW, and Subtropical Water (STW)

  1. MRP-227/228 component inspections supporting nuclear power plant license renewal

    Highlights: • Inspections meeting the new requirements of MRP-227/228 are presented. • These inspections allow utilities to comply with requirements for license extension. • Modeling results for UT inspection methods are presented. • Defects down to 1% cross-sectional area were detected in a blind demonstration. • All MRP-required demonstrations were successfully passed. - Abstract: As the world’s nuclear reactor fleet continues to age, the importance of verifying the structural integrity of critical reactor components and systems has continued to increase. Some critical components are the reactor internals found in close proximity to the nuclear fuel rods which are exposed not only to high stresses and temperatures, but also to high radiation and neutron fluxes. The Materials Reliability Program (MRP-227/228) has provided guidance indicating which components are of the highest importance and susceptibility to the aging mechanisms found in nuclear reactors. These components must be either inspected or replaced in order for plants to be granted license renewals to continue commercial operations. Several inspection methods are presented that were successfully demonstrated and comply with these new guidelines to meet the requirements for license renewal

  2. Distribution of Th-232 and Th-228 in Santos and Sao Vicente Estuary, Sao Paulo, Brazil

    Silva, P.S.C.; Mazzilli, B.P.; Favaro, D.I.T. [Instituto de Pesquisas Energeticas e Nucleares, Av. Lineu Prestes, 2242, Caixa Postal 05508-000, Cidade Universitaria, Sao Paulo (Brazil)]. e-mail: Pscsilva@ipen.br

    2004-07-01

    In the last decades considerable attention has been given to technologically enhanced natural occurring radioactive material (TENORM). Within this frame, of particular concern is the phosphate fertilizer industry. Santos Basin, located in Southwest Brazil, Sao Paulo State, comprising Santos and Sao Vicente estuarine system, is considered the most important industrial region of the country. Among the industrial activities present, phosphate fertilizer plants are responsible for the production of 69 millions tons of phosphogypsum waste, which is stockpiled in the surrounding environment. This waste concentrates radionuclides of the natural series originally present in the phosphate rock used as raw material. This study aims to evaluate the environmental impact of such activities in the sediments of the estuarine system. {sup 232} Th and {sup 228} Th concentrations in Santos and San Vicente estuary sediments were determined by Neutron activation analysis and Gamma spectrometry, respectively. {sup 232} Th concentration ranged from 6.5 to 198 Bq kg{sup -1} with mean value of 57 {+-} 39 Bq kg{sup -1}, for 42 samples. {sup 228} Th content varied from 12 to 110 Bq kg{sup -1} with a mean value of 74 {+-} 23 Bq kg{sup -1}, for 18 samples. It can be seen that the amount of {sup 232} Th is higher in the rivers close to the phosphogypsum piles, at least five points were identified as being affected by anthropogenic factor. (Author)

  3. Production and characterization of 228Th calibration sources with low neutron emission for GERDA

    Baudis, L.; Benato, G.; Carconi, P.; Cattadori, C.; De Felice, P.; Eberhardt, K.; Eichler, R.; Petrucci, A.; Tarka, M.; Walter, M.

    2015-12-01

    The GERDA experiment at the Laboratori Nazionali del Gran Sasso (LNGS) searches for the neutrinoless double beta decay of 76Ge. In view of the GERDA Phase II data collection, four new 228Th radioactive sources for the calibration of the germanium detectors enriched in 76Ge have been produced with a new technique, leading to a reduced neutron emission rate from (α, n) reactions. The gamma activities of the sources were determined with a total uncertainty of ~4% using an ultra-low background HPGe detector operated underground at LNGS. The neutron emission rate was determined using a low background LiI(Eu) detector and a 3He counter at LNGS. In both cases, the measured neutron activity is ~10-6 n/(sṡBq), with a reduction of about one order of magnitude with respect to commercially available 228Th sources. Additionally, a specific leak test with a sensitivity to leaks down to ~10 mBq was developed to investigate the tightness of the stainless steel capsules housing the sources after their use in cryogenic environment.

  4. Production and Characterization of 228Th Calibration Sources with Low Neutron Emission for GERDA

    Baudis, Laura; Carconi, Pierluigi; Cattadori, Carla Maria; De Felice, Pierino; Eberhardt, Klaus; Eichler, Robert; Petrucci, Andrea; Tarka, Michal; Walter, Manuel

    2015-01-01

    The GERDA experiment at the Laboratori Nazionali del Gran Sasso (LNGS) searches for the neutrinoless double beta decay of 76-Ge. In view of the GERDA Phase II data collection, four new 228-Th radioactive sources for the calibration of the germanium detectors enriched in 76-Ge have been produced with a new technique, leading to a reduced neutron flux from ( alpha; n ) reactions. The gamma activities of the sources were determined with a total uncertainty of 4 percent using an ultra-low background HPGe detector operated underground at LNGS. The emitted neutron flux was determined using a low background LiI(Eu) detector and a 3-He counter at LNGS. In both cases, a reduction of about one order of magnitude with respect to commercially available 228-Th sources was obtained. Additionally, a specific leak test with a sensitivity to leaks down to 10 mBq was developed to investigate the tightness of the stainless steel capsules housing the sources after their use in cryogenic environment.

  5. Production and characterization of 228Th calibration sources with low neutron emission for GERDA

    The GERDA experiment at the Laboratori Nazionali del Gran Sasso (LNGS) searches for the neutrinoless double beta decay of 76Ge. In view of the GERDA Phase II data collection, four new 228Th radioactive sources for the calibration of the germanium detectors enriched in 76Ge have been produced with a new technique, leading to a reduced neutron emission rate from (α, n) reactions. The gamma activities of the sources were determined with a total uncertainty of ∼4% using an ultra-low background HPGe detector operated underground at LNGS. The neutron emission rate was determined using a low background LiI(Eu) detector and a 3He counter at LNGS. In both cases, the measured neutron activity is ∼10−6 n/(s⋅Bq), with a reduction of about one order of magnitude with respect to commercially available 228Th sources. Additionally, a specific leak test with a sensitivity to leaks down to ∼10 mBq was developed to investigate the tightness of the stainless steel capsules housing the sources after their use in cryogenic environment

  6. THE REMOVAL OF REACTIVE RED 228 DYE FROM AQUEOUS SOLUTIONS BY CHITOSAN-MODIFIED FLAX SHIVE

    Hao Feng,

    2011-12-01

    Full Text Available Flax shive (FS is a byproduct from flax fiber separation. The use of absorbent prepared from chitosan-modified flax shive (CFS has been studied for removal of reactive red dye (RR228 from aqueous solutions. CFS was characterized by the Brunauer-Emmett-Teller (BET method, Scanning Electron Microscopy (SEM, Fourier Transform Infrared spectrometry (FTIR, and X-ray photoelectron spectroscopy (XPS. A batch adsorption study was conducted under various contact time, initial concentration, solution pH, and adsorbent dosage. It was found that the BET and Langmuir surface area of CFS were 1.772 m2 g-1 and 3.057 m2 g-1, respectively. Results showed that CFS has the same pores as FS and that the –NH2 group on CFS is the main adsorption site for dye sorption. Equilibrium adsorption capacity could be reached within 480 min, and RR228 uptake was satisfactory at a pH of 2.0. The percentage removal were 100%, 100%, 90%, and 85% at pH 2.0 under dye concentrations of 10 mg/L, 20 mg/L, 30 mg/L, and 40 mg/L, respectively. The adsorption accurately fitted a pseudo-second-order kinetic model and a Langmuir isotherm model. It is proposed that CFS could be applied as a low-cost absorbent in removal of dyes from wastewater.

  7. Optimization of the Extraction Efficiency of a Gas Stopper using a Th-228 Source

    Devanzo, Michael; Alfonso, Marisa C.; Folden, Charles M., III

    2012-10-01

    A gas stopper, or Recoil Transfer Chamber (RTC), for heavy element research has been fabricated at the Cyclotron Institute at Texas A&M University and characterized offline using a Th-228 source. The RTC features a laminar He gas flow and a series of ring and spherical electrodes to efficiently transport heavy ions through an extraction nozzle to an appropriate chemistry set up. Applying a decreasing potential difference across the ring and spherical electrodes creates potential gradients which act as a means of guiding and focusing heavy ions, respectively. By systematically altering potential gradients in the RTC, a determination can be made of the most efficient RTC configuration by using the radioactive recoils from a Th-228 source as a measure of extraction efficiency. An efficiency of up to 70 percent was obtained with the most effective electrode configuration, based on recent offline measurements. This poster will elaborate on RTC experimentation and propose electrode settings for which maximal extraction efficiency may be achieved.

  8. The Stealthy Superbug: the Role of Asymptomatic Enteric Carriage in Maintaining a Long-Term Hospital Outbreak of ST228 Methicillin-Resistant Staphylococcus aureus

    Senn, Laurence; Clerc, Olivier; Zanetti, Giorgio; Basset, Patrick; Prod’Hom, Guy; Gordon, Nicola C.; Sheppard, Anna E.; Crook, Derrick W; James, Richard; Thorpe, Harry A.; Feil, Edward J.; Blanc, Dominique S.

    2016-01-01

    ABSTRACT Whole-genome sequencing (WGS) of 228 isolates was used to elucidate the origin and dynamics of a long-term outbreak of methicillin-resistant Staphylococcus aureus (MRSA) sequence type 228 (ST228) SCCmec I that involved 1,600 patients in a tertiary care hospital between 2008 and 2012. Combining of the sequence data with detailed metadata on patient admission and movement confirmed that the outbreak was due to the transmission of a single clonal variant of ST228, rather than repeated i...

  9. The Stealthy Superbug: The role of asymptomatic enteric carriage in maintaining a long-term hospital outbreak of ST228 methicillin-resistant Staphylococcus aureus.

    Senn, L; Clerc, O; Zanetti, G; Basset, P.; Prod'hom, G.; Gordon, NC; Sheppard, AE; Crook, DW; JAMES, R; Thorpe, HA; Feil, EJ; Blanc, DS

    2016-01-01

    Whole-genome sequencing (WGS) of 228 isolates was used to elucidate the origin and dynamics of a long-term outbreak of methicillin-resistant Staphylococcus aureus(MRSA) sequence type 228 (ST228) SCCmec I that involved 1,600 patients in a tertiary care hospital between 2008 and 2012. Combining of the sequence data with detailed metadata on patient admission and movement confirmed that the outbreak was due to the transmission of a single clonal variant of ST228, rather than repeated introductio...

  10. Concentration of natural radionuclides (40K, 228Ra and 226Ra) in vegetables and fruits collected around Kudankulam, South India

    Baseline activity concentration of the natural radio nuclides 40K, 228Ra and 226Ra in vegetables and fruits was determined around Kudankulam. In many of the samples, 228Ra and 226Ra was below minimum detection limit. 40K was found to be more in leafy vegetables followed by pods, tubers and fleshy fruits. The highest accumulator among the matrices was the leafy vegetables with the geometric mean of 189.47 Bq.kg-1 fresh for vegetables and fruits with the geometric mean of 128.95 Bq.kg-1 fresh. 228Ra activity in vegetables and fruits ranged from 0.074 to 1.153 and 0.074 to 0.131 Bq.kg-l fresh respectively. 226Ra in vegetables and fruits ranged from BDL to 0.07 and BDL-.044 Bq.kg-l fresh respectively. 40K in vegetables and fruits followed a log normal distribution. (author)

  11. Concentration Of Th-228, Ra-226, Cs-137, and K-40 In Soil At Several Places In West Java Province

    Analysis of 228 Th, 226 Ra, 137 Cs, and 40K in the soil samples at several places in West Java Propince have been conducted. The measurements of 228 Th, 226 Ra, 137 Cs, and 40K concentration were done using gamma spectrometer with HP-Ge detector. The aim of the analysis is to obtain base line data on environmental radioactivity at several places in West Java Propince. The results of analysis showed that 228 Th concentration ranges from undetectable (226 Ra concentration ranges from undetectable (137Cs concentration ranges undetectable (40K concentration ranges from undetectable (< 1,36 Bq/kg) to (26,58 Bq/kg) with the average of (15,27 n 0,27 Bq/kg)

  12. An evaluation of 226Ra and 228Ra in drinking water in several counties in Texas, USA

    Naturally Occurring Radioactive Material (NORM) or Technology Enhanced Naturally Occurring Radioactive Material (TENORM) can be a potential health risk. It is now well known that the underlying geology in many parts of Texas has given rise to levels of 226Ra and 228Ra that often exceed the limits set by the US Environmental Protection Agency. A detailed literature search was undertaken to assess the levels of 226Ra and 228Ra in all of the Texas counties. Several statistical evaluations of the data were performed. The Hickory aquifer in the Llano Uplift region of Texas has consistently had the highest number of 226Ra and 228Ra concentrations above the legal limit. As well many of the affected rural communities may not have the financial resources to rectify the problem

  13. Transfer of 226Ra, 228Ra, 210Pb and 210Po in aquatic organisms and food chain

    Objective: To find out the transfer regularities of 226Ra, 228Ra, 210Pb and 210Po, which are natural radionuclides in the aquatic organisms and food chain. Methods: Large amount of breed of representative aquatic products and their living waters and sediments were collected and treated according to routine experimental procedures. The contents of 226Ra, 228Ra, 210Pb and 210Po were detected in each sample. Measured data were analyzed statistically and pairwise comparisons were made to determine the differences between groups. Results: 226Ra, 228Ra and 210Pb were mainly deposited in the bones (or shells), their concentration factors (CF) ranged from 102 to 103; the CF ranged only from 100 to 102 in the flesh. 210Po was mainly deposited in the soft tissues, CF ranged from 102 to 104; especially in the stomachs and intestines of fishes, the value reached 104. The cooking process did not impinge significantly on the transfer of 226Ra, 228Ra and 210Pb in the food chain (P>0.05), but did significantly influence the transfer of 210Po, especially in the freshwater fishes and shrimps. Paired comparison test of the activities between raw flesh and cooked flesh showed very significant difference (P226Ra, 228Ra, 210Pb and 210Po. Even though the bones (or shells) of aquatic organisms contained relatively higher levels of 226Ra, 228Ra and 210Pb, the cooking process does not significantly increase the radioactive contents in the foodstuffs. However, the cooking process does significantly influence the transfer of 210Po. It does significantly increase the content of 210Po in foodstuffs

  14. Novel Mutations L228I and Y232H Cause Nonnucleoside Reverse Transcriptase Inhibitor Resistance in Combinational Pattern.

    Zhang, Xiao-Min; Zhang, Qiwei; Wu, Hao; Lau, Terrence Chi-Kong; Liu, Xuan; Chu, Hin; Zhang, Ke; Zhou, Jie; Chen, Zhi-Wei; Jin, Dong-Yan; Zheng, Bo-Jian

    2016-09-01

    The emergence of drug resistance mutations is increasing after the implementation of highly active antiretroviral therapy. To characterize two novel mutations L228I and Y232H in the primer grip of reverse transcriptase (RT) of HIV-1 circulating recombination form 08_BC (CRF08_BC) subtype, both mutant clones were constructed to determine their impacts on viral phenotypic susceptibility and replication capacity (RC). Results showed that the novel mutation, L228I, conferred a low-level resistance to etravirine by itself. L228I in combination with Y188C displayed a high level of cross-resistance to both nevirapine (NVP) and efavirenz (EFV). The copresence of A139V and Y232H induced a moderate level of resistance to NVP and EFV. Mutations Y188C/L228I, A139V, Y232H, and A139V/Y232H reduced more than 55% of viral RC compared with that of the wild-type (WT) reference virus. Modeling study suggested that the copresence of Y188C/L228I or A139V/Y232H might induce conformational changes to RT, which might result in reduced drug susceptibility and viral RC due to abolished hydrogen bonding or complex interaction with vicinal residues. Our results demonstrated that L228I and Y232H were novel accessory nonnucleoside reverse transcriptase inhibitor resistance-related mutations and provided valuable information for clinicians to design more effective treatment to patients infected with HIV-1 subtype CRF08_BC. PMID:27067022

  15. Determination of 228Th, 226Ra and 40K in Soil Using In-Situ GammaSpectrometer

    Determination of natural radionuclide in latosol soil at six locationsaround PPTN Serpong by using Inspector portable gamma spectrometer with highpurity Germanium detector (HPGe) which has 26% relative efficiency had beenobtained. Radionuclides data of 228Th, 226Ra and 40K were obtained in4 hours, shorter than laboratories analysis which needed 3 weeks. Thedifferences between in-situ measurement and laboratory were 3.6% to 56.2% forsix conditions of soil measured. According to the specific activity dataanalysis using statistic hypothesis, the result shows that the activity of228Th and 226Ra are independent on location, but 40K is dependent onlocation. (author)

  16. Basis document for PFP plutonium nitrate ion exchange process in Room 228A

    The PFP facility currently has approximately 4300 liters of plutonium nitrate solution in storage. This material will be calcined by the Vertical Denigration Calciner (VDC) located in room 230C. However, part of the material needs to be purified to remove constituents that will interfere with the calcination process. An Ion Exchange process using Reillextrademark HPQ anion exchange resin was tested by the Plutonium Process Support Laboratories (PPSL) (I). The Ion exchange process is to be installed in glovebox HC-7 in room 228A/234-5Z. The plutonium separated from the interfering constituents will be in a concentrated condition ready to be calcined by the VDC in room 230C. The oxide product of the VDC will be placed into the 2736-Z vaults for long term storage

  17. Determination of 226 Ra and 228 Ra in mineral spring waters of the Aguas da Prata region

    Concentration levels of 226 Ra and 228 Ra have been analysed in most of the mineral spring waters available in the Aguas da Prata region. The 226 Ra and 228 Ra were determined by coprecipitation with barium sulphate. The 226 Ra was determined by gross alpha counting of the Ba(Ra)SO4 precipitate. The determination of 228 Ra was done by measuring the gross beta activity of the same precipitate. Both measurements were carried out in a low background gas flow proportional counter. Dose calculations were performed in order to evaluate the relative importance of such radionuclides to the radiation exposure due to the ingestion of these waters. Based upon measured concentrations, committed effective doses up to 5.5 x 10-1 mSv/y and 1.0 x 10-2 mSv/y were observed for 226 Ra and 228 Ra, respectively. These results show that 226 Ra is the main contributor to radiation exposure. (author)

  18. Geochemical Speciation of Soil 7Be,137Cs,226Ra and 228Ra as Tracers to Particle Trnsport

    BALZHANGUO; WANGUOJIANG; 等

    1997-01-01

    A brunisolic soil collected from an erosive forest land(HF-1-1) and a yellow soil from and accumulative shallow basin(HF-6-1) in the watershed of Lake Hongfeng (HF) were used for activity measurements of 7Be,137Cs,226Ra and 228Ra in different geochemical speciation.More than 85% of 7Be,137Cs,226Ra and 228Ra in the soils were bound to organic Fe-Mn oxy-hydroxide and residual fractions.They could move with soil particlesw and be used as tracers for the erosion and /or accumulation of soil particles.7Be gohemical specition in the soils agreed with its trace for seasonal particle transport.137Cs geohemial speciaiton was suitable for tracing soil particle accumulation and for sediment aating.226Ra and 228Ra were ombined in crystalline skeleton of clay minerals and mainly remained as residues in the soils and little was bound to the soluble,exchangeable and carbonate fractions.The differentiation of 226 Ra/228Ra activity ratios in different geoheical fractions in the soils could be used as a parameter to trace accumulation and /or erosion of soil particles.

  19. 49 CFR Appendix C to Part 228 - Guidelines for Clean, Safe, and Sanitary Railroad Provided Camp Cars

    2010-10-01

    ..., published at 42 CFR part 72, or is approved for drinking purposes by the State or local authority having...” occur, as defined in 49 CFR 228.101 (c)(3) and (c)(4), respectively. Every reasonable effort should be... serious physical harm. (k) Urinal means a toilet facility maintained within a toilet room for the...

  20. Equilibration of the ground state of 26Al with its isomer at 228 keV under astrophysical conditions

    The renewed interest in the production of 26Al in connection with the study of isotopic ratios in meteorites and with the formation of the solar system forms the basis for studying the equilibration of the ground state of 26Al with its isomer at 228 keV. (orig./AH)

  1. Quantitative laws governing the migration of magnesium, calcium, radium-226, thorium-228 in the link between soils and plants

    Concentrations of magnesium, calcium, radium 226 and thorium 228 in podsolized chernozem and medium-loamy soils and in agricultural plants (wheat, barley, peas, potatoes, beets, and carrots) were determined. Transition coefficients of magnesium, calcium and radium 226 from soils to plants were calculated

  2. Speciation of 226Ra, 238U and 228Ra in an upland organic soil overlying a uraniferous granite

    A sequential chemical extraction procedure was implemented in order to ascertain the chemical speciation of 226Ra, 238U and 228Ra within fractions of an upland organic soil. A number of samples and depth cores were taken from a region where the soil contains elevated levels of these radionuclides. Sequential chemical extractions were employed to identify within which of the three soil phases, namely exchangeable cations, easily oxidisable organic matter or iron oxides, the radionuclides were incorporated. The primary analytical technique was high-resolution gamma ray spectrometry. A number of other chemical parameters likely to affect the mode of occurrence of the radionuclides were also analysed. These included humic acid content, iron and manganese content and cation exchange capacity. Results indicate that the average amount of radionuclides bound as exchangeable cations, expressed as a percentage of the specific activities of each radionuclide, are: 226Ra - 2.13% (S.D. 2.15), 238U - 5.2% (S.D. 4.6) and 228Ra - 12.2% (S.D. 7.0). For easily oxidisable organic matter, the average percentages are: 236Ra - 3.2% (S.D. 3.2), 238U - 21.9% (S.D. 18.4), and 228Ra - 8.5% (S.D. 8.7). Percentages for iron oxides are 226Ra - 8.7% (S.D. 7.5), 238U - 54.8% (S.D. 22.2) and 228Ra - 19.7% (S.D. 12.9). N equals 17 in all cases. The results indicate that the primary factor controlling U238 accumulation, and to a lesser extent 226Ra and 228Ra, is the redox condition of the peat. Release of radionuclides from the peat could possibly occur via changes in the redox status as a result of activities such as forestry or drainage of the peat. (orig.)

  3. Seasonal variation of 228Ra/226Ra ratio in seaweed: implications for water circulation patterns in coastal areas of the Noto Peninsula, Japan

    To examine water circulation patterns of coastal water, 72 seaweed (Sargasso) samples and 27 coastal water samples were collected from coastal areas of the Noto Peninsula, Japan, during the period from December 1998 to June 2002. The 228Ra and 226Ra activities of those samples were measured by low-background γ-ray spectrometry. There was a wide range of activities of 228Ra (0.5-2 Bq/kg-fresh) and 226Ra (0.5-1.2 Bq/kg-fresh) in the Sargasso samples. The 228Ra/226Ra activity ratio of Sargasso samples exhibited seasonal variation with minimum values in June (228Ra/226Ra = ∼1) and maximum values in December (1.5-2.5), which was mainly governed by changes in 228Ra activity. It is also notable that the seasonal variation of the 228Ra/226Ra ratio of Sargasso is in approximate agreement with that of the ambient coastal water. Sargasso samples appear to have retained the 228Ra/226Ra ratio of the ambient coastal waters, and the temporal variations in that ratio provide insight into seasonal changes in water circulation in the Noto Peninsula coastal area

  4. Using 226Ra/228Ra disequilibrium to determine the residence half-lives of radium in vegetation compartments

    The concentrations of 226Ra and 228Ra were studied in different vegetation compartments and in available and non-available soil fractions in a Mediterranean scrubland ecosystem. A high percentage of the plant samples showed an apparent discrimination in favour of 226Ra over 228Ra. A linear compartmental model was applied to the soil-plant system. It allowed us to explain why these discrimination coefficients differed from unity, to obtain the residence half-lives of radium in the different compartments, to estimate the age of the plants, and to simulate the temporal evolution of the radioactive concentrations in each compartment. (Copyright (c) 1999 Elsevier Science B.V., Amsterdam. All rights reserved.)

  5. Study of viscosity on the fission dynamics of the excited nuclei 228U produced in 19F + 209Bi reactions

    A two-dimensional (2D) dynamical model based on Langevin equations was applied to study the fission dynamics of the compound nuclei 228U produced in 19F + 209Bi reactions at intermediate excitation energies. The distance between the centers of masses of the future fission fragments was used as the first dimension and the projection of the total spin of the compound nucleus onto the symmetry axis, K, was considered as the second dimension in Langevin dynamical calculations. The magnitude of post-saddle friction strength was inferred by fitting measured data on the average pre-scission neutron multiplicity for 228U. It was shown that the results of calculations are in good agreement with the experimental data by using values of the post-saddle friction equal to 6–8 × 1021s-1. (author)

  6. Sequential determination of U and Th isotopes, 226Ra, 228Ra, 210Pb, and 210Po in mushroom

    For this study, mushroom samples were collected in Brazil at the Sao Paulo Metropolitan Region and at the Pocos de Caldas Plateau (PC; a region of elevated natural radioactivity, which houses the first Brazilian uranium mine). This paper discusses a sequential methodology to determine natural series radionuclides in mushrooms, such as uranium (238U and 234U) and thorium (232Th, 230Th, and 228Th) isotopes, radium-226, radium-228, as well as lead-210 and polonium-210; using Alpha Spectrometry, Gamma Spectrometry, and Total Alpha and Beta Counting. The method involves total sample dissolution in a closed system in order to avoid loss of Polonium and employment of specific chromatographic resins for radionuclide purification. A subsequent interpretation of the results can provide information on pollutants present in mushrooms and infer possible contamination in the areas sampled as well as allow an association of measured concentrations to radioactive anomalies in the Plateau. (author)

  7. Half-lives of long-lived isotopes of transactinium elements from 228Th to 257Fm

    The experimental measurements and critical evaluation results of the long-lived isotope half-decay periods of transactinium elements (from 228Th to 257Fm) are given on July 1981 to be published in open literature and related to the natural radioactive decay. From the massif of the known half-decay periods the most reliable data were selected, received or evaluated and recommended for practical use; the calculations of isotope specific activities were performed on this data. (author)

  8. Bioavailability of radionuclides 226Ra, 228Ra and 210Pb present in the brazilian phosphate fertilizers and phosphogypsum

    Phosphogypsum, also called gypsum, by-product of the phosphate fertilizer industry, can be used as soil conditioner since it provides improvements in the soil-plant system. However, this by-product concentrates radionuclides of the U and Th series, present in the phosphate rock used as raw material, which can impact the environment. In order to study the bioavailability of radionuclides, samples of phosphogypsum and phosphate fertilizers (monoammonium phosphate and triple superphosphate) were analyzed. The concentration of 226Ra, 228Ra and 210Pb were determined by gamma spectrometry. The samples were leached with a mild EDTA solution and the radionuclides present in the final solution were determined by total alpha and beta counting on a gas flow proportional counter. The percentage of extraction varied from 1.6% to 1.7% for 210Pb, from 0.5% to 1.4% for 226Ra and from 0.1% to 1.0% for the 228Ra in phosphogypsum samples. The low percentage of extraction obtained for the radionuclides can be partly explained by the low solubility of phosphogypsum, which ranged from 7.7% to 16%. For the monoammonium phosphate samples the percentage of extraction were less than 26% for 226Ra, less than 10% for '228Ra and less than 10% for 210Pb. In spite of the high solubility of 77% of monoammonium phosphate in the EDTA solution, low concentrations of radionuclides were observed in the leached solution. For the triple superphosphate samples, the percentage of extraction was 2.3% for 226Ra, 1.2% for 228Ra and 11.3% for 210Pb. In spite of the high solubility of 66% of triple superphosphate in the EDTA solution, low concentrations of radionuclides were observed in the leached solution. (author)

  9. Measurement of the Natural Content of Th228, Ra226 and their Daughters in the Human Body

    The purpose of these investigations was the determination of both the content and the distribution of the alpha emitters radium-226, thorium-228 and polonium-210 in the human body. The content of radium-226 in human bones and soft tissues was determined by the emanation method, the content of polonium-210 by chemical enrichment followed by measuring the activity in a methane flow counter. The thorium-228 content as well as the total alpha activity was measured by means of a specially- developed scintillation method, the so-called mixing method. The content of radium-226 in human bones and organs related to the patient's age is performed in order to get information on the incorporation of this nuclide at continuous administration of extremely low amounts. As to bones and soft tissues the specific activity of radium-226 in man showed to be constant from the fourth month of pregnancy up to an age as high as 80 yr. The content of polonium-210 and lead-210 in femur and tibia bones was measured in order to determine the ratio of polonium-210 and lead-210 in the human skeleton of the living organism. This ratio is 0.8 on the average. The ratio of thorium-228 and radium-226 in human bone ashes is about 0.4. The age of the examined persons ranged from 5 to 70 yr. As a result of these investigations the human radiation burden caused by the radium-226, thorium-228 and polonium-210 content was estimated. (author)

  10. No structural change due to G228S substitution of haemagglutinin in emerging H6N1 influenza virus

    Beuy; Joob; Viroj; Wiwanitkit

    2014-01-01

    To the editor,Sir,in later 2013,the newest emerging influenza infection is firstly reported from Taiwan[1,2].This newest cross species influeza is called H6N1 bird flu[1,2].Genetic mutation is believed to be the cause of cross species infection and the G228S substitution of haeniagglutinin is proposed for increasing the mutant affinity for the humanα2-6 linked sialic acid receptor[3].This mechanism is believed to

  11. Determination of 226Ra, 224Ra, 223Ra and 228Ra in mineral water samples of the Slovak Republic

    The Slovak Republic is very rich in mineral water sources. In recent years, it has been discovered that a number of mineral waters in the Slovak Republic contain high levels of 226Ra and 228Ra. Moreover, there is a lack of information on 224Ra and 223Ra concentrations in mineral waters as well. The currently approved techniques for alpha emitting radium isotopes are based on radon emanation methods. Due to the long ingrowth periods required by these techniques, any 224Ra and 223Ra in the sample decay away and go undetected. For this reason, we have used an alpha spectrometric method for the simultaneous determination of 226Ra, 223Ra and 224Ra. Radium was concentrated by a lead sulphate co-precipitation. The precipitate was dissolved in EDTA and the radium isotopes were separated from possible interfering radionuclides using barium sulphate micro precipitation. The radium-barium precipitate was filtered and counted by alpha spectrometry. 133Ba was used to quantify the yield by gamma spectrometry. In our laboratory, gamma spectrometry was also used for the determination of 228Ra in mineral water samples. Radium was concentrated by a lead-barium sulphate co-precipitation. 133Ba was used to quantify the yield, found to be 97 % on the average, by gamma spectrometry. Furthermore, the committed effective doses for 226Ra, 224Ra, 223Ra, 228Ra intake via ingestion of mineral waters for the members of public were calculated. (author)

  12. Production and characterization of a custom-made 228Th source with reduced neutron source strength for the Borexino experiment

    A custom-made 228Th source of several MBq activities was produced for the Borexino experiment to study the external background of the detector. The aim was to reduce the unwanted neutron emission produced via (α,n) reactions in ceramics typically used for commercial 228Th sources. For this purpose a ThCl4 solution was chemically converted into ThO2 and embedded in a gold foil. The paper describes the production of the custom-made source and its characterization by means of γ-activity, dose rate and neutron source strength measurements. From γ-spectroscopic measurements it was deduced that activity transfer from the initial solution to the final source was >91% (at 68% C.L.) and the final activity was (5.41±0.30) MBq. The dose rate was measured with two dosimeters yielding 12.1 mSv/h and 14.3 mSv/h in 1 cm distance. The neutron source strength of the 5.41 MBq 228Th source was determined to be (6.59±0.85) s−1.

  13. Determination of the concentration of {sup 238}U, {sup 234}U, {sup 232}Th, {sup 228}Th, {sup 228}Ra, {sup 226}Ra and {sup 210}Pb in the feces of workers from a mining company of niobium and their families; Determinacao da concentracao de {sup 238}U, {sup 234}U, {sup 232}Th, {sup 228}Th, {sup 228}Ra, {sup 226}Ra e {sup 210}Pb na excrecao fecal de trabalhadores de uma mineradora de niobio e de seus familiares

    Oliveira, Roges de; Lopes, Ricardo T. [Coordenacao dos Programas de Pos-Graduacao de Engenharia (LIN/COPPE/UFRJ), RJ (Brazil). Programa de Engenharia Nuclear. Lab. de Intrumentacao Nuclear; Melo, Dunstana R.; Juliao, Ligia M.Q.C. [Instituto de Radioprotecao e Dosimetria (SEMINIRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil). Servico de Monitoracao Individual Interna

    2005-07-01

    The object of this study consists of an open mine from which Niobium ore (pyrochlore) is extracted and a metallurgy company, where Fe-Nb alloys are produced for export. For geological reasons, the main ore is associated to natural radionuclides U and Th, and its decay products. The concentration of {sup 234}U, {sup 238}U, {sup 232}Th, {sup 226}Ra and {sup 228}Ra, {sup 228}Th, including {sup 210}Pb in fecal excretion of 12:0 am, 29 workers and 13 family members were determined. The technique employed for the determination of the elements was the sequential method of radiochemical separation, followed by alpha spectrometry and counting {alpha} and {beta} in proportional detector. Statistically significant difference was observed in the concentration of {sup 234}U and {sup 238}U, in feces samples, among the group of mining workers and family members; as well as for {sup 232}Th in the feces of workers of crushing and metallurgy groups when compared with the Family Group. No statistically significant difference was detected at a concentration of {sup 226}Ra, {sup 228}Ra and {sup 210}Pb, in feces of any group of workers of the installation in relation to the family group.

  14. 226Ra and 228Ra activity levels in potable drinking water supplied to pharmaceutical companies in India

    The low level 226Ra and 228Ra activities were measured in Potable water samples received by pharmaceutical companies located in Maharashtra, Goa, Gujarat, Madhya Pradesh and Himachal Pradesh through private Borewell Supply and Municipal water Supply units. Radium in drinking water and food enhances the ingestion dose due to its long radiological and biological half-life. The Radium activity level in the fresh water was supposed to be within the limits prescribed by USEPA Guideline for Drinking Water Quality, 40 CFR 141,a Code of Federal Regulation. Higher concentration of Radium can be easily measured by Gamma spectrometry. The paper gives the low levels of radium isotopes present in the water samples which are not detectable successfully by simple gamma spectrometry. A separation chemistry considering Radium isotopes decay scheme and chemical similarity to Calcium was adapted to measure the activity with sequential chemical separation method followed by determining the alpha and beta activity of individual radium isotopes. In bore well water 226Ra activity level was in the range of 0.21 to 60±3.7 mBq/l and 228Ra level was in the range of 5.48 to 111.9±12.2 mBq/l while in Municipal water supply 226Ra and 228Ra was observed to be in the range of 0.32 to 28.89 mBq/l and 2.19 to 117.43 mBq/l respectively. A combined 226Ra+228Ra activity was observed to be in the range of 2.63 to 171.9±12.75 mBq/l which is very much within the prescribed limits. The investigation indicated that 228Ra activity is comparatively more than 226Ra indicating the water source to be from Thorium rich locations.The expected dose assessed was in the range of 13.18 to 0.04 μSv/y which is well within the limit of 0.1 mSv/y. (author)

  15. 226Ra and 228Ra activities associated with agricultural drainage ponds and wetland ponds in the Kankakee Watershed, Illinois-Indiana, USA

    Background radioactivity is elevated in many agricultural drainage ponds and also constructed wetland ponds in the Kankakee watershed. During 1995-1999, gross-α and -β activities were measured up to 455 and 1650 mBq L-1, respectively. 226Ra and 228Ra averaged 139 and 192 mBq L-1 in controlled drainage ponds compared to 53 and 58 mBq L-1 for 226Ra and 228Ra, respectively, in native wetland ponds. Analyses of applied ammonium phosphate fertilizers near both native and controlled ponds indicate comparable 226Ra/228Ra and 228Ra/232Th activity ratios with only the surface waters in the controlled ponds. For example, 226Ra/ 228Ra activity ratios in controlled ponds ranged from 0.79 to 0.91 and group with a local fertilizer batch containing FL phosphate compounds with 226Ra/228Ra activity ratios of 0.83-1.04. Local soils of the Kankakee watershed have 226Ra/228Ra activity ratios of 0.54-0.70. Calculated Ra fluxes of waters, in drainage ditches associated with these controlled ponds, for 226Ra ranged from 0.77 to 9.00 mBq cm-2 d-1 and for 228Ra ranged from 1.22 to 8.43 mBq cm-2 d-1. Ra activity gradients were measured beneath these controlled ponds both in agricultural landscapes and in constructed wetlands, all being associated with drainage ditches. Ra had infiltrated to the local water table but was below regulatory maximum contaminant limits. Still, measurable Ra activity was measured downgradient of even the constructed wetlands in the Kankakee watershed, suggesting that the attenuation of Ra was low. However, no Ra excess was observed in the riparian zone or the Kankakee River downgradient of the native wetland ponds

  16. PF573,228 inhibits vascular tumor cell growth, migration as well as angiogenesis, induces apoptosis and abrogates PRAS40 and S6RP phosphorylation.

    Mabeta, Peace

    2016-09-01

    PF573,228 is a compound that targets focal adhesion kinase (FAK), a non-receptor protein kinase, which is over-expressed in various tumors. The aim of this study was to evaluate the effects of PF573,228 on the cells derived from mouse vascular tumors, namely, endothelioma cells. The treatment of endothelioma cells with PF573,228 reduced their growth with an IC50 of approximately 4.6 μmol L-1 and inhibited cell migration with an IC50 of about 0.01 μmol L-1. Microscopic studies revealed morphological attributes of apoptosis. These observations were confirmed by ELISA, which showed increased caspase-3 activity. PF573,228 also inhibited angiogenesis in a dose-dependent manner, with an IC50 of approximately 3.7 μmol L-1, and abrogated the phosphorylation of cell survival proteins, proline-rich Akt substrate (PRAS40) and S6 ribosomal protein (S6RP). Array data further revealed that PF573,228 induced caspase-3 activation, thus promoting apoptosis. Since all the processes inhibited by PF573,228 provide important support to tumor survival and progression, the drug may have a potential role in the treatment of vascular tumors. PMID:27383888

  17. Inventory of 226Ra, 228Ra and 210Pb in marine sediments cores of Southwest Atlantic Ocean

    210Pb (22.3 y) is a radioactive isotope successfully applied as tracer of sediment dating of the last 100-150 years. The application of 226Ra and 228Ra as paleoceanographic tracers (half-lives of 1,600 y and 5.7 y, respectively) also gives some information of ocean's role in past climate change. In this work, it was analyzed 2 sediment cores collect at Southwest Atlantic Ocean. The sediments samples were freeze-dried and acid digested in microwave. It was carried out a radiochemical separation of 226Ra, 228Ra and 210Pb and performed a gross alpha and gross beta measurement of both precipitates Ba(Ra)SO4 and PbCrO4 in a low background gas-flow proportional counter. Activity concentrations of 226Ra ranged from 45 Bq kg-1 to 70 Bq kg-1 in NAP-62 and from 57 Bq kg-1 to 82 Bq kg-1 in NAP-63 samples. The concentration of 228Ra varied between 37 Bq kg-1 and 150 Bq kg-1 in NAP-62 and between 23 Bq kg-1 and 111 Bq kg-1 in NAP-63 samples. The concentration of total 210Pb ranged from 126 Bq kg-1 to 256 Bq kg-1 in NAP-62 and from 63 Bq kg-1 to 945 Bq kg-1 in NAP-63 samples. Results of 210Pbuns varied from 68 Bq kg-1 to 192 Bq kg-1 for NAP-62, while varied from <4.9 Bq kg-1 to 870 Bq kg-1 in NAP-63 profile. Increased values of 210Pbuns were found on the top of both NAP-62 and NAP- 63 sediment profile. (author)

  18. A Procedure for the Rapid Determination of 226Ra and 228Ra in Drinking Water by Liquid Scintillation Counting

    Since 2004, the environment programme of the IAEA has included activities aimed at the development of a set of procedures for the determination of radionuclides in terrestrial environmental samples. Reliable, comparable and ‘fit for purpose’ results are essential requirements for any decision based on analytical measurements. For the analyst, tested and validated analytical procedures are extremely important tools for the production of such data. For maximum utility, such procedures should be comprehensive, clearly formulated and readily available to both the analyst and the customer. This publication describes a procedure for the rapid determination of 226Ra and 228Ra in drinking water. The determination of radium in drinking water is important for protecting human health, since the consumption of drinking water containing radium may lead to an accumulation in the body, contributing to the radiological dose. The method is based on the separation of 226Ra and 228Ra from interfering elements using PbSO4 and Ba(Ra)SO4 coprecipitation steps. The isotopes 226Ra and 228Ra are then determined by liquid scintillation counting. The procedure is expected to be of general use to a wide range of laboratories, including the laboratories of the Analytical Laboratories for the Measurement of Environmental Radioactivity (ALMERA) network, both in emergency situations and for routine environmental monitoring purposes. The method was established after an extensive review of papers from the scientific literature, and was tested and validated in terms of repeatability and trueness (relative bias) in accordance with International Organization for Standardization guidelines. Reproducibility tests were performed at expert laboratories. The calculation of massic activities, uncertainty budget, decision threshold and detection limit are also described

  19. Development and evaluation of a technique for the determination of 226Ra and 228Ra by liquid scintillation in biological samples

    Radium isotopes are dispersed in the environment according to their physicochemical characteristics. Considering their long half-lives and radiological effects, 226Ra and 228Ra are very important issues to radiological protection. In Brazil, radium isotopes represent an exposure problem both in the nuclear fuel cycle installations and in high natural radiation background areas. The experimental part of this work includes the development of a technique for the determination of 226Ra and 228Ra by liquid scintillation in biological samples. Radium was concentrated and then separated from the others constituents of the sample by coprecipitation/ precipitation with Ba(Ra)SO4. The precipitate was filtered and weighted to calculate the chemical yield. The filter containing the precipitate of Ba(Ra)SO4 was transferred to a scintillation vial. Two methods were used to prepare the sources. The first one consisted gel suspension and the second one, phases method. The solutions obtained were counted in a low background scintillation spectrometry system (Quantulus) suitable for the detection and identification of both alpha and beta particles for the determination of 226Ra and 228Ra. The activity values of 226Ra and 228Ra calculated by the two methods are in good agreement with the reference value indicating that both methods are suitable for the determination of 226Ra and 228Ra. The values of minimum detectable activity (MDA) for the gel suspension method were 2.5 mBq.L-1 for 226Ra and 53 mBq.L-1 for 228Ra and for the method of phases were 2.6 mBq.L-1 for 226Ra and 66 mBq.L-1 for 228Ra. (author)

  20. Development and evaluation of a technique for the determination of {sup 226}Ra and {sup 228}Ra by liquid scintillation in biological samples

    Fernandes, Paulo Cesar P.; Sousa, Wanderson O.; Dantas, Bernardo M.; Juliao, Ligia M.Q.C. [Instituto de Radioprotecao e Dosimetria (IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil)], e-mail: pcesar@ird.gov.br

    2009-07-01

    Radium isotopes are dispersed in the environment according to their physicochemical characteristics. Considering their long half-lives and radiological effects, {sup 226}Ra and {sup 228}Ra are very important issues to radiological protection. In Brazil, radium isotopes represent an exposure problem both in the nuclear fuel cycle installations and in high natural radiation background areas. The experimental part of this work includes the development of a technique for the determination of {sup 226}Ra and {sup 228}Ra by liquid scintillation in biological samples. Radium was concentrated and then separated from the others constituents of the sample by coprecipitation/ precipitation with Ba(Ra)SO{sub 4}. The precipitate was filtered and weighted to calculate the chemical yield. The filter containing the precipitate of Ba(Ra)SO{sub 4} was transferred to a scintillation vial. Two methods were used to prepare the sources. The first one consisted gel suspension and the second one, phases method. The solutions obtained were counted in a low background scintillation spectrometry system (Quantulus) suitable for the detection and identification of both alpha and beta particles for the determination of {sup 226}Ra and {sup 228}Ra. The activity values of {sup 226}Ra and {sup 228}Ra calculated by the two methods are in good agreement with the reference value indicating that both methods are suitable for the determination of {sup 226}Ra and {sup 228}Ra. The values of minimum detectable activity (MDA) for the gel suspension method were 2.5 mBq.L{sup -1} for {sup 226}Ra and 53 mBq.L{sup -1} for {sup 228}Ra and for the method of phases were 2.6 mBq.L{sup -1} for {sup 226}Ra and 66 mBq.L{sup -1} for {sup 228}Ra. (author)

  1. Determination of Ra-224, Ra-226 and Ra-228 by gamma-ray spectrometry with radon retention

    Full text: The purpose of this work is to improve the determination, through gamma-ray spectrometry, of radium isotopes 228Ra, 226Ra and 224Ra in water. This improvement has been developed after the participation in the IAEA Proficiency test: 'Determination of radium and Uranium radionuclides in water' in December 2002, and applied to the same samples of this proficiency test. The aim of this new procedure is the determination of 228Ra, 226Ra and 224Ra activities by measuring the gamma-ray emissions of their decay products 228Ac, 214Pb and 212Pb, respectively. In the search for these activities, radiochemical separation of radium and lead are required. A coprecipitation method with stable barium and lead was carried out to obtain two different precipitates, both of them as sulphate. However emanation of unknown quantities of 222Rn and 220Rn is produced from the fine precipitate of the radium sulphate obtained which leads to wrong determinations of 224Ra and 226Ra activities. To avoid this radon exhalation effect the mentioned deposit, once the chemical yield has been calculated, is dissolved with EDTA and the resulting liquid incorporated into charcoal, and then it is dried and introduced into a suitable container. Afterwards the container is sealed and stored in a freezer. Different configurations of charcoal sizes and types as well as containers have been analysed. To perform this analysis several samples of those mentioned above containing 226Ra were used in order to test its equilibrium with the progeny, 214Pb and 214Bi, through gamma-ray spectrometry. The following results for contaminated samples with less than 50 Bq of 226Ra and using 30 ∼ 50 g of charcoal have been obtained: 1) There is a slight tendency to obtain better results using metallic containers rather than plastic ones 2) In general, specific activated charcoals, prepared to retain radon or noble gases allow better results than unspecific charcoals, but cannot be considered as better in a clear

  2. Seasonal changes in submarine groundwater discharge to coastal salt ponds estimated using 226Ra and 228Ra as tracers

    Hougham, A.L.; Moran, S.B.; Masterson, J.P.; Kelly, R.P.

    2008-01-01

    Submarine groundwater discharge (SGD) to coastal southern Rhode Island was estimated from measurements of the naturally-occurring radioisotopes 226Ra (t1/2 = 1600??y) and 228Ra (t1/2 = 5.75??y). Surface water and porewater samples were collected quarterly in Winnapaug, Quonochontaug, Ninigret, Green Hill, and Pt. Judith-Potter Ponds, as well as nearly monthly in the surface water of Rhode Island Sound, from January 2002 to August 2003; additional porewater samples were collected in August 2005. Surface water activities ranged from 12-83??dpm 100??L- 1 (60??dpm = 1??Bq) and 21-256??dpm 100??L- 1 for 226Ra and 228Ra, respectively. Porewater 226Ra activities ranged from 16-736??dpm 100??L- 1 (2002-2003) and 95-815??dpm 100??L- 1 (2005), while porewater 228Ra activities ranged from 23-1265??dpm 100??L- 1. Combining these data with a simple box model provided average 226Ra-based submarine groundwater fluxes ranging from 11-159??L m- 2 d- 1 and average 228Ra-derived fluxes of 15-259??L m- 2 d- 1. Seasonal changes in Ra-derived SGD were apparent in all ponds as well as between ponds, with SGD values of 30-472??L m- 2 d- 1 (Winnapaug Pond), 6-20??L m- 2 d- 1 (Quonochontaug Pond), 36-273??L m- 2 d- 1 (Ninigret Pond), 29-76??L m- 2 d- 1 (Green Hill Pond), and 19-83??L m- 2 d- 1 (Pt. Judith-Potter Pond). These Ra-derived fluxes are up to two orders of magnitude higher than results predicted by a numerical model of groundwater flow, estimates of aquifer recharge for the study period, and values published in previous Ra-based SGD studies in Rhode Island. This disparity may result from differences in the type of flow (recirculated seawater versus fresh groundwater) determined using each technique, as well as variability in porewater Ra activity. ?? 2007 Elsevier B.V. All rights reserved.

  3. Estimation of annual effective dose from 226Ra and 228Ra due to consumption of foodstuffs by inhabitants of Ramsar city, Iran

    226Ra and 228Ra contents in foodstuffs of Ramsar which is a coastal city in the northern part of lran were determined by gamma spectrometry. Measurement results together with food consumption rates were used to estimate annual effective dose from 226Ra and 228Ra, due to consumption of food stuffs by inhabitants of Ramsar city. Materials and methods: a total of 33 samples from 11 different foodstuffs including root vegetables (beetroot), leafy vegetables (lettuce, parsley and spinach) and tea, meat, chicken, pea, broad bean, rice, and cheese were purchased from markets of Ramsar city and were analyzed for their 226Ra and 228Ra concentration. 1-8 kg of fresh weight sample was placed in Marinnelli beaker and sealed. The measurement of natural radioactivity levels as performed by gamma-spectrometry system, using a high purity germanium detector with 40% relative efficiency. Results: The highest concentrations of 226Ra and 228Ra were determined in tea samples with 1570 and 1140 mBq/kg, respectively, and the lowest concentration of 226Ra was in pea, cheese, chicken, broad bean, and beetroot. Conclusion:The maximum estimated annual effective dose from 226Ra and 228Ra due to consumption, foodstuffs were determined to be 19.22 and 0.71 mSv from rice and meat samples respectively, where as, minimum estimated annual effective dose for 226Ra was 0.017, 0.018 and 0.019 mSv from beetroot, cheese and pea samples respectively

  4. Observations of the Bursting Activity of the 6.7GHz Methanol Maser in G33.641-0.228

    Fujisawa, Kenta; Nagadomi, Yoshito; Kimura, Saki; Shimomura, Tadashi; Takase, Genta; Sugiyama, Koichiro; Motogi, Kazuhito; Niinuma, Kotaro; Hirota, Tomoya; Yonekura, Yoshinori

    2014-01-01

    We have observed bursting variability of the 6.7 GHz methanol maser of G33.641-0.228. Five bursts were detected in the observation period of 294 days from 2009 to 2012. The typical burst is a large flux density rise in about one day followed by a slow fall. A non-typical burst observed in 2010 showed a large and rapid flux density enhancement from the stable state, but the rise and fall of the flux density were temporally symmetric and a fast fluctuation continued 12 days. On average, the bursts occurred once every 59 days, although bursting was not periodic. Since the average power required for causing the burst of order of 10^21 Js^-1 is far smaller than the luminosity of G33.641-0.228, a very small fraction of the source's power would be sufficient to cause the burst occasionally. The burst can be explained as a solar-flare like event in which the energy is accumulated in the magnetic field of the circumstellar disk, and is released for a short time. However, the mechanism of the energy release and the dus...

  5. Tl-208, Pb-212, Bi-212, Ra-226 and Ac-228 adsorption onto polyhydroxyethylmethacrylate-bentonite composite

    The adsorption of naturally occurring radionuclides (208Tl+, 212Pb2+, 226Ra2+, 212Bi3+ and 228Ac3+) onto Polyhydroxyethylmethacrylate-bentonite (PHEMA-B) composite was investigated. Experimentally obtained isotherms were evaluated with reference to Langmuir, Freundlich and Dubinin-Radushkevich (DR) models. The adsorption isotherms were L type of Giles classification proving that PHEMA-B had a high affinity adsorbent for the studied radionuclides. The Langmuir adsorption capacities (XL) were in the order of 226Ra (2.8 MBq kg-1)>212Bi (0.4 MBq kg-1)>212Pb (0.3 MBq kg-1)>228Ac and 208Tl (0.2 MBq kg-1). The adsorption process was physical via complex formation after proton exchanger for which the adsorption energies obtained from DR model was evidence. The enthalpy and entropy changes were positive and the negative free enthalpy change was proof for the spontaneity of adsorption. The reusability tests for PHEMA-B for five uses demonstrated that the adsorbent could be reused after complete recovery of the loaded radionuclide ions by 1 M HCl. The chemical structure of the composite did not change after the reuses and storage foregoing.

  6. Determination of 226Ra and 228Ra concentrations in foodstuffs consumed by inhabitants of Tehran city of Iran

    The presence of primordial radionuclide in human habitats has always been a source of prolonged exposure. Measurement of naturally occurring radionuclides in the environment can be used as baseline to evaluate the impact of non-nuclear activities and also routine releases from nuclear installations. Materials and Methods: A total of 56 samples from 18 different foodstuff including root vegetables (beetroot, carrot, onion, potato, radish and turnip), leafy vegetables (lettuce, parsley, spinach and white cabbage) and lentil, kidney bean, Soya, eggs, rice, meat, tomato and cooking oil were purchased and analyzed by low level gamma spectrometry. Results: The 226Ra concentrations from root vegetables varied from 13-62 mBqkg-1 with turnip of highest concentration, i.e. 62mBqkg-1. Among leafy vegetables; parsley showed the maximum concentration of 228Ra equal to 173 mBqkg-1. 226Rand 228Ra contents in the soya, 394 and 578 mBq kg-1 was much higher than those of other samples respectively. Conclusion : Results indicate that foodstuff consumed by Tehran inhabitants have low radium content and are safe, as far as radium concentrations is concerned

  7. Measurement of 226Ra, 228Ra and 40K in soil in district of Kuala Krai using gamma spectrometry

    The granitic region is known to have high natural radionuclides content. The natural background of the area will be elevated and the exposure rate also will be higher as compared to other region. The present study is focusing on the presence of natural uranium isotopes using its progenies in soils belong to the river basin of the granitic region of Kuala Krai district, Malaysia. Granitic characteristics of the region were believed to produce significant concentrations of natural radionuclide such as uranium and thorium. This paper presents the results of measurement activity concentration 226Ra, 228Ra and 40K in soil using Gamma Spectrometry to estimate activity concentration of radionuclides in fourteen soil samples collected from this study area. The range of activity concentration of 226Ra, 228Ra and 40K is 40.2-264.0, 49.2-312.9 and 491.1-1184.2 Bq/ kg respectively. These results were used to estimate the hazards index and annual exposure rate to the member of public. (author)

  8. Isotopic constraints (210Pb, 228Th) on the sedimentary dynamics of contaminated sediments from a subtropical coastal lagoon (NW Mexico)

    Ruiz-Fernandez, A.; Hillaire-Marcel, C.; Ghaleb, B.; Paez-Osuna, F.; Soto-Jimenez, M.

    2001-11-01

    Six sediment push-cores were collected at a coastal lagoon system affected by urban and agriculture wastes. The sediments were analyzed for 228Th, 230Th, 232Th, 210Pb, 226Ra, and 137Cs. 137Cs activities were at background level for all samples. The 210Pbtot activities found in the area varied from 0.5 to 4.5 dpm g-1 with 210Pbsup levels ranging between 1.2-1.8 dpm g-1. Cores CHI and EPC showed flat profiles depleted of 210Pbxs, indicating the absence of recent sedimentation. Core CAI shows a flat 210Pbxs profile that seems to be bioturbated. Cores ERC and BRI show chaotic profiles with layers totally depleted in 210Pbxs, likely caused by resuspension triggered by storm conditions. High 228Th/232Th values observed at core ERC suggest that the resuspension event occurred less than 10 years ago. The contaminated sediment of the lagoon are frequently resuspended, re-oxygenated, and therefore the contaminating trace metals will continue to be easily remobilized in the food chain.

  9. Determination of 226Ra, 228Ra, and 210Pb in mushroom from a naturally high radioactive region

    Many studies have shown that mushrooms are organisms which efficiently accumulate radionuclides and can be used as indicators of environmental contamination and ecosystem quality. The Pocos de Caldas plateau, in Minas Gerais, is a region that has elevated natural radioactivity due to the presence of radiological anomalies of volcanic origin. Seventy areas of radioactive anomalies have been identified in this region. From the radiological point of view the determination of 226Ra, 228Ra, and 210Pb is relevant because they are decay products of the natural series of 238U and 232Th, mainly responsible for natural radioactive exposures of man. The present paper is part of a broader study conducted in the Pocos de Caldas plateau, in which the concentration activities of 226Ra, 228Ra, and 210Pb in mushroom samples were determined. The mushrooms were collected at different points of the plateau under the influence of radioactive anomalies and away from the influence of anomalies. From statistical studies a correlation between the accumulation of radionuclides in mushrooms and anomalies was established and it was possible to confirm the efficiency that the mushrooms present as environmental contamination indicators. (author)

  10. Determination of {sup 226}Ra, {sup 228}Ra, and {sup 210}Pb in mushroom from a naturally high radioactive region

    Rosa, Mychelle M.L.; Custodio, Luis Gustavo; Cheberle, Luan T.V.; Taddei, Maria Helena T., E-mail: mychelle@cnen.gov.br, E-mail: lgcustodio@hotmail.com, E-mail: lt.cheberle@bol.com.br, E-mail: mhtaddei@cnen.gov.br [Comissao Nacional de Energia Nuclear (LAPOC/CNEN-MG), Pocos de Caldas, MG (Brazil). Laboratorio de Pocos de Caldas; Maihara, Vera A., E-mail: vmaihara@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (CNEN/IPEN-SP), Sao Paulo, SP (Brazil)

    2013-07-01

    Many studies have shown that mushrooms are organisms which efficiently accumulate radionuclides and can be used as indicators of environmental contamination and ecosystem quality. The Pocos de Caldas plateau, in Minas Gerais, is a region that has elevated natural radioactivity due to the presence of radiological anomalies of volcanic origin. Seventy areas of radioactive anomalies have been identified in this region. From the radiological point of view the determination of {sup 226}Ra, {sup 228}Ra, and {sup 210}Pb is relevant because they are decay products of the natural series of {sup 238}U and {sup 232}Th, mainly responsible for natural radioactive exposures of man. The present paper is part of a broader study conducted in the Pocos de Caldas plateau, in which the concentration activities of {sup 226}Ra, {sup 228}Ra, and {sup 210}Pb in mushroom samples were determined. The mushrooms were collected at different points of the plateau under the influence of radioactive anomalies and away from the influence of anomalies. From statistical studies a correlation between the accumulation of radionuclides in mushrooms and anomalies was established and it was possible to confirm the efficiency that the mushrooms present as environmental contamination indicators. (author)

  11. Radon leakage as a source of additional uncertainty in simultaneous determination of 226Ra and 228Ra by gamma spectrometry—Validation of analysis procedure

    A series of validation experiments was carried out to assess robustness, repeatability, and trueness of an analysis procedure for simultaneous determination of 226Ra and 228Ra in water samples. The study revealed instabilities in the radon holding capacity of the sample matrix (epoxy resin). The discovered effect is a new additional component in the uncertainty budget which should be considered when 226Ra is measured via its progeny in similar sample matrices. - Highlights: • 226Ra and 228Ra determined gamma spectrometrically via 214Pb and 228Ac. • Procedure proved to be robust for conserved water samples of pH 226Ra is determined via progeny in similar matrices. • Results of an intercomparison study proved the procedure to be fit for its purpose

  12. Values of soil-plant transfer factor of 226Ra and 228Ra: agricultural areas versus areas of high natural radioactivity

    In this work, soil to plant transfer factor of 226Ra and 228Ra obtained in areas of traditional agricultural practices varied as a function of the considered cultivated species but little variation was observed as a function of the soil type. Beans and soybeans presented more important absorption than cereals (corn, rice and wheat). In our work legumes (bean and soybean) presented transfer factors up to one order of magnitude higher than average values for regions where natural radioactivity is high. On the other hand, the results for cereals did not presented such clear differences. It can be concluded that cultural inputs of 226Ra and 228Ra are occurring in agricultural areas, but few species can concentrate it. The transfer factor values obtained in this work for 226Ra and 228Ra can be applied in risk assessment models. (author)

  13. Inventory of {sup 226}Ra, {sup 228}Ra and {sup 210}Pb in marine sediments cores of Southwest Atlantic Ocean

    Costa, Alice M.R.; Oliveira, Joselene de, E-mail: alice.costa@usp.br, E-mail: jolivei@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil). Gerencia de Metrologia das Radiacoes. Lab. de Radiometria Ambiental; Figueira, Rubens C.L.; Mahiques, Michel M.; Sousa, Silvia H.M., E-mail: rfigueira@usp.br, E-mail: mahiques@usp.br, E-mail: smsousa@usp.br [Universidade de Sao Paulo (USP), Sao Paulo, SP (Brazil). Instituto Oceanografico

    2015-07-01

    {sup 210}Pb (22.3 y) is a radioactive isotope successfully applied as tracer of sediment dating of the last 100-150 years. The application of {sup 226}Ra and {sup 228}Ra as paleoceanographic tracers (half-lives of 1,600 y and 5.7 y, respectively) also gives some information of ocean's role in past climate change. In this work, it was analyzed 2 sediment cores collect at Southwest Atlantic Ocean. The sediments samples were freeze-dried and acid digested in microwave. It was carried out a radiochemical separation of {sup 226}Ra, {sup 228}Ra and {sup 210}Pb and performed a gross alpha and gross beta measurement of both precipitates Ba(Ra)SO{sub 4} and PbCrO{sub 4} in a low background gas-flow proportional counter. Activity concentrations of {sup 226}Ra ranged from 45 Bq kg{sup -1} to 70 Bq kg{sup -1} in NAP-62 and from 57 Bq kg{sup -1} to 82 Bq kg{sup -1} in NAP-63 samples. The concentration of {sup 228}Ra varied between 37 Bq kg{sup -1} and 150 Bq kg{sup -1} in NAP-62 and between 23 Bq kg{sup -1} and 111 Bq kg{sup -1} in NAP-63 samples. The concentration of total {sup 210}Pb ranged from 126 Bq kg{sup -1} to 256 Bq kg{sup -1} in NAP-62 and from 63 Bq kg{sup -1} to 945 Bq kg{sup -1} in NAP-63 samples. Results of {sup 210}Pb{sub uns} varied from 68 Bq kg{sup -1} to 192 Bq kg{sup -1} for NAP-62, while varied from <4.9 Bq kg{sup -1} to 870 Bq kg{sup -1} in NAP-63 profile. Increased values of {sup 210}Pb{sub uns} were found on the top of both NAP-62 and NAP- 63 sediment profile. (author)

  14. Removal of 226Ra and 228Ra from Groundwater Resources in Use for Drinking Water Supply Purposes (Czech Republic)

    Water for drinking water supply purposes in the Czech Republic is abstracted from both surface water and groundwater resources and groundwater represents 40% of the total drinking water supply. Natural concentrations of naturally produced radionuclides in surface waters are generally small, amounting normally to 10 mBq/l of radium radioisotopes and less then 0.002 mg/l of uranium. In groundwaters, dependably on hydrogeological conditions, 222Rn concentrations can reach 200 - 4000 Bq/l. 226Ra and 228Ra concentrations do not exceed 0.3 Bq/l and uranium concentrations are below 0.2 mg/l. Increased concentrations of 226Ra, 228Ra and uranium that have been detected for some water resources are not normally correlated with 222Rn concentrations. Water treatment technologies normally include water aeration, sand filtering and health treatment. These technologies were originally designed to remove carbon dioxide, iron and manganese. It was shown in the following period that the aeration process, initially implemented by aeration in a horizontal arrangement, reduced the 222Rn concentration by about 80%. Currently, the proposed aeration towers achieve effective reduction of 222Rn by more than 95%. Depending on local conditions, sand filters with natural cover by iron oxides and manganese are able to capture 30 to 70% of radium radioisotopes. These water treatment processes do not reduce concentrations of uranium. For reduction of radium isotopes, these processes can be intensified by dissolving the layer of iron and manganese by acids and its recovering by dosing of potassium permanganate in shorter intervals. Waste from the water treatment originates mainly from backwash sludge. The washing water is returned after sedimentation as raw water and the sludge is discharged into municipal wastewater treatment plants or landfills. Concentrations of 226Ra and 228Ra in the filter cartridges are in the range from 0.5 to 5 kBq/kg. Experience has shown that the duration of their use

  15. Interlaboratory comparison of the determination of 226Ra and 228Ra in samples simulating coal mine water

    The aim of the experiment organized by the National Atomic Energy Agency of Poland, was to carry out an interlaboratory comparison on the determination of long-lived radium isotopes in waste waters from Polish coal mines. It was expected that the experiment would allow to evaluate the proficiency of the national participants, and to eliminate possible errors in their work. 9 participating laboratories have determined the concentrations of 226Ra and 228Ra (or only 226Ra) in 6 synthetic samples containing from 0 to 300 Bq/dm3 of each isotope. The results have been evaluated according to recent recommendations of IUPAC, ISO and AOAC. It is concluded that a significant majority of the results meet the proficiency criterium at the selected target accuracy. In some cases small systematic errors appear. Only a few laboratories meet a rigorous proficiency criterium. Analytical methods used for radium determination have also been evaluated. (author)

  16. Congenital erythropoietic porphyria with two mutations of the uroporphyrinogen III synthase gene (Cys73Arg, Thr228Met

    Zoran Gucev

    2011-01-01

    Full Text Available Congenital erythropoietic porphyria (CEP is an autosomal recessive inborn error of metabolism that results from the markedly deficient activity of uroporphyrinogen III synthase (UROS. We describe a 14-year-old girl with red urine since infancy, progressive blistering and scarring of the skin, and moderate hemolytic anemia. After years of skin damage, her face is mutilated; she has a bald patch on the scalp, hypertrichosis of the neck, areas of skin darkening, and limited joint movements of the hands. Total urine excretion and fecal total porphyrin were both markedly raised above normal levels. Sequencing of the UROS gene identified two mutations causing CEP (Cys73Arg, Thr228Met. The patient lesions are progressing. Bone marrow transplantation and/or gene therapy are proposed as the next steps in her treatment. In brief, we describe a CEP with confirmed two pathogenic mutations, severe phenotype and discuss the various treatment options available.

  17. UAS Integration into the NAS: Detect and Avoid Display Evaluations in Support of SC-228 MOPS Development

    Fern, Lisa; Rorie, Conrad; Shively, Jay

    2016-01-01

    At the May 2015 SC-228 meeting, requirements for TCAS II interoperability became elevated in priority. A TCAS interoperability work group was formed to identify and address key issuesquestions. The TCAS work group came up with an initial list of questions and a plan to address those questions. As part of that plan, NASA proposed to run a mini HITL to address display, alerting and guidance issues. A TCAS Interoperability Workshop was held to determine potential displayalertingguidance issues that could be explored in future NASA mini HITLS. Consensus on main functionality of DAA guidance when TCAS II RA occurs. Prioritized list of independent variables for experimental design. Set of use cases to stress TCAS Interoperability.

  18. Petroleum and gas production and exploration facilities with materials, spare parts of components contaminated with Ra-226 and Rd-228, and their radioactive descendants

    This Regulation refers to the Chapter 4 of the Regulation CNEN-NE.6.02 and its application for the classification of production ad exploration facilities of petroleum and gas, which have materials, pieces or components contaminated with Ra-226 and Ra-228 and its radioactive descendants

  19. Bioavailability pf radionuclides 226Ra, 228Ra and 210Pb present in Brazilian phosphogypsum and phosphate fertilizers

    Phosphogypsum (PG) is a by-product of phosphate fertilizers industries. The USEPA classified PG as a - Technologically Enhanced Naturally Occurring Radioactive Material (TENORM). Its worldwide production on 2006 was estimated in 150 million tons. Annually the three main phosphate industries in Brazil are responsible for 5.5x106 tons of phosphogypsum, which is stored in stacks. The level of radionuclides present in phosphogypsum is well-known and makes its disposal or reutilization an environmental concern. Part of this byproduct can be reused, for example, to improve fertility of agricultural soils. To assess the long term environmental impact of radioactive contamination of ecosystems, information on source term including radionuclide speciation, mobility and biological uptakes have high importance. This paper intends to evaluate the bioavailability of the radionuclides 226Ra, 228Ra and 210Pb to the environment by following a procedure established by the EC (European Community), which includes a single EDTA-NH4 0.05M extraction at pH 7.0 prior to the analyses. These results is compared with the total activity concentration of these radionuclides in Brazilian PG and the most used phosphate fertilizers (SSP, TSP, MAP and DAP). This procedure intends to represent on a more realistic way the leaching of radionuclides from PG and fertilizers to soil and agricultural products. (author)

  20. Current (1984) status of the study of 226Ra and 228Ra in humans at the Center for Human Radiobiology

    The Center for Human Radiobiology has identified 5784 persons by name and type of exposure to 226Ra and 228Ra. Included are 4863 dial painters (mostly women) and non-laboratory employees of the radium dial industry, 410 laboratory workers, 399 persons who received radium for supposed therapeutic effects, and 112 in other categories. Body contents of radium have been measured in 1916 of the dial workers and about one-half of the subjects in the other groups. Bone sarcomas, carcinomas of the paranasal sinuses and mastoids, and deterioration of skeletal tissue are still the only effects unequivocally attributable to internal radium. Excess leukemias have not been observed and other malignancies, if in excess, appear more likely to be related to external gamma radiation or radon than to internal radium. Positive correlations with radium burdens have been found for the incidence of benign exostoses among subjects exposed to radium before age 18 and for shortened latency of ocular cataracts. 27 references, 3 figures, 5 tables

  1. Bioavailability pf radionuclides {sup 226}Ra, {sup 228}Ra and {sup 210}Pb present in Brazilian phosphogypsum and phosphate fertilizers

    Russo, Ana Carolina; Saueia, Catia H.R.; Mazzilli, Barbara P., E-mail: chsaueia@ipen.br [Instituto de Pesquisas Energeticas e Nucleares(IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2011-07-01

    Phosphogypsum (PG) is a by-product of phosphate fertilizers industries. The USEPA classified PG as a - Technologically Enhanced Naturally Occurring Radioactive Material (TENORM). Its worldwide production on 2006 was estimated in 150 million tons. Annually the three main phosphate industries in Brazil are responsible for 5.5x106 tons of phosphogypsum, which is stored in stacks. The level of radionuclides present in phosphogypsum is well-known and makes its disposal or reutilization an environmental concern. Part of this byproduct can be reused, for example, to improve fertility of agricultural soils. To assess the long term environmental impact of radioactive contamination of ecosystems, information on source term including radionuclide speciation, mobility and biological uptakes have high importance. This paper intends to evaluate the bioavailability of the radionuclides {sup 226}Ra, {sup 228}Ra and {sup 210}Pb to the environment by following a procedure established by the EC (European Community), which includes a single EDTA-NH{sub 4} 0.05M extraction at pH 7.0 prior to the analyses. These results is compared with the total activity concentration of these radionuclides in Brazilian PG and the most used phosphate fertilizers (SSP, TSP, MAP and DAP). This procedure intends to represent on a more realistic way the leaching of radionuclides from PG and fertilizers to soil and agricultural products. (author)

  2. A 2 Tesla Full Scale High Performance Periodic Permanent Magnet Model for Attractive (228 KN) and repulsive Maglev

    Stekly, Z. J. J.; Gardner, C.; Domigan, P.; Baker, J.; Hass, M.; McDonald, C.; Wu, C.; Farrell, R. A.

    1996-01-01

    Two 214.5 cm. long high performance periodic (26 cm period) permanent magnet half-assemblies were designed and constructed for use as a wiggler using Nd-B-Fe and vanadium permendur as hard and soft magnetic materials by Field Effects, a division of Intermagnetics General Corporation. Placing these assemblies in a supporting structure with a 2.1 cm pole to pole separation resulted in a periodic field with a maximum value of 2.04 T. This is believed to be the highest field ever achieved by this type of device. The attractive force between the two 602 kg magnet assemblies is 228 kN, providing enough force for suspension of a 45,500 kg vehicle. If used in an attractive maglev system with an appropriate flat iron rail, one assembly will generate the same force with a gap of 1.05 cm leading to a lift to weight ratio of 38.6, not including the vehicle attachment structure. This permanent magnet compares well with superconducting systems which have lift to weight ratios in the range of 5 to 10. This paper describes the magnet assemblies and their measured magnetic performance. The measured magnetic field and resulting attractive magnetic force have a negative spring characteristic. Appropriate control coils are necessary to provide stable operation. The estimated performance of the assemblies in a stable repulsive mode, with eddy currents in a conducting guideway, is also discussed.

  3. {sup 226}Ra, {sup 228}Ra and {sup 210}Pb determination in surface water and groundwater by liquid scintillation counting

    Faria, Ligia S.; Moreira, Rubens M., E-mail: ligsfaria@gmail.com, E-mail: rubens@cdtn.br [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil)

    2015-07-01

    The municipalities of Brumadinho and Nova Lima are located in the metropolitan region of Belo Horizonte city, in the State of Minas Gerais. These two sites are important due to being located inside an Environmental Protection Area inserted in the Iron Quadrangle. In addition to the mineral wealth, the region has geological features that include quartz conglomerates associated with uranium and a significant groundwater potential exhibiting quite peculiar and complex hydrogeological features, such as the quartzite aquifer itself. Nuclear techniques applied to hydrology, such as Liquid Scintillation Counting technique (LSC), make possible the evaluation of natural radioactivity in surface water and groundwater. The objectives of this study were the determination of the activities of the long half-life radionuclides of the uranium and thorium series, such as {sup 226}Ra, {sup 228}Ra and {sup 210}Pb, and provide an effective methodology to define if the direct consumption of these waters can cause risk to health due to its radioactivity. The results were compared with the recommendations of the Ministry of Health. (author)

  4. 226Ra, 228Ra and 210Pb determination in surface water and groundwater by liquid scintillation counting

    The municipalities of Brumadinho and Nova Lima are located in the metropolitan region of Belo Horizonte city, in the State of Minas Gerais. These two sites are important due to being located inside an Environmental Protection Area inserted in the Iron Quadrangle. In addition to the mineral wealth, the region has geological features that include quartz conglomerates associated with uranium and a significant groundwater potential exhibiting quite peculiar and complex hydrogeological features, such as the quartzite aquifer itself. Nuclear techniques applied to hydrology, such as Liquid Scintillation Counting technique (LSC), make possible the evaluation of natural radioactivity in surface water and groundwater. The objectives of this study were the determination of the activities of the long half-life radionuclides of the uranium and thorium series, such as 226Ra, 228Ra and 210Pb, and provide an effective methodology to define if the direct consumption of these waters can cause risk to health due to its radioactivity. The results were compared with the recommendations of the Ministry of Health. (author)

  5. Current (1984) status of the study of 226Ra and 228Ra in humans at the Center for Human Radiobiology

    The Center for Human Radiobiology has identified 5784 persons by name and type of exposure to 226Ra and 228Ra. Included are 4863 dial painters (mostly women) and non-laboratory employees of the radium dial industry, 410 laboratory workers, 399 persons who received radium for supposed therapeutic effects, and 112 in other categories. Body contents of radium have been measured in 1916 of the dial workers and about one-half of the subjects in the other groups. Bone sarcomas, carcinomas of the paranasal sinuses and mastoids, and deterioration of skeletal tissue are still the only effects unequivocally attributable to internal radium. Excess leukemias have not been observed and other malignancies, if in excess, appear more likely to be related to external gamma radiation or radon than to internal radium. Positive correlations with radium burdens have been found for the incidence of benign exostoses among subjects exposed to radium before age 18 and for shortened latency of ocular cataracts. 26 references, 3 figures, 5 tables

  6. A sequential and fast method for low level of 226Ra , 228Ra, 210Pb e 210Po in mine effluents and uranium processing plant

    Due to biological risk and long half lives, the radionuclides 228Ra, 226Ra, 210Pb and 210Po should be frequently monitored to check for any environmental contamination around mines and uranium plants. Currently, the methods used for the determination of these radionuclides take about thirty days to reach the radioactive equilibrium of the 210Pb and 226Ra daughter's. The evaluation of effluent discharges and leakage of deposits to water bodies in monitoring programs, require quick answers to implement corrective measures. Thereby fast determination methods must be implemented. This work presents a fast and sequential method to, in three days, determine accurately and sensitively, 226Ra, 228Ra, 210Pb, 210Po, in water and effluent samples

  7. Spatial distribution of natural and fallout level of 226Ra, 228Ra, 40K and 137Cs in grab sediments of Mumbai Harbour Bay

    Radionuclides introduced from fall-out and nuclear installations into the marine surface water subjected to movement and mixing with tides and current, undergo horizontal dispersion, dilution and get bound to suspended particles by various physical, chemical, and biological processes. For this study, about 250 g of meshed grab sediments of eight sampling locations were transferred to a suitable cylindrical acrylic container, sealed and kept for 30 days to allow for in-growth of radon gas in order to achieve secular equilibrium between 226Ra, 214Pb and 214Bi in the 238U decay chain and between 212Pb, 208TI and 228Ac in the 232Th decay chain. The activity concentrations of 226Ra, 228Ra, 40K and 137Cs were measured using Gamma spectrometry system

  8. Development of a liquid scintillation method for in vitro determination of {sup 226}Ra and {sup 228} Ra in bioassay samples

    Fernandes, Paulo Cesar P.; Sousa, Wanderson O.; Juliao, Ligia M.Q.C.; Dantas, Bernardo M., E-mail: pcesar@ird.gov.b [Instituto de Radioprotecao e Dosimetria (IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil)

    2011-07-01

    Radium isotopes are dispersed in the environment according to their physicochemical characteristics. The intake of {sup 226}Ra and {sup 228}Ra in humans can occur by inhalation and ingestion and the risk of internal exposure are related to their long half-lives, characteristics of the emission and biokinetics of the isotopes in the human body. The goal of this work is to develop a methodology for the analysis of {sup 226}Ra and {sup 228}Ra in excreta samples (urine and feces), using liquid scintillation technique. Excreta samples were provided by non-exposed humans for the purpose of standardizing the methodology and the establishment of a background level of radium excretion. Radium isotopes were concentrated and separated from the constituents of the sample by co-precipitation with barium sulphate. The precipitate of Ba(Ra)SO{sub 4} was filtrated and weighted for the determination of the chemical yield. The filter containing the precipitate was transferred to a scintillation vial. In the scintillation vial, 8 mL of water, 8 mL of Instagel XF and 4 mL of UltimaGold were added, forming a gel suspension, after stirring the solution. The {sup 226}Ra and {sup 228}Ra activities were determined 21 days after the precipitation of samples. The samples were counted in a liquid scintillation spectrometer. The technique presented adequate sensitivity and reproducibility for the analysis of urine and feces. The activities of {sup 226}Ra and {sup 228}Ra in excreta samples provide useful information for the identification of the main route of intake and for the assessment of the internal exposure of occupationally exposed workers and inhabitants of high background areas. (author)

  9. Estimation of annual effective dose from 226Ra 228Ra due to consumption of foodstuffs by inhabitants of high level natural radiation of Ramsar, Iran

    Full text: A knowledge of natural radioactivity in man and his environment is important since naturally occurring radionuclides are the major source of radiation exposure to man. Radioactive nuclides present in the natural environment enter the human body mainly through food and water.Besides, measurement of naturally occurring radionuclides in the environment can be used not only as a reference when routine releases from nuclear installation or accidental radiation exposures are assessed, but also as a baseline to evaluate the impact caused by non-nuclear activities. In Iran, measurement of natural and artificial radionuclides in environmental samples in normal and high-background radiation areas have been performed by some investigators but no information has been available on 226Ra and 228Ra in foodstuffs. Therefore we have started measurements of 226Ra and 228Ra in foodstuffs of Ramsar which is a coastal city in the north part of Iran and has been known as one of the world's high level natural radiation areas, using low level gamma spectrometry measurement system .The results from our measurements and food consumption rates for inhabitants of Ramsar city have been used for the estimation of annual effective dose due to consumption of foodstuffs by inhabitants of Ramsar city. A total of 33 samples from 11 different foodstuffs including root vegetables (beetroot), leafy vegetables (lettuce, parsley and spinach) and tea, meat,chicken, pea,broad bean, rice, and cheese were purchased from markets and were analyzed for their 226Ra and 228Ra concentrations. The highest concentrations of 226 Ra and 228 Ra were determined in tea samples with 1570 and 1140 mBq kg-1 respectively and the maximum estimated annual effective dose from 226 Ra and Ra due to consumption foodstuffs were determined to be 19.22 and 0.71 μSv from rice and meat samples respectively

  10. Clinical experience in treatment of 228 cases with idiopathic teratospermia%特发性畸形精子症228例临床治疗的研究

    梁文君; 谷春会; 高利伟; 程俊杰; 付璐璐; 郑连文

    2013-01-01

    Objective To investigate the relationship between clinical efficacy of the drug and its treatment time for patients with diopathic teratospermia. Methods Total of 228 patients with idiopathic teratospermia who were treated with VC+VE+ folic acid+ l-carnitine + undecanoic acid testosterone therapy in the Reproductive Center of the Second Hospital of Jilin University from Sep.2011 to Apr. 2013 were retrospectively reviewed. The percentages of normal sperm morphology before treatment and after 3 and/or 6 months treatment were statistically analzyed. Results After 3 months treatment, the effective rate was 68.32%, it was obviously improved in the percentage of normal morphology sperm compared to that of pre-treatment (P<0.05). After 6 months treatment, the effective rate was 81.99%, it was obviously improved in the percentage of normal morphology sperm compared to that of pre-treatment(P<0.05).There was significant different in the percentage of normal morphology sperm between patients treated for 6 months and patients treated for 3 months (P<0.05). Conclusion VC+VE+folicacid+l-carnitine+ undecanoic acid testosterone therapy can obviously improve the percenrage of normal morphology sperm in patients with idiopathic teratospermia. Efficacy of long term treatment (6 months) is superior to that of short term treatment (3 months).%目的:探讨特发性畸形精子症药物治疗效果及与治疗时间的关系。方法回顾性选择2011年9月至2013年4月就诊于吉林大学第二医院生殖医学中心男科门诊确诊为特发性畸形精子症、予以VC+VE+叶酸+左旋肉碱+十一酸睾酮方案治疗的患者,共228例,收集治疗前、治疗3个月后和(或)6个月后正常形态精子百分比,并予以统计学分析。结果治疗3个月后,有效率68.32%,正常形态精子百分比较治疗前明显提高(P<0.05);治疗6个月后,有效率81.99%,正常形态精子百分比较治疗前明显提高(P<0.05

  11. Tracking of activity of major daughter products (212Bi, 212Pb and 228Ac) in Thorium ore with time in a hermetically sealed container

    During this work activities of 212Bi, 212 Pb and 228Ac were tracked at different time intervals for 30 days in hermetically sealed closed container. IAEA-RGTh-1 reference materials having 2.89% Th with floated silica powder of similar grain size distribution ( 232Th in the composite sample (ore) is 3250 ± 270 Bq kg-1. Gamma measurement was carried on a high-purity p-type germanium (HPGe) detector having a relative efficiency of 50%. Data obtained during this work clearly shows that there is only minor variation in the concentration of 212Bi, 212Pb and 228Ac from the time of sealing to 30th day. Mean concentration of 232Th evaluated using gamma energy line of 228Ac (912 keV) and 212Bi (728 keV) shows a deviation of only 0.05%, and 5.66% respectively from the certified mean value of 232Th, whereas a large negative deviation of 29.9% was observed in the case of 212Pb (239 keV). (author)

  12. Daily ingestion of 232Th, 238U, 226Ra, 228Ra and 210Pb in vegetables by inhabitants of Rio de Janeiro City

    The concentrations of the naturally occurring radionuclides 232Th, 238U, 210Pb, 226Ra and 228Ra were determined in the vegetables (leafy vegetables, fruit, root, bean and rice) and derived products (sugar, coffee, manioc flour, wheat flour, corn flour and pasta) consumed most by the adult inhabitants of Rio de Janeiro City. A total of 88 samples from 26 different vegetables and derived products were analyzed. The highest contribution to radionuclide intake arises from bean, wheat flour, manioc flour, carrot, rice, tomato and potato consumption. The estimated daily intakes due to the consumption of vegetables and derived products are 1.9 mBq of 232Th (0.47 μg), 2.0 mBq of 238U (0.17 μg), 19 mBq of 226Ra, 26 mBq of 210Pb and 47 mBq of 228Ra. The estimated annual effective dose due to the ingestion of vegetables and their derived products with the long-lived natural radionuclides is 14.5 μSv. Taking into account literature data for water and milk from Rio de Janeiro the dose value increases to 29 μSv, with vegetables and derived products responsible for 50% of the dose and water for 48%. 210Pb (62%) and 228Ra (24%) were found to be the main sources for internal irradiation

  13. Verification of anticlockwise gyre in the semi-closed water area of Lake Nakaumi, southwest Japan, by using 224Ra/228Ra activity ratios

    The Honjyo area in Lake Nakaumi is a semi-closed brackish water area where some mixing of up-flowing marine water and down-flowing lake water take place. A large-scale gyre that caused by the residual circulation was once indicated by a temporal algal blooming that spread over the semi-closed Honjyo area in brackish Lake Nakaumi. In order to verify this type of water circulation, we examined 224Ra (t1/2=3.66 d)/228Ra (t1/2=5.75 y) activity ratios of both upper and lower waters that differentiated by a well-developed halocline. The 224Ra/228Ra ratios in the upper water were lowest in the central area, suggesting the formation of anticlockwise gyre. The ratios in the lower water were rather uniform, but a basin-wide anticlockwise flow of water is also indicated. The 224Ra/228Ra ratio is clearly effective to trace the water flow for both the deep and surface waters. (author)

  14. 226Ra and 228Ra tracer study on material transport in the east coast of Hainan Island, China: a case of nutrients

    Ni SU

    2011-06-01

    Full Text Available Material fluxes (e.g. nutrients from coast to offshore play an important role in controlling the water quality in the concerned adjacent sea not only by the increase of nutrient concentration but by the change of nutrient structure. In the present work, naturally occurring isotopes (226Ra and 228Ra had been measured by alpha spectrometry in Wenjiao/Wenchang and Wanquan river estuaries and adjacent sea water of the east coast of Hainan Island. The excess dissolved 226Ra and 228Ra activities were observed in comparison with the values expected from the conservative mixing of freshwater and seawater end-members in both estuaries. Using 1-Dimensional Diffusion model, the estimated horizontal eddy diffusion coefficients (Kh derived from 228Ra activities away from its sources was 3.16?105 cm2 s-1. Furthermore, the corresponding nutrient fluxes into the coastal area were assessed. The results can provide useful information for the processes of mixing and exchange of coastal water as well as the transportation of dissoluble pollutants in this sea area.

  15. Using the British National Collection of Asters to Compare the Attractiveness of 228 Varieties to Flower-Visiting Insects.

    Garbuzov, Mihail; Ratnieks, Francis L W

    2015-06-01

    Wildlife-friendly gardening practices can help conserve biodiversity in urban areas. These include growing ornamental plant varieties attractive to flower-visiting insects. Because varieties vary greatly in attractiveness, there is a need to quantify it in order to give objective advice to gardeners. Here, we used the British national collection of asters to compare the attractiveness of varieties to flower-visiting insects. We counted and identified insects as they foraged on flowers in 228 varieties growing in discrete patches that flowered during the survey period, 14 September-20 October 2012. In each variety, we also determined the overall capitulum size, the central disc floret area, and the ray floret color (blue, red, purple, or white). We also scored attributes relevant to gardening: attractiveness to humans, ease of cultivation, and availability in the United Kingdom. There was great variation among varieties in their attractiveness to insects, ranging from 0.0 to 15.2 per count per square meter, and highly skewed, with most being unattractive. A similar skew held for the two main insect categories, honey bees and hover flies, which comprised 28 and 64% of all insects, respectively. None of the floral traits or attributes relevant to gardening correlated significantly with attractiveness to insects. Our study shows the practicality of using a national collection for quantifying and comparing the attractiveness of ornamental varieties to flower-visiting insects. These results imply that choosing varieties carefully is likely to be of conservation benefit to flower-visiting insects, and that doing so is a no-cost option in terms of garden beauty and workload. PMID:26313970

  16. Monitoring of Ra-226 and Ra-228 in manioc (Manihot utilissima) and its flour in uranium mining in Caetite - Tropical area in Brazil

    Full text: Tropical ecosystems have few developments from the radioecology point of view. In Brazil, radioecology studies had their development mainly in the 50's decade, but a little attention has been given to the radionuclides in food. The Uranium Concentrate Unit of 'Caetite' started operation in the 90's decade, and was preceded by the environmental pre-operational monitoring program, carried out during 15 years (1982-1999), according to established licensing procedures, using biological samples from the human and animal food chain. This work shows the results of last ten years of the pre-operational monitoring program of 'Caetite' in manioc (Manihot utilissima) and it's flour. The parameters studied are Ra-226 and Ra-228. Manioc (and it's flour) was chosen because of its role as the most important component of human food chain (82 kg/year for manioc and de same for manioc flour). This study was performed in 44 results of Ra-226 and 44 results of Ra-228 analyses, in 22 samples of manioc and 22 samples of manioc flour. For the analysis, initially, the Anderson-Darling goodness-of-fit test for the maximum likelihood to the gaussian distribution is executed. With the data adjusted to the gaussian curve, an Analysis of variance (ANOVA) test is executed. If there is difference between concentrations, t Student tests are then executed. The data have shown best goodness-of-fit to the log-normal distribution. After proper transformation (y=Ln(x+1)), data have shown best goodness-of-fit to the normal distribution. The ANOVA test applied to normalized data have pointed differences in concentrations, that were identified by t Student tests as the Ra-226 values in manioc and the Ra-228 values in manioc flour. All other values are statistically equal. (author)

  17. Fractionation of 226Ra and 228Ra in waste material of coal mines and coal fired power plants and the effect of speciation on plant uptake

    The potential radiological risk of contaminated areas by enhanced level of natural occurring radionuclides is depend on chemical and ecological behavior of these radionuclides. Fractionation is a proper method to determine the mobility of radionuclides which is assumed closely related to bioavailability and uptake by biota. In the present work four different areas were investigated. Sites which are located in Upper Silesia have been used for discharging of pit water. Sites in Hungary are used as a deposit of waste material from coal fired power plants. Because the 226Ra and 228Ra are the most prominent radionuclides among the potential contaminants around mining sites and waste deposit, our research was focused on investigation the behavior of Ra. The level of 226Ra activity-concentration in sediment samples from the regions of Upper Silesia is varied between 0.5-25 kBq/kg and the level in ash samples from Hungarian sites changes in a range of 0.20-3.30 kBq/kg. The paper summarized two studies. The first investigation has concerned to the determination of mobility of radionuclides in waste materials. The second study is dealing with plant uptake of 226Ra and 228Ra and the determination of site specific concentration factors on these areas. Different sequential extraction procedures were applied to investigate the speciation of radium. The ratio of radium was determined in 'water' fraction, 'readily exchangeable' fraction, in the 'bound to carbonate' fraction and in the 'bound to Fe and Mn oxide' fraction respectively. To calculate a realistic CR for 226Ra and 228Ra we take into account mobility of radionuclides. CR values were calculated on base of dry matters of sampled natural vegetation. The value of CR for the Ra on sites of depository in Hungary and on the settling ponds in Poland varied between (0.05-2.4), (0.06-51.0) respectively due to the mobile fraction. (author)

  18. Validation of {sup 226}Ra, {sup 228}Ra and {sup 210}Pb measurements in soil and sediment samples through high resolution gamma ray spectrometry

    Dias, Danila Carrijo da Silva; Silva, Nivaldo Carlos da; Bonifacio, Rodrigo Leandro; Guerrero, Eder Tadeu Zenun [Comissao Nacional de Energia Nuclear (LAPOC/CNEN-MG), Pocos de Caldas, MG (Brazil). Laboratorio de Pocos de Caldas

    2013-07-01

    Radionuclides found in ore extraction waste materials are a great source of concern regarding public health and environmental safety. One technique to determine the concentration of substances is high resolution gamma ray spectrometry using HPGe. Validating a measurement technique is essential to warrant high levels of quality to any scientific work. The Laboratory of Pocos de Caldas of the Brazilian Commission for Nuclear Energy partakes into a Quality Management System project, seeking Accreditation under ISO/IEC 17025 through the validation of techniques of chemical and radiometric analysis of environmental samples from water, soil and sediment. The focus of the Radon Laboratory at LAPOC is validation of Ra-226, Ra-228 and Pb-210 concentration determinations in soil and sediment through a gamma spectrometer system. The stages of this validation process included sample reception and preparation, detector calibration and sample analyses. Dried samples were sealed in metallic containers and analyzed after radioactive equilibrium between Ra-226 and daughters Pb-214 and Bi-214. Gamma spectrometry was performed using CANBERRA HPGe detector and gamma spectrum software Genie 2000. The photo peaks used for Ra-226 determination were 609 keV and 1020 keV of Bi-214 and 351 keV of Pb-214. For the Ra-228 determination a photopeak of 911 keV was used from its short half-life daughter Ac-228 (T1/2 = 6.12 h). For Pb-210, the photopeak of 46.5 keV was used, which, due to the low energy, self-absorption correction was needed. Parameters such as precision, bias/accuracy, linearity, detection limit and uncertainty were evaluated for that purpose. The results have pointed to satisfying results. (author)

  19. Molecular characterization of resistance to Rifampicin in an emerging hospital-associated Methicillin-resistant Staphylococcus aureus clone ST228, Spain

    Liñares Josefina

    2010-03-01

    Full Text Available Abstract Background Methicillin-resistant S. aureus (MRSA has been endemic in Hospital Universitari de Bellvitge, Barcelona, since 1990. During the 1990-95 period the Iberian clone (ST-247; SCCmec-I was dominant. Isolates of clonal complex 5 (ST-125; SCCmec-IV gradually replaced the Iberian clone from 1996 to 2003. A new multiresistant MRSA phenotype showing rifampicin resistance emerged in 2004 and rapidly increased from 25% in 2004 to 45% in 2006. The aims of this study were i the molecular characterisation of rifampicin resistant MRSA isolates, ii the study of the rifampicin resistance expression by disk diffusion, microdilution and E-test, and iii the analysis of the rpoB gene mutations involved in rifampicin resistance. Results A sample of representative 108 rifampicin-resistant MRSA isolates belonged to a single PFGE genotype, ST-228, SCCmec type I and spa type t041. Of 108 isolates, 104 (96% had a low-level rifampicin resistance (MICs, 2 to 4 mg/L and 4 a high-level rifampicin resistance (MICs, 128 - ≥ 256 mg/L. Disk diffusion and E-test methods failed to identify a low-level rifampicin resistance in 20 and 12 isolates, respectively. A low-level rifampicin resistance was associated with amino acid substitution 481His/Asn in the beta-subunit of RNA polymerase. Isolates with a high-level rifampicin resistance carried additional mutations in the rpoB gene. Conclusions The emergence of MRSA clone ST228-SCCmecI, related to the Southern Germany clone, involved a therapeutical challenge for treating serious MRSA infections. Decreased susceptibility to rifampicin in MRSA strains of ST228-SCCmecI was associated with one or two specific mutations in the rpoB gene. One fifth of isolates with low-level rifampicin-resistance were missed by the diffusion methods.

  20. Evaluation of the activity concentration of {sup 226}Ra, {sup 228}Ra and {sup 210}Pb in sediments from Antarctica in the Admiralty Bay region

    Mora, Tamires de A.; Oliveira, Joselene de, E-mail: tamires.mora@usp.br, E-mail: jolivei@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil); Figueira, Rubens C.L.; Mahiques, Michel M.; Sousa, Silvia H.M., E-mail: rfigueira@usp.br, E-mail: mahiques@usp.br, E-mail: smsousa@usp.br [Universidade de Sao Paulo (USP), Sao Paulo, SP (Brazil). Instituto Oceanografico

    2015-07-01

    In this study, we performed the radiochemical characterization of a sedimentary record (1B profile), collected in the vicinity of Admiralty Bay, King George Island in Antarctic Operation XXXI (January/2013). The activities of {sup 226}Ra, {sup 228}Ra and {sup 210}Pb were determined by the counting of gross alpha and gross beta activities in the precipitates of Ba(Ra)SO{sub 4} and PbCrO{sub 4}. Those measurements were carried out in a low background gas flow proportional detector. The {sup 226}Ra and {sup 228}Ra were measured after 21 days of the final precipitation. The {sup 210}Pb activity was determined after 10 days of the precipitation date by gross beta counting of its {sup 210}Bi decay product. The activity concentration of {sup 226}Ra ranged from 11±1 (mBq g-1) to 54±3 (mBq g{sup -1}), and the {sup 228}Ra ranged from 48±5 (mBq g{sup -1}) to 155±16 (mBq g{sup -1}). The activity concentration of {sup 210}Pb varied from 8±1 (mBq g{sup -1}) to 458±46 (mBq g{sup -1}), while unsupported {sup 210}Pb ranged from 6±1 (mBq g{sup -1}) to 434±65 (mBq g{sup -1}). The {sup 210}Pb concentrations in sediments have often been used to dating events like deposition and accumulation in various marine environments. Taking into account the results of {sup 210}Pb and {sup 226}Ra activities obtained in testimony-1B it was estimated the unsupported {sup 210}Pb activity which was applied to the CIC geochronological dating model (Constant Initial Concentration). Based in these data, the sedimentation rate obtained was 0.63±0.02 cm year{sup -1}. (author)

  1. A Preliminary Flight Test on a Basic Performance of the Flight Research Airplane Do 228:Velocity v.s. Glide Path Angle

    Yoshikazu, Miyazawa; Takatsugu, Ono; Yasuhito, Kawagoe

    1989-01-01

    A preliminary flight test was conducted of the research airplane Dornier Do228-200 that is being modified for use as an in-flight simulator by the National Aerospace Laboratory. The basic performance of the airplane was evaluated by the flight test. Glide path angles were examined with various parameters, such as velocity, altitude, and power. The flight test results were compared with those of a mathematical model based on the Dornier GmbH wind-tunnel test data. Since an onboard data acquisi...

  2. Activity concentrations of Rn-222, Ra-226, Ra-228, U-238 and Cs-137 in water samples of Styria/Austria; Aktivitaetskonzentrationen von Rn-222, Ra-226, Ra-228, U-238 und Cs-137 in Wasserproben aus der Steiermark/Oesterreich

    Pichl, E. [Verein zur Foerderung der Strahlenforschung Oesterreich, Graz (Austria). Strahlenmesstechnik Graz; Rauch, P. [Land Steiermark (Austria). Abt. 15 - Energie, Wohnbau, Technik

    2015-07-01

    Activity concentrations of radon (Rn-222), radium (Ra-226, Ra-228), uranium (U-238), and radiocesium (Cs-137), were determined in 50 water samples from different geogenic regions of Styria/Austria. Samples were collected in the years 2010, 2011 and 2012, by experts of the Styrian government. For measuring activities of U-238 we used a low energy-semiconductor detector, and a high purity-semiconductor detector to analyze the activities of all the other radionuclides. More than 90% of the activity concentrations of Rn-222 in all water samples were lower than 50 Bq/l. All activity concentrations observed for radium and uranium were lower than the detection limits of the corresponding radionuclides (Ra-226: 0,02 Bq/l, Ra-228: 0,03 Bq/l, U-238: 0,06 Bq/l). None of the water samples were contaminated by Cs-137.

  3. Androgen dependence of hirsutism, acne, and alopecia in women: retrospective analysis of 228 patients investigated for hyperandrogenism.

    Karrer-Voegeli, Sandra; Rey, François; Reymond, Marianne J; Meuwly, Jean-Yves; Gaillard, Rolf C; Gomez, Fulgencio

    2009-01-01

    Hirsutism, acne, alopecia, and oligo-amenorrhea are clinical expressions of hyperandrogenism, one of the most frequent endocrine disorders in women of reproductive age. Women referred to our endocrine clinics for skin symptoms of hyperandrogenism underwent a laboratory workup to evaluate hormone measurements and received antiandrogen therapy. We retrospectively analyzed the outcome of 228 consecutive patients investigated over 6 years.Patients with hirsutism had higher levels of androstenedione, dehydroepiandrosterone sulfate (DHEAS), and salivary testosterone; lower levels of sex hormone-binding globulin (SHBG); and a higher prevalence of oligo-amenorrhea than patients with alopecia, while patients with acne showed intermediate values. Hirsutism score correlated positively with androstenedione, DHEAS, and salivary testosterone, and correlated negatively with SHBG; salivary testosterone showed the highest correlation coefficient. Total testosterone was not significantly different among patients with hirsutism, alopecia, or acne, and did not significantly correlate with hirsutism score. Hirsutism and oligo-amenorrhea were the most sensitive symptoms of hyperandrogenism, and no androgenic parameter alone allowed us to identify all cases of hyperandrogenism.Patients of central European origin sought consultation with milder hirsutism scores than patients of southern European origin. There was, however, no difference in the clinical-biological correlation between these groups, arguing against differences in skin sensitivity to androgens.Polycystic ovary syndrome, defined as hyperandrogenism (hirsutism or elevated androgens) and oligo-amenorrhea, was diagnosed in 63 patients (27.6%), an underestimate compared with other reports that include systematic ovarian ultrasound studies. Neither pelvic ultrasound, used in a limited number of cases, nor the luteinizing hormone/follicle-stimulating hormone ratio helped to distinguish patients with polycystic ovary syndrome from

  4. Studies of transport pathways of Th, rare earths, Ra-228, and Ra-226 from soil to plants and farm animals. Progress report, April 1, 1985-February 28, 1986

    The field study is to assess the soil-to-plant and soil-to-animal concentration factors of the naturally occurring radionuclides 226Ra, 228Ra, 232Th, 230Th, and 228Th, as well as of the light rare earth elements (REE), La, Ce and Nd. Farms situated near the center of a deeply weathered alkalic intrusive known as the Pocos de Caldas (PC) plateau were selected for study because of their proximity (i.e., within a few kilometers) to what may be the largest single near-surface deposit of Th (approx.30,000 tonnes) and REE's (>100,000 tonnes) situated near the summit of a hill (the Morro do Ferro (MF)). An ancillary field study is being conducted in Orange County, New York, where a local cattleman has permitted sampling members of the herd as well as soil and feeds which are all grown on the premises. Vegetable samples and soil have also been analyzed from five additional farms in Orange County, NY. 64 refs., 25 figs., 45 tabs

  5. Resistência de soja a insetos: II. Teste de livre escolha entre a linhagem IAC 73/228 e o cultivar Paraná, infestados por Nezara viridula (L. em telado Resistance of soybean to insects: II. Free choice test between the line IAC 73/228 and the cultivar Paraná infested by Nezara viridula(L. under screen cage

    Carlos Jorge Rossetto

    1984-01-01

    Full Text Available A linhagem de soja IAC 73/228 foi comparada com o cultivar Paraná, em condições de telado e com infestação artificial de Nezara viridula (L. (Hemiptera, Pentatomidae. As plantas foram cultivadas diretamente no solo do telado. Utilizou-se um delineamento em blocos ao acaso com dois tratamentos e trinta repetições, sendo a parcela de uma planta individual. Não houve diferença no número de percevejos observados infestando os dois tratamentos. O número de vagens planas (não granadas resultantes do dano causado pelos insetos, também não diferiu nos dois tratamentos. O número total de vagens da linhagem IAC 73/228 foi em média 291 e, o do 'Paraná', 100. O número de vagens cheias (com grãos desenvolvidos e o peso de grãos comerciais colhidos da linhagem IAC 73/228 foram maiores que os do 'Paraná'. Comparando as produções em peso dos dois materiais, com infestação artificial do inseto e sem infestação em telado contíguo, observou-se que a linhagem não sofreu nenhuma perda na sua produção devida à infestação do inseto, enquanto o cultivar sofreu 67,5% de quebra na produção. Por ocasião da colheita, todas as plantas do 'Paraná' apresentavam o sintoma de retenção foliar, conhecido por "soja louca", contra apenas quatro plantas (13,3% da linhagem IAC 73/228. Concluiu-se que os quatro critérios mais práticos para discriminar materiais resistentes de suscetíveis em condições de alto nível de infestação foram: produção em peso de grãos, porcentagem de plantas com retenção foliar, índice de dano de vagens da região mediana da planta e porcentagem de grãos sadios.A free choice type experiment was made, with two treatments (line IAC 73/228 and cultivar Paraná and thirty replications, inside a screen cage with artificial infestation of Nezara viridula (L. (Hemiptera : Pentatomidae. The level of infestation used in this experiment was, approximately, 1 adult per plant during the reproductive phase of the

  6. Effects of carbon dioxide and nitrogen on adhesive growth and expressions of E-cadherin and VEGF of human colon cancer cell CCL-228

    Kai-Lin Cai; Guo-Bing Wang; Li-Juan Xiong

    2003-01-01

    AIM: To study the effects of carbon dioxide on the metastatic capability of cancer cells, and to compare them with that of nitrogen.METHODS: The colon cancer cell CCL-228 was treated with 100 % carbon dioxide or nitrogen at different time points and then cultured under normal condition. Twelve hours after the treatment, the survival rates of suspension cells and the expressions of e-cadherin and VEGF were examined.RESULTS: After 60 min of carbon dioxide and longer time of nitrogen treatment, the suspended cells increased and the expression of e-cadherin decreased while the expression of VEGF was enhanced significantly. And the effects of nitrogen were similar to, but weaker than, those of carbon dioxide.CONCLUSION: Carbon dioxide may improve the metastatic capability of cancer cells and its effects are significantly stronger than that of nitrogen. A sequential use of carbon dioxide and nitrogen in pneumoperitoneum may take the advantage of both gases.

  7. Daily intakes of 238U, 234U, 232Th, 230Th, 228Th and 226Ra in the adult population of central Poland

    Pietrzak-Flis, Z.; Rosiak, L.; Suplinska, M.M.; Chrzanowski, E.; Dembinska, S. [Central Laboratory for Radiological Protection, Konwaliowa 7, 03-194 Warsaw (Poland)

    2001-06-12

    Activity concentration of the uranium and thorium series radionuclides was determined in foodstuffs and drinking water in central Poland. Annual and daily intake for the adult population was estimated from the concentrations determined and average annual consumption of food and water. The daily intakes (in mBq) were 22.1 (238U), 26.5 (234U), 2.38 (232Th), 4.06 (230Th), 11.2 (228Th) and 42.2 (226Ra). The intake of uranium isotopes occurred mainly with water; the main intake of thorium isotopes was with animal products, vegetables, cereals and potatoes, whereas 226Ra entered mainly with animal products, cereals and vegetables. From the intake and dose coefficients, the annual effective doses for the ingested radionuclides were calculated. The annual effective dose was 5.95 {mu}Sv, of which 72.4% originated from 226Ra.

  8. Mechanical properties of self-compacting concrete state-of-the-art report of the RILEM technical committee 228-MPS on mechanical properties of self-compacting concrete

    Schutter, Geert

    2014-01-01

    The State-of-the-Art Report of RILEM Technical Committee 228-MPS on Mechanical properties of Self-Compacting Concrete (SCC) summarizes an extensive body of information related to mechanical properties and mechanical behaviour of SCC. Due attention is given to the fact that the composition of SCC varies significantly. A wide range of  mechanical properties are considered, including compressive strength, stress-strain relationship, tensile and flexural strengths, modulus of elasticity, shear strength, effect of elevated temperature, such as fire spalling and residual properties after fire, in-situ properties, creep, shrinkage, bond properties, and structural behaviour. A chapter on fibre-reinforced SCC is included, as well as a chapter on specialty SCC, such as light-weight SCC, heavy-weight SCC, preplaced aggregate SCC, special fibre reinforced SCC, and underwater concrete.

  9. The dietary intake of 238U, 234U, 230Th, 232Th, 228Th and 226Ra from food and drinking water by inhabitants of the Walbrzych region

    Intake with food and water of the natural radionuclides of the uranium and thorium series was determined for adult population of the south-western region in Poland, where in the 1950-ies an exploration of uranium ore was conducted. Concentration of the radionuclides was determined in food products and drinking water and their annual intake was estimated on the basis of the average annual consumption. The intake of 238U, 234U and 230Th occurred mainly with water (33% to 68%), whereas the intake of 232Th, 228Th and 226Ra was mainly with vegetables, potatoes, milk and flour. From the intake and dose coefficients the annual effective doses from the ingested radionuclides were calculated. The total dose was 5.6μSv, of which 74% originated from 226Ra. (author)

  10. Daily intakes of 238U, 234U, 232Th, 230Th, 228Th and 226Ra in the adult population of central Poland

    Activity concentration of the uranium and thorium series radionuclides was determined in foodstuffs and drinking water in central Poland. Annual and daily intake for the adult population was estimated from the concentrations determined and average annual consumption of food and water. The daily intakes (in mBq) were 22.1 (238U), 26.5 (234U), 2.38 (232Th), 4.06 (230Th), 11.2 (228Th) and 42.2 (226Ra). The intake of uranium isotopes occurred mainly with water; the main intake of thorium isotopes was with animal products, vegetables, cereals and potatoes, whereas 226Ra entered mainly with animal products, cereals and vegetables. From the intake and dose coefficients, the annual effective doses for the ingested radionuclides were calculated. The annual effective dose was 5.95 μSv, of which 72.4% originated from 226Ra