WorldWideScience

Sample records for actinium 227

  1. Separation of Actinium 227 from the uranium minerals

    The purpose of this work was to separate Actinium 227, whose content is 18%, from the mineral carnotite found in Gomez Chihuahua mountain range in Mexico. The mineral before processing is is pre-concentrated and passed, first through anionic exchange resins, later the eluate obtained is passed through cationic resins. The resins were 20-50 MESH QOWEX and 100-200 MESH 50 X 8-20 in some cased 200-400 MESH AG 50W-X8, 1X8 in other cases. The eluates from the ionic exchange were electrodeposited on stainless steel polished disc cathode and platinum electrode as anode; under a current ODF 10mA for 2.5 to 5 hours and of 100mA for .5 of an hour. it was possible to identify the Actinium 227 by means of its descendents, TH-227 and RA-223, through alpha spectroscopy. Due to the radiochemical purity which the electro deposits were obtained the Actinium 227 was low and was not quantitatively determined. A large majority of the members of the natural radioactive series 3 were identified and even alpha energies reported in the literature with very low percentages of non-identified emissions were observed. We conclude that a more precise study is needed concerning ionic exchange and electrodeposit to obtain an Actinium 227 of radiochemical purity. (Author)

  2. Neutron-Induced Fission of Actinium-227, Protactinium-231 and Neptunium-237: Mass Distribution

    Results of radiochemical studies on the mass distribution in the neutron-induced fission of actinium-227, protactinium-231 and neptunium-237 have been presented. This work has been carried out as part of a programme to determine the mass distribution in the fission of heavy elements as a function of Z and A. All irradiations have been carried out in the core of the swimming-pool type reactor APSARA with cadmium shielding wherever necessary. Relative yields of several fission product nuclides have been obtained by a method involving a comparison of the fission product activities from the respective targets with those formed from uranium-235 simultaneously irradiated. Thermal-neutron fission yields of uranium-235 have been assumed. These results indicate a predominantly asymmetric mass distribution in all the three cases, and also a distinct though small symmetric peak in the case of actinium-227. (author)

  3. A new method for the determination of low-level actinium-227 in geological samples

    We developed a new method for the determination of 227Ac in geological samples. The method uses extraction chromatographic techniques and alpha-spectrometry and is applicable for a range of natural matrices. Here we report on the procedure and results of the analysis of water (fresh and seawater) and rock samples. Water samples were acidified and rock samples underwent total dissolution via acid leaching. A DGA (N,N,N',N'-tetra-n-octyldiglycolamide) extraction chromatographic column was used for the separation of actinium. The actinium fraction was prepared for alpha spectrometric measurement via cerium fluoride micro-precipitation. Recoveries of actinium in water samples were 80 ± 8 % (number of analyses n = 14) and in rock samples 70 ± 12 % (n = 30). The minimum detectable activities (MDA) were 0.017-0.5 Bq kg-1 for both matrices. Rock sample 227Ac activities ranged from 0.17 to 8.3 Bq kg-1 and water sample activities ranged from below MDA values to 14 Bq kg-1of 227Ac. From the analysis of several standard rock and water samples with the method we found very good agreement between our results and certified values. (author)

  4. Production of high-purity radium-223 from legacy actinium-beryllium neutron sources.

    Soderquist, Chuck Z; McNamara, Bruce K; Fisher, Darrell R

    2012-07-01

    Radium-223 is a short-lived alpha-particle-emitting radionuclide with potential applications in cancer treatment. Research to develop new radiopharmaceuticals employing (223)Ra has been hindered by poor availability due to the small quantities of parent actinium-227 available world-wide. The purpose of this study was to develop innovative and cost-effective methods to obtain high-purity (223)Ra from (227)Ac. We obtained (227)Ac from two surplus actinium-beryllium neutron generators. We retrieved the actinium/beryllium buttons from the sources and dissolved them in a sulfuric-nitric acid solution. A crude actinium solid was recovered from the solution by coprecipitation with thorium fluoride, leaving beryllium in solution. The crude actinium was purified to provide about 40 milligrams of actinium nitrate using anion exchange in methanol-water-nitric acid solution. The purified actinium was then used to generate high-purity (223)Ra. We extracted (223)Ra using anion exchange in a methanol-water-nitric acid solution. After the radium was separated, actinium and thorium were then eluted from the column and dried for interim storage. This single-pass separation produces high purity, carrier-free (223)Ra product, and does not disturb the (227)Ac/(227)Th equilibrium. A high purity, carrier-free (227)Th was also obtained from the actinium using a similar anion exchange in nitric acid. These methods enable efficient production of (223)Ra for research and new alpha-emitter radiopharmaceutical development. PMID:22697483

  5. Radium, thorium, and actinium extraction from seawater using an improved manganese-oxide-coated fiber

    Laboratory experiments were conducted to determine the efficiency with which improved manganese-oxide-coated acrylic fibers extract radium, thorium, and actinium from seawater. Tests were made using surface seawater spiked with 227Ac, 227Th and 223Ra. For sample volumes of approximately 30 liters and flow rates up to 0.5 liters per minute, radium and actinium are removed quantitatively. Approximately 80-95% of the thorium is removed under these same conditions. (Auth.)

  6. Extraction of actinium with di-(2-ethylhexyl)phosphoric acid from hydrochloric and nitric acid solutions

    The extraction of actinium with HDEHP from Cl- and NO3- systems has been investigated. It was found that extraction of actinium from HCl solutions is much better than from HNO3 solutions. Stability constants of actinium complexes Ac(X-)+2 with Cl- and NO3- ligands were determined. Our results show that the actinium formed less stable complexes with Cl- than with NO3- ligands. 5 refs., 3 figs., 1 tab. (author)

  7. The sorption of polonium, actinium and protactinium onto geological materials

    This paper describes a combined experimental and modeling program of generic sorption studies to increase confidence in the performance assessment for a potential high-level radioactive waste repository in Japan. The sorption of polonium, actinium and protactinium onto geological materials has been investigated. Sorption of these radioelements onto bentonite, tuff and granodiorite from equilibrated de-ionized water was studied under reducing conditions at room temperature. In addition, the sorption of actinium and protactinium was investigated at 60 C. Thermodynamic chemical modeling was carried out to aid interpretation of the results

  8. Spectroscopic and computational investigation of actinium coordination chemistry.

    Ferrier, Maryline G; Batista, Enrique R; Berg, John M; Birnbaum, Eva R; Cross, Justin N; Engle, Jonathan W; La Pierre, Henry S; Kozimor, Stosh A; Lezama Pacheco, Juan S; Stein, Benjamin W; Stieber, S Chantal E; Wilson, Justin J

    2016-01-01

    Actinium-225 is a promising isotope for targeted-α therapy. Unfortunately, progress in developing chelators for medicinal applications has been hindered by a limited understanding of actinium chemistry. This knowledge gap is primarily associated with handling actinium, as it is highly radioactive and in short supply. Hence, Ac(III) reactivity is often inferred from the lanthanides and minor actinides (that is, Am, Cm), with limited success. Here we overcome these challenges and characterize actinium in HCl solutions using X-ray absorption spectroscopy and molecular dynamics density functional theory. The Ac-Cl and Ac-OH2O distances are measured to be 2.95(3) and 2.59(3) Å, respectively. The X-ray absorption spectroscopy comparisons between Ac(III) and Am(III) in HCl solutions indicate Ac(III) coordinates more inner-sphere Cl(1-) ligands (3.2±1.1) than Am(III) (0.8±0.3). These results imply diverse reactivity for the +3 actinides and highlight the unexpected and unique Ac(III) chemical behaviour. PMID:27531582

  9. Discovery of the actinium, thorium, protactinium, and uranium isotopes

    Fry, C; Thoennessen, M

    2012-01-01

    Currently, 31 actinium, 31 thorium, 28 protactinium, and 23 uranium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  10. Groundwater seepage from the Ranger uranium mine tailings dam: radioisotopes of radium, thorium and actinium. Supervising Scientist report 106

    Monitoring of bores near the Ranger uranium mine tailings dam has revealed deterioration in water quality in several bores since 1983. In a group of bores to the north of the dam, increases have been observed of up to 500 times for sulphate concentrations and of up to 5 times for 226Ra concentrations. Results are presented here of measurements of members of the uranium, thorium and actinium decay series in borewater samples collected between 1985 and 1993. In particular, measurements of all four naturally-occurring radium isotopes have been used in an investigation of the mechanism of radium concentration changes. For the most seepage-affected bores the major findings of the study include: 228Ra/226Ra 223Ra /226Ra and 224Ra/228Ra ratios all increased over the course of the study; barium concentrations show high seasonal variability, being lower in November than May, but strontium concentrations show a steady increase with time. Calculations show that the groundwater is probably saturated with respect to barite but not with respect to celestite or anglesite; sulphide concentrations are low in comparison with sulphate, and are higher in November than in May; and 227Ac concentrations have increased with time, but do not account for the high 223Ra/226Ra ratios. It is concluded on the basis of these observations that increases in Ra isotope concentrations observed in a number of seepage-affected bores arise from increases in salinity leading to desorption of radium from adsorption sites in the vicinity of the bore rather by direct transport of radium from the tailings. Increased salinity is also causing the observed increases in 227Ac and strontium concentrations, while formation of a barite solid phase in the groundwater is causing the removal of some radium from solution. This is the cause of the increasing radium isotope ratios noted above

  11. Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232

    The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces ∼100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 GeV protons

  12. Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232

    Harvey, James T.; Nolen, Jerry; Vandergrift, George; Gomes, Itacil; Kroc, Tom; Horwitz, Phil; McAlister, Dan; Bowers, Del; Sullivan, Vivian; Greene, John

    2011-12-30

    The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces {approx}100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 Ge

  13. AAS 227: Day 2

    Kohler, Susanna

    2016-01-01

    Editors Note:This week were at the 227th AAS Meeting in Kissimmee, FL. Along with several fellow authors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting at the end of each day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Welcome to Day 2 of the winter American Astronomical Society (AAS) meeting in Kissimmee! Several of us are attending the conference this year, and we will report highlights from each day here on astrobites. If youd like to see more timely updates during the day, we encourage you to follow @astrobites on twitter or search the #aas227 hashtag.Plenary Session: Black Hole Physics with the Event Horizon Telescope (by Susanna Kohler)If anyone needed motivation to wake up early this morning, they got it in the form of Feryal Ozel (University of Arizona) enthralling us all with exciting pictures, videos, and words about black holes and the Event Horizon Telescope. Ozel spoke to a packed room (at 8:30am!) about where the project currently stands, and where its heading in the future.The EHT has pretty much the coolest goal ever: actually image the event horizons of black holes in our universe. The problem is that the largest black hole we can look at (Sgr A*, in the center of our galaxy) has an event horizon size of 50 as. For this kind of resolution roughly equivalent to trying to image a DVD on the Moon! wed need an Earth-sized telescope. EHT has solved this problem by linking telescopes around the world, creating one giant, mm-wavelength effective telescope with a baseline the size of Earth.Besides producing awesome images, the EHT will be able to test properties of black-hole spacetime, the no-hair theorem, and general relativity (GR) in new regimes.Ozel walked us through some of the theory prep work we need to do now in order to get the most science out of the EHT, including devising new

  14. Exposure to radioactive aerosols in mining and milling operations: the importance of 227Ac and 231Pa

    'Full-Text:' 227Ac (half-life of 21.8 y) is the daughter or 231Pa; a beta emitter and parent of a subseries with five short-lived alpha-emitters. 231Pa (half-life of 3.27x104 y) is an alpha-emitter of the actinium series, the decay chain of 235U. As daughters of this uranium isotope they are thought to be unimportant as a radiological hazard, despite the fact that their ALI values for ingestion and inhalation are the lowest of any other radionuclide. Both nuclides can be considered as being in secular equilibrium with uranium in most geological media and so the mass concentration of 231Pa is the same of the 226Ra and that of 227Ac is the same of the 210Pa, to mention only two radionuclides of radiological concern. It is shown in this paper that if 231Pa and 227Ac are considered in the evaluations of dose commitments incurred by inhalation of aerosols in mining and milling operations, the results can be 70% higher than those calculated by the methodology of ICRP Publication 47. (author)

  15. AAS 227: Day 1

    Kohler, Susanna

    2016-01-01

    Editors Note:This week were at the 227th AAS Meeting in Kissimmee, FL. Along with several fellow authors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting at the end of each day. Follow along here or at astrobites.com, or catch ourlive-tweeted updates from the @astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Things kicked off last night at our undergraduate reception booth. Thanks to all of you who stopped by we were delightedto have so many people tell us that they already know about and useastrobites, and we were excited to introduce a new cohort of students at AAS to astrobites for the first time.Tuesday morning was the official start of the meeting. Here are just a few of the talks and workshops astrobiters attended today.Opening Address (by Becky Smethurst)The President of the AAS, aka our fearless leader Meg Urry kicked off the meeting this morning at the purely coffee powered hour of 8am this morning. She spoke about the importance of young astronomers at the meeting (heres looking at you reader!) and also the importance of the new Working Group for Accessibility and Disabilities (aka WGAD pronounced like wicked) at the AAS. The Society has made extra effort this year to make the conference accessible to all,a message which was very well received by everyone in attendance.Kavli Lecture: New Horizons Alan Stern (by Becky Smethurst)We were definitely spoilt with the first Plenary lecture at this years conference Alan Stern gave us a a review of the New Horizons mission of the Pluto Fly By (astrobites covered the mission back in July with this post). We were treated to beautiful images, wonderful results and a foray into geology.Before (Hubble) and after #NewHorizons. #thatisall #science #astro alanstern #aas227 pic.twitter.com/kkMt6RsSIR Science News (@topsciencething) January 5, 2016Some awesome facts from the lecture that blew my mind:New Horizons is now 2AU (!) beyond Pluto

  16. AAS 227: Day 3

    Kohler, Susanna

    2016-01-01

    Editors Note:This week were at the 227th AAS Meeting in Kissimmee, FL. Along with several fellow authors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting at the end of each day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Welcome to Day 3 of the winter American Astronomical Society (AAS) meeting in Kissimmee! Several of us are attending the conference this year, and we will report highlights from each day here on astrobites. If youd like to see more timely updates during the day, we encourage you to follow @astrobites on twitter or search the #aas227 hashtag.Henry Norris Russell Lecture: Viewing the Universe with Infrared Eyes: The Spitzer Space Telescope (by Erika Nesvold)The Henry Norris Russell Award is the highest honor given by the AAS, for a lifetime of eminence in astronomy research. This years award went to Giovanni Fazio of the Harvard-Smithsonian Center for Astrophysics. Fazio became a leader in gamma ray astronomy before switching mid-career to the study of infrared astronomy, and he gave his award lecture on the latter subject, specifically on the Spitzer Space Telescope, one of the most successful infrared telescopes of all time.Artists rendering of the Spitzer space telescope. [NASA/JPL-Caltech]Spitzer has been operating for more than twelve years, and has resulted in over six thousand papers in refereed journals in that time. The telescope sits in an Earth-trailing orbit around the Sun, and is now farther from the Earth (1.4 AU) than the Earth is from the Sun. Fazio gave the audience a fascinating overview of the science done by Spitzer over more than a decade. One of the most productive areas of research for Spitzer is the study of exoplanets, which hadnt even been discovered when the Spitzer Telescope was first conceived. Spitzers high sensitivity and ability to observe exoplanets over

  17. Analysis of the gamma spectra of the uranium, actinium, and thorium decay series

    Momeni, M.H.

    1981-09-01

    This report describes the identification of radionuclides in the uranium, actinium, and thorium series by analysis of gamma spectra in the energy range of 40 to 1400 keV. Energies and absolute efficiencies for each gamma line were measured by means of a high-resolution germanium detector and compared with those in the literature. A gamma spectroscopy method, which utilizes an on-line computer for deconvolution of spectra, search and identification of each line, and estimation of activity for each radionuclide, was used to analyze soil and uranium tailings, and ore.

  18. Analysis of the gamma spectra of the uranium, actinium, and thorium decay series

    This report describes the identification of radionuclides in the uranium, actinium, and thorium series by analysis of gamma spectra in the energy range of 40 to 1400 keV. Energies and absolute efficiencies for each gamma line were measured by means of a high-resolution germanium detector and compared with those in the literature. A gamma spectroscopy method, which utilizes an on-line computer for deconvolution of spectra, search and identification of each line, and estimation of activity for each radionuclide, was used to analyze soil and uranium tailings, and ore

  19. AAS 227: Day 4

    Kohler, Susanna

    2016-01-01

    Editors Note:This week were at the 227th AAS Meeting in Kissimmee, FL. Along with several fellow authors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting at the end of each day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Welcome to Day 4 of the winter American Astronomical Society (AAS) meeting in Kissimmee! Several of us are attending the conference this year, and we will report highlights from each day here on astrobites. If youd like to see more timely updates during the day, we encourage you to follow @astrobites on twitter or search the #aas227 hashtag.Helen B. Warner Prize: Origins of Structure in Planetary Systems (by Erika Nesvold)Another excellent prize lecture started off todays sessions. The Helen B. Warner Prize is awarded for achievement in observational or theoretical astrophysics by a young researcher (no more than eight years after their Ph.D.). This years Warner Prize was presented to Ruth Murray-Clay of UC Santa Barbara. For her award lecture, Murray-Clay told us all about planetary system architecture: the number, masses, and orbits of planets in a given system.Ruth Murray-Clay [photo from http://web.physics.ucsb.edu/ ~murray/biocv.html]The underlying question motivating this type of research is: How rare is the Solar System? In other words, how likely is it that a given planetary system will have rocky planets close to their star, gas giants farther out, and ice giants at the outer reaches of the system? Answering this question will help us solve the physics problem of how and where planets form, and will also help us on our search for other planets like Earth.The data on exoplanet population from transit and radial velocity observations and from direct imaging tell us that our Solar System is not common (many systems we observe have much more eccentric gas giants), but that doesnt

  20. AAS 227: Day 4

    Kohler, Susanna

    2016-01-01

    Editors Note:This week were at the 227th AAS Meeting in Kissimmee, FL. Along with several fellow authors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting at the end of each day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Welcome to Day 4 of the winter American Astronomical Society (AAS) meeting in Kissimmee! Several of us are attending the conference this year, and we will report highlights from each day here on astrobites. If youd like to see more timely updates during the day, we encourage you to follow @astrobites on twitter or search the #aas227 hashtag.Helen B. Warner Prize: Origins of Structure in Planetary Systems (by Erika Nesvold)Another excellent prize lecture started off todays sessions. The Helen B. Warner Prize is awarded for achievement in observational or theoretical astrophysics by a young researcher (no more than eight years after their Ph.D.). This years Warner Prize was presented to Ruth Murray-Clay of UC Santa Barbara. For her award lecture, Murray-Clay told us all about planetary system architecture: the number, masses, and orbits of planets in a given system.Ruth Murray-Clay [photo from http://web.physics.ucsb.edu/ ~murray/biocv.html]The underlying question motivating this type of research is: How rare is the Solar System? In other words, how likely is it that a given planetary system will have rocky planets close to their star, gas giants farther out, and ice giants at the outer reaches of the system? Answering this question will help us solve the physics problem of how and where planets form, and will also help us on our search for other planets like Earth.The data on exoplanet population from transit and radial velocity observations and from direct imaging tell us that our Solar System is not common (many systems we observe have much more eccentric gas giants), but that doesnt

  1. AAS 227: Day 2

    Kohler, Susanna

    2016-01-01

    Editors Note:This week were at the 227th AAS Meeting in Kissimmee, FL. Along with several fellow authors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting at the end of each day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Welcome to Day 2 of the winter American Astronomical Society (AAS) meeting in Kissimmee! Several of us are attending the conference this year, and we will report highlights from each day here on astrobites. If youd like to see more timely updates during the day, we encourage you to follow @astrobites on twitter or search the #aas227 hashtag.Plenary Session: Black Hole Physics with the Event Horizon Telescope (by Susanna Kohler)If anyone needed motivation to wake up early this morning, they got it in the form of Feryal Ozel (University of Arizona) enthralling us all with exciting pictures, videos, and words about black holes and the Event Horizon Telescope. Ozel spoke to a packed room (at 8:30am!) about where the project currently stands, and where its heading in the future.The EHT has pretty much the coolest goal ever: actually image the event horizons of black holes in our universe. The problem is that the largest black hole we can look at (Sgr A*, in the center of our galaxy) has an event horizon size of 50 as. For this kind of resolution roughly equivalent to trying to image a DVD on the Moon! wed need an Earth-sized telescope. EHT has solved this problem by linking telescopes around the world, creating one giant, mm-wavelength effective telescope with a baseline the size of Earth.Besides producing awesome images, the EHT will be able to test properties of black-hole spacetime, the no-hair theorem, and general relativity (GR) in new regimes.Ozel walked us through some of the theory prep work we need to do now in order to get the most science out of the EHT, including devising new

  2. AAS 227: Welcome!

    Kohler, Susanna

    2016-01-01

    Greetings from the 227th American Astronomical Society meeting in Kissimmee, Florida! This week, along with several fellow authors from astrobites, Iwill bewritingupdates on selectedevents at themeeting and posting at the end of each day. You can follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.If youre an author or referee (or plan to be!) and youre here at the meeting, consider joining us at our Author and Referee Workshop on Wednesday in the Tallahassee room, where well be sharingsome of the exciting new features of the AAS journals. You can drop intoeither of the two-hour sessions(10 AM 12 PM or 1 PM 3 PM), and there will be afree buffet lunch at noon.Heres the agenda:Morning SessionTopic Speaker10:00 am 10:05 amIntroductionsJulie Steffen10:05 am 10:35 amChanges at AAS Journals; How to Be a Successful AAS AuthorEthan Vishniac10:35 am 11:00 amThe Peer Review ProcessButler Burton11:00 am 11:15 amAAS Nova: Sharing AAS Authors Research with the Broader CommunitySusanna Kohler11:15 am 11:30 amFixing Software and Instrumentation Publishing: New Paper Styles in AAS JournalsChris Lintott11:30 am 11:45 amMaking Article Writing Easier with the New AASTeX v6.0Greg Schwarz11:45 am 12:00 pmBringing JavaScript and Interactivity to Your AAS Journal FiguresGus MuenchLunch SessionTopic Speaker12:00 pm 12:15 pmUnified Astronomy ThesaurusKatie Frey12:15 pm 12:30 pmAAS/ADS ORCID Integration ToolAlberto Accomazzi12:30 pm 12:45 pmWorldWide Telescope and Video AbstractsJosh Peek12:45 pm 01:00 pmArizona Astronomical Data Hub (AADH)Bryan HeidornAfternoon SessionTopic Speaker01:00 pm 01:05 pmIntroductionsJulie Steffen01:05 pm 01:35 pmChanges at AAS Journals; How to Be a Successful AAS AuthorEthan Vishniac01:35 pm 02:00 pmThe Peer Review ProcessButler Burton02:00 pm 02:15 pmAAS Nova: Sharing AAS Authors Research with the Broader CommunitySusanna Kohler02:15 pm 02:30 pm

  3. 49 CFR 238.227 - Suspension system.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Suspension system. 238.227 Section 238.227 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Equipment § 238.227 Suspension system. On or after November 8, 1999— (a) All passenger equipment...

  4. 7 CFR 227.40 - Program information.

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Program information. 227.40 Section 227.40 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS NUTRITION EDUCATION AND TRAINING PROGRAM Miscellaneous § 227.40...

  5. 36 CFR 223.227 - Sale advertisement.

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Sale advertisement. 223.227 Section 223.227 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE SALE AND DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER Special Forest Products Advertisement and Bids § 223.227 Sale advertisement. (a) The Forest Service...

  6. In-source laser spectroscopy developments at TRILIS—towards spectroscopy on actinium and scandium

    Resonance Ionization Laser Ion Sources (RILIS) have become a versatile tool for production and study of exotic nuclides at Isotope Separator On-Line (ISOL) facilities such as ISAC at TRIUMF. The recent development and addition of a grating tuned spectroscopy laser to the TRIUMF RILIS solid state laser system allows for wide range spectral scans to investigate atomic structures on short lived isotopes, e.g., those from the element actinium, produced in uranium targets at ISAC. In addition, development of new and improved laser ionization schemes for rare isotope production at ISAC is ongoing. Here spectroscopic studies on bound states, Rydberg states and autoionizing (AI) resonances on scandium using the existing off-line capabilities are reported. These results allowed to identify a suitable ionization scheme for scandium via excitation into an autoionizing state at 58,104 cm − 1 which has subsequently been used for ionization of on-line produced exotic scandium isotopes.

  7. 40 CFR 227.4 - Criteria for evaluating environmental impact.

    2010-07-01

    ... impact. 227.4 Section 227.4 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) OCEAN... Impact § 227.4 Criteria for evaluating environmental impact. This subpart B sets specific environmental... of direct environmental impact....

  8. 49 CFR 227.115 - Hearing protectors.

    2010-10-01

    ... greater. The hearing protectors should be used to reduce sound levels to within those levels required by... 49 Transportation 4 2010-10-01 2010-10-01 false Hearing protectors. 227.115 Section 227.115 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD...

  9. 40 CFR 227.5 - Prohibited materials.

    2010-07-01

    ... 227.5 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) OCEAN DUMPING CRITERIA FOR THE EVALUATION OF PERMIT APPLICATIONS FOR OCEAN DUMPING OF MATERIALS Environmental Impact § 227.5... environmental impact criteria of this subpart B; (d) Persistent inert synthetic or natural materials which...

  10. 18 CFR 3b.227 - Mailing lists.

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Mailing lists. 3b.227 Section 3b.227 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION, DEPARTMENT... specifically authorized by law. This provision shall not be construed to require the withholding of names...

  11. 27 CFR 44.227 - Customs procedure.

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Customs procedure. 44.227..., WITHOUT PAYMENT OF TAX, OR WITH DRAWBACK OF TAX Drawback of Tax § 44.227 Customs procedure. The customs... having inspected the articles and supervised the lading thereof on the export carrier, the...

  12. Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL

    Raeder, S.; Bastin, B.; Block, M.; Creemers, P.; Delahaye, P.; Ferrer, R.; Fléchard, X.; Franchoo, S.; Ghys, L.; Gaffney, L. P.; Granados, C.; Heinke, R.; Hijazi, L.; Huyse, M.; Kron, T.; Kudryavtsev, Yu.; Laatiaoui, M.; Lecesne, N.; Luton, F.; Moore, I. D.; Martinez, Y.; Mogilevskiy, E.; Naubereit, P.; Piot, J.; Rothe, S.; Savajols, H.; Sels, S.; Sonnenschein, V.; Traykov, E.; Van Beveren, C.; Van den Bergh, P.; Van Duppen, P.; Wendt, K.; Zadvornaya, A.

    2016-06-01

    To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.

  13. 48 CFR 227.7103-6 - Contract clauses.

    2010-10-01

    ... software or computer software documentation (see 227.72), commercial items (see 227.7102-3), existing works (see 227.7105), special works (see 227.7106), or when contracting under the Small Business Innovation... Software Previously Delivered to the Government, in solicitations when the resulting contract will...

  14. 40 CFR 227.18 - Factors considered.

    2010-07-01

    ... Esthetic, Recreational and Economic Values § 227.18 Factors considered. The assessment of the potential for impacts on esthetic, recreational and economic values will be based on an evaluation of the...

  15. 7 CFR 227.5 - Program funding.

    2010-01-01

    ... CHILD NUTRITION PROGRAMS NUTRITION EDUCATION AND TRAINING PROGRAM General § 227.5 Program funding. (a... programs. FNS funds for the Program shall augment current nutrition education and training programs and... assessment in the State, (iii) Developing a State Plan for nutrition education and training......

  16. 7 CFR 227.2 - Definitions.

    2010-01-01

    ... CHILD NUTRITION PROGRAMS NUTRITION EDUCATION AND TRAINING PROGRAM General § 227.2 Definitions. (a... support services. (m) Program means the Nutrition Education and Training Program authorized by section 19...), reach and success of any current nutrition education activities, including those relating to:...

  17. 7 CFR 227.3 - Administration.

    2010-01-01

    ... Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS NUTRITION EDUCATION AND TRAINING PROGRAM General § 227.3 Administration. (a) Within the Department, FNS shall act on behalf of the Department in the administration of the Program....

  18. 22 CFR Appendix A to Part 227 - Certification Regarding Lobbying

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Certification Regarding Lobbying A Appendix A to Part 227 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT NEW RESTRICTIONS ON LOBBYING Pt. 227, App. A Appendix A to Part 227—Certification Regarding Lobbying Certification for...

  19. 34 CFR 300.227 - Direct services by the SEA.

    2010-07-01

    ... 34 Education 2 2010-07-01 2010-07-01 false Direct services by the SEA. 300.227 Section 300.227... CHILDREN WITH DISABILITIES Local Educational Agency Eligibility § 300.227 Direct services by the SEA. (a) General. (1) An SEA must use the payments that would otherwise have been available to an LEA or to a...

  20. 20 CFR 227.5 - Employer tax credits.

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Employer tax credits. 227.5 Section 227.5... SUPPLEMENTAL ANNUITIES § 227.5 Employer tax credits. Employers are entitled to tax credits if they pay non.... The tax credits for each month equal the sum of the reductions for employer pensions in...

  1. 7 CFR 227.42 - Grant closeout procedures.

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Grant closeout procedures. 227.42 Section 227.42 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS NUTRITION EDUCATION AND TRAINING PROGRAM Miscellaneous § 227.42...

  2. 50 CFR 665.227 - Allowable gear and gear restrictions.

    2010-10-01

    ... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Allowable gear and gear restrictions. 665.227 Section 665.227 Wildlife and Fisheries FISHERY CONSERVATION AND MANAGEMENT, NATIONAL OCEANIC AND... Fisheries § 665.227 Allowable gear and gear restrictions. (a) Hawaii coral reef ecosystem MUS may be...

  3. 48 CFR 3452.227-70 - Publication and publicity.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Publication and publicity. 3452.227-70 Section 3452.227-70 Federal Acquisition Regulations System DEPARTMENT OF EDUCATION ACQUISITION REGULATION CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and Clauses 3452.227-70 Publication...

  4. 48 CFR 352.227-70 - Publications and publicity.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Publications and publicity. 352.227-70 Section 352.227-70 Federal Acquisition Regulations System HEALTH AND HUMAN SERVICES CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and Clauses 352.227-70 Publications and publicity. As prescribed...

  5. 48 CFR 2453.227 - Patents, data, and copyrights.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Patents, data, and copyrights. 2453.227 Section 2453.227 Federal Acquisition Regulations System DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT CLAUSES AND FORMS FORMS Prescription of Forms 2453.227 Patents, data, and copyrights....

  6. 48 CFR 227.7103-2 - Acquisition of technical data.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Acquisition of technical data. 227.7103-2 Section 227.7103-2 Federal Acquisition Regulations System DEFENSE ACQUISITION... Rights in Technical Data 227.7103-2 Acquisition of technical data. (a) Contracting officers shall...

  7. New method for large scale production of medically applicable Actinium-225 and Radium-223

    Alpha-emitters (211At, 212Bi, 213Bi, 223Ra, 225Ac) are promising for targeted radiotherapy of cancer. Only two alpha decays near a cell membrane result in 50% death of cancer cell and only a single decay inside the cell is required for this. 225Ac may be used either directly or as a mother radionuclide in 213Bi isotope generator. Production of 225Ac is provided by three main suppliers - Institute for Transuranium Elements in Germany, Oak Ridge National Laboratory in USA and Institute of Physics and Power Engineering in Obninsk, Russia. The current worldwide production of 225Ac is approximately 1.7 Ci per year that corresponds to only 100-200 patients that could be treated annually. The common approach for 225Ac production is separation from mother 229Th or irradiation of 226Ra with protons in a cyclotron. Both the methods have some practical limitations to be applied routinely. 225Ac can be also produced by irradiation of natural thorium with medium energy protons . Cumulative cross sections of 225Ac, 227Ac, 227Th, 228Th formations have been obtained recently. Thorium targets (1-9 g) were irradiated by 114-91 MeV proton beam (1-50 μA) at INR linear accelerator. After dissolution in 8 M HNO3 + 0.004 M HF thorium was removed by double LLX by HDEHP in toluene (1:1). Ac and REE were pre-concentrated and separated from Ra and most fission products by DGA-Resin (Triskem). After washing out by 0.01 M HNO3 Ac was separated from REE by TRU Resin (Triskem) in 3 M HNO3 media. About 6 mCi 225Ac were separated in hot cell with chemical yield 85%. The method may be upscaled for production of Ci amounts of the radionuclide. The main impurity is 227Ac (0.1% at the EOB) but it does not hinder 225Ac from being used for medical 225Ac/213Bi generators. (author)

  8. 223Ra for endoradiotherapeutic applications prepared from an immobilized 227Ac/227Th source

    A method is described for the production of 223Ra (t1/2 = 11.4 d) in a quality useful for endoradiotherapeutic applications. The method is based on a long term operating generator with a source of 227Ac (t1/2 = 21.7 years), from which 223Ra is eluted. The 227Ac was isolated from a 231Pa source using the f-element selective extraction chromatographic material TRU-resin. The purified 227Ac/227Th source was subsequently applied to another extraction chromatographic resin, containing the extractant P,P'-di(2-ethylhexyl)methanediphosphonic acid on silica (Dipex-2) and used as a generator for 223Ra. From the generator column, the yield of 223Ra was about 60 kBq per 100 kBq of 227Ac with a highly effective separation of 223Ra from the precursors. In production runs, the activity of 227Ac was found to be 6 x 10-6 relative to the eluted activity of 223Ra. By using a second column of Dipex-2 for additional purification, the activity of Ac was reduced to below 7 x 10-8 relative to 223Ra with nearly quantitative recovery of 223Ra. The described procedure resulted in a high purity 223Ra preparation, potentially useful in, e.g., targeted radiotherapy of tumors. (orig.)

  9. Purification of selenium from thorium, uranium, radium, actinium and potassium impurities for low background measurements

    A technique of selenium purification from 232Th, 238U, 226,228Ra, 227Ac and 40K was developed. This technique is simple to perform and employs a minimum number of highly pure reagents (bidistilled water, nitric acid). Operations carried out during purification (elution, evaporation) practically exclude losses of the target product (chemical yields of Se > 99%). A test purification of 100 g of selenium was carried out using this technique. The efficiency of this technique was confirmed by low background gamma spectrometry of the purified selenium sample. Distribution coefficients of Th, U, Ra and Ac on DOWEX 50W- x 8 cation-exchange resin at different concentrations of selenium and nitric acid were experimentally determinated. Instrumental neutron activation analysis of bidistilled water, deionized water and nitric acid was performed. (orig.)

  10. Purification of selenium from thorium, uranium, radium, actinium and potassium impurities for low background measurements

    Rakhimov, A.V. [Joint Institute for Nuclear Research (JINR), Dubna (Russian Federation); Uzbek Academy of Sciences, Tashkent (Uzbekistan). Inst. of Nuclear Physics (INP AS RUz); Warot, G. [CEA-CNRS, Modane (France). Laboratoire Souterrain de Modane (LSM); Karaivanov, D.V. [Joint Institute for Nuclear Research (JINR), Dubna (Russian Federation); Institute for Nuclear Research and Nuclear Energy (INRNE), Sofia (Bulgaria); Kochetov, O.I.; Lebedev, N.A.; Filosofov, D.V. [Joint Institute for Nuclear Research (JINR), Dubna (Russian Federation); Mukhamedshina, N.M.; Sadikov, I.I. [Uzbek Academy of Sciences, Tashkent (Uzbekistan). Inst. of Nuclear Physics (INP AS RUz)

    2013-07-01

    A technique of selenium purification from {sup 232}Th, {sup 238}U, {sup 226,228}Ra, {sup 227}Ac and {sup 40}K was developed. This technique is simple to perform and employs a minimum number of highly pure reagents (bidistilled water, nitric acid). Operations carried out during purification (elution, evaporation) practically exclude losses of the target product (chemical yields of Se > 99%). A test purification of 100 g of selenium was carried out using this technique. The efficiency of this technique was confirmed by low background gamma spectrometry of the purified selenium sample. Distribution coefficients of Th, U, Ra and Ac on DOWEX 50W- x 8 cation-exchange resin at different concentrations of selenium and nitric acid were experimentally determinated. Instrumental neutron activation analysis of bidistilled water, deionized water and nitric acid was performed. (orig.)

  11. 12 CFR 227.21 - Definitions.

    2010-01-01

    ...-end credit,” “credit card,” and “charge card” have the same meanings as in 12 CFR 226.2. The following... the requirements of 12 CFR 226.5b that are accessible by a credit or charge card; (2) Overdraft lines... DECEPTIVE ACTS OR PRACTICES (REGULATION AA) Consumer Credit Card Account Practices Rule § 227.21...

  12. 14 CFR 417.227 - Toxic release hazard analysis.

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Toxic release hazard analysis. 417.227..., DEPARTMENT OF TRANSPORTATION LICENSING LAUNCH SAFETY Flight Safety Analysis § 417.227 Toxic release hazard... hazard associated with toxic release and demonstrate compliance with the public risk criterion of §...

  13. Dicty_cDB: AFF227 [Dicty_cDB

    Full Text Available AF (Link to library) AFF227 (Link to dictyBase) - - - Contig-U16373-1 AFF227P (Link to Original ... fnssfkf****y***w*y***rinkk*www**i**qi*ksktt t**kr**skw ***q****kfk*kpyck***iyitii*lssfr*irkgkretrl*nhl*y* ...

  14. 20 CFR 227.4 - Reduction for employer pension.

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Reduction for employer pension. 227.4 Section... COMPUTING SUPPLEMENTAL ANNUITIES § 227.4 Reduction for employer pension. (a) General. The supplemental annuity for each month is reduced by the amount of any private pension the employee is receiving for...

  15. 14 CFR 121.227 - Pressure cross-feed arrangements.

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Pressure cross-feed arrangements. 121.227 Section 121.227 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION... cross-feed arrangements. (a) Pressure cross-feed lines may not pass through parts of the airplane...

  16. 7 CFR 227.44 - Management evaluations and reviews.

    2010-01-01

    ... 7 Agriculture 4 2010-01-01 2010-01-01 false Management evaluations and reviews. 227.44 Section 227.44 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS NUTRITION EDUCATION AND TRAINING PROGRAM...

  17. Feasibility study of direct cyclotron production of 227-Th

    Kozempel, J.; Vlk, M.; Mičolová, P.; Lebeda, Ondřej; Moša, M.; Morgenstern, A.

    2013-01-01

    Roč. 40, 2 Supplement (2013), S191-S192. ISSN 1619-7070. [Annual Congress of the European Association of Nuclear Medicine (EANM). 19.10.2013-23.10.2013, Lyon] Institutional support: RVO:61389005 Keywords : 227Th * alternative method of production 227Th * cyclotron U-120M Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders

  18. Dicty_cDB: VSC227 [Dicty_cDB

    Full Text Available VS (Link to library) VSC227 (Link to dictyBase) - - - Contig-U12232-1 VSC227Z (Link to Original ... mplet... 121 1e-26 AB211503_1( AB211503 |pid:none) Drosera ... adelae RNase DA-I mRNA for... 120 2e-26 AB034248_1 ...

  19. 12 CFR 227.13 - Unfair credit contract provisions.

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Unfair credit contract provisions. 227.13... RESERVE SYSTEM UNFAIR OR DECEPTIVE ACTS OR PRACTICES (REGULATION AA) Credit Practices Rule § 227.13 Unfair credit contract provisions. It is an unfair act or practice for a bank to enter into a consumer...

  20. 48 CFR 3452.227-72 - Advertising of awards.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Advertising of awards. 3452.227-72 Section 3452.227-72 Federal Acquisition Regulations System DEPARTMENT OF EDUCATION ACQUISITION REGULATION CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions...

  1. 48 CFR 52.227-3 - Patent Indemnity.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Patent Indemnity. 52.227-3... AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 52.227-3 Patent Indemnity. As prescribed in 27.201-2(c)(1), insert the following clause: Patent Indemnity (APR 1984) (a)...

  2. Research on Transport Properties of HFC-227ea

    Lin Shi; Xiaojun Liu; Yuanyuan Duan; Lizhong Han; Mingshan Zhu

    2001-01-01

    HFC-227ea(1,1,1,2,3,3,3-heptafluoropropane) is considered as a promising refrigerant alternative, especially as a component in mixtures, to replace to CFC-12, HCFC-22 and R502. But reliable transport properties data for HFC-227ea are very limited. In this paper, experimental data of viscosity along the saturation line and gaseous thermal conductivity of HFC-227ea are given. The viscosity of HFC-227ea was measured with a capillary viscometer at temperatures between 263.15 K and 333.15 K along the saturation line and its uncertainty of the results is estimated to be no more than +3%. The thermal conductivity of gaseous HFC-227ea was also measured with a transient hot-wire instrument at temperatures between 259.28 K and 341.75 K and pressures up to 1.289MPa, and its uncertainty of the results is estimated to be less than +1%.

  3. Canadair CL-227 Remotely Piloted Vehicle

    Clark, Andrew S.

    1983-08-01

    The Canadair CL-227 is a rotary winged Remotely Piloted Vehicle (RPV) intended initially as the air-vehicle for a medium range battlefield surveillance and target acquisition system. The concept on which this vehicle is based brings together in-house expertise as a designer and manufacturer of surveillance drones (AN-USD-50l -MIDGE-) with experience in rigid rotor technology from the CL-84 tilt wing VTOL program. The vehicle is essentially modular in design with a power module containing the engine, fuel and related systems, a rotor module containing the two counter-rotating rotors and control actuators, and a control module containing the autopilot, data link and sensor system. The vehicle is a true RPV (as opposed to a drone) as it is flown in real time by an operator on the ground and requires relatively little skill to pilot.

  4. 48 CFR 252.227-7019 - Validation of asserted restrictions-Computer software.

    2010-10-01

    ... restrictions-Computer software. 252.227-7019 Section 252.227-7019 Federal Acquisition Regulations System...—Computer software. As prescribed in 227.7104(e)(3) or 227.7203-6(c), use the following clause: Validation of Asserted Restrictions—Computer Software (JUN 1995) (a) Definitions. (1) As used in this...

  5. 7 CFR 227.43 - Participation of adults.

    2010-01-01

    ... Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS NUTRITION EDUCATION AND TRAINING PROGRAM Miscellaneous § 227.43... available or distributing to adults education materials, resources, activities or programs authorized...

  6. 40 CFR 98.227 - Records that must be retained.

    2010-07-01

    ... (CONTINUED) MANDATORY GREENHOUSE GAS REPORTING Nitric Acid Production § 98.227 Records that must be retained... paragraphs (a) through (g) of this section for each nitric acid production facility: (a) Records of... hours in the calendar year for each nitric acid train (hours). (e) Annual nitric acid...

  7. 48 CFR 227.7003 - Claims for copyright infringement.

    2010-10-01

    ... Claims, Licenses, and Assignments 227.7003 Claims for copyright infringement. The procedures set forth herein will be followed, where applicable, in copyright infringement claims. ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Claims for...

  8. 48 CFR 227.7203-4 - License rights.

    2010-10-01

    ... or documentation or the licensor of the software or documentation if the development contractor is... Software and Computer Software Documentation 227.7203-4 License rights. (a) Grant of license. The Government obtains rights in computer software or computer software documentation, including a...

  9. 7 CFR 227.31 - Audits, management reviews, and evaluations.

    2010-01-01

    ... Section 227.31 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS NUTRITION EDUCATION AND TRAINING PROGRAM State... institutions of higher education and public or private nonprofit educational or research agencies,...

  10. 7 CFR 227.4 - Application and agreement.

    2010-01-01

    ... Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS NUTRITION EDUCATION AND TRAINING PROGRAM General § 227.4 Application and... Program shall enter into a written agreement with the Department for the administration of the Program...

  11. 7 CFR 227.1 - General purpose and scope.

    2010-01-01

    ... AGRICULTURE CHILD NUTRITION PROGRAMS NUTRITION EDUCATION AND TRAINING PROGRAM General § 227.1 General purpose... carry out a nutrition information and education program through a system of grants to State agencies to... management training of school foodservice personnel, and (c) the conduct of nutrition education......

  12. 7 CFR 227.41 - Recovery of funds.

    2010-01-01

    ... Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS NUTRITION EDUCATION AND TRAINING PROGRAM Miscellaneous § 227.41 Recovery of... determines, through a review of the State agency's reports, program, or financial analysis, monitoring,...

  13. 40 CFR 264.227 - Emergency repairs; contingency plans.

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Emergency repairs; contingency plans... FACILITIES Surface Impoundments § 264.227 Emergency repairs; contingency plans. (a) A surface impoundment... days after detecting the problem. (c) As part of the contingency plan required in subpart D of...

  14. 40 CFR 227.30 - High-level radioactive waste.

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false High-level radioactive waste. 227.30...-level radioactive waste. High-level radioactive waste means the aqueous waste resulting from the operation of the first cycle solvent extraction system, or equivalent, and the concentrated waste...

  15. 48 CFR 1852.227-84 - Patent rights clauses.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Patent rights clauses. 1852... 1852.227-84 Patent rights clauses. The contracting officer shall insert the following provision as prescribed in 1827.303-70(e): Patent Rights Clauses (DEC 1989) This solicitation contains the patent...

  16. 40 CFR 180.227 - Dicamba; tolerances for residues.

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Dicamba; tolerances for residues. 180... PROGRAMS TOLERANCES AND EXEMPTIONS FOR PESTICIDE CHEMICAL RESIDUES IN FOOD Specific Tolerances § 180.227 Dicamba; tolerances for residues. (a) General. (1) Tolerances are established for the combined residues...

  17. 40 CFR 227.16 - Basis for determination of need for ocean dumping.

    2010-07-01

    ... ocean dumping. 227.16 Section 227.16 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) OCEAN DUMPING CRITERIA FOR THE EVALUATION OF PERMIT APPLICATIONS FOR OCEAN DUMPING OF MATERIALS Need for Ocean Dumping § 227.16 Basis for determination of need for ocean dumping. (a) A need for...

  18. 40 CFR 227.6 - Constituents prohibited as other than trace contaminants.

    2010-07-01

    ... trace contaminants. 227.6 Section 227.6 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... Environmental Impact § 227.6 Constituents prohibited as other than trace contaminants. (a) Subject to the..., of materials containing the following constituents as other than trace contaminants will not...

  19. 19 CFR 10.227 - Verification and justification of claim for preferential treatment.

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Verification and justification of claim for preferential treatment. 10.227 Section 10.227 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF...-Caribbean Basin Trade Partnership Act § 10.227 Verification and justification of claim for...

  20. 48 CFR 227.675-1 - International Traffic in Arms Regulations.

    2010-10-01

    ... set forth in the International Traffic in Arms Regulations, 22 CFR, et seq.) Before authorizing such... Arms Regulations. 227.675-1 Section 227.675-1 Federal Acquisition Regulations System DEFENSE... COPYRIGHTS Foreign License and Technical Assistance Agreements 227.675-1 International Traffic in...

  1. 30 CFR 227.104 - What will MMS do when it receives a State's delegation proposal?

    2010-07-01

    ... record the receipt date. MMS will notify you in writing within 15 business days whether your proposal is... delegation proposal? 227.104 Section 227.104 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT DELEGATION TO STATES Delegation Proposals § 227.104 What will MMS...

  2. 48 CFR 227.7104 - Contracts under the Small Business Innovation Research (SBIR) Program.

    2010-10-01

    ... Business Innovation Research (SBIR) Program. 227.7104 Section 227.7104 Federal Acquisition Regulations... Data and Computer Software—Small Business Innovation Research (SBIR) Program, when technical data or... PATENTS, DATA, AND COPYRIGHTS Rights in Technical Data 227.7104 Contracts under the Small...

  3. 48 CFR 252.227-7027 - Deferred ordering of technical data or computer software.

    2010-10-01

    ... technical data or computer software. 252.227-7027 Section 252.227-7027 Federal Acquisition Regulations... data or computer software. As prescribed at 227.7103-8(b), use the following clause: Deferred Ordering of Technical Data or Computer Software (APR 1988) In addition to technical data or computer...

  4. 48 CFR 252.227-7026 - Deferred delivery of technical data or computer software.

    2010-10-01

    ... technical data or computer software. 252.227-7026 Section 252.227-7026 Federal Acquisition Regulations... data or computer software. As prescribed at 227.7103-8(a), use the following clause: Deferred Delivery of Technical Data or Computer Software (APR 1988) The Government shall have the right to require,...

  5. 22 CFR Appendix B to Part 227 - Disclosure Form To Report Lobbying

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Disclosure Form To Report Lobbying B Appendix B to Part 227 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT NEW RESTRICTIONS ON LOBBYING Pt. 227, App. B Appendix B to Part 227—Disclosure Form To Report Lobbying EC06OC91.012...

  6. 42 CFR 435.227 - Individuals under age 21 who are under State adoption assistance agreements.

    2010-10-01

    ... determines that— (i) At the time of the adoption placement, the child had special needs for medical or rehabilitative care that made the child difficult to place; and (ii) There is in effect an adoption assistance... adoption assistance agreements. 435.227 Section 435.227 Public Health CENTERS FOR MEDICARE &...

  7. 48 CFR 52.227-2 - Notice and Assistance Regarding Patent and Copyright Infringement.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Notice and Assistance Regarding Patent and Copyright Infringement. 52.227-2 Section 52.227-2 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION (CONTINUED) CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses...

  8. 47 CFR 80.227 - Special requirements for protection from RF radiation.

    2010-10-01

    ... requirements for protection from RF radiation. As part of the information provided with transmitters for ship... 47 Telecommunication 5 2010-10-01 2010-10-01 false Special requirements for protection from RF radiation. 80.227 Section 80.227 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) SAFETY...

  9. 48 CFR 252.227-7006 - License grant-running royalty.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false License grant-running... of Provisions And Clauses 252.227-7006 License grant—running royalty. As prescribed at 227.7009-4(a...—Running Royalty (AUG 1984) (a) The Contractor hereby grants to the Government, as represented by...

  10. 48 CFR 252.227-7007 - License term-running royalty.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false License term-running... of Provisions And Clauses 252.227-7007 License term—running royalty. As prescribed at 227.7009-4(b), insert the following clause in patent releases, license agreements, and assignments: License...

  11. 48 CFR 227.7009-3 - Additional clauses-contracts except running royalty contracts.

    2010-10-01

    ...-contracts except running royalty contracts. 227.7009-3 Section 227.7009-3 Federal Acquisition Regulations...—contracts except running royalty contracts. The following clauses are examples for use in patent release and settlement agreements, and license agreements not providing for payment by the Government of a...

  12. 48 CFR 227.7204 - Contracts under the Small Business Innovative Research Program.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Contracts under the Small Business Innovative Research Program. 227.7204 Section 227.7204 Federal Acquisition Regulations System... under the Small Business Innovative Research Program. When contracting under the Small...

  13. 77 FR 5615 - First Meeting: RTCA Special Committee 227, Standards of Navigation Performance

    2012-02-03

    ... Federal Aviation Administration First Meeting: RTCA Special Committee 227, Standards of Navigation Performance AGENCY: Federal Aviation Administration (FAA), U.S. Department of Transportation (DOT). ACTION... this notice to advise the public of the first meeting of RTCA Special Committee 227, Standards...

  14. 48 CFR 252.227-7039 - Patents-reporting of subject inventions.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Patents-reporting of... CLAUSES Text of Provisions And Clauses 252.227-7039 Patents—reporting of subject inventions. As prescribed in 227.303(1), use the following clause: Patents—Reporting of Subject Inventions (APR 1990)...

  15. 48 CFR 252.227-7012 - Patent license and release contract.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Patent license and release... of Provisions And Clauses 252.227-7012 Patent license and release contract. As prescribed at 227.7012, insert the following clause in patent releases, license agreements, and assignments: (Contract...

  16. 21 CFR 1.227 - What definitions apply to this subpart?

    2010-04-01

    ... 21 Food and Drugs 1 2010-04-01 2010-04-01 false What definitions apply to this subpart? 1.227 Section 1.227 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL... kitchens, day care kitchens, and nursing home kitchens are restaurants; and (ii) Pet shelters, kennels,...

  17. 12 CFR 227.26 - Unfair charging of security deposits and fees for the issuance or availability of credit to...

    2010-01-01

    ... for the issuance or availability of credit to consumer credit card accounts. 227.26 Section 227.26... UNFAIR OR DECEPTIVE ACTS OR PRACTICES (REGULATION AA) Consumer Credit Card Account Practices Rule § 227... consumer credit card accounts. (a) Limitation for first year. During the first year, a bank must not...

  18. 40 CFR 227.14 - Criteria for evaluating the need for ocean dumping and alternatives to ocean dumping.

    2010-07-01

    ... ocean dumping and alternatives to ocean dumping. 227.14 Section 227.14 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) OCEAN DUMPING CRITERIA FOR THE EVALUATION OF PERMIT APPLICATIONS FOR OCEAN DUMPING OF MATERIALS Need for Ocean Dumping § 227.14 Criteria for evaluating the need for...

  19. In vivo detection of prion amyloid plaques using [11C]BF-227 PET

    In vivo detection of pathological prion protein (PrP) in the brain is potentially useful for the diagnosis of transmissible spongiform encephalopathies (TSEs). However, there are no non-invasive ante-mortem means for detection of pathological PrP deposition in the brain. The purpose of this study is to evaluate the amyloid imaging tracer BF-227 with positron emission tomography (PET) for the non-invasive detection of PrP amyloid in the brain. The binding ability of BF-227 to PrP amyloid was investigated using autoradiography and fluorescence microscopy. Five patients with TSEs, including three patients with Gerstmann-Straeussler-Scheinker disease (GSS) and two patients with sporadic Creutzfeldt-Jakob disease (CJD), underwent [11C]BF-227 PET scans. Results were compared with data from 10 normal controls and 17 patients with Alzheimer's disease (AD). The regional to pons standardized uptake value ratio was calculated as an index of BF-227 retention. Binding of BF-227 to PrP plaques was confirmed using brain samples from autopsy-confirmed GSS cases. In clinical PET study, significantly higher retention of BF-227 was detected in the cerebellum, thalamus and lateral temporal cortex of GSS patients compared to that in the corresponding tissues of normal controls. GSS patients also showed higher retention of BF-227 in the cerebellum, thalamus and medial temporal cortex compared to AD patients. In contrast, the two CJD patients showed no obvious retention of BF-227 in the brain. Although [11C]BF-227 is a non-specific imaging marker of cerebral amyloidosis, it is useful for in vivo detection of PrP plaques in the human brain in GSS, based on the regional distribution of the tracer. PET amyloid imaging might provide a means for both early diagnosis and non-invasive disease monitoring of certain forms of TSEs. (orig.)

  20. In vivo detection of prion amyloid plaques using [{sup 11}C]BF-227 PET

    Okamura, Nobuyuki; Yanai, Kazuhiko [Tohoku University School of Medicine, Department of Pharmacology, Sendai (Japan); Shiga, Yusei; Itoyama, Yasuhito [Tohoku University School of Medicine, Department of Neurology, Sendai (Japan); Furumoto, Shozo [Tohoku University School of Medicine, Department of Pharmacology, Sendai (Japan); Tohoku University, Division of Radiopharmaceutical Chemistry, Cyclotron and Radioisotope Center, Sendai (Japan); Tashiro, Manabu [Tohoku University, Division of Cyclotron Nuclear Medicine, Cyclotron and Radioisotope Center, Sendai (Japan); Tsuboi, Yoshio [Fukuoka University School of Medicine, Department of Neurology, Fukuoka (Japan); Furukawa, Katsutoshi; Arai, Hiroyuki [Institute of Development, Aging, and Cancer, Tohoku University, Department of Geriatrics and Gerontology, Division of Brain Sciences, Sendai (Japan); Iwata, Ren [Tohoku University, Division of Radiopharmaceutical Chemistry, Cyclotron and Radioisotope Center, Sendai (Japan); Kudo, Yukitsuka [Tohoku University, Innovation of New Biomedical Engineering Center, Sendai (Japan); Doh-ura, Katsumi [Tohoku University School of Medicine, Department of Prion Research, 2-1 Seiryo-machi, Aoba-ku, Sendai (Japan)

    2010-05-15

    In vivo detection of pathological prion protein (PrP) in the brain is potentially useful for the diagnosis of transmissible spongiform encephalopathies (TSEs). However, there are no non-invasive ante-mortem means for detection of pathological PrP deposition in the brain. The purpose of this study is to evaluate the amyloid imaging tracer BF-227 with positron emission tomography (PET) for the non-invasive detection of PrP amyloid in the brain. The binding ability of BF-227 to PrP amyloid was investigated using autoradiography and fluorescence microscopy. Five patients with TSEs, including three patients with Gerstmann-Straeussler-Scheinker disease (GSS) and two patients with sporadic Creutzfeldt-Jakob disease (CJD), underwent [{sup 11}C]BF-227 PET scans. Results were compared with data from 10 normal controls and 17 patients with Alzheimer's disease (AD). The regional to pons standardized uptake value ratio was calculated as an index of BF-227 retention. Binding of BF-227 to PrP plaques was confirmed using brain samples from autopsy-confirmed GSS cases. In clinical PET study, significantly higher retention of BF-227 was detected in the cerebellum, thalamus and lateral temporal cortex of GSS patients compared to that in the corresponding tissues of normal controls. GSS patients also showed higher retention of BF-227 in the cerebellum, thalamus and medial temporal cortex compared to AD patients. In contrast, the two CJD patients showed no obvious retention of BF-227 in the brain. Although [{sup 11}C]BF-227 is a non-specific imaging marker of cerebral amyloidosis, it is useful for in vivo detection of PrP plaques in the human brain in GSS, based on the regional distribution of the tracer. PET amyloid imaging might provide a means for both early diagnosis and non-invasive disease monitoring of certain forms of TSEs. (orig.)

  1. Surgical intervention for advanced valvular heart disease in 227 cases

    ZHANG Xi; ZHONG Fo-tian; XU Zhe; XU Ying-qi; WANG Zhi-ping; WU Zhong-kai; TANG Bai-yun; XIONG Mai; YAO Jian-ping; SUN Pei-wu

    2005-01-01

    Background Although the results of surgical treatment in cardiac valve disease continue to improve, the postoperative mortality rate and the rate of complications in patients with advanced valvular heart disease (AVHD) are still very high. We did this retrospective study to summarize the surgical experience of heart valve replacement for patients with AVHD and discuss effective ways to improve the surgical outcome.Results The operative mortality rate was 13.2% (30/227). The main causes of death included multiple organ dysfunction syndrome (MODS), low cardiac output syndrome and ventricular fibrillation. From the results of the binary noncounterpart multivariate logistic regression, the following statistically significant factors were found to influence the operative mortality rate: redo operation, age ≥55 years, preoperative NYHA cardiac function grading, extracorporeal circulation time ≥120 minutes and postoperative usage of GIK (glucose, insulin and potassium) solution. All factors were risk ones except postoperative application of GIK. The Hosmer-Lemeshow goodness of fit coefficient of this model was 0.976.Conclusions The risk factors associated with postoperative mortality rate in the patients with AVHD were redo operation, age ≥55 years, preoperative NYHA cardiac function grading and extracorporeal circulation time ≥120 minutes. Postoperative usage of GIK acted as a kind of metabolic therapy and will improve the recovery for patients with AVHD. Active perioperative management and care will play a very important role in reducing the operative risk and improving the short term outcome of surgical treatment for the patients with AVHD.

  2. Development, integration and test of an automatic UAV recovery system for the CL227 VTOL-UAV

    Μπώκος, Γιώργος Δ.; Ferrier, Bernard

    1995-01-01

    The CL227 autoland program was designed to operate at sea from small ship combatants. This article highlights the evolution of the automated ship recovery system being developed in support of the CL227 UAV. Test results are provided concentrating on system response and control aspects affecting the performance of the CL227 recovery activity. A brief summary of the feasibility and simulation studies is given. A description of the data link software and hardware components is presented.

  3. Application of MRP-227-A boarding inspection guidelines to NPP Almaraz

    It has developed a proposal for inspection program to the internal components of the vessels of Almaraz NPP reactors for the extended operation of the plant, taking as a reference the MRP-227-A document of EPRI, which contains guidelines for inspection and evaluation of the internal components during long-term operation. In line with the guidelines of the MRP-227-A, inmates have been classified into four groups, according to which the relevant requirements of inspection and acceptance criteria have been established. The application of this new inspection program ensures compliance of NUREG-1801 Rev.2.

  4. 25 CFR 900.227 - Can the awarding official change the decision after it has been made?

    2010-04-01

    ... has been made? 900.227 Section 900.227 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR... change the decision after it has been made? (a) The decision of the awarding official is final and... is timely commenced as authorized by the Contract Disputes Act. Once the decision has been made,...

  5. 48 CFR 252.227-7018 - Rights in noncommercial technical data and computer software-Small Business Innovation Research...

    2010-10-01

    ... technical data and computer software-Small Business Innovation Research (SBIR) Program. 252.227-7018 Section... Innovation Research (SBIR) Program. As prescribed in 227.7104(a), use the following clause: Rights in Noncommercial Technical Data and Computer Software—Small Business Innovation Research (SBIR) Program (JUN...

  6. 48 CFR 227.7009-4 - Additional clauses-contracts providing for payment of a running royalty.

    2010-10-01

    ...-contracts providing for payment of a running royalty. 227.7009-4 Section 227.7009-4 Federal Acquisition... clauses—contracts providing for payment of a running royalty. The clauses set forth below are examples... desired to cover the subject matter thereof and the contract provides for payment of a running royalty....

  7. An ISO far-infrared survey of line and continuum emission for 227 galaxies

    Brauher, J. R.

    2002-01-01

    Far-infrared line and continuum fluxes are presented for a sample of 227 galaxies observed with the Long Wavelength Spectrometer on the Infrared Space Observatory, selected from the ISO Data Archive and having an IRAS 60/100 mu m color ration of 0.2-1.4 and IRAS 60 mu m flux density between 0.1 Jy and 1300 Jy.

  8. 40 CFR 227.10 - Hazards to fishing, navigation, shorelines or beaches.

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Hazards to fishing, navigation... Environmental Impact § 227.10 Hazards to fishing, navigation, shorelines or beaches. (a) Wastes which may present a serious obstacle to fishing or navigation may be dumped only at disposal sites and...

  9. 48 CFR 1852.227-11 - Patent Rights-Retention by the Contractor (Short Form).

    2010-10-01

    ... of tier, for experimental, developmental, research, design, or engineering work to be performed by... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Patent Rights-Retention by... CLAUSES Texts of Provisions and Clauses 1852.227-11 Patent Rights—Retention by the Contractor (Short...

  10. CSAR 81-001 addendum 2: Use of a plexiglass contamination barrier in HC-227-T

    Plutonium Finish Plant (PFP) Engineering requested a criticality safety evaluation (Appendix 1) to support a revision of Criticality Prevention Specification CPS-Z-165-80601 allowing a plexiglass enclosure (PGE) to be placed inside the HC-227T hood as a contamination barrier. The HC-227T hood is the receiving/transfer enclosure for Pu nitrate solution contained in Product Removal containers (PR Cans), L10 Containers (L10, Fl-10, 10 L) or L-3 Containers. Within the HC-227T, a 1.349 square meter (15 square foot) enclosure, PGE, has been created to provide contamination control around the weighing scale. Two or more standard criticality drains shall be installed on this enclosure prior to beneficial usage. The evaluation considered the normal process, spillage scenarios, waste/container accumulations within the enclosure, and interactions of Pu within the enclosure as well as other containers external to the enclosure. The results from the criticality safety analysis by CRA shows that such as contamination barrier can be placed inside the HC-227T Hood if the PGE is equipped with adequate criticality drains. In addition, other limits as well as administrative controls listed in CPS-Z-165-80601 Rev./Mod. B/0 and CPS-Z-165-80010 Rev./Mod. C/1 shall also apply

  11. 7 CFR 227.37 - State plan for nutrition education and training.

    2010-01-01

    ... NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS NUTRITION EDUCATION AND TRAINING PROGRAM State Coordinator Provisions § 227.37 State plan for nutrition education and training. (a) General... year; (5) Provisions for coordinating the nutrition education and training programs carried out...

  12. Has California's Passage of Proposition 227 Made a Difference in the Way We Teach?

    Arellano-Houchin, Anna; Flamenco, Claudia; Merlos, Moises M.; Segura, Lorena

    2001-01-01

    Examined how teachers were impacted by California's Proposition 227, highlighting changes in teaching styles and beliefs about the proposition and its effectiveness. Teachers had to change their teaching strategies to accommodate the new curriculum. They were not sufficiently trained for immediate implementation of English-only education. Teaching…

  13. 25 CFR 227.25 - Inspection of premises, books and accounts.

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Inspection of premises, books and accounts. 227.25... Inspection of premises, books and accounts. Lessee shall agree to allow the lessor and his agents or any... Department; and their books and records, showing manner of operations and persons interested, shall be...

  14. 30 CFR 250.227 - What environmental impact analysis (EIA) information must accompany the EP?

    2010-07-01

    ... harvest practices, recreation, recreational and commercial fishing (including typical fishing seasons... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What environmental impact analysis (EIA... and Information Contents of Exploration Plans (ep) § 250.227 What environmental impact analysis...

  15. 48 CFR 227.7009 - Patent releases, license agreements, and assignments.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Patent releases, license... ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE GENERAL CONTRACTING REQUIREMENTS PATENTS, DATA, AND COPYRIGHTS Infringement Claims, Licenses, and Assignments 227.7009 Patent releases, license agreements,...

  16. 48 CFR 52.227-10 - Filing of Patent Applications-Classified Subject Matter.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Filing of Patent... Text of Provisions and Clauses 52.227-10 Filing of Patent Applications—Classified Subject Matter. As prescribed at 27.203-2, insert the following clause: Filing of Patent Applications—Classified Subject...

  17. 48 CFR 52.227-4 - Patent Indemnity-Construction Contracts.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Patent Indemnity... Clauses 52.227-4 Patent Indemnity—Construction Contracts. As prescribed in 27.201-2(d)(1), insert the following clause: Patent Indemnity—Construction Contracts (DEC 2007) Except as otherwise provided,...

  18. 48 CFR 52.227-7 - Patents-Notice of Government Licensee.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Patents-Notice of... Clauses 52.227-7 Patents—Notice of Government Licensee. As prescribed at 27.202-5(b), insert the following provision: Patents—Notice of Government Licensee (APR 1984) The Government is obligated to pay a...

  19. The Political Discourse of the Campaign against Bilingual Education: From "Proposition 227" to "Horne v. Flores"

    Yamagami, Mai

    2012-01-01

    Using the frameworks of critical discourse analysis, representation theory, and legitimization theory, this study examines the political discourse of the campaign for Proposition 227 in California--particularly, the key social representations of languages, their speakers, and the main political actors in the campaign. The analysis examines the…

  20. Initial evaluation of 227Th-p-benzyl-DOTA-rituximab for low-dose rate α-particle radioimmunotherapy

    Radioimmunotherapy has proven clinically effective in patients with non-Hodgkin's lymphoma. Radioimmunotherapy trials have so far been performed with β-emitting isotopes. In contrast to β-emitters, the shorter range and high linear energy transfer (LET) of α particles allow for more efficient and selective killing of individually targeted tumor cells. However, there are several obstacles to the use of α-particle immunotherapy, including problems with chelation chemistry and nontarget tissue toxicity. The α-emitting radioimmunoconjugate 227Th-DOTA-p-benzyl-rituximab is a new potential anti-lymphoma agent that might overcome some of these difficulties. The present study explores the immunoreactivity, in vivo stability and biodistribution, as well as the effect on in vitro cell growth, of this novel radioimmunoconjugate. To evaluate in vivo stability, uptake in balb/c mice of the α-particle-emitting nuclide 227Th alone, the chelated form, 227Th-p-nitrobenzyl-DOTA and the radioimmunoconjugate 227Th-DOTA-p-benzyl-rituximab was compared in a range of organs at increasing time points after injection. The immunoreactive fraction of 227Th-DOTA-p-benzyl-rituximab was 56-65%. During the 28 days after injection of radioimmunoconjugate only, very modest amounts of the 227Th had detached from DOTA-p-benzyl-rituximab, indicating a relevant stability in vivo. The half-life of 227Th-DOTA-p-benzyl-rituximab in blood was 7.4 days. Incubation of lymphoma cells with 227Th-DOTA-p-benzyl-rituximab resulted in a significant antigen-dependent inhibition of cell growth. The data presented here warrant further studies of 227Th-DOTA-p-benzyl-rituximab

  1. Treatment of HER2-Expressing Breast Cancer and Ovarian Cancer Cells With Alpha Particle-Emitting 227Th-Trastuzumab

    Purpose: To evaluate the cytotoxic effects of low-dose-rate alpha particle-emitting radioimmunoconjugate 227Th-p-isothiocyanato-benzyl-DOTA-trastuzumab (227Th-trastuzumab [where DOTA is 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid]) internalized by breast and ovarian cancer cell lines in order to assess the potential of 227Th-trastuzumab as a therapeutic agent against metastatic cancers that overexpress the HER2 oncogene. Methods and Materials: Clonogenic survival and cell growth rates of breast cancer cells treated with 227Th-trastuzumab were compared with rates of cells treated with nonbinding 227Th-rituximab, cold trastuzumab, and X-radiation. Cell growth experiments were also performed with ovarian cancer cells. Cell-associated radioactivity was measured at several time points, and the mean radiation dose to cells was calculated. Results: SKBR-3 cells got 50% of the mean absorbed radiation dose from internalized activity and 50% from cell surface-bound activity, while BT-474 and SKOV-3 cells got 75% radiation dose from internalized activity and 25% from cell surface-bound activity. Incubation of breast cancer cells with 2.5 kBq/ml 227Th-trastuzumab for 1 h at 4oC, followed by washing, resulted in mean absorbed radiation doses of 2 to 2.5 Gy. A dose-dependent inhibition of cell growth and an increase in apoptosis were induced in all cell lines. Conclusions: Clinically relevant activity concentrations of 227Th-trastuzumab induced a specific cytotoxic effect in three HER2-expressing cell lines. The cytotoxic effect of 227Th-trastuzumab was higher than that of single-dose X-radiation (relative biological effectiveness = 1.2). These results warrant further studies of treatment of breast cancer and ovarian cancer with 227Th-trastuzumab.

  2. Analysis of early phase [11C]BF-227 PET, and its application for anatomical standardization of late-phase images for 3D-SSP analysis

    To examine the usefulness of the early phase [11C]BF-227 positron emission tomography (PET) for (1) conferring additional diagnostic value by providing perfusion-like information and (2) obtaining the appropriate anatomical standardization (AS) using three-dimensional stereotactic surface projection (3D-SSP) method. This study included 20 mild cognitive impairment (MCI), 19 Alzheimer's disease (AD), and 17 normal cognitive (NC) subjects. Early- and late-phase BF-227 PET images were obtained 0-10 and 40-60 min after the injection, respectively. AS for late-phase BF-227 images were performed by 2 methods: (1) method A, for AS of late-phase BF-227 images using 8F-fluorodeoxyglucose (FDG) images of the same subject and (2) method B, for AS of late-phase BF-227 images using early phase BF-227 images. Method B was successfully used for AS in all cases. The Z score maps of 3D-SSP analyses of FDG PET and early phase BF-227 PET for AD and MCI groups showed a typical AD-like pattern. Regional analyses revealed that the early phase BF-227 PET showed significant differences between AD and NC, and MCI and NC. The early phase BF-227 PET images showed significant abnormal findings for the AD and MCI groups. AS of late-phase BF-227 images using early phase BF-227 images were successful, and enabled appropriate 3D-SSP analyses. (author)

  3. Human Cystathionine-β-Synthase Phosphorylation on Serine227 Modulates Hydrogen Sulfide Production in Human Urothelium.

    Roberta d'Emmanuele di Villa Bianca

    Full Text Available Urothelium, the epithelial lining the inner surface of human bladder, plays a key role in bladder physiology and pathology. It responds to chemical, mechanical and thermal stimuli by releasing several factors and mediators. Recently it has been shown that hydrogen sulfide contributes to human bladder homeostasis. Hydrogen sulfide is mainly produced in human bladder by the action of cystathionine-β-synthase. Here, we demonstrate that human cystathionine-β-synthase activity is regulated in a cGMP/PKG-dependent manner through phosphorylation at serine 227. Incubation of human urothelium or T24 cell line with 8-Bromo-cyclic-guanosine monophosphate (8-Br-cGMP but not dibutyryl-cyclic-adenosine monophosphate (d-cAMP causes an increase in hydrogen sulfide production. This result is congruous with the finding that PKG is robustly expressed but PKA only weakly present in human urothelium as well as in T24 cells. The cGMP/PKG-dependent phosphorylation elicited by 8-Br-cGMP is selectively reverted by KT5823, a specific PKG inhibitor. Moreover, the silencing of cystathionine-β-synthase in T24 cells leads to a marked decrease in hydrogen sulfide production either in basal condition or following 8-Br-cGMP challenge. In order to identify the phosphorylation site, recombinant mutant proteins of cystathionine-β-synthase in which Ser32, Ser227 or Ser525 was mutated in Ala were generated. The Ser227Ala mutant cystathionine-β-synthase shows a notable reduction in basal biosynthesis of hydrogen sulfide becoming unresponsive to the 8-Br-cGMP challenge. A specific antibody that recognizes the phosphorylated form of cystathionine-β-synthase has been produced and validated by using T24 cells and human urothelium. In conclusion, human cystathionine-β-synthase can be phosphorylated in a PKG-dependent manner at Ser227 leading to an increased catalytic activity.

  4. The sensitivity of female NMRI mice of different ages for osteosarcoma induction with 227thorium

    The effect of age on osteosarcoma induction after incorporation of the short-lived alpha-emitter 227Th was studied in 12 month old and young (1 month and 3 month old) female NMRI mice. Injection of 1 μCi/kg 227Th in 1 month or 12 month old mice induced osteosarcomas with a similar incidence in both groups (21% and 16%, maximum corrected cumulative incidence 32% and 43%). The osteosarcoma appearance time in the older animals was shorter and there was no significant difference in the age at appearance of osteosarcomas in the two groups. After injection of 5 μCi/kg 227Th the maximum corrected cumulative osteosarcoma incidence was considerably lower in the older group (10%) than in the younger group (61%) despite the fact that there were 32 survivors in the older group at the time of appearance of the last osteosarcoma. Incorporation of 2x1 μCi/kg 227Th at the age of 12 months and 14 months or 3 months and 5 months induced osteosarcoma with a similar maximum corrected cumulative osteosarcoma incidence (62% and 68% respectively). The mean osteosarcoma appearance time after the first incorporation was shorter in the older age group than in the younger age group but osteosarcomas still appeared overall at a younger age in the younger age group. The mean osteosarcoma appearance time after the first incorporation following fractionation of the internal irradiation period, by injection of 1 μCi/kg at the age of 3 months and 12 months, was significantly longer than in either the 3-months/5-months group or the 12-months /14-months group. (orig.)

  5. Interplay of fission modes in mass distribution of light actinide nuclei 225,227Pa

    R. Dubey

    2016-01-01

    Full Text Available Fission-fragment mass distributions were measured for 225,227Pa nuclei formed in fusion reactions of 19F+206,208Pb around fusion barrier energies. Mass-angle correlations do not indicate any quasi-fission like events in this bombarding energy range. Mass distributions were fitted by Gaussian distribution and mass variance extracted. At below-barrier energies, the mass variance was found to increase with decrease in energy for both nuclei. Results from present work were compared with existing data for induced fission of 224,226Th and 228U around barrier energies. Enhancement in mass variance of 225,227Pa nuclei at below-barrier energies shows evidence for presence of asymmetric fission events mixed with symmetric fission events. This is in agreement with the results of mass distributions of nearby nuclei 224,226Th and 228U where two-mode fission process was observed. Two-mode feature of fission arises due to the shell effects changing the landscape of the potential-energy surfaces at low excitation energies. The excitation-energy dependence of the mass variance gives strong evidence for survival of microscopic shell effects in fission of light actinide nuclei 225,227Pa with initial excitation energy ∼30–50 MeV.

  6. Interplay of fission modes in mass distribution of light actinide nuclei 225,227Pa

    Dubey, R.; Sugathan, P.; Jhingan, A.; Kaur, Gurpreet; Mukul, Ish; Mohanto, G.; Siwal, D.; Saneesh, N.; Banerjee, T.; Thakur, Meenu; Mahajan, Ruchi; Kumar, N.; Chatterjee, M. B.

    2016-01-01

    Fission-fragment mass distributions were measured for 225,227Pa nuclei formed in fusion reactions of 19F + 206,208Pb around fusion barrier energies. Mass-angle correlations do not indicate any quasi-fission like events in this bombarding energy range. Mass distributions were fitted by Gaussian distribution and mass variance extracted. At below-barrier energies, the mass variance was found to increase with decrease in energy for both nuclei. Results from present work were compared with existing data for induced fission of 224,226Th and 228U around barrier energies. Enhancement in mass variance of 225,227Pa nuclei at below-barrier energies shows evidence for presence of asymmetric fission events mixed with symmetric fission events. This is in agreement with the results of mass distributions of nearby nuclei 224,226Th and 228U where two-mode fission process was observed. Two-mode feature of fission arises due to the shell effects changing the landscape of the potential-energy surfaces at low excitation energies. The excitation-energy dependence of the mass variance gives strong evidence for survival of microscopic shell effects in fission of light actinide nuclei 225,227Pa with initial excitation energy ∼30-50 MeV.

  7. The half-life of 227Th by direct and indirect measurements

    Utilising a chemically purified solution the radioactive half-life of 227Th has been determined indirectly by observation of the ingrowth of 223Ra using an ionisation chamber (IC) and for the first time by direct observation of the change in activity with time using a high-purity germanium (HPGe) γ-ray spectrometer. The radioactive decay was observed for ~104 days (~5.6 half-lives) by γ-ray spectrometry and approximately 63 days and 72 days (~3.4 and ~3.9 half-lives) using an ionisation chamber (IC). The resulting half-life values – 18.695 (4) days (IC) and 18.683 (20) days (HPGe) – are consistent and detailed uncertainty budgets are presented for the two measurement techniques. A weighted mean of our results of 18.695 (4) days is inconsistent with the most precise published half-life value of 18.7176 (52) days (Jordan and Blanke, 1967). A critical evaluation of literature data has been performed, indicating a paucity of reliable and independent measurements. Selected independent published values have been used to determine a recommended half-life of 18.697 (7) days. A method has been introduced in the course of this work so that the recommended half-life of 227Th as determined by ingrowth can be modified if a different 223Ra half-life has been determined, evaluated and adopted. - Highlights: • First direct measurement of 227Th half-life by HPGe γ-ray spectrometry. • Precision half-life measurement by ionisation chamber. • New half-life of 18.695 (4) days determined. • Critical evaluation of published half-lives and recommended value determined

  8. Facile solvent extraction separation of Th-227 and Ac-225 based on room-temperature ionic liquids

    New separation methodologies for radioisotopes are crucial to many medical applications. In this work, the solvent extraction of Th-227 and Ac-225 based on ionic liquids (ILs) was investigated using N,N,N',N'-tetraoctyldiglycolamide (TODGA) or di(2-ethylhexyl)phosphoric acid (HDEHP) as an extractant. Four ILs, 1-butyl-3-methylimidazolium bis(trifluoromethanesulfonyl)imide ([C4mim][NTf2]), 1-butyl-3-methylimidazolium bis(perfluoroethanesulfonyl)imide ([C4mim][BETI]), 1-butyl-2,3-trimethyleneimidazolium (trifluoromethanesulfonyl)imide ([BuI5][NTf2]), and 1-benzyl pyridinium bis(trifluoromethanesulfonyl)imide ([PhCH2Py][NTf2]) with different cation or anion structural features were used as diluents for the separation of Th-227 and Ac-225. Excellent extraction efficiencies and selectivities were found for Th-227/Ac-225 when HDEHP was used as an extractant in these ILs. The effects of different extractant concentrations in ILs and different aqueous phase acidities on extraction efficiencies and selectivities of Th-227/Ac-225 are also presented. The success in separation of Th-227 and Ac-225 isotopes highlights great potentials of use of ionic liquids in isotope production. (orig.)

  9. MRP-227 Reactor vessel internals inspection planning and initial results at the Oconee nuclear station unit 2

    The U.S. PWR industry has pro-actively developed generic inspection requirements and standards for reactor vessel (RV) internals. The Electric Power Research Institute (EPRI) Pressurized Water Reactor (PWR) Materials Reliability Program (MRP) has issued MRP-227-A and MRP-228 with mandatory and needed requirements based on the Nuclear Energy Institute (NEI) document NEI 03-08. The inspection and evaluation guidelines contained in MRP-227-A consider eight age-related degradation mechanisms: stress corrosion cracking (SCC), irradiation-assisted stress corrosion cracking (IASCC), wear, fatigue, thermal aging embrittlement, irradiation embrittlement, void swelling and irradiation growth, and thermal and irradiation-enhanced stress relaxation or irradiation-enhanced creep. This paper will discuss the decision planning efforts required for implementing the MRP-227-A and MRP-228 requirements and the results of these initial inspections at the Oconee Nuclear power station (ONS) units. Duke Energy and AREVA overcame a significant technology and NDE challenge by successfully completing the first-of-a-kind MRP-227-A scope requirements at ONS-1 in one outage below the estimated dose and with zero safety issues or events. This performance was repeated at ONS-2 a year later. The remote NDE tooling and processes developed to examine the MRP-227-A scope for ONS-1 and ONS-2 are transferable to other PWRs

  10. Interplay of fission modes in mass distribution of light actinide nuclei 225,227Pa

    R Dubey; Sugathan, P; Jhingan, A.; Gurpreet Kaur; Ish Mukul; G. Mohanto; Siwal, D.; Saneesh, N.; T Banerjee; Meenu Thakur; Ruchi Mahajan; Kumar, N; Chatterjee, M. B.

    2016-01-01

    Fission-fragment mass distributions were measured for 225,227 Pa nuclei formed in fusion reactions of 19 F + 206,208 Pb around fusion barrier energies. Mass-angle correlations do not indicate any quasi-fission like events in this bombarding energy range. Mass distributions were fitted by Gaussian distribution and mass variance extracted. At below-barrier energies, the mass variance was found to increase with decrease in energy for both nuclei. Results from present work were compared with exis...

  11. Decommissioning of TA-21-153, a 227Ac contaminated old filter building

    An exhaust air filter building contaminated with 227Ac was decommissioned at the Los Alamos National Laboratory, Los Alamos, New Mexico, in 1978. The building was constructed in the late 1940s to clean exhaust air from several buildings at TA-21, DP Site. It was in service until March 1970. The project involved preliminary decontamination, dismantling the building, and burying the debris at an on-site waste disposal/storage area. This report presents the details on the decommissioning procedures, health physics, waste management, environmental surveillance, and costs for the operation

  12. Interplay of fission modes in mass distribution of light actinide nuclei 225,227Pa

    Dubey, R; Jhingan, A; Kaur, Gurpreet; Mukul, Ish; Mohanto, G; Siwal, D; Saneesh, N; Banerjee, T; Thakur, Meenu; Mahajan, Ruchi; Kumar, N; Chatterjee, M B

    2015-01-01

    Fission-fragment mass distributions were measured for 225,227Pa nuclei formed in fusion reactions of 19F + 206, 208Pb around fusion barrier energies. Mass-angle correlations do not indicate any quasi-fission like events in this bombarding energy range. Mass distributions were fitted by Gaussian distribution and mass variance extracted. At below-barrier energies, the mass variance was found to increase with decrease in energy for both nuclei. Results from present work were compared with existing data for induced fission of 224, 226Th and 228U around barrier energies. Enhancement in mass variance of 225, 227Pa nuclei at below-barrier energies shows evidence for presence of asymmetric fission events mixed with symmetric fission events. This is in agreement with the results of mass distributions of nearby nuclei 224, 226Th and 228U where two-mode fission process was observed. Two-mode feature of fission arises due to the shell effects changing the landscape of the potential energy surfaces at low excitation energ...

  13. MRP-227/228 component inspections supporting nuclear power plant license renewal

    Highlights: • Inspections meeting the new requirements of MRP-227/228 are presented. • These inspections allow utilities to comply with requirements for license extension. • Modeling results for UT inspection methods are presented. • Defects down to 1% cross-sectional area were detected in a blind demonstration. • All MRP-required demonstrations were successfully passed. - Abstract: As the world’s nuclear reactor fleet continues to age, the importance of verifying the structural integrity of critical reactor components and systems has continued to increase. Some critical components are the reactor internals found in close proximity to the nuclear fuel rods which are exposed not only to high stresses and temperatures, but also to high radiation and neutron fluxes. The Materials Reliability Program (MRP-227/228) has provided guidance indicating which components are of the highest importance and susceptibility to the aging mechanisms found in nuclear reactors. These components must be either inspected or replaced in order for plants to be granted license renewals to continue commercial operations. Several inspection methods are presented that were successfully demonstrated and comply with these new guidelines to meet the requirements for license renewal

  14. In Vitro Cytotoxicity of Low-Dose-Rate Radioimmunotherapy by the Alpha-Emitting Radioimmunoconjugate Thorium-227-DOTA-Rituximab

    Purpose: To determine whether the low-dose-rate α-particle-emitting radioimmunoconjugate 227Th-1,4,7,10-p-isothiocyanato-benzyl-tetraazacyclododecane-1,4,7, 10-tetraacetic acid (DOTA)-rituximab can be used to inactivate lymphoma cells growing as single cells and small colonies. Methods and Materials: CD20-positive lymphoma cell lines were treated with 227Th-DOTA-rituximab for 1-5 weeks. To simulate the in vivo situation with continuous but decreasing supply of radioimmunoconjugates from the blood pool, the cells were not washed after incubation with 227Th-DOTA-rituximab, but half of the medium was replaced with fresh medium, and cell concentration and cell-bound activity were determined every other day after start of incubation. A microdosimetric model was established to estimate the average number of hits in the nucleus for different localizations of activity. Results: There was a specific targeted effect on cell growth of the 227Th-DOTA-rituximab treatment. Although the cells were not washed after incubation with 227Th-DOTA-rituximab, the average contribution of activity in the medium to the mean dose was only 6%, whereas the average contribution from activity on the cells' own surface was 78%. The mean dose rates after incubation with 800 Bq/mL 227Th-DOTA-rituximab varied from 0.01 to 0.03 cGy/min. The average delay in growing from 105 to 107 cells/mL was 15 days when the cells were treated with a mean absorbed radiation dose of 2 Gy α-particle radiation from 227Th-DOTA-rituximab, whereas it was 11 days when the cells were irradiated with 6 Gy of X-radiation. The relative biologic effect of the treatment was estimated to be 2.9-3.4. Conclusions: The low-dose-rate radioimmunoconjugate 227Th-DOTA-rituximab is suitable for inactivation of single lymphoma cells and small colonies of lymphoma cells.

  15. Complete genome sequence of Lactobacillus plantarum LZ227, a potential probiotic strain producing B-group vitamins.

    Li, Ping; Zhou, Qingqing; Gu, Qing

    2016-09-20

    B-group vitamins play an important role in human metabolism, whose deficiencies are associated with a variety of disorders and diseases. Certain microorganisms such as Lactic acid bacteria (LAB) have been shown to have capacities for B-group vitamin production and thus could potentially replace chemically synthesized vitamins for food fortification. A potential probiotic strain named Lactobacillus plantarum LZ227, which was isolated from raw cow milk in this study, exhibits the ability to produce B-group vitamins. Complete genome sequencing of LZ227 was performed to gain insights into the genetic elements involved in B-group vitamin production. The genome of LZ227 contains a circular 3,131,750-bp chromosome, three circular plasmids and two predicted linear plasmids. LZ227 also contains gene clusters for biosynthesis of both riboflavin and folate. This genome sequence provides a basis for further elucidation of its molecular genetics and probiotic functions, and will facilitate its applications as starter cultures in food industry. PMID:27480344

  16. Accelerating growth of HFC-227ea (1,1,1,2,3,3,3-heptafluoropropane) in the atmosphere

    Laube, J.C.; Martinerie, P.; Witrant, E.;

    2010-01-01

    We report the first measurements of 1,1,1,2,3,3,3-heptafluoropropane (HFC-227ea), a substitute for ozone depleting compounds, in air samples originating from remote regions of the atmosphere and present evidence for its accelerating growth. Observed mixing ratios ranged from below 0.01 ppt in deep...

  17. 27 CFR 70.227 - Suspension of running of period of limitation; wrongful seizure of property of third party.

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Suspension of running of... Limitations § 70.227 Suspension of running of period of limitation; wrongful seizure of property of third party. The running of the period of limitations on collection after assessment prescribed in 26...

  18. 27 CFR 28.227 - Removals of beer by persons other than the brewer or agent of the brewer.

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Removals of beer by... ALCOHOL Exportation of Beer With Benefit of Drawback Execution of Claims § 28.227 Removals of beer by persons other than the brewer or agent of the brewer. Where there is a removal of taxpaid beer by a...

  19. 78 FR 9420 - Central Gulf of Mexico Planning Area (CPA) Outer Continental Shelf (OCS) Oil and Gas Lease Sale 227

    2013-02-08

    ... 227 will begin at 9 a.m., Wednesday, March 20, 2013, at the Mercedes-Benz Superdome, 1500 Sugarbowl... to 66 FR 28002 (published May 21, 2001), 69 FR 23211 (published April 28, 2004), 72 FR 27590 (published May 16, 2007), 72 FR 35720 (published June 29, 2007), 73 FR 63505 (published October 24,...

  20. Age related retention and dose burden after injection of 224Ra and 227Th in mice

    Incorporation of 224Ra in different aged female NMRI mice was investigated. The retention in skeleton (long bones) decreased continuously with age and remained constant after an age of about 10 months (decrease of percentage uptake from 50 to 25%). Rather similar conditions were found for the retention of 227Th, but with a somewhat smaller decrease (45 to 35%). These skeletal doses are often based on the values of femur concentration. In the case of mice, however, most bone tumours occur in the lumbar vertebrae, where the retention does not vary much with age. In contrast to the skeleton the retention of 224Ra was increased with age in the spleen, reaching concentrations even higher than that in the skeleton of old animals. It was remarkable that radium was retained in the spleen in this high concentration only when it was injected directly (as 224Ra) but much less, when it was given indirectly i.e. as the daughter nuclide 223Ra of its parent 227Th. If equal skeletal doses for different aged animals are to be intended, the reduced retention in the higher age has to be taken into account. Since dosage is mostly related to body weight (for instance Bq per kilogram) the resulting skeletal dose will be too small if the body weight and skeletal weight would be proportional. Since by the growth of fat tissue the body weight normally increases more than skeletal weight (after an age of a few months), the lowered retention might be more or less corrected for by relating to body weight. 3 refs.; 3 figs

  1. Study on the Relationship between Blood Stasis Syndrome and Clinical Pathology in 227 Patients with Primary Glomerular Disease

    李深; 饶向荣; 王素霞; 张改华; 李晓玫; 戴希文; 陈可冀

    2009-01-01

    To investigate the relationship between the severity of Chinese medicine(CM) bloodstasis syndrome(BSS) with clinical features and renal lesion indexes of the primary glomerular disease. Methods:An epidemiological survey was conducted to collect the data of 227 patients diagnosed as chronic primary glomerular diseases,and their severity of BSS were scored three days before renal biopsies were performed.The following clinical indexes were analyzed:age,course of glomerular diseases,24-h urine protein ration...

  2. Structural basis for nematode eIF4E binding an m(2,2,7)G-Cap and its implications for translation initiation.

    Liu, Weizhi; Jankowska-Anyszka, Marzena; Piecyk, Karolina; Dickson, Laura; Wallace, Adam; Niedzwiecka, Anna; Stepinski, Janusz; Stolarski, Ryszard; Darzynkiewicz, Edward; Kieft, Jeffrey; Zhao, Rui; Jones, David N M; Davis, Richard E

    2011-11-01

    Metazoan spliced leader (SL) trans-splicing generates mRNAs with an m(2,2,7)G-cap and a common downstream SL RNA sequence. The mechanism for eIF4E binding an m²²⁷G-cap is unknown. Here, we describe the first structure of an eIF4E with an m(2,2,7)G-cap and compare it to the cognate m⁷G-eIF4E complex. These structures and Nuclear Magnetic Resonance (NMR) data indicate that the nematode Ascaris suum eIF4E binds the two different caps in a similar manner except for the loss of a single hydrogen bond on binding the m(2,2,7)G-cap. Nematode and mammalian eIF4E both have a low affinity for m(2,2,7)G-cap compared with the m⁷G-cap. Nematode eIF4E binding to the m⁷G-cap, m(2,2,7)G-cap and the m(2,2,7)G-SL 22-nt RNA leads to distinct eIF4E conformational changes. Additional interactions occur between Ascaris eIF4E and the SL on binding the m(2,2,7)G-SL. We propose interactions between Ascaris eIF4E and the SL impact eIF4G and contribute to translation initiation, whereas these interactions do not occur when only the m(2,2,7)G-cap is present. These data have implications for the contribution of 5'-UTRs in mRNA translation and the function of different eIF4E isoforms. PMID:21965542

  3. Outcomes From AAS Hack Day at the 227th AAS Meeting

    Kohler, Susanna

    2016-01-01

    Editors Note:This is a final post from the 227th AAS Meeting in Kissimmee, FL. This special summary of AAS Hack Day, a meeting of AAS members to collaboratively work on various small projects, was written by Meredith Rawls (@Merrdiff) and was originally posted on astrobites.com.As the 227thAmerican Astronomical Society meeting drew to a close (see highlights from Day 1, Day 2, Day 3, and Day 4), a group of at least 50 attendees spent Day 4working on small projects fondly called hacks. Thanks to sponsorship from LSST and Northrup Grumman, the industrious hackers werewell-caffeinated and fed so we could devote time and energy toworking in groups on one-day projects.TheHack Day beganat 10am with pitches. Anybody with a project idea was welcome to briefly speak and try to convince others to work with them. Only someideas panned out, but the enthusiasm was palpable. Its not every day you get a full room of astronomers and affiliates eager to spend hours working on fun and useful projects to benefit the community.#hackAAS is getting underway! #aas227 pic.twitter.com/yX7jlOnSCK James R A Davenport (@jradavenport) January 8, 2016Here is a rundown of what we accomplished. Pretty impressive for a single day! Many thanks to fellow astrobiter Erika Nesvold (now at Carnegie DTM; @erikanesvold) whose hack was live-documenting all the other hacks. Her tweets as @astrobites appeared with the #hackaas hashtag, and her notes made this recap post infinitely easier to write.Interested in joining the fun? Sign up for Hack Day at the 2017 JanuaryAAS meeting (its free with meeting registration), and consider applying for the .Astronomy conference this summer.Towards Optimal Session Scheduling:Adrian Price-Whelan (Columbia), David Hogg (NYU), and Scott Idem (AAS) began writing a program to take all submitted abstracts to a conference like AAS and sort them using keywords to avoid scheduling similar talks in parallel sessions. Its impossible to make everyone happy, but minimizing conflicts

  4. LiB 3O 5 crystal structure at 20, 227 and 377 °C

    Shepelev, Yu. F.; Bubnova, R. S.; Filatov, S. K.; Sennova, N. A.; Pilneva, N. A.

    2005-10-01

    Crystal structure of LiB 3O 5 (a framework of [B 3O 5] - rings and Li atoms located in interspaces) was refined at high temperatures using single-crystal X-ray diffraction, Mo Kα-radiation, anharmonic approximation, orthorhombic; Pna2 1; Z=4; 20 °C ( a=8.444, b=7.378, c=5.146 Å, 1411 F( hkl), R=0.022); 227 °C ( a=8.616, b=7.433, c=5.063 Å, 1336 F( hkl), R=0.026), 377 °C ( a=8.746, b=7.480, c=5.013 Å, 1193 F( hkl), R=0.035). A high mobility of Li atoms and their highly asymmetric vibrations are revealed. Ellipsoid of Li thermal vibrations is oviform. Li is shifted on heating to 0.26 Å mainly along a-axis causing high thermal expansion in this direction; Li temperature factors are multiplied by 4 on heating. Rigid boron-oxygen groups in LiB 3O 5 remain practically stable on heating similar to α-Na 2B 8O 13 and α-CsB 5O 8. At the same time these groups rotate relative to each other like hinges leading to extremely anisotropic thermal expansion ( α a=101, α b=31, α c=-71, α v=60×10 -6 °C -1, 20-530 °C, HTXRPD data).

  5. Interaction between supernova remnant G22.7–0.2 and the ambient molecular clouds

    We have carried out 12CO (J = 1-0 and 2-1), 13CO (J = 1-0), and C18O (J = 1-0) observations in the direction of the supernova remnant (SNR) G22.7–0.2. A filamentary molecular gas structure, which is likely part of a larger molecular complex with V LSR ∼ 75-79 km s–1, is detected and is found to surround the southern boundary of the remnant. In particular, the high-velocity wing (77-110 km s–1) in the 12CO (J = 1-0 and J = 2-1) emission shows convincing evidence of the interaction between SNR G22.7–0.2 and the 75-79 km s–1 molecular clouds (MCs). Spectra with redshifted profiles, a signature of shocked molecular gas, are seen in the southeastern boundary of the remnant. The association between the remnant and the 77 km s–1 MCs places the remnant at the near distance of 4.4 ± 0.4 kpc, which agrees with a location on the Scutum-Crux arm. We suggest that SNR G22.7–0.2, SNR W41, and H II region G022.760-0.485 are at the same distance and are associated with GMC G23.0–0.4.

  6. Removal of actinium from europium for the determination of specific radioactivity of ultra low-level Eu-152 in a sample exposed to atomic-bomb neutrons in Nagasaki

    Measurements of specific radioactivities of residual neutron-induced radionuclides such as 152Eu and 60Co have been carried out to check the validity of a series of computer calculations employed for the atomic-bomb neutron dosimetry in Hiroshima (exposed to uranium bomb) and Nagasaki (exposed to plutonium bomb). The use of these nuclides for atomic-bomb neutron dosimetry, however, has been limited by the following difficulties: (1) today, these radionuclides are found only at extremely low concentrations in materials exposed to the atomic-bomb and (2) the neutrons that induced these radionuclides were thermal and epithermal, while the neutron dose received in Hiroshima and Nagasaki is attributable to fast neutrons. In order to overcome the first difficulty, we established a chemical procedure to extract Eu and Co from materials exposed to the atomic-bomb, and the chemical procedure has been successful for the materials exposed to atomic-bomb within 1400 m in slant distance from the explosion point. As for Nagasaki, materials exposed in the distances farther than 1200 m have never been subjected to the measurement of residual neutron-induced radionuclides. In this work, determination of specific radioactivity of 152Eu (half-life: 13.542 y) in a sample exposed to Nagasaki atomic-bomb at a distant place from the explosion point was undertaken. But, because of radioactive decay during this ∝60 years since 1945 and long distance from the explosion point, the present specific radioactivity of 152Eu in the sample is extremely low (estimated to be ∝3 x 10-4 Bq-152Eu/mg-Eu), and a serious problem is interferences from daughters of 227Ac (half-life: 21.8 y) in the measurement of ultra low-level radioactivity of 152Eu. Hence, our chemical procedure to obtain Eu-enriched counting source should be improved, and much attention is being denoted to removal of Ac from Eu. (orig.)

  7. LiB3O5 crystal structure at 20, 227 and 377 deg. C

    Crystal structure of LiB3O5 (a framework of [B3O5]- rings and Li atoms located in interspaces) was refined at high temperatures using single-crystal X-ray diffraction, MoKα-radiation, anharmonic approximation, orthorhombic; Pna21; Z=4; 20 deg. C (a=8.444, b=7.378, c=5.146 A, 1411 F(hkl), R=0.022); 227 deg. C (a=8.616, b=7.433, c=5.063 A, 1336 F(hkl), R=0.026), 377 deg. C (a=8.746, b=7.480, c=5.013 A, 1193 F(hkl), R=0.035). A high mobility of Li atoms and their highly asymmetric vibrations are revealed. Ellipsoid of Li thermal vibrations is oviform. Li is shifted on heating to 0.26 A mainly along a-axis causing high thermal expansion in this direction; Li temperature factors are multiplied by 4 on heating. Rigid boron-oxygen groups in LiB3O5 remain practically stable on heating similar to α-Na2B8O13 and α-CsB5O8. At the same time these groups rotate relative to each other like hinges leading to extremely anisotropic thermal expansion (αa =101, αb =31, αc =-71, αv =60x10-6 deg. C-1, 20-530 deg. C, HTXRPD data). - Graphical abstract: Li anharmonic thermal vibrations in LiB3O5 crystal structures. Display Omitted

  8. The HB22.7 Anti-CD22 monoclonal antibody enhances bortezomib-mediated lymphomacidal activity in a sequence dependent manner

    Martin Shiloh M

    2011-12-01

    Full Text Available Abstract Most non-Hodgkin's lymphomas (NHL initially respond to chemotherapy, but relapse is common and treatment is often limited by chemotherapy-related toxicity. Bortezomib, is a highly selective proteasome inhibitor with anti-NHL activity; it is currently FDA approved for second-line treatment of mantle cell lymphoma (MCL. Bortezomib exerts its activity in part through the generation of reactive oxygen species (ROS and also by the induction of apoptosis. We previously validated CD22 as a potential target in treating NHL and have shown that the anti-CD22 ligand blocking antibody, HB22.7, has significant independent lymphomacidal properties in NHL xenograft models. We sought to determine whether or not these agents would work synergistically to enhance cytotoxicity. Our results indicate that treatment of NHL cell lines with HB22.7 six hours prior to bortezomib significantly diminished cell viability. These effects were not seen when the agents were administered alone or when bortezomib was administered prior to HB22.7. Additionally, HB22.7 treatment prior to bortezomib increased apoptosis in part through enhanced ROS generation. Finally, in a mouse xenograft model, administration of HB22.7 followed 24 hours later by bortezomib resulted in 23% smaller tumor volumes and 20% enhanced survival compared to treatment with the reverse sequence. Despite the increased efficacy of HB22.7 treatment followed by bortezomib, there was no corresponding decrease in peripheral blood cell counts, indicating no increase in toxicity. Our results suggest that pre-treatment with HB22.7 increases bortezomib cytotoxicity, in part through increased reactive oxygen species and apoptosis, and that this sequential treatment combination has robust efficacy in vivo.

  9. Combined renin inhibition/(prorenin receptor blockade in diabetic retinopathy--a study in transgenic (mREN227 rats.

    Wendy W Batenburg

    Full Text Available Dysfunction of renin-angiotensin system (RAS contributes to the pathogenesis of diabetic retinopathy (DR. Prorenin, the precursor of renin is highly elevated in ocular fluid of diabetic patients with proliferative retinopathy. Prorenin may exert local effects in the eye by binding to the so-called (prorenin receptor ((PRR. Here we investigated the combined effects of the renin inhibitor aliskiren and the putative (PRR blocker handle-region peptide (HRP on diabetic retinopathy in streptozotocin (STZ-induced diabetic transgenic (mRen227 rats (a model with high plasma prorenin levels as well as prorenin stimulated cytokine expression in cultured Müller cells. Adult (mRen227 rats were randomly divided into the following groups: (1 non-diabetic; (2 diabetic treated with vehicle; (3 diabetic treated with aliskiren (10 mg/kg per day; and (4 diabetic treated with aliskiren+HRP (1 mg/kg per day. Age-matched non-diabetic wildtype Sprague-Dawley rats were used as control. Drugs were administered by osmotic minipumps for three weeks. Transgenic (mRen227 rat retinas showed increased apoptotic cell death of both inner retinal neurons and photoreceptors, increased loss of capillaries, as well as increased expression of inflammatory cytokines. These pathological changes were further exacerbated by diabetes. Aliskiren treatment of diabetic (mRen227 rats prevented retinal gliosis, and reduced retinal apoptotic cell death, acellular capillaries and the expression of inflammatory cytokines. HRP on top of aliskiren did not provide additional protection. In cultured Müller cells, prorenin significantly increased the expression levels of IL-1α and TNF-α, and this was completely blocked by aliskiren or HRP, their combination, (PRR siRNA and the AT1R blocker losartan, suggesting that these effects entirely depended on Ang II generation by (PRR-bound prorenin. In conclusion, the lack of effect of HRP on top of aliskiren, and the Ang II-dependency of the ocular

  10. Eta' photoproduction on the proton for photon energies from 1.527 to 2.227 GeV.

    Dugger, M; Ball, J P; Collins, P; Pasyuk, E; Ritchie, B G; Adams, G; Ambrozewicz, P; Anciant, E; Anghinolfi, M; Asavapibhop, B; Asryan, G; Audit, G; Avakian, H; Bagdasaryan, H; Baillie, N; Baltzell, N A; Barrow, S; Batourine, V; Battaglieri, M; Beard, K; Bedlinskiy, I; Bektasoglu, M; Bellis, M; Benmouna, N; Berman, B L; Bianchi, N; Biselli, A S; Bonner, B E; Bouchigny, S; Boiarinov, S; Bradford, R; Branford, D; Briscoe, W J; Brooks, W K; Bültmann, S; Burkert, V D; Butuceanu, C; Calarco, J R; Careccia, S L; Carman, D S; Carnahan, B; Chen, S; Cole, P L; Coleman, A; Coltharp, P; Cords, D; Corvisiero, P; Crabb, D; Crannell, H; Credé, V; Cummings, J P; De Sanctis, E; DeVita, R; Degtyarenko, P V; Denizli, H; Dennis, L; Deur, A; Dharmawardane, K V; Dhuga, K S; Djalali, C; Dodge, G E; Donnelly, J; Doughty, D; Dragovitsch, P; Dytman, S; Dzyubak, O P; Egiyan, H; Egiyan, K S; Elouadrhiri, L; Empl, A; Eugenio, P; Fatemi, R; Fedotov, G; Feldman, G; Feuerbach, R J; Forest, T A; Funsten, H; Garçon, M; Gavalian, G; Gilfoyle, G P; Giovanetti, K L; Girod, F X; Goetz, J T; Gothe, R W; Griffioen, K A; Guidal, M; Guillo, M; Guler, N; Guo, L; Gyurjyan, V; Hadjidakis, C; Hakobyan, R S; Hardie, J; Heddle, D; Hersman, F W; Hicks, K; Hleiqawi, I; Holtrop, M; Hu, J; Huertas, M; Hyde-Wright, C E; Ilieva, Y; Ireland, D G; Ishkhanov, B S; Ito, M M; Jenkins, D; Jo, H S; Joo, K; Juengst, H G; Kellie, J D; Khandaker, M; Kim, K Y; Kim, K; Kim, W; Klein, A; Klein, F J; Klimenko, A V; Klusman, M; Kossov, M; Kramer, L H; Kubarovsky, V; Kuhn, J; Kuhn, S E; Lachniet, J; Laget, J M; Langheinrich, J; Lawrence, D; Lee, T; Lima, A C S; Livingston, K; Lukashin, K; Manak, J J; Marchand, C; Maximon, L C; McAleer, S; McKinnon, B; McNabb, J W C; Mecking, B A; Mestayer, M D; Meyer, C A; Mibe, T; Mikhailov, K; Minehart, R; Mirazita, M; Miskimen, R; Mokeev, V; Morrow, S A; Muccifora, V; Mueller, J; Mutchler, G S; Nadel-Turonski, P; Napolitano, J; Nasseripour, R; Niccolai, S; Niculescu, G; Niczyporuk, B B; Niyazov, R A; Nozar, M; O'Rielly, G V; Osipenko, M; Ostrovidov, A I; Park, K; Paterson, C; Philips, S A; Pierce, J; Pivnyuk, N; Pocanic, D; Pogorelko, O; Pozdniakov, S; Preedom, B M; Price, J W; Prok, Y; Protopopescu, D; Qin, L M; Raue, B A; Riccardi, G; Ricco, G; Ripani, M; Ronchetti, F; Rosner, G; Rossi, P; Rowntree, D; Rubin, P D; Sabatié, F; Salgado, C; Santoro, J P; Sapunenko, V; Schumacher, R A; Serov, V S; Shafi, A; Sharabian, Y G; Shaw, J; Simionatto, S; Skabelin, A V; Smith, E S; Smith, L C; Sober, D I; Spraker, M; Stavinsky, A; Stepanyan, S S; Stepanyan, S; Stokes, B E; Stoler, P; Strakovsky, I I; Strauch, S; Taiuti, M; Taylor, S; Tedeschi, D J; Thoma, U; Thompson, R; Tkabladze, A; Tkachenko, S; Tur, C; Ungaro, M; Vineyard, M F; Vlassov, A V; Wang, K; Weinstein, L B; Weller, H; Weygand, D P; Williams, M; Wolin, E; Wood, M H; Yegneswaran, A; Yun, J; Zana, L; Zhang, J

    2006-02-17

    Differential cross sections for the reaction gamma p --> eta' p have been measured with the CLAS spectrometer and a tagged photon beam with energies from 1.527 to 2.227 GeV. The results reported here possess much greater accuracy than previous measurements. Analyses of these data suggest for the first time the coupling of the eta'N channel to both the S11(1535) and P11(1710) resonances, known to couple strongly to the etaN channel in photoproduction on the proton, and the importance of J = 3/2 resonances in the process. PMID:16605984

  11. Developing 226Ra and 227Ac age-dating techniques for nuclear forensics to gain insight from concordant and non-concordant radiochronometers

    The model age or 'date of purification' of a nuclear material is an important nuclear forensic signature. In this study, chemical separation and MC-ICP-MS measurement techniques were developed for 226 Ra and 227Ac: grand-daughter nuclides in the 238U and 235U decay chains respectively. The 230Th-234U, 226Ra-238U, 231Pa-235U, and 227Ac-235U radiochronometers were used to calculate model ages for CRM-U100 standard reference material and two highly-enriched pieces of uranium metal from the International Technical Working Group Round Robin 3 Exercise. In conclusion, the results demonstrate the accuracy of the 226Ra-238U and 227Ac-235U chronometers and provide information about nuclide migration during uranium processing

  12. Developing 226Ra and 227Ac age-dating techniques for nuclear forensics to gain insight from concordant and non-concordant radiochronometers

    The model age or 'date of purification' of a nuclear material is an important nuclear forensic signature. In this study, chemical separation and MC-ICP-MS measurement techniques were developed for 226Ra and 227Ac: grand-daughter nuclides in the 238U and 235U decay chains, respectively. The 230Th-234U, 226Ra-238U, 231Pa-235U, and 227Ac-235U radiochronometers were used to calculate model ages for CRM-U100 standard reference material and two highly-enriched pieces of uranium metal from the International Technical Working Group Round Robin 3 Exercise. Results demonstrate the accuracy of the 226Ra-238U and 227Ac-235U chronometers and provide information about nuclide migration during uranium processing. (author)

  13. Development of the method for treatment for bone metastasis by using disequilibrium-type alpha particle emitting in vivo generator: 227Th-EDTMP

    To evaluate the efficacy of an alpha emitting radiopharmaceutical, 227Th-EDTMP for treatment of bone metastasis, 1) the process of bone metastasis on rats were monitored by radiography and gamma scintigraphy, and 2) 227Th-EDTMP were administered to bone metastasis model rats and assessed its palliation effect by von Frey filament test and measured tumor size. Two weeks after tumor cell inoculation, rats showed osteolytic change on cell inoculated site and bone lesion was detected by scintigraphy. In the therapy study, the rats showed no toxic effect by 227Th-EDTMP. However, the tumor volume size was increased with time and the bone pain palliation was comparable to control groups. Further experiment was necessary. (author)

  14. A modified method of 3D-SSP analysis for amyloid PET imaging using [11C]BF-227

    Three-dimensional stereotactic surface projection (3D-SSP) analyses have been widely used in dementia imaging studies. However, 3D-SSP sometimes shows paradoxical results on amyloid positron emission tomography (PET) analyses. This is thought to be caused by errors in anatomical standardization (AS) based on an 18F-fluorodeoxyglucose (FDG) template. We developed a new method of 3D-SSP analysis for amyloid PET imaging, and used it to analyze 11C-labeled 2-(2-[2-dimethylaminothiazol-5-yl]ethenyl)-6-(2-[fluoro]ethoxy) benzoxazole (BF-227) PET images of subjects with mild cognitive impairment (MCI) and Alzheimer's disease (AD). The subjects were 20 with MCI, 19 patients with AD, and 17 healthy controls. Twelve subjects with MCI were followed up for 3 years or more, and conversion to AD was seen in 6 cases. All subjects underwent PET with both FDG and BF-227. For AS and 3D-SSP analyses of PET data, Neurostat (University of Washington, WA, USA) was used. Method 1 involves AS for BF-227 images using an FDG template. In this study, we developed a new method (Method 2) for AS: First, an FDG image was subjected to AS using an FDG template. Then, the BF-227 image of the same patient was registered to the FDG image, and AS was performed using the transformation parameters calculated for AS of the corresponding FDG images. Regional values were normalized by the average value obtained at the cerebellum and values were calculated for the frontal, parietal, temporal, and occipital lobes. For statistical comparison of the 3 groups, we applied one-way analysis of variance followed by the Bonferroni post hoc test. For statistical comparison between converters and non-converters, the t test was applied. Statistical significance was defined as p < 0.05. Among the 56 cases we studied, Method 1 demonstrated slight distortions after AS of the image in 16 cases and heavy distortions in 4 cases in which the distortions were not observed with Method 2. Both methods demonstrated that the

  15. Assessment of long-term radiotoxicity after treatment with the low-dose-rate alpha-particle-emitting radioimmunoconjugate 227Th-rituximab

    The anti-CD20 antibody rituximab labelled with the α-particle-emitting radionuclide 227Th is of interest as a radiotherapeutic agent for treatment of lymphoma. Complete regression of human lymphoma Raji xenografts in 60% of mice treated with 200 kBq/kg 227Th-rituximab has been observed. To evaluate possible late side effects of 227Th-rituximab, the long-term radiotoxicity of this potential radiopharmaceutical was investigated. BALB/c mice were injected with saline, cold rituximab or 50, 200 or 1,000 kBq/kg 227Th-rituximab and followed for up to 1 year. In addition, nude mice with Raji xenografts treated with various doses of 227Th-rituximab were also included in the study. Toxicity was evaluated by measurements of mouse body weight, white blood cell (WBC) and platelet counts, serum clinical chemistry parameters and histological examination of tissues. Only the 1,000 kBq/kg dosage resulted in decreased body weight of the BALB/c mice. There was a significant but temporary decrease in WBC and platelet count in mice treated with 400 and 1,000 kBq/kg 227Th-rituximab. Therefore, the no-observed-adverse-effect level (NOAEL) was 200 kBq/kg. The maximum tolerated activity was between 600 and 1,000 kBq/kg. No significant signs of toxicity were observed in histological sections in any examined tissue. There were significantly (p 227Th-rituximab or non-labelled antibody when compared with control mice. The maximum tolerated dose to bone marrow was between 2.1 and 3.5 Gy. Therapeutically relevant dose levels of 227Th-rituximab were well tolerated in mice. Bone marrow suppression, as indicated by decrease in WBC count, was the dose-limiting radiotoxicity. These toxicity data together with anti-tumour activity data in a CD20-positive xenograft mouse model indicate that therapeutic effects could be obtained with relatively safe dosage levels of the radioimmunoconjugate. (orig.)

  16. CSRL-V ENDF/B-V 227-group neutron cross-section library and its application to thermal-reactor and criticality safety benchmarks

    Characteristics and contents of the CSRL-V (Criticality Safety Reference Library based on ENDF/B-V data) 227-neutron-group AMPX master and pointwise cross-section libraries are described. Results obtained in using CSRL-V to calculate performance parameters of selected thermal reactor and criticality safety benchmarks are discussed

  17. A synchrotron study of Na2.27Ho7.73(SiO46O0.72

    Luis Fuentes

    2009-05-01

    Full Text Available A well crystallized powder sample of sodium holmium orthosilicate oxyapatite, Na2.27Ho7.73(SiO46O0.72, was obtained after mechanical milling and thermal treatment at 1123 K. Crystal structure analysis was performed from the results of Rietveld refinement of the synchrotron diffraction data. As in other rare-earth orthosilicate apatites, sodium cations appear located sharing with holmium the 4f Wyckoff position at the center of a tricapped trigonal prism. In its turn, holmium almost fully occupies the 6h position at the center of a seven-coordinated pentagonal bipyramid. A small quantity of Na atoms was found at this site. No vacancies are present in the two independent crystallographic sites available for Ho and Na atoms.

  18. Two-dimensional Langevin modeling of fission dynamics of the excited compound nuclei 188Pt, 227Pa and 251Es

    Eslamizadeh, H.

    2016-02-01

    A stochastic approach based on one- and two-dimensional Langevin equations is applied to calculate the pre-scission neutron multiplicity, fission probability, anisotropy of fission fragment angular distribution, fission cross section and the evaporation cross section for the compound nuclei 188Pt, 227Pa and 251Es in an intermediate range of excitation energies. The chaos weighted wall and window friction formula are used in the Langevin equations. The elongation parameter, c, is used as the first dimension and projection of the total spin of the compound nucleus onto the symmetry axis, K, considered as the second dimension in Langevin dynamical calculations. A constant dissipation coefficient of K, γK = 0.077(MeV zs)-1/2, is used in two-dimensional calculations to reproduce the above mentioned experimental data. Comparison of the theoretical results of the pre-scission neutron multiplicity, fission probability, fission cross section and the evaporation cross section with the experimental data shows that the results of two-dimensional calculations are in better agreement with the experimental data. Furthermore, it is shown that the two-dimensional Langevin equations together with a dissipation coefficient of K, γK = 0.077(MeV zs)-1/2, can satisfactorily reproduce the anisotropy of fission fragment angular distribution for the heavy compound nucleus 251Es. However, a larger value of γK = 0.250(MeV zs)-1/2 is needed to reproduce the anisotropy of fission fragment angular distribution for the lighter compound nucleus 227Pa.

  19. Structural insights into parasite eIF4E binding specificity for m7G and m2,2,7G mRNA caps.

    Liu, Weizhi; Zhao, Rui; McFarland, Craig; Kieft, Jeffrey; Niedzwiecka, Anna; Jankowska-Anyszka, Marzena; Stepinski, Janusz; Darzynkiewicz, Edward; Jones, David N M; Davis, Richard E

    2009-11-01

    The eukaryotic translation initiation factor eIF4E recognizes the mRNA cap, a key step in translation initiation. Here we have characterized eIF4E from the human parasite Schistosoma mansoni. Schistosome mRNAs have either the typical monomethylguanosine (m(7)G) or a trimethylguanosine (m(2,2,7)G) cap derived from spliced leader trans-splicing. Quantitative fluorescence titration analyses demonstrated that schistosome eIF4E has similar binding specificity for both caps. We present the first crystal structure of an eIF4E with similar binding specificity for m(7)G and m(2,2,7)G caps. The eIF4E.m(7)GpppG structure demonstrates that the schistosome protein binds monomethyl cap in a manner similar to that of single specificity eIF4Es and exhibits a structure similar to other known eIF4Es. The structure suggests an alternate orientation of a conserved, key Glu-90 in the cap-binding pocket that may contribute to dual binding specificity and a position for mRNA bound to eIF4E consistent with biochemical data. Comparison of NMR chemical shift perturbations in schistosome eIF4E on binding m(7)GpppG and m(2,2,7)GpppG identified key differences between the two complexes. Isothermal titration calorimetry demonstrated significant thermodynamics differences for the binding process with the two caps (m(7)G versus m(2,2,7)G). Overall the NMR and isothermal titration calorimetry data suggest the importance of intrinsic conformational flexibility in the schistosome eIF4E that enables binding to m(2,2,7)G cap. PMID:19710013

  20. Modifications in Dynamic Contrast-Enhanced Magnetic Resonance Imaging Parameters After α-Particle-Emitting {sup 227}Th-trastuzumab Therapy of HER2-Expressing Ovarian Cancer Xenografts

    Heyerdahl, Helen, E-mail: Helen.Heyerdahl@rr-research.no [Department of Radiation Biology, Institute for Cancer Research, Oslo University Hospital - The Norwegian Radium Hospital, Oslo (Norway); Røe, Kathrine [Department of Oncology, Division of Medicine, Akershus University Hospital, Lørenskog (Norway); Brevik, Ellen Mengshoel [Department of Research and Development, Algeta ASA, Oslo (Norway); Dahle, Jostein [Nordic Nanovector AS, Oslo (Norway)

    2013-09-01

    Purpose: The purpose of this study was to investigate the effect of α-particle-emitting {sup 227}Th-trastuzumab radioimmunotherapy on tumor vasculature to increase the knowledge about the mechanisms of action of {sup 227}Th-trastuzumab. Methods and Materials: Human HER2-expressing SKOV-3 ovarian cancer xenografts were grown bilaterally in athymic nude mice. Mice with tumor volumes 253 ± 36 mm{sup 3} (mean ± SEM) were treated with a single injection of either {sup 227}Th-trastuzumab at a dose of 1000 kBq/kg body weight (treated group, n=14 tumors) or 0.9% NaCl (control group, n=10 tumors). Dynamic T1-weighted contrast-enhanced magnetic resonance imaging (DCEMRI) was used to study the effect of {sup 227}Th-trastuzumab on tumor vasculature. DCEMRI was performed before treatment and 1, 2, and 3 weeks after therapy. Tumor contrast-enhancement curves were extracted voxel by voxel and fitted to the Brix pharmacokinetic model. Pharmacokinetic parameters for the tumors that underwent radioimmunotherapy were compared with the corresponding parameters of control tumors. Results: Significant increases of k{sub ep}, the rate constant of diffusion from the extravascular extracellular space to the plasma (P<.05), and k{sub el,} the rate of clearance of contrast agent from the plasma (P<.01), were seen in the radioimmunotherapy group 2 and 3 weeks after injection, compared with the control group. The product of k{sub ep} and the amplitude parameter A, associated with increased vessel permeability and perfusion, was also significantly increased in the radioimmunotherapy group 2 and 3 weeks after injection (P<.01). Conclusions: Pharmacokinetic modeling of MRI contrast-enhancement curves evidenced significant alterations in parameters associated with increased tumor vessel permeability and tumor perfusion after {sup 227}Th-trastuzumab treatment of HER2-expressing ovarian cancer xenografts.

  1. A sorption study of 85Sr, 137Cs and 227Th onto glacial sand as part of an interlaboratory exercise

    A number of radionuclide batch sorption tests have been carried out on core material from boreholes on the BNFL Drigg site, Cumbria, as part of an intercomparison exercise with BNFL, Sellafield. This report describes the nature of the materials used, the method and the results of the BGS side of the interlaboratory exercise. Another report will describe the intercomparison. These experiments formed part of a wider programme of laboratory tests by BGS to ascertain the sorption properties of the Drigg sands and silts as an information base for designing artificial in-situ radionuclide migration experiments on site at Drigg. Three radionuclides were used, 85Sr, 137Cs, and 227Th. Interestingly, although sorption of strontium was about 15 times less than for thorium, the pattern of sorption as a function of borehole depth i.e. mineralogical composition, was very similar. Sorption of 137Cs was found to be non-linear, depending strongly on caesium concentration in the groundwater. Isotherm fits were used to determine the energy of sorption in the ion exchange process, the mechanism responsible for uptake. There is a need for a standard batch sorption method to be in common use. (author)

  2. MUC1 (CD227) interacts with lck tyrosine kinase in Jurkat lymphoma cells and normal T cells.

    Mukherjee, P; Tinder, T L; Basu, G D; Gendler, S J

    2005-01-01

    MUC1 (CD227) is a large transmembrane epithelial mucin glycoprotein, which is aberrantly overexpressed in most adenocarcinomas and is a target for immune therapy for epithelial tumors. Recently, MUC1 has been detected in a variety of hematopoietic cell malignancies including T and B cell lymphomas and myelomas; however, its function in these cells is not clearly defined. Using the Jurkat T cell lymphoma cell line and normal human T cells, we demonstrate that MUC1 is not only expressed in these cells but is also phosphorylated upon T cell receptor (TCR) ligation and associates with the Src-related T cell tyrosine kinase, p56lck. Upon TCR-mediated activation of Jurkat cells, MUC1 is found in the low-density membrane fractions, where linker of T cell activation is contained. Abrogation of MUC1 expression in Jurkat cells by MUC1-specific small interfering RNA resulted in defects in TCR-mediated downstream signaling events associated with T cell activation. These include reduction in Ca2+ influx and extracellular signal-regulated kinase 1/2 phosphorylation, leading to a decrease in CD69 expression, proliferation, and interleukin-2 production. These results suggest a regulatory role of MUC1 in modulating proximal signal transduction events through its interaction with proteins of the activation complex. PMID:15513966

  3. The prevalence of ABCB1:c.227_230delATAG mutation in affected dog breeds from European countries.

    Firdova, Zuzana; Turnova, Evelina; Bielikova, Marcela; Turna, Jan; Dudas, Andrej

    2016-06-01

    Deletion of 4-base pairs in the canine ABCB1 (MDR1) gene, responsible for encoding P-glycoprotein, leads to nonsense frame-shift mutation, which causes hypersensitivity to macrocyclic lactones drugs (e.g. ivermectin). To date, at least 12 purebred dog breeds have been found to be affected by this mutation. The aim of this study was to update information about the prevalence of ABCB1 mutation (c.227_230delATAG) in predisposed breeds in multiple European countries. This large scale survey also includes countries which were not involved in previous studies. The samples were collected in the period from 2012 to 2014. The overview is based on genotyping data of 4729 individuals. The observed mutant allele frequencies were 58.5% (Smooth Collie), 48.3% (Rough Collie), 35% (Australian Shepherd), 30.3% (Shetland Sheepdog), 28.1% (Silken Windhound), 26.1% (Miniature Australian Shepherd), 24.3% (Longhaired Whippet), 16.2% (White Swiss Shepherd) and 0% (Border Collie). The possible presence of an ABCB1 mutant allele in Akita-Inu breed has been investigated with negative results. This information could be helpful for breeders in optimization of their breeding strategy and for veterinarians when prescribing drug therapy for dogs of predisposed breeds. PMID:27234542

  4. Quantitative kinetic analysis of PET amyloid imaging agents [11C]BF227 and [18F]FACT in human brain

    Introduction: The purpose of this study was to compare two amyloid imaging agents, [11C]BF227 and [18F]FACT (derivative from [11C]BF227) through quantitative pharmacokinetics analysis in human brain. Methods: Positron emission tomography studies were performed on six elderly healthy control (HC) subjects and seven probable Alzheimer’s disease (AD) patients with [11C]BF227 and 10 HC subjects and 10 probable AD patients with [18F]FACT. Data from nine regions of interest were analyzed by several approaches, namely non-linear least-squared fitting methods with arterial input functions (one-tissue compartment model(1TCM), two-tissue compartment model (2TCM)), Logan plot, and linearized methods with reference region (Reference Logan plot (RefLogan), MRTM0, MRTM2). We also evaluated SUV and SUVR for both tracers. The parameters estimated by several approaches were compared between two tracers for detectability of differences between HC and AD patients. Results: For [11C]BF227, there were no significant difference of VT (2TCM, 1TCM) and SUV in all regions (Student t-test; p < 0.05) and significant differences in the DVRs (Logan, RefLogan, and MRTM2) and SUVRs in six neocortical regions (p < 0.05) between the HC and AD groups. For [18F]FACT, significant differences in DVRs (RefLogan, MRTM0, and MRTM2) were observed in more than four neocortical regions between the HC and AD groups (p < 0.05), and the significant differences were found in SUVRs for two neocortical regions (inferior frontal coretex and lateral temporal coretex). Our results showed that both tracers can clearly distinguish between HC and AD groups although the pharmacokinetics and distribution patterns in brain for two tracers were substantially different. Conclusion: This study revealed that although the PET amyloid imaging agents [11C]BF227 and [18F]FACT have similar chemical and biological properties, they have different pharmacokinetics, and caution must be paid for usage of the tracers

  5. Systematic identification of non-coding RNA 2,2,7-trimethylguanosine cap structures in Caenorhabditis elegans

    Skogerbø Geir

    2007-09-01

    Full Text Available Abstract Background The 2,2,7-trimethylguanosine (TMG cap structure is an important functional characteristic of ncRNAs with critical cellular roles, such as some snRNAs. Here we used immunoprecipitation with both K121 and R1131 anti-TMG antibodies to systematically identify the TMG cap structures for all presently characterized ncRNAs in C. elegans. Results The two anti-TMG antibodies precipitated a similar group of the C. elegans ncRNAs. All snRNAs known to have a TMG cap structure were found in the precipitate, indicating that our identification system was efficient. Other ncRNA families related to splicing, such as SL RNAs and Sm Y RNAs, were also found in the precipitate, as were 7 C/D box snoRNAs. Further analysis showed that the SL RNAs and the Sm Y RNAs shared a very similar Sm binding site element (AAU4–5GGA, which sequence composition differed somewhat from those of other U snRNAs. There were also 16 ncRNAs without an Sm binding site element in the precipitate, suggesting that for these ncRNAs, TMG formation may occur independently of Sm proteins. Conclusion Our results showed that most ncRNAs predicted to be transcribed by RNA polymerase II had a TMG cap, while those predicted to be transcribed by RNA plymerase III or located in introns did not have a TMG cap structure. Compared to ncRNAs without a TMG cap, TMG-capped ncRNAs tended to have higher expression levels. Five functionally non-annotated ncRNAs also have a TMG cap structure, which might be helpful for identifying the cellular roles of these ncRNAs.

  6. Intoxicación por ciguatera: Estudio de 227 pacientes durante el periodo 1999 al 2005 Ciguatera poisoning: Study of 277 patients in the 1999-2005 period.

    Carlos Manuel Maya Entenza; Miladys Martín Labrador; Marisol Monteagudo Torres

    2007-01-01

    La ciguatera es la intoxicación alimentaría causada por el consumo de pescados ciguatóxicos, cuyos efectos sobre el ser humano pueden ser graves y conducir a la muerte. Se describieron las principales características epidemiológicas, clínicas y del tratamiento en los pacientes con ciguatera. La investigación incluyó 227 pacientes con ciguatera estudiados de forma prospectiva en el Hospital Clínico-Quirúrgico Universitario “Comandante Manuel Fajardo” de Ciudad de La Habana entre lo...

  7. Absolute rate constant and O(3P yield for the O(1D+N2O reaction in the temperature range 227 K to 719 K

    S. A. Carl

    2008-10-01

    Full Text Available The absolute rate constant for the reaction that is the major source of stratospheric NOx, O(1D+N2O → products, has been determined in the temperature range 227 K to 719 K, and, in the temperature range 248 K to 600 K, the fraction of the reaction that yields O(3P. Both the rate constants and product yields were determined using a recently-developed chemiluminescence technique for monitoring O(1D that allows for higher precision determinations for both rate constants, and, particularly, O(3P yields, than do other methods. We found the rate constant, kR1, to be essentially independent of temperature between 400 K and 227 K, having a value of (1.37±0.11×10−10 cm3 s−1, and for temperatures greater than 450 K a marked decrease in rate constant was observed, with a rate constant of only (0.94±0.11×10−10 cm3 s−1 at 719 K. The rate constants determined over the 227 K–400 K range show very low scatter and are significantly greater, by 20% at room temperature and 15% at 227 K, than the current recommended values. The fraction of O(3P produced in this reaction was determined to be 0.002±0.002 at 250 K rising steadily to 0.010±0.004 at 600 K, thus the channel producing O(3P can be entirely neglected in atmospheric kinetic modeling calculations. A further result of this study is an expression of the relative quantum yields as a function of temperature for the chemiluminescence reactions (kCL1C2H + O(1D → CH(A + CO and (kCL2C2H + O(3P → CH(A + CO, both followed by CH(A → CH(X + hν, as kCL1(T/kCL2(T=(32.8T−3050/(6.29T+398.

  8. Cloning, functional organization, transcript studies, and phylogenetic analysis of the complete nitrogenase structural genes (nifHDK2) and associated genes in the archaeon Methanosarcina barkeri 227.

    Chien, Y T; Zinder, S. H.

    1996-01-01

    Determination of the nucleotide sequence of the nitrogenase structural genes (nifHDK2) from Methanosarcina barkeri 227 was completed in this study by cloning and sequencing a 2.7-kb BamHI fragment containing the 3' end of nifK2 and 1,390 bp of the nifE2-homologous genes. Open reading frame nifK2 is 1,371 bp long including the stop codon TAA and encodes a polypeptide of 456 amino acids. Phylogenetic analysis of the deduced amino acid sequences of the nifK2 and nifE2 gene products from M. barke...

  9. Development of separation technology for the removal of radium-223 from decayed thorium-227 in drug formulations. Material screening and method development.

    Frenvik, Janne Olsen; Kristensen, Solveig; Ryan, Olav B

    2016-08-01

    Targeted thorium conjugates are currently being investigated as a new class of alpha-radiopharmaceuticals. The natural decay of thorium-227 ((227)Th) results in the ingrowth of radium-223 ((223)Ra). Consideration must, therefore, be given to define acceptable limits of (223)Ra in the drug product at the time of dose administration. By effective sequestration of (223)Ra, we aim to improve the radiochemical purity and extend the effective user window of drug products containing (227)Th. (223)Ra is the first progeny of (227)Th and the only one with a long half-life (days). We have, therefore, focused on the removal of this specific species since the progenies of (223)Ra will have a very limited lifetime in the formulation once (223)Ra is removed. In this study, we investigated a multitude of materials for their ability to reduce the (223)Ra level by: (1) passive diffusion or (2) by cartridge filtration on gravity columns. In addition, we probe the compatibility of these materials in the presence of antibody trastuzumab to assess the level of protein binding and estimate the quenching of radiolysis by binding of radionuclides. A screening matrix of organic and inorganic materials was established, i.e. strontium and calcium alginate gel beads, distearoyl phosphatidylglycerol (DSPG) liposomes, ceramic hydroxyapatite, Zeolite UOP type 4A and cation exchange resins AG50W-X8 and SOURCE 30S. First, passive diffusional uptake of (223)Ra by suspended materials present in the formulation was measured as a decrease in sample radioactivity after separation. Second, selected materials were packed on gravity columns in order to evaluate the efficiency of column separation versus diffusional adsorption. The retention of (223)Ra and (227)Th were characterized by measuring the radioactivity in the eluate and on the columns. Finally, the compatibility between trastuzumab, as a selected model antibody, and suspensions of the binding materials was analyzed during storage of the drug

  10. Fractionated therapy of HER2-expressing breast and ovarian cancer xenografts in mice with targeted alpha emitting 227Th-DOTA-p-benzyl-trastuzumab.

    Helen Heyerdahl

    Full Text Available BACKGROUND: The aim of this study was to investigate therapeutic efficacy and normal tissue toxicity of single dosage and fractionated targeted alpha therapy (TAT in mice with HER2-expressing breast and ovarian cancer xenografts using the low dose rate radioimmunoconjugate (227Th-DOTA-p-benzyl-trastuzumab. METHODOLOGY/PRINCIPAL FINDINGS: Nude mice carrying HER2-overexpressing subcutaneous SKOV-3 or SKBR-3 xenografts were treated with 1000 kBq/kg (227Th-trastuzumab as single injection or four injections of 250 kBq/kg with intervals of 4-5 days, 2 weeks, or 4 weeks. Control animals were treated with normal saline or unlabeled trastuzumab. In SKOV-3 xenografts tumor growth to 10-fold size was delayed (p<0.01 and survival with tumor diameter less than 16 mm was prolonged (p<0.05 in all TAT groups compared to the control groups. No statistically significant differences were seen among the treated groups. In SKBR-3 xenografts tumor growth to 10-fold size was delayed in the single injection and 4-5 days interval groups (p<0.001 and all except the 4 weeks interval TAT group showed improved survival to the control groups (p<0.05. Toxicity was assessed by blood cell counts, clinical chemistry measurements and body weight. Transient reduction in white blood cells was seen for the single injection and 4-5 days interval groups (p<0.05. No significant changes were seen in red blood cells, platelets or clinical chemistry parameters. Survival without life threatening loss of body weight was significantly prolonged in 4 weeks interval group compared to single injection group (p<0.05 for SKOV-3 animals and in 2 weeks interval group compared with the 4-5 days interval groups (p<0.05 for SKBR-3 animals. CONCLUSIONS/SIGNIFICANCE: The same concentration of radioactivity split into several fractions may improve toxicity of (227Th-radioimmunotherapy while the therapeutic effect is maintained. Thus, it might be possible to increase the cumulative absorbed radiation dose

  11. The V227A polymorphism at the PPARA locus is associated with serum lipid concentrations and modulates the association between dietary polyunsaturated fatty acid intake and serum high density lipoprotein concentrations in Chinese women.

    Chan, Edmund; Tan, Chuen Seng; Deurenberg-Yap, Mabel; Chia, Kee Seng; Chew, Suok Kai; Tai, E Shyong

    2006-08-01

    Peroxisome proliferators activated receptor alpha (PPARalpha) regulates the transcription of several proteins involved in human lipoprotein metabolism. We screened the PPARA locus for polymorphisms in 20 unrelated subjects from each of three ethnic groups (Chinese, Malays and Asian Indians). Only the V227A polymorphism was observed. We genotyped 4248 subjects (2899 Chinese, 761 Malay and 588 Asian Indians) and found allele frequencies for the A227 allele of 0.04 in Chinese, 0.006 in Malays and 0.003 in Asian Indians. We examined the associations between this polymorphism and serum lipid concentrations in Chinese. In women, but not in men, the presence of the A227 allele was associated with lower serum concentrations of total cholesterol [5.38mmol/l (95%CI: 5.22-5.54) versus 5.21mmol/l (95%CI: 4.99-5.43), p=0.047] and triglycerides [1.19mmol/l (95%CI: 1.10-1.28) versus 1.09mmol/l (95%CI: 0.98-1.21), p=0.048]. We also found that the V227A polymorphism modulates the association between dietary polyunsaturated fatty acid intake and serum high density lipoprotein concentration (p-value for interaction=0.049). Our findings implicate PPARalpha in the lipid lowering associated with diets high in PUFA and suggests that genetic variation at the PPARA locus may determine the lipid response to changes in PUFA intake. PMID:16288935

  12. Application of USP inlet extensions to the TSI impactor system 3306/3320 using HFA 227 based solution metered dose inhalers.

    Mogalian, Erik; Myrdal, Paul Brian

    2005-12-01

    The objective of this study was to further evaluate the need for a vertical inlet extension when testing solution metered dose inhalers using the TSI Model 3306 Impactor Inlet in conjunction with the TSI Model 3320 Aerodynamic Particle Sizer (APS). The configurations tested using the TSI system were compared to baseline measurements that were performed using the Andersen Mark II 8-stage cascade impactor (ACI). Seven pressurized solution metered dose inhalers were tested using varied concentrations of beclomethasone dipropionate (BDP), ethanol, and HFA 227 propellant. The inhalers were tested with the cascade impactor, and with the TSI system. The TSI system had three different configurations as the manufacturer provided (0 cm) or with inlet extensions of 20 and 40 cm. The extensions were located between the USP inlet and the Model 3306 Impactor Inlet. There were no practical differences between each system for the stem, actuator, or USP inlet. The fine particle mass (aerodynamic mass < 4.7 microm) was affected by extension length and correlated well with the ACI when an extension was present. APS particle size measurements were unaffected by the extension lengths and correlated well to particle size determined from the ACI analysis. It has been confirmed that an inlet extension may be necessary for the TSI system in order to give mass results that correlate to the ACI, especially for formulations having significant concentrations of low volatility excipients. Additionally, the results generated from this study were used to evaluate the product performance of HFA 227 based solution formulations that contain varying concentrations of ethanol as a cosolvent. PMID:16316853

  13. Effect of pressurized solution nitriding on phase changes and mechanical properties of ferritic Fe–22.7Cr–2.4Mo stainless steel

    Mohammadzadeh, Roghayeh, E-mail: r_mohammadzadeh@sut.ac.ir; Akbari, Alireza, E-mail: akbari@sut.ac.ir

    2014-01-13

    Pressurized solution nitriding (PSN) of ferritic Fe–22.7Cr–2.4Mo stainless steel at 1200 °C in nitrogen gas under pressure of 0.25 MPa for different times has been investigated. The structure and mechanical properties were characterized using X-ray diffraction, optical microscopy, scanning electron microscopy and tensile testing. Phase transformation of ferrite to austenite starts from the sample surface and grows further into the core with increasing nitriding time. A fully austenitic structure was achieved after 9 h nitriding for plates of 2 mm thick. Strip-like chromium nitride precipitates with discontinuous morphology are found in the edges of the sample nitrided for 12 h. The average solute nitrogen content of austenite phase was estimated based on lattice parameter calculations to vary from 1.25 to 1.75 wt%. The yield strength is monotonically increased above 900 MPa with increasing the PSN time. The solution nitrided samples for 6 h exhibit high elongation to fracture (above 30%) and high tensile strength (above 1000 MPa). Solution nitriding changes the fracture mode from ductile to a mixed mode inter-granular and trans-granular brittle fracture. Formation of the planar slip bands plays a major role in brittle fracture of the austenite phase. Brittle fracture is favored with precipitation of chromium nitrides. The time of the PSN should be optimized to suppress chromium nitride precipitation.

  14. Effect of pressurized solution nitriding on phase changes and mechanical properties of ferritic Fe–22.7Cr–2.4Mo stainless steel

    Pressurized solution nitriding (PSN) of ferritic Fe–22.7Cr–2.4Mo stainless steel at 1200 °C in nitrogen gas under pressure of 0.25 MPa for different times has been investigated. The structure and mechanical properties were characterized using X-ray diffraction, optical microscopy, scanning electron microscopy and tensile testing. Phase transformation of ferrite to austenite starts from the sample surface and grows further into the core with increasing nitriding time. A fully austenitic structure was achieved after 9 h nitriding for plates of 2 mm thick. Strip-like chromium nitride precipitates with discontinuous morphology are found in the edges of the sample nitrided for 12 h. The average solute nitrogen content of austenite phase was estimated based on lattice parameter calculations to vary from 1.25 to 1.75 wt%. The yield strength is monotonically increased above 900 MPa with increasing the PSN time. The solution nitrided samples for 6 h exhibit high elongation to fracture (above 30%) and high tensile strength (above 1000 MPa). Solution nitriding changes the fracture mode from ductile to a mixed mode inter-granular and trans-granular brittle fracture. Formation of the planar slip bands plays a major role in brittle fracture of the austenite phase. Brittle fracture is favored with precipitation of chromium nitrides. The time of the PSN should be optimized to suppress chromium nitride precipitation

  15. LASL experience in decontamination of the environment

    This discussion represents one part of a major effort in soil decontamination at the Los Alamos site. A contaminated industrial waste line in the Los Alamos townsite was removed, and a plutonium incineration facility, and a filter building contaminated with actinium-227 were dismantled. The former plutonium handling facility has been decontaminated, and canyons and an old firing site contaminated with strontium-90 have been surveyed

  16. Study of the origin of elements of the uranium-235 family observed in excess in the vicinity of the experimental nuclear EL4 reactor under dismantling. Lessons got at this day and conclusions; Etude de l'origine des elements de la famille de l'uranium-235 observes en exces dans les environs du reacteur nucleaire experimental EL4 en cours de demantelement. Enseignements retires a ce jour et conclusion

    NONE

    2007-07-01

    This study resumes the discovery of an excess of actinium 227 found around by EL4 nuclear reactor actually in dismantling. The search for the origin of this excess revealed a real inquiry of investigation during three years. Because a nuclear reactor existed in this area a particular attention will have concerned this region. The doubt became the line of conduct to find the answer to the human or natural origin of this excess. Finally and against any evidence, it appears that the origin of this phenomenon was natural, consequence of the particular local geology. The detail of the different investigations is given: search of a possible correlation with the composition of elevations constituent of lanes, search (and underlining) of new sites in the surroundings of the Rusquec pond and the Plouenez station, study of the atmospheric deposits under winds of the nuclear power plant and in the east direction, search of a possible relationship with the gaseous effluents of the nuclear power plant in the past, historical study of radioactive effluents releases in the fifty last years by the analysis of the sedimentary deposits in the Saint-Herbiot reservoir, search of a possible correlation between the excess of actinium 227 and the nuclear power plant activity; search of a possible correlation with a human activity without any relationship with the nuclear activities, search of a correlation with the underground waters, search of a correlation with the geological context, collect of information on the possible transfers in direction of the food chain, determination of the radiological composition of the underground waters ( not perturbed by human activity), search of the cause of an excess of actinium 227 in the old channel of liquid effluents release of the nuclear power plant. The results are given and discussed. And contrary to all expectations the origin of the excess of actinium 227 is completely natural. (N.C.)

  17. Anxiolytic- and antidepressant-like effects of angiotensin-(1-7) in hypertensive transgenic (mRen2)27 rats.

    Almeida-Santos, Ana Flávia; Kangussu, Lucas M; Moreira, Fabrício A; Santos, Robson A S; Aguiar, Daniele C; Campagnole-Santos, Maria José

    2016-07-01

    Angiotensin-(1-7) [Ang-(1-7)], a counter-regulatory peptide of the renin-angiotensin system (RAS) exerts its effects through the G-protein-coupled receptor Mas, which is expressed in different tissues, including the brain. Ang-(1-7) has a broad range of effects beyond the well-described cardiovascular and renal actions, including the modulation of emotional and behavioural responses. In the present study we tested the hypothesis that Ang-(1-7) could attenuate the anxiety- and depression-like behaviours observed in transgenic hypertensive (mRen2)27 rats (TGRs). We also hypothesized that Ang-(1-7) could be involved in the anxiolytic-like effect induced by ACE (angiotensin-converting enzyme) treatment in these hypertensive rats. Therefore, TGRs and Sprague-Dawley rats were subjected to the Elevated Plus Maze (EPM) test, Forced Swimming Test (FST) and Novelty Suppressed Feeding (NSF). TGRs presented a decreased percentage of entries in the open arms of the EPM test, a phenotype reversed by systemic treatment with enalapril or intracerebroventricular infusion of Ang-(1-7). It is interesting that pre-treatment with A779, a selective Mas receptor antagonist, prevented the anxiolytic-like effect induced by the ACE inhibitor. In the NSF test, TGRs showed increased latency to eating, an indicative of a higher aversion in response to a new environment. These animals also showed increased immobility in the FST. Again, Ang-(1-7) reversed this phenotype. Thus, our data showed that Ang-(1-7) can modulate anxiety- and depression-like behaviours in TGRs and warrant further investigation as a new therapy for certain psychiatric disorders. PMID:27129185

  18. Absolute rate constant and O(3P) yield for the O(1D)+N2O reaction in the temperature range 227 K to 719 K

    Carl, S. A.; Peeters, J.; Vranckx, S.

    2008-01-01

    The absolute rate constant for the reaction that is the major source of stratospheric NOx, O(1D)+N2O → products, has been determined in the temperature range 227 K to 719 K, and, in the temperature range 248 K to 600 K, the fraction of the reaction that yields O(3P). Both the rate constants and product yields were determined using a recently-developed chemiluminescence technique for monitoring O(1D) that allows for higher precision determinations for both rate constants, and, particularl...

  19. Cloning, functional organization, transcript studies, and phylogenetic analysis of the complete nitrogenase structural genes (nifHDK2) and associated genes in the archaeon Methanosarcina barkeri 227.

    Chien, Y T; Zinder, S H

    1996-01-01

    Determination of the nucleotide sequence of the nitrogenase structural genes (nifHDK2) from Methanosarcina barkeri 227 was completed in this study by cloning and sequencing a 2.7-kb BamHI fragment containing the 3' end of nifK2 and 1,390 bp of the nifE2-homologous genes. Open reading frame nifK2 is 1,371 bp long including the stop codon TAA and encodes a polypeptide of 456 amino acids. Phylogenetic analysis of the deduced amino acid sequences of the nifK2 and nifE2 gene products from M. barkeri showed that both genes cluster most closely with the corresponding nif-1 gene products from Clostridium pasteurianum, consistent with our previous analyses of nifH2 and nifD2. The nifE gene product is known to be homologous to that of nifD, and our analysis shows that the branching pattern for the nifE proteins resembles that for the nifD product (with the exception of vnfE from Azotobacter vinelandii), suggesting that a gene duplication occurred before the divergence of nitrogenases. Primer extension showed that nifH2 had a single transcription start site located 34 nucleotides upstream of the ATG translation start site for nifH2, and a sequence resembling the archaeal consensus promoter sequence [TTTA(A/T)ATA] was found 32 nucleotides upstream from that transcription start site. A tract of four T's, previously identified as a transcription termination site in archaea, was found immediately downstream of the nifK2 gene, and a potential promoter was located upstream of the nifE2 gene. Hybridization with nifH2 and nifDK2 probes with M. barkeri RNA revealed a 4.6-kb transcript from N2-grown cells, large enough to harbor nifHDK genes and their internal open reading frames, while no transcript was detected from NH4(+)-grown cells. These results support a model in which the nitrogenase structural genes in M. barkeri are cotranscribed in a single NH4(+)-repressed operon. PMID:8550408

  20. Intoxicación por ciguatera: Estudio de 227 pacientes durante el periodo 1999 al 2005 Ciguatera poisoning: Study of 277 patients in the 1999-2005 period.

    Carlos Manuel Maya Entenza

    2007-08-01

    Full Text Available La ciguatera es la intoxicación alimentaría causada por el consumo de pescados ciguatóxicos, cuyos efectos sobre el ser humano pueden ser graves y conducir a la muerte. Se describieron las principales características epidemiológicas, clínicas y del tratamiento en los pacientes con ciguatera. La investigación incluyó 227 pacientes con ciguatera estudiados de forma prospectiva en el Hospital Clínico-Quirúrgico Universitario “Comandante Manuel Fajardo” de Ciudad de La Habana entre los años 1999 al 2005. Para la recolección de la muestra se elaboró una encuesta que recogió los datos demográficos, identidad personal, manifestaciones clínicas, tratamiento empleado en los pacientes, así como la especie que causó la intoxicación. Se encontró que existe un incremento significativo en la incidencia de pacientes con ciguatera que acuden al hospital en los últimos 3 años. Los meses de abril a septiembre son los de mayor incidencia de la enfermedad. Hubo predominio de las mujeres sobre los hombres. Los pacientes comprendidos entre las edades de 21 y 50 años son los más afectados. El promedio de edad de los enfermos es de 39,2±10 años. Las especies barracuda y gallego fueron las que más frecuentemente provocaron la intoxicación en 74 y 38 pacientes, respectivamente y 73 intoxicados desconocían la especie ingerida. Los síntomas referidos con mayor frecuencia por los pacientes fueron la fatiga muscular, los trastornos gastrointestinales y las manifestaciones sensitivas. Los hallazgos más frecuentes al examen físico fueron los sensitivos, los signos de deshidratación y la debilidad muscular. El tiempo transcurrido entre la ingestión del pescado y el inicio del cuadro clínico fue menor o igual a las 12 horas en 70,8 % de los casos. Los medicamentos que con más frecuencia se emplearon en los enfermos fueron los antieméticos, vitaminas, antihistamínicos y el manitol al 20 % resultando este último la única terapia que

  1. 两种试验方法对227名乡村医生潜伏性结核感染检测的结果分析

    胡冬梅; 侯月云; 宋渝丹; 熊勇超; 耿梦杰; 何广学

    2014-01-01

    目的 获得乡村医生潜伏性结核感染(latent tuberculosis irnfection,LTBI)情况,比较γ干扰素释放试验中的QuantiFERON TB Gold In-Tube(QFT GIT)和结核菌素皮肤试验(tuberculin skin test,TST)(纯化蛋白衍生物,PPD)检测LTBI的一致性.方法 采用横断面研究,选择内蒙古自治区巴彦淖尔市临河区为研究现场,于2011年11月对临河区227名乡村医生进行问卷调查,同时采用QFT-GIT和TST两种检测方法检测乡村医生中的LTBI者.共发放227份问卷,收回有效问卷227份,回收率100.0%.采用构成比、率等统计指标描述乡村医生的基本信息和LTBI率,计算Kappa值评价QFTGIT和TST结果的一致性.结果 227名乡村医生完成QFTGIT检测,以QFT-GIT检测结果为依据(排除2名不确定结果),225名乡村医生LTBI率为44.0%(99/225).226名乡村医生完成了TST检测,以TST检测结果为依据,乡村医生LTBI率分别为59.3%(134/226)(硬结平均直径≥5 mm)、41.2%(93/226)(硬结平均直径≥10 mm)、22.6%(51/226)(硬结平均直径≥15 mm).TST以硬结平均直径5 mm为阳性临界值时,Kappa值为0.415;以10 mm为阳性临界值时,Kappa值为0.444;以15 mm为阳性临界值时,Kappa值为0.358.结论 临河区被调查的乡村医生LTBI率较高,本研究显示两种检测一致性一般,有必要开展农村结核感染控制工作,降低乡村医生的LTBI率.

  2. 人才环境感知对研发人才工作绩效、工作嵌入的影响研究——以深圳227家高新技术企业为例%An Empirical Study of the Impact of the Perceived Talent Environment on Performance and Job Embeddedness of the R & D Talents——Taking 227 High -tech Enterprises in Shenzhen as Example

    李玉香; 刘军

    2009-01-01

    以深圳227家高新技术企业及其研发人才为样本,采用探索性分析方法,将研发人才环境感知分为人才政策环境感知、事业环境感知、生活环境感知三部分,并探讨研发人才环境感知对研发人才工作绩效和工作嵌入的影响.研究结果显示,企业对研发人才政策环境越满意,研发人才工作绩效越高;研发人才对事业环境越满意,其3-作绩效越高;对事业环境以及生活环境越满意,其工作嵌入越深.

  3. Reflection asymmetry in odd-A and odd-odd actinium nuclei

    Theoretical calculations and measurements indicate that octupole correlations are at a maximum in the ground states of the odd-proton nuclei Ac and Pa. It has been expected that odd-odd nuclei should have even larger amount of octupole-octupole correlations. We have recently made measurements on the structure of 224Ac. Although spin and parity assignments could not be made, two bands starting at 354.1 and 360.0 keV have properties characteristic of reflection asymmetric shape. These two bands have very similar rotational constants and also similar alpha decay rates, which suggest similarity between the wavefunctions of these bands. These signatures provide evidence for octupole correlations in these nuclides

  4. Bestimmung der Ionisationsenergie von Actinium und Ultraspurenanalyse von Plutonium mit resonanter Ionisationsmassenspektrometrie (RIMS)

    Waldek, Achim Marcus

    2001-01-01

    ZusammenfassungDie Resonanzionisationsmassenspektrometrie (RIMS) verbindet hohe Elementselektivität mit guter Nachweiseffizienz. Aufgrund dieser Eigenschaften ist die Methode für Ultraspurenanalyse und Untersuchungen an seltenen oder schwer handhabbaren Elementen gut geeignet. Für RIMS werden neutrale Atome mit monochromatischem Laserlicht ein- oder mehrfach resonant auf energetisch hoch liegende Niveaus angeregt und anschließend durch einen weiteren Laserstrahl oder durch ein elektrisches Fe...

  5. Radium-228 analysis of natural waters by Cherenkov counting of Actinium-228

    The activities of 228Ra in natural waters were determined by the Cherenkov counting of the daughter nuclide 228Ac. The radium was pre-concentrated on MnO2 and the radium purified via ion exchange and, after a 2-day period of incubation to allow for secular equilibrium between the parent-daughter 228Ra(228Ac), the daughter nuclide 228Ac was isolated by ion exchange according to the method of Nour et al. [2004. Radium-228 determination of natural waters via concentration on manganese dioxide and separation using Diphonix ion exchange resin. Appl. Radiat. Isot. 61, 1173-1178]. The Cherenkov photons produced by 228Ac were counted directly without the addition of any scintillation reagents. The optimum Cherenkov counting window, sample volume, and vial type were determined experimentally to achieve optimum Cherenkov photon detection efficiency and lowest background count rates. An optimum detection efficiency of 10.9±0.1% was measured for 228Ac by Cherenkov counting with a very low Cherenkov photon background of 0.317±0.013 cpm. The addition of sodium salicylate into the sample counting vial at a concentration of 0.1 g/mL yielded a more than 3-fold increase in the Cherenkov detection efficiency of 228Ac to 38%. Tests of the Cherenkov counting technique were conducted with several water standards of known activity and the results obtained compared closely with a conventional liquid scintillation counting technique. The advantages and disadvantages of Cherenkov counting compared to liquid scintillation counting methods are discussed. Advantages include much lower Cherenkov background count rates and consequently lower minimal detectable activities for 228Ra and no need for expensive environmentally unfriendly liquid scintillation cocktails. The disadvantages of the Cherenkov counting method include the need to measure 228Ac Cherenkov photon detection efficiency and optimum Cherenkov counting volume, which are not at all required when liquid scintillation analysis is used

  6. Linear free energy relationship applied to trivalent cations with lanthanum and actinium oxide and hydroxide structure

    Linear free energy relationships for trivalent cations with crystalline M2O3 and, M(OH)3 phases of lanthanides and actinides were developed from known thermodynamic properties of the aqueous trivalent cations, modifying the Sverjensky and Molling equation. The linear free energy relationship for trivalent cations is as ΔGf,MvX0=aMvXΔGn,M3+0+bMvX+βMvXrM3+, where the coefficients aMvX, bMvX, and βMvX characterize a particular structural family of MvX, rM3+ is the ionic radius of M3+ cation, ΔGf,MvX0 is the standard Gibbs free energy of formation of MvX and ΔGn,M3+0 is the standard non-solvation free energy of the cation. The coefficients for the oxide family are: aMvX=0.2705, bMvX=-1984.75 (kJ/mol), and βMvX=197.24 (kJ/molnm). The coefficients for the hydroxide family are: aMvX=0.1587, bMvX=-1474.09 (kJ/mol), and βMvX=791.70 (kJ/molnm).

  7. Actinium: A RESTful Runtime Container for Scriptable Internet of Things Applications

    Kovatsch, Matthias; Lanter, Martin; Duquennoy, Simon

    2012-01-01

    Programming Internet of Things (IoT) applications is challenging because developers have to be knowledgeable in various technical domains, from low-power networking, over embedded operating systems, to distributed algorithms. Hence, it will be challenging to find enough experts to provide software for the vast number of expected devices, which must also be scalable and particularly safe due to the connection to the physical world. To remedy this situation, we propose an architecture that pr...

  8. Synthesis of chelating agents for actinium 225 complexation and its application in radioimmunotherapy

    Immunotherapy with radiolabeled antibodies should allow fairly specific targeting of certain cancers. However, iodine 131 may not be the best isotope for tumor therapy because of its limited specific activity, low beta-energy, relatively long half life and strong gamma emission. Another approach to improve therapeutic efficacy is the use of replacement isotopes with better physical properties. Chelator that can hold radio-metals with high stability under physiological conditions are essential to avoid excessive damage to non-target cells; Moreover, the development of new bifunctional chelating agents is essential for this purpose. Accordingly, our efforts have been directed, for several years, to the synthesis of original chelating agents likely to form stable complexes in vivo with the numerous potential candidates for such applications. Therefore, we have developed a new simple and efficient synthesis pathway of 2-(4-iso-thio-cyanate-benzyl)-1,4,7,10,13,16- hexa-aza-cyclo-hexadecane- 1,4,7,10,13,16-hexa-acetic acid, though functionalized on the cycle by a termination allowed coupling to an antibody or any other biological substance such as a hapten. (author)

  9. Variability of the quasi-2-day wave and interaction with longer period planetary waves in the MLT at Cachoeira Paulista (22.7°S, 45°W)

    Guharay, A.; Batista, P. P.; Clemesha, B. R.

    2015-08-01

    An exclusive study has been carried out with long term meteor wind data (2000-2014) to characterize the quasi-2-day wave (QTDW) in the mesosphere and lower thermosphere (MLT) and its interactions with the longer period planetary waves at Cachoeira Paulista (22.7°S, 45°W). The QTDW is observed to be dominant during late summer (January-February) all the years under consideration except 2013. All the wave parameters exhibit significant interannual variability. The maximum wave amplitude comes out to be 39 m/s, which is significantly higher than the reported northern hemispheric findings. The mean MLT period exhibits a wide range of variability (36-70 h) indicating the presence of multiple Rossby normal modes with varying zonal wave numbers. Modulations of the QTDW amplitude by the planetary waves with longer periodicities (>9 days) are evident, especially during summer. The nonlinear interactions between the 2-day wave and longer period waves are believed to give rise to a host of secondary waves with frequencies lying close to 2-day. The strong QTDW activity, as observed at this location, has potential to cause significant effect on the overlying ionosphere and hence the atmosphere-ionosphere dynamical coupling.

  10. Testing nuclear forces by polarization transfer coefficients in d(\\vec p, \\vec p)d and d(\\vec p,\\vec d)p reactions at E^{lab}_p = 22.7 MeV

    Witala, H; Glöckle, W; Golak, J; Kamada, H; Kievsky, A; Nogga, A; Skibinski, R; Viviani, M

    2006-01-01

    The proton to proton polarization transfer coefficients K_x^{x'}, K_y^{y'}, K_z^{x'} and the proton to deuteron polarization transfer coefficients K_x^{x'}, K_y^{y'}, K_z^{x'}, K_x^{y'z'}, K_y^{z'z'}, K_z^{y'z'}, K_y^{x'z'} and K_y^{x'x'-y'y'} have been measured in d(\\vec p, \\vec p)d and d(\\vec p, \\vec d)p reactions at E^{lab}_p = 22.7 MeV, respectively. The data have been compared to predictions of modern nuclear forces obtained by solving the three-nucleon Faddeev equations in momentum space. Realistic (semi) phenomenological nucleon-nucleon potentials combined with model three-nucleon forces and modern chiral nuclear forces have been used. The AV18, CD Bonn, Nijm I and II nucleon-nucleon interactions have been applied alone or combined with the Tucson-Melbourne 99 three-nucleon force, adjusted separately for each potential to reproduce the triton binding energy. For the AV18 potential also the Urbana IX three-nucleon force have been used. In addition chiral NN potentials in the next-to-leading-order and ch...

  11. Radioimmunodetection of lymph node invasion in prostatic cancer. The use of iodine-123 (123I)-labeled monoclonal anti-prostatic acid phosphatase (PAP) 227 A F(ab')2 antibody fragments in vivo

    The therapeutic indications in prostatic cancer depend on the regional and distant extension of the cancer and are difficult to assess before lymphadenectomy. Radioimmunodetection of lymph node involvement with monoclonal anti-prostatic acid phosphatase (PAP) antibodies can be proposed as a noninvasive alternative to lymphadenectomy. Fifteen patients with various stages of histologically proven prostatic cancer were examined by immunolymphoscintigraphy (ILS) before treatment to detect lymph node metastases. These patients had Stage A (n = 7), Stage B (n = 3), Stage C (n = 2), and Stage D (n = 3) tumors. They received between 100 and 400 micrograms of monoclonal antibody 227 A in the form of F(ab')2 fragments labeled with iodine-123 (123I). The antibody was injected directly into the periprostatic area. ILS images were obtained after 1, 3, 6, and 24 hours. Three days later, each patient underwent a lymphadenectomy for histologic examination. The results of the histologic examination and ILS were compared. In ten patients, the examination did not show any images capable of being interpreted as lymphadenopathy and histologic examination confirmed the integrity of the nodes examined. In five cases, scintigraphy suggested the presence of lymph node invasion by prostatic cancer and this was confirmed by histologic examination in three of the five cases. Overall, in terms of lymphadenopathy, this examination had a sensitivity of 100% and a specificity of 83%. Therefore, ILS appears to be capable of detecting lymph node metastases in prostatic cancer

  12. Purification of snRNPs U1, U2, U4, U5 and U6 with 2,2,7-trimethylguanosine-specific antibody and definition of their constituent proteins reacting with anti-Sm and anti-(U1)RNP antisera.

    Bringmann, P; Rinke, J; Appel, B; Reuter, R; Lührmann, R

    1983-01-01

    Small nuclear ribonucleoprotein particles (snRNPs) of the U-snRNP class from Ehrlich ascites tumor cells were purified in a one-step procedure by affinity chromatography with antibodies specific for 2,2,7-trimethylguanosine (m23.2.7G), which is part of the 5'-terminal cap structure of snRNAs U1-U5. Antibody-bound snRNPs are desorbed from the affinity column by elution with excess nucleoside m23.2.7G; this guarantees maintenance of their native structure. The snRNPs U1, U2, U4, U5 and U6 can b...

  13. QTL Information Table: 227 [Q-TARO

    Full Text Available Resistance or Tolerance Blast resistance Leaf blast incidence against the THL84 Mixture C)Inte... Pa-In, N., Vongsaprom, C., and Toojinda, T. (2002). Quantitative Trait Loci Associated with Leaf and Neck Blast Resistanc... Res 9, 79-88. http://dnaresearch.oxfordjournals.org/cgi/content/abstract/9/3/79 ... ...e in Recombinant Inbred Line Population of Rice (Oryza Sativa). DNA

  14. 50 CFR 600.227 - Lobbying.

    2010-10-01

    ... Commerce implementing regulations published at 15 CFR part 28, “New Restrictions on Lobbying.” These... general principles and detailed items of costs. (3) Under 2 CFR part 230, costs for certain lobbying... Management Council Grants and Cooperative Agreements summarized as follows: (1) Title 2 CFR part 230 -...

  15. 40 CFR 227.21 - Uses considered.

    2010-07-01

    ... limited to: (a) Commercial fishing in open ocean areas; (b) Commercial fishing in coastal areas; (c) Commercial fishing in estuarine areas; (d) Recreational fishing in open ocean areas; (e) Recreational fishing... EVALUATION OF PERMIT APPLICATIONS FOR OCEAN DUMPING OF MATERIALS Impact of the Proposed Dumping on Other...

  16. 49 CFR 227.5 - Definitions.

    2010-10-01

    ... the meaning assigned by the regulations of the Surface Transportation Board (49 CFR part 120; General...) and 1 CFR part 51. You may obtain a copy of the incorporated standard from the American National... second or less. Decibel (dB) means a unit of measurement of sound pressure levels. dB(A) means the...

  17. Danish Media coverage of 22/7

    Hervik, Peter; Boisen, Sophie

    2013-01-01

    ’s Danish connections through an analysis of the first 100 days of Danish media coverage. We scrutinised 188 articles in the largest daily newspapers to find out how Danish actors related to ABB’s ideas. The key argument is that the discourses and opinions reflect pre-existing opinions and entrenched...

  18. A francium-223 reservoir source

    By improving and accelerating a method which had been earlier tried for caesium-rubidium separation on a cellulose column, i.e. elution with 2N HCl-equilibrated phenol, the author succeeded in obtaining consecutive and quasi-selective elutions of francium-223, starting with actinium-227 fixed at the top of a small cellulose column to which ZrO2 had been added. The francium-223, rapidly eluted under pressure, is extracted by water while the phenol is extracted by ether; it can easily be cleared of any residual traces of radioactive contaminants (thallium-207, radium-223, thorium-227) by two consecutive BaSO4 precipitations. The preparation of a Fr223 solution (HCl-H2SO4) requires approximately 20 min; the time noted for Fr223 was closer to 22 than to 21 min. (author)

  19. Purification of radium-226 for the manufacturing of actinium-225 in a cyclotron for alpha-immunotherapy; Radium-Aufreinigung zur Herstellung von Actinium-225 am Zyklotron fuer die Alpha-Immuntherapie

    Marx, Sebastian Markus

    2014-09-23

    The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.

  20. Renal uptake of bismuth-213 and its contribution to kidney radiation dose following administration of actinium-225-labeled antibody

    Schwartz, J; O' Donoghue, J A; Humm, J L [Department of Medical Physics, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); Jaggi, J S [Bristol-Myers Squibb, Plainsboro, NJ (United States); Ruan, S; Larson, S M [Nuclear Medicine Service Department of Radiology, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); McDevitt, M; Scheinberg, D A, E-mail: schwarj1@mskcc.org [Molecular Pharmacology and Chemistry, Sloan-Kettering Institute, 1275 York Avenue, New York, NY 10065 (United States)

    2011-02-07

    Clinical therapeutic studies using {sup 225}Ac-labeled antibodies have begun. Of major concern is renal toxicity that may result from the three alpha-emitting progeny generated following the decay of {sup 225}Ac. The purpose of this study was to determine the amount of {sup 225}Ac and non-equilibrium progeny in the mouse kidney after the injection of {sup 225}Ac-huM195 antibody and examine the dosimetric consequences. Groups of mice were sacrificed at 24, 96 and 144 h after injection with {sup 225}Ac-huM195 antibody and kidneys excised. One kidney was used for gamma ray spectroscopic measurements by a high-purity germanium (HPGe) detector. The second kidney was used to generate frozen tissue sections which were examined by digital autoradiography (DAR). Two measurements were performed on each kidney specimen: (1) immediately post-resection and (2) after sufficient time for any non-equilibrium excess {sup 213}Bi to decay completely. Comparison of these measurements enabled estimation of the amount of excess {sup 213}Bi reaching the kidney ({gamma}-ray spectroscopy) and its sub-regional distribution (DAR). The average absorbed dose to whole kidney, determined by spectroscopy, was 0.77 (SD 0.21) Gy kBq{sup -1}, of which 0.46 (SD 0.16) Gy kBq{sup -1} (i.e. 60%) was due to non-equilibrium excess {sup 213}Bi. The relative contributions to renal cortex and medulla were determined by DAR. The estimated dose to the cortex from non-equilibrium excess {sup 213}Bi (0.31 (SD 0.11) Gy kBq{sup -1}) represented {approx}46% of the total. For the medulla the dose contribution from excess {sup 213}Bi (0.81 (SD 0.28) Gy kBq{sup -1}) was {approx}80% of the total. Based on these estimates, for human patients we project a kidney-absorbed dose of 0.28 Gy MBq{sup -1} following administration of {sup 225}Ac-huM195 with non-equilibrium excess {sup 213}Bi responsible for approximately 60% of the total. Methods to reduce renal accumulation of radioactive progeny appear to be necessary for the success of {sup 225}Ac radioimmunotherapy.

  1. Purification of radium-226 for the manufacturing of actinium-225 in a cyclotron for alpha-immunotherapy

    The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.

  2. Distribution of trace elements in land plants and botanical taxonomy with special reference to rare earth elements and actinium

    Distribution profiles of trace elements in land plants were studied by neutron activation analysis and radioactivity measurements without activation. Number of botanical samples analyzed were more than three thousand in which more than three hundred botanical species were included. New accumulator plants of Co, Cr, Zn, Cd, rare earth elements, Ac, U, etc., were found. Capabilities of accumulating trace elements can be related to the botanical taxonomy. Discussions are given from view points of inorganic chemistry as well as from botanical physiology

  3. Origin of elements of the Uranium-235 family observed in the Ellez river near the EL-4 experimental nuclear reactor in dismantling (Monts d'Arree- Finistere department); Origine des elements de la famille de l'uranium-235 observes dans la riviere Ellez a proximite du reacteur nucleaire experimental EL4 en cours de demantelement (Mont d'Arree - departement du Finistere). Resultats et premiers constats annee 2006

    NONE

    2006-07-01

    In a previous study which concerned the catchment basin of the harbour of Brest, the A.C.R.O. put in evidence a marking by artificial radioelements around the power plant of Brennilis which can be imputed without ambiguities to the nuclear installation. It also put in evidence abnormalities concerning the natural radioactivity which justifies this new study. In the area of the Monts d'Arree, actinium 227 ({sup 227}Ac), non born by its ascendents which are {sup 235}U and {sup 231}Pa is observed. This phenomenon is characterized by mass activities superior to these ones of {sup 235}U and able to reach these ones of {sup 238}U. Its presence corresponds with the drainage of the Ellez river since the former channel of radioactive effluents releases from the nuclear power plant EL-4 up to the reservoir Saint-Herblot situated 6 km downstream. The strongest values of radioactivity are registered near the disused power plant, at this place a relationship exists between the level of actinium 227 and this one of the artificial radioactivity as it exists a relationship with the decay products of radon exhaled from the subsoil ({sup 210}Pb). But its presence is not limited to a part of the Ellez river, it is equally observed in terrestrial medium, in places in priori not influenced by the direct liquid effluents of the power plant. This place is situated at more than 4 km and without any connection with the Ellez waters. At this stage of the study, it is not possible to answer with certainty the question of the origin of this phenomenon. A new reorientation is considered indispensable to clarify definitively the origin of this unknown phenomenon in the scientific publications and the environmental monitoring. (N.C.)

  4. origin of elements of the Uranium-235 family observed in the Ellez river near the EL-4 experimental nuclear reactor in dismantling (Monts d'Arree- Finistere department)

    In a previous study which concerned the catchment basin of the harbour of Brest, the A.C.R.O. put in evidence a marking by artificial radioelements around the power plant of Brennilis which can be imputed without ambiguities to the nuclear installation. It also put in evidence abnormalities concerning the natural radioactivity which justifies this new study. In the area of the Monts d'Arree, actinium 227 (227Ac), non born by its ascendents which are 235U and 231Pa is observed. This phenomenon is characterized by mass activities superior to these ones of 235U and able to reach these ones of 238U. Its presence corresponds with the drainage of the Ellez river since the former channel of radioactive effluents releases from the nuclear power plant EL-4 up to the reservoir Saint-Herblot situated 6 km downstream. The strongest values of radioactivity are registered near the disused power plant, at this place a relationship exists between the level of actinium 227 and this one of the artificial radioactivity as it exists a relationship with the decay products of radon exhaled from the subsoil (210Pb). But its presence is not limited to a part of the Ellez river, it is equally observed in terrestrial medium, in places in priori not influenced by the direct liquid effluents of the power plant. This place is situated at more than 4 km and without any connection with the Ellez waters. At this stage of the study, it is not possible to answer with certainty the question of the origin of this phenomenon. A new reorientation is considered indispensable to clarify definitively the origin of this unknown phenomenon in the scientific publications and the environmental monitoring. (N.C.)

  5. Dicty_cDB: VFF227 [Dicty_cDB

    Full Text Available phoprotein P0. 1544 0.0 2 CD203589 |CD203589.1 Ls_AM1_10H07_T7 Litomosoides sigmodontis adult male 1 Litomos...oides sigmodontis cDNA clone Ls_AM1_10H07 5', mRNA sequence. 62 7e-07 2 AA901452 |AA9014...mal protein P0; 500 e-140 R5DOP0( S14012 ) ribosomal protein P0 - slime mold (Dictyostelium ... 496 e-139 AY...241 4e-62 AB284186_1( AB284186 |pid:none) Neospora caninum mRNA for ribosoma... 240 5e-62 AJ457827_1( AJ457827 |pid:none) Bombyx mo...spwklv tqpllqfhiqs*mlsriy*pshskpltlsmllknsnqplllpqllplhplllqlplprks sskkrkknqmmiwvwvsxikix*infffqk Homology

  6. 48 CFR 1852.227-70 - New technology.

    2010-10-01

    ... Administration. (For the purpose of this definition, the size standard contained in 13 CFR 121.3-8 for small business contractors and in 13 CFR 121.3-12 for small business subcontractors will be used.) Subject... Regulations, 14 CFR part 1245, subpart 1, have adopted the Presidential Memorandum on Government Patent...

  7. Dicty_cDB: CHC227 [Dicty_cDB

    Full Text Available GGTA TCCCACCAGATCT sequence update 2002. 9.10 Translated Amino Acid sequence ---xxxxxxxxxxxxxxxxi*xxx...LTGKTITLE VEGSDNIENVKTKIQDKEGIPPD Translated Amino Acid sequence (All Frames) Frame A: ---xxxxxxxxxxxxxxxxi*xxx...ENVKTKIQDKEGIPPD Frame B: ---xxmxxxxxxxxxixxxfsxxxkxwyxxfcxnpxw*xynxxklkvlxxlrmlk...pkxkt kkvfhqinxvsfspvxnwrmvvlslittfkrnplsi*fsd*evvckfl*klslvkplhxk lkvvttlrm*kqkfktkkvshqi Frame C: ---xxxxxxxxxkxxsxxxlvxxxxggxxx

  8. 49 CFR 192.227 - Qualification of welders.

    2010-10-01

    ... accordance with section 6 of API 1104 (incorporated by reference, see § 192.7) or section IX of the ASME... produces a hoop stress of less than 20 percent of SMYS by performing an acceptable test weld, for the process to be used, under the test set forth in section I of Appendix C of this part. Each welder who...

  9. Dicty_cDB: CHG227 [Dicty_cDB

    Full Text Available sitlg rsy*sles*tnflwfcwylyfimerrfrfnr*ts*s*kd*ss*vshveleerfrketssl *sfpsn*igq*k**csrikw*t*g*tifpyfkqri*yh*kf...YFFLILSFFLKFFFFKKKNXNNLIXNNNNNXKNNXXPLNFFXX--- ---SPLIMSIWTVPNRCKRSNHFHSRRYDSCNGVTKSHSIYDS*sqetl*sr*ewsitlg rsy*sles*tnflwfcwylyfimer...rfrfnr*ts*s*kd*ss*vshveleerfrketssl *sfpsn*igq*k**csrikw*t*g*tifpyfkqri*yh*kfktfpsk

  10. 48 CFR 252.227-7020 - Rights in special works.

    2010-10-01

    ..., algorithms, processes, flow charts, formulae and related material that would enable the software to be... publicity, arising out of the creation, delivery, use, modification, reproduction, release,...

  11. Brookhaven lecture series No. 227: The Chernobyl accident

    This lecture discusses the events leading to, during, and following the Chernobyl Reactor number 4 accident. A description of the light water cooled, graphite moderated reactor, the reactor site conditions leading to meltdown is presented. The emission of radioactive effluents and the biological radiation effects is also discussed. (FI)

  12. 1935 15' Quad #227 Aerial Photo Mosaic Index

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  13. 7 CFR 227.30 - Responsibilities of State agencies.

    2010-01-01

    ..., DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS NUTRITION EDUCATION AND TRAINING PROGRAM State Agency... shall appoint a nutrition education specialist to serve as a State Coordinator for the Program who may.... Each State agency shall submit to the Secretary a State plan for Nutrition Education and Training...

  14. 7 CFR 227.36 - Requirements of needs assessment.

    2010-01-01

    ..., DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS NUTRITION EDUCATION AND TRAINING PROGRAM State Coordinator... nutrition education and training programs including their: (i) Goals and objectives; (ii) Source and level... currently available for nutrition education and training programs, and determine for each: (i)......

  15. 7 CFR 227.35 - Responsibilities of State coordinator.

    2010-01-01

    ..., DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS NUTRITION EDUCATION AND TRAINING PROGRAM State Coordinator... implementation of the State Plan, (f) Coordination of the Program with the Child Nutrition Programs at the State and local levels, (g) Coordination of the Program with other nutrition education and......

  16. 48 CFR 227.7203-5 - Government rights.

    2010-10-01

    ... or transfer of some or all of a business entity or it assets to another party; (5) Computer software... subject to the use and non-disclosure restrictions. Public announcements in the Commerce Business Daily or... planned software maintenance philosophy, anticipated time or user sharing requirements, and other...

  17. 25 CFR 227.22 - Diligence and prevention of waste.

    2010-04-01

    ... prevention of waste of oil or gas developed on the land, or the entrance of water through wells drilled by... prevention of waste. The lessee shall exercise diligence in drilling and operating wells for oil and gas on... the same and to shut off effectually all water from the oil or gas-bearing strata; not drill any...

  18. 49 CFR 227.103 - Noise monitoring program.

    2010-10-01

    ... opportunity to observe any noise dose measurements conducted pursuant to this section. (g) Reporting of... with 5 U.S.C. 552(a) and 1 CFR part 51. You may obtain a copy of the incorporated materials from the... decibels to 140 decibels shall be integrated into the noise measurements. (2) Noise measurements shall...

  19. 12 CFR Supplement I to Part 227 - Official Staff Commentary

    2010-01-01

    ..., such as that in the Wall Street Journal, even if the bank's own prime rate is one of several rates used.... Claims or defenses under Regulation Z, 12 CFR 226.12(c). When a consumer has asserted a claim or defense against the card issuer pursuant to 12 CFR 226.12(c), the bank must allocate consistent with 12 CFR...

  20. 7 CFR 2.27 - Office of Administrative Law Judges.

    2010-01-01

    ... Seed Act, as amended (7 U.S.C. 1551 et seq.); the (Laboratory) Animal Welfare Act, as amended (7 U.S.C....); the Forest Resources Conservation and Shortage Relief of 1990 (16 U.S.C. 630 et seq.); and any...

  1. Dicty_cDB: SSL227 [Dicty_cDB

    Full Text Available developmental stages Lycopersicon esculentum cDNA, mRNA sequence. 34 0.79 2 BQ515661 |BQ515661.1 EST623076 Generation...60 |BQ515660.1 EST623075 Generation of a set of potato cDNA clones for microarray

  2. Dicty_cDB: SHD227 [Dicty_cDB

    Full Text Available 1 BOHEC38TF BOHE Brassica oleracea genomic clone BOHEC38, DNA sequence. 32 3.1 2 CO214588 |CO214588.1 WS00929.B21...lignments: (bits) Value SHK418 (SHK418Q) /CSM/SH/SHK4-A/SHK418Q.Seq.d/ 1400 0.0 SHG576 (SHG576Q) /CSM/SH/SHG5-D/SHG576Q.Seq.d/ 1400... 0.0 SHG486 (SHG486Q) /CSM/SH/SHG4-D/SHG486Q.Seq.d/ 1400 0.0 SHG409 (SHG409Q) /CSM/SH/SHG4-A/SHG40...9Q.Seq.d/ 1400 0.0 SHG402 (SHG402Q) /CSM/SH/SHG4-A/SHG402Q.Seq.d/ 1400 0.0 SHD789 (SHD789Q) /CS...M/SH/SHD7-D/SHD789Q.Seq.d/ 1400 0.0 SHD746 (SHD746Q) /CSM/SH/SHD7-B/SHD746Q.Seq.d/ 1400

  3. 48 CFR 227.7103-5 - Government rights.

    2010-10-01

    ..., component, or process, including logistics support and other factors which may have relevance for a... adequate competition among the sources; or (iii) Reverse engineering, or providing items from Government... reverse engineering....

  4. Brookhaven lecture series No. 227: The Chernobyl accident

    Kouts, H.

    1986-09-24

    This lecture discusses the events leading to, during, and following the Chernobyl Reactor number 4 accident. A description of the light water cooled, graphite moderated reactor, the reactor site conditions leading to meltdown is presented. The emission of radioactive effluents and the biological radiation effects is also discussed. (FI)

  5. Study on laser atomic spectroscopy

    Laser atomic spectroscopic study on actinium element has been performed in many areas of spectroscopy. The study on characteristic of atomic vapor has been proceeded for copper atom and the spatial density distribution of copper vapor is measured. This experimental data has been compared with the theoretically calculated data. In spectroscopic experiment, the first and second excited states for actinium element are identified and the most efficient ionization scheme for actinium element is identified. In addition, the corrosion problem for filament material due to the heating of the actinium element has been studied. (Author)

  6. Development of an Ultra-Low Background Liquid Scintillation Counter for Trace Level Analysis

    Erchinger, Jennifer L.; Orrell, John L.; Aalseth, Craig E.; Bernacki, Bruce E.; Douglas, Matthew; Finn, Erin C.; Fuller, Erin S.; Keillor, Martin E.; Morley, Shannon M.; Mullen, Crystal A.; Panisko, Mark E.; Shaff, Sarah M.; Warren, Glen A.; Wright, Michael E.

    2015-09-01

    Low-level liquid scintillation counting (LSC) has been established as one of the radiation detection techniques useful in elucidating environmental processes and environmental monitoring around nuclear facilities. The Ultra-Low Background Liquid Scintillation Counter (ULB-LSC) under construction in the Shallow Underground Laboratory at Pacific Northwest National Laboratory aims to further reduce the MDAs and/or required sample processing. Through layers of passive shielding in conjunction with an active veto and 30 meters water equivalent overburden, the background reduction is expected to be 10 to 100 times below typical analytic low-background liquid scintillation systems. Simulations have shown an expected background of around 14 counts per day. A novel approach to the light collection will use a coated hollow light guide cut into the inner copper shielding. Demonstration LSC measurements will show low-energy detection, spectral deconvolution, and alpha/beta discrimination capabilities, from trials with standards of tritium, strontium-90, and actinium-227, respectively. An overview of the system design and expected demonstration measurements will emphasize the potential applications of the ULB-LSC in environmental monitoring for treaty verification, reach-back sample analysis, and facility inspections.

  7. Enhanced radioactivity due to natural oil and gas production and related radiological problems

    Within the scope of a research contract, the following aspects are considered: External radiation exposure at production sites; internal radiation exposures during cleaning operations such as removing of scale by sand blasting; problems of waste disposal; internal radiation exposure due to radon inhalation by consumers; the origin of the high radium content of brines from oil and gas fields. Enhanced dose rates up to 50 μSv/h have been found at the external surface of saltwater tanks, but 72% of the 160 sites investigated did not show any increase above the natural background. Brines from gas contained radium-226 up to 286 Bq/1 and scale up to 1 kBq/g. In brines and scale from oil fields radium-228 was usually the dominating radionuclide. Some samples contained significant amounts of lead-210 and even actinium-227, too, but practically no uranium or thorium. The radon-222 concentrations in natural gas samples varied between 0.004 and 4 Bq/l with an average value of 0.6 Bq/l. Related radiological problems are discussed. (orig./HP)

  8. Latino Parent Agency within the Restrictionist Language Policy Environment of California's Proposition 227

    Farruggio, Peter

    2010-01-01

    CThe article is a study of Latino immigrant parents' agency toward primary language (L1) instruction in the face of restrictionist language policy. Certain attitudes and characteristics were associated with advocacy for Spanish L1 instruction. Interviews conducted in an urban California school district among parents with different background…

  9. 48 CFR 252.227-7014 - Rights in noncommercial computer software and noncommercial computer software documentation.

    2010-10-01

    ... government purpose rights in computer software development with mixed funding. (ii) Government purpose rights...), contract modification, or option exercise that required development of the computer software. (iii) The... rights to use, release, or disclose computer software. **Indicate whether development was exclusively...

  10. AB227. Our experience of T-shaped shunt for the treatment of ischemic priapism

    Tang, Yuxin; Tan, Zhengyu; Zhou, Jun; Peng, Dongyi; Gan, Yu; Yang, Jianfu; He, Leye; Wang, Yong

    2016-01-01

    Objective To explore the efficacy of T-shaped shunt operation for the treatment of ischemic priapism. Methods We retrospectively studied nine patients with ischemic priapism. All patients were given preoperative MRI examination, T-shaped shunt operation and heparin saline flushing were performed when conservative therapy failed, a wedge biopsy of corpus cavernosum were done during the operation for tissue diagnosis. Results All patients had satisfactory outcome of the T-shaped shunt surgery except two patients who were diagnosed as malignant priapism, one was due to perineal neuroendocrine carcinoma and he refused taking further therapy and died 3 months later; the other was caused by penile epithelioid sarcoma and then accepted partial resection of penis; during 6–12 months follow-up, five cases developed erectile dysfunction. Conclusions MRI appears to be valuable for the management of ischemic priapism. Although T-shaped shunt operation has advantages of simple operation, less complications and satisfactory efficacy, it is not suitable for the patient of ischemic priapism which is caused by tumor. A wedge biopsy of corpus cavernosum during operation is helpful to confirm malignant priapism.

  11. 48 CFR 252.227-7013 - Rights in technical data-Noncommercial items.

    2010-10-01

    ... recording, of a scientific or technical nature (including computer software documentation). The term does... paragraph (l) to the basic clause: (l) Publication for sale. (1) This paragraph only applies to technical... such data on its behalf if, prior to publication for sale by the Government and within twenty-four...

  12. 7 CFR Appendix to Part 227 - Apportionment of Funds for Nutrition Education and Training

    2010-01-01

    ... Public schools 1 Private schools 2 Residential child care institutions 3 Nonresidential child care...) U.S. Department of Health, Education, and Welfare, Education Division, NCES, Statistics of Public Schools, Fall 1977, prepublication data, Table 5 for States and areas, except (2) Northern Marianas...

  13. Erostratus Unbound: Norway’s 22/7 Converging Frames of War

    Meret, Susi; Hervik, Peter

    2013-01-01

    The purpose of this introductory article is to set the stage for the theme issue on the 22 July 2011 terror attacks in Oslo and Utøya by mass murderer, Anders Behring Breivik. The article opens up with the historical and literary figure Erostratus to discuss the differences and similarities between...... “multiculturalism” appearing synonymous with “cultural Marxism” as well as subscribing to what goes under the term of Eurabia conspiracy. In addition, through centring on other catch-all concept of political correctness, the clusters of different anti-migration, anti-feminism and Islamophobic opposition are united...... together in news articles in a way not unlike the media coverage (and academic analyses) of the Danish Muhammad cartoon affair...

  14. Erostratus Unbound: Norway’s 22/7 Converging Frames of War

    Meret, Susi; Hervik, Peter

    2013-01-01

    The purpose of this introductory article is to set the stage for the theme issue on the 22 July 2011 terror attacks in Oslo and Utøya by mass murderer, Anders Behring Breivik. The article opens up with the historical and literary figure Erostratus to discuss the differences and similarities between this lone wolf character and the acts of terrorist Anders Behring Breivik. It then situates Breivik firmly within an ideological landscape where communities of politicians, pundits and others dista...

  15. Puesta en valor de un espectógrafo Hilger E227, modelo grande

    Baravalle, Román; Bartolomé, I. L; Pereyra, E. L; Rumi, G.

    2013-01-01

    Este trabajo fue realizado en el marco de un programa de capacitación en Comunicación Social de la Ciencia del Museo de Física de La Plata, en donde se buscó explotar la instancia de contacto directo con los instrumentos físicos históricos como un modo de aprendizaje tanto de principios físicos, de técnicas experimentales y de la historia de los instrumentos e investigadores de la época.

  16. 48 CFR 952.227-84 - Notice of right to request patent waiver.

    2010-10-01

    .... See DOE's patent waiver regulations at 10 CFR part 784. (End of provision) ... accordance with 48 CFR 927.409(t). Right To Request Patent Waiver (FEB 1998) Offerors have the right to... exceptional circumstances or intelligence activities. Therefore, small businesses and nonprofit...

  17. 30 CFR 227.1 - What is the purpose of this part?

    2010-07-01

    ... 205 of the Federal Oil and Gas Royalty Management Act of 1982 (the Act), 30 U.S.C. 1735, as amended by the Federal Oil and Gas Royalty Simplification and Fairness Act of 1996, Pub. L. 104-185, August 13... investigation functions to States under Pub. L. 102-154 for solid mineral leases, geothermal leases and...

  18. 30 CFR 227.101 - What royalty management functions may MMS delegate to a State?

    2010-07-01

    ... Continental Shelf Lands Act, 43 U.S.C. 1337 (g), or solid mineral leases or geothermal leases on Federal lands... leases subject to the Act on Federal lands within your State, MMS may delegate the following royalty... verification. (b) If there are oil and gas leases subject to the Act on Federal lands within your State,...

  19. 40 CFR 227.27 - Limiting permissible con-cen-tra-tion (LPC).

    2010-07-01

    ....29, will not exceed a toxicity threshold defined as 0.01 of a concentration shown to be acutely toxic... not cause unreasonable acute or chronic toxicity or other sublethal adverse effects based on...

  20. 40 CFR 227.32 - Liquid, suspended particulate, and solid phases of a material.

    2010-07-01

    ... the case may be, may require that the separation of liquid, suspended particulate, and solid phases of the material be performed upon a mixture of the waste with ocean water rather than on the material... alkaline waste) based on guidance provided by EPA on particular cases, or in accordance with approved...

  1. 227 Views of RNA: Is RNA Unique in Its Chemical Isomer Space?

    Meringer, Markus; Goodwin, Jay

    2015-01-01

    Abstract Ribonucleic acid (RNA) is one of the two nucleic acids used by extant biochemistry and plays a central role as the intermediary carrier of genetic information in transcription and translation. If RNA was involved in the origin of life, it should have a facile prebiotic synthesis. A wide variety of such syntheses have been explored. However, to date no one-pot reaction has been shown capable of yielding RNA monomers from likely prebiotically abundant starting materials, though this does not rule out the possibility that simpler, more easily prebiotically accessible nucleic acids may have preceded RNA. Given structural constraints, such as the ability to form complementary base pairs and a linear covalent polymer, a variety of structural isomers of RNA could potentially function as genetic platforms. By using structure-generation software, all the potential structural isomers of the ribosides (BC5H9O4, where B is nucleobase), as well as a set of simpler minimal analogues derived from them, that can potentially serve as monomeric building blocks of nucleic acid–like molecules are enumerated. Molecules are selected based on their likely stability under biochemically relevant conditions (e.g., moderate pH and temperature) and the presence of at least two functional groups allowing the monomers to be incorporated into linear polymers. The resulting structures are then evaluated by using molecular descriptors typically applied in quantitative structure–property relationship (QSPR) studies and predicted physicochemical properties. Several databases have been queried to determine whether any of the computed isomers had been synthesized previously. Very few of the molecules that emerge from this structure set have been previously described. We conclude that ribonucleosides may have competed with a multitude of alternative structures whose potential proto-biochemical roles and abiotic syntheses remain to be explored. Key Words: Evolution—Chemical evolution—Exobiology—Prebiotic chemistry—RNA world. Astrobiology 15, 538–558. PMID:26200431

  2. 227 Views of RNA: Is RNA Unique in Its Chemical Isomer Space?

    Cleaves, H. James; Meringer, Markus; Goodwin, Jay T.

    2015-01-01

    Abstract Ribonucleic acid (RNA) is one of the two nucleic acids used by extant biochemistry and plays a central role as the intermediary carrier of genetic information in transcription and translation. If RNA was involved in the origin of life, it should have a facile prebiotic synthesis. A wide variety of such syntheses have been explored. However, to date no one-pot reaction has been shown capable of yielding RNA monomers from likely prebiotically abundant starting materials, though this do...

  3. 48 CFR 952.227-13 - Patent rights-acquisition by the Government.

    2010-10-01

    ... date of award of this contract. See 10 CFR part 784. Agency licensing regulations and applicable agency... 10 CFR part 781. (b) Allocations of principal rights—(1) Assignment to the Government. The Contractor... (10 CFR part 784) to require the Contractor, an assignee, or exclusive licensee of a subject...

  4. 48 CFR 252.227-7038 - Patent Rights-Ownership by the Contractor (Large Business).

    2010-10-01

    ... corporate structure of which the Contractor is a part; (B) Includes the right to grant sublicenses to the... Contractor made in the performance of work under this contract. (b) Contractor's rights—(1) Ownership. The... subject invention pursuant to an application for an exclusive license submitted in accordance with 37...

  5. 48 CFR 952.227-11 - Patent rights-retention by the contractor (short form).

    2010-10-01

    ... its domestic subsidiary and affiliates, if any, within the corporate structure of which the Contractor... subcontracting at 13 CFR 121.3-8 and 13 CFR 121.3-12, respectively, will be used. (6) Subject invention means any invention of the contractor conceived or first actually reduced to practice in the performance of work...

  6. 48 CFR 52.227-13 - Patent Rights-Ownership by the Government.

    2010-10-01

    ... domestic subsidiaries and affiliates within the corporate structure of which the Contractor is a part, and... of the Contractor made in the performance of work under this contract. (b) Ownership—(1) Assignment...) and in accordance with the procedures set forth in 37 CFR 401.6 and any supplemental regulations...

  7. 48 CFR 252.227-7021 - Rights in data-existing works.

    2010-10-01

    ... REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text... includes literary, musical, and dramatic works; pantomimes and choreographic works; pictorial, graphic...

  8. 227 Views of RNA: Is RNA Unique in Its Chemical Isomer Space?

    Cleaves, H James; Meringer, Markus; Goodwin, Jay

    2015-07-01

    Ribonucleic acid (RNA) is one of the two nucleic acids used by extant biochemistry and plays a central role as the intermediary carrier of genetic information in transcription and translation. If RNA was involved in the origin of life, it should have a facile prebiotic synthesis. A wide variety of such syntheses have been explored. However, to date no one-pot reaction has been shown capable of yielding RNA monomers from likely prebiotically abundant starting materials, though this does not rule out the possibility that simpler, more easily prebiotically accessible nucleic acids may have preceded RNA. Given structural constraints, such as the ability to form complementary base pairs and a linear covalent polymer, a variety of structural isomers of RNA could potentially function as genetic platforms. By using structure-generation software, all the potential structural isomers of the ribosides (BC5H9O4, where B is nucleobase), as well as a set of simpler minimal analogues derived from them, that can potentially serve as monomeric building blocks of nucleic acid-like molecules are enumerated. Molecules are selected based on their likely stability under biochemically relevant conditions (e.g., moderate pH and temperature) and the presence of at least two functional groups allowing the monomers to be incorporated into linear polymers. The resulting structures are then evaluated by using molecular descriptors typically applied in quantitative structure-property relationship (QSPR) studies and predicted physicochemical properties. Several databases have been queried to determine whether any of the computed isomers had been synthesized previously. Very few of the molecules that emerge from this structure set have been previously described. We conclude that ribonucleosides may have competed with a multitude of alternative structures whose potential proto-biochemical roles and abiotic syntheses remain to be explored. PMID:26200431

  9. 48 CFR 52.227-11 - Patent Rights-Ownership by the Contractor.

    2010-10-01

    ... require licensing pursuant to 35 U.S.C. 203 and 210(c), and in accordance with the procedures in 37 CFR... the subject invention is assigned in accordance with 35 U.S.C. 202(e) and 37 CFR 401.10; (3) Use the... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Patent Rights-Ownership...

  10. 40 CFR 227.7 - Limits established for specific wastes or waste constituents.

    2010-07-01

    ... containing biodegradable constituents, or constituents which consume oxygen in any fashion, may be dumped in the ocean only under conditions in which the dissolved oxygen after allowance for initial mixing,...

  11. Generator method of 225Ac production without a carrier for nuclear medicine

    The two-steps isotope generator scheme of 225Ac production from 229Th has been developed. The first step is used for separation of thorium, actinium, radium and daughter decay products (DDP), and removals of parent radionuclide. The second step provides additional separation of actinium from traces of radium and DDP, and conversion of actinium in the nitrate form. The chosen solutions provide optimal conditions for carry out of process. The yield of the 225Ac was 99.9% at minimal losses of parent 229Th (less than 0.1%)

  12. Astatine-211 Pathway from Radiochemistry to Clinical Investigation

    Particularly in clinical settings where tumour burden is low and cancers are located in close proximity to essential normal tissue structures, α-particle emitting radionuclides can offer significant advantages for targeted radionuclide therapy. One of the first alpha emitters to be evaluated for this purpose is the 7.2-h half-life radiohalogen Astatine-211 (211At). From a commercialization-potential perspective 211At, is less appealing than the longer half-life alpha particle emitters Radium-223, Actinium-225 and Thorium-227, which have become the focus of many laboratories. However, if methods for providing a better supply of 211At could be developed, this alpha emitter would be the radionuclide of choice for many potential therapeutic applications. With regard to the production of 211At, this can be readily be accomplished by bombarding natural bismuth targets with 28−29.5 MeV alpha particles via the 209Bi(α,2n)211At reaction. The goal is to utilize an alpha particle beam energy that provides the required balance for maximizing 211At production while minimizing creation of 210At, which is problematic because of its 138.4-day half life alpha-particle emitting daughter, 210Po. For most intended clinical applications, alpha particle beam energy of about 29 MeV offers the best compromise between maximizing yield and providing 211At with sufficient radionuclidic purity for clinical use. Clinically relevant levels of 211At have been produced at several institutions using both internal and external cyclotron targets

  13. Characterisation of the physico-chemical and solid-state behaviour of drugs in HFA-134 and 227

    Bouhroum, Abdennour

    2011-01-01

    Most drugs have a considerably low solubility in the environmentally friendly hydrofluoroalkane propellants (HFAs) currently used in pressurized metered dose inhalers (pMDIs). As a consequence, instability can occur from crystal growth and Ostwald ripening of the system altering the therapeutic performance of the pMDI. Understanding and being able to predict the behaviour of such drugs in the propellant will help in selecting the correct co-solvents and/or surfactants to increase the stabilit...

  14. 49 CFR 173.227 - Materials poisonous by inhalation, Division 6.1, Packing Group I, Hazard Zone B.

    2010-10-01

    ... times the vapor pressure at 55 °C (131 °F) of the material to be packaged; (2) Have screw closures that are— (i) Closed and tightened to a torque prescribed by the closure manufacturer, using a properly calibrated device that is capable of measuring torque; (ii) Physically held in place by any means capable...

  15. [Nebraska 4-H Wheat Science School Enrichment Project, Teacher/Leader Guides 213-222 and 227.

    Nebraska Univ., Lincoln. Inst. of Agriculture and Natural Resources.

    Through the 4-H Wheat Science project, students learn the importance of wheat from the complete process of growing wheat to the final product of bread. The curriculum is designed to include hands-on experiences in science, consumer education, nutrition, production economics, vocabulary, and applied mathematics. Teachers can select those units out…

  16. 48 CFR 952.227-14 - Rights in data-general. (DOE coverage-alternates VI and VII)

    2010-10-01

    ... CFR 927.404(m) make the change described in Alternate VII to limit the contractor's use of DOE restricted data. Insert the parenthetical phrase “(except Restricted Data in category C-24, 10 CFR part 725... (FEB 1998) As prescribed at 48 CFR 927.404(l) insert Alternate VI to require the contractor to...

  17. SU-E-J-227: Breathing Pattern Consistency and Reproducibility: Comparative Analysis for Supine and Prone Body Positioning

    Purpose: Evaluate and compare the cycle-to-cycle consistency of breathing patterns and their reproducibility over the course of treatment, for supine and prone positioning. Methods: Respiratory traces from 25 patients were recorded for sequential supine/prone 4DCT scans acquired prior to treatment, and during the course of the treatment (weekly or bi-weekly). For each breathing cycle, the average(AVE), end-of-exhale(EoE) and end-of-inhale( EoI) locations were identified using in-house developed software. In addition, the mean values and variations for the above quantities were computed for each breathing trace. F-tests were used to compare the cycle-to-cycle consistency of all pairs of sequential supine and prone scans. Analysis of variances was also performed using population means for AVE, EoE and EoI to quantify differences between the reproducibility of prone and supine respiration traces over the treatment course. Results: Consistency: Cycle-to-cycle variations are less in prone than supine in the pre-treatment and during-treatment scans for AVE, EoE and EoI points, for the majority of patients (differences significant at p<0.05). The few cases where the respiratory pattern had more variability in prone appeared to be random events. Reproducibility: The reproducibility of breathing patterns (supine and prone) improved as treatment progressed, perhaps due to patients becoming more comfortable with the procedure. However, variability in supine position continued to remain significantly larger than in prone (p<0.05), as indicated by the variance analysis of population means for the pretreatment and subsequent during-treatment scans. Conclusions: Prone positioning stabilizes breathing patterns in most subjects investigated in this study. Importantly, a parallel analysis of the same group of patients revealed a tendency towards increasing motion amplitude of tumor targets in prone position regardless of their size or location; thus, the choice for body positioning during radiation therapy will have to consider the clinical relevance of the two opposing trends - breathing consistency and motion amplitude

  18. 40 CFR 745.227 - Work practice standards for conducting lead-based paint activities: target housing and child...

    2010-07-01

    ... Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) TOXIC SUBSTANCES CONTROL ACT LEAD-BASED... history and each exterior component with a distinct painting history shall be tested for lead-based paint..., each component with a distinct painting history in every common area, except those components that...

  19. Comparison between the IAEA/TRS-227 and the new protocol IAEA/TRS-398 in dosimetry of photon beams

    This work presents a comparison of the measured values of absorbed dose in water for photon beams, using the formalism of the IAEA/TRS-277 and the new protocol IAEA/TRS-398. For measurements were used a linear accelerator Clinac 2300 C/D with energy beams of 6 MV and 15 MV, and a cobalt machine Theratron 780 C installed at the Instituto Nacional de Cancer, Rio de Janeiro. The value of the absorbed dose in water, Dw, was measured using the calibration factor in terms of absorbed dose in water (ND,w), according to TRS-398 and the calibration factor in terms of kerma in air (Nk,ar), from the TRS-277 (with the actualization of the TRS-381). The higher difference comparing the two protocols was 0,6 % for the Clinac 2300, for the energy of 15 MV. (author)

  20. Transient neonatal diabetes due to a missense mutation (E227K) in the gene encoding the ATP-sensitive potassium channel (KCNJ11).

    Martins, Luísa; Lourenço, Rita; Maia, Ana Lúcia; Maciel, Paula; Monteiro, Maria Isabel; Pacheco, Lucinda; Anselmo, João; César, Rui; Gomes, Maria Fernanda

    2015-10-01

    Neonatal diabetes is a monogenic form of diabetes. Herein, we report on a newborn presenting diabetic ketoacidosis at 17 days of life. A KCNJ11 mutation was identified. In such cases, insulin can be replaced by sulfonylurea with a successful metabolic control, as an example of how molecular diagnosis may influence the clinical management of the disorder. PMID:26509005

  1. Geta burðardýr verið fórnarlömb mansals skv. skilgreiningu 227. gr. a almennra hegningarlaga?

    Eyrún Halla Eyjólfsdóttir 1976

    2014-01-01

    Efni þessarar ritgerðar lýtur að málefnum svokallaðra „burðardýra“ í fíkniefnamálum. Þessi málaflokkur hefur lítið verið rannsakaður en þekkt er að burðardýr hafa orðið fyrir þvingunum og nauðung innan fíkniefnaheimsins. Þessi heimur er eins og gefur að skilja lítt kunnur þar sem hann starfar utan laga og réttar og er lítið vitað um stöðu þessara einstaklinga. Staða þeirra er þó afar erfið vegna ólögmætis starfs þeirra. Þeir standa utan réttarkerfisins og njóta ekki verndar yfirvalda. Dómu...

  2. Baduel Pierre-Robert (dir.), Construire un monde ? Mondialisation, pluralisme et universalisme, Paris, Maisonneuve & Larose, IRMC (coll. connaissance du Maghreb), 2008, 227 p.

    Sylvie Mazzella

    2010-01-01

    Depuis la fin des années 1990, la notion de civilisation revient en force, à un moment où le débat sur la question de l’islam et de ses relations avec l’Occident ne cesse de s’amplifier, et où les positions idéologiques se radicalisent. La montée en force en sciences sociales, durant ces mêmes dix dernières années, de la notion concurrente de mondialisation, n’a pas aidé à clarifier les idées. Le programme du livre dirigé par Pierre Robert Baduel, Construire un monde ? avec son sous-titre exp...

  3. Retraction notice to: Artificial intelligence in pharmaceutical product formulation: Neural computing [Chem. Ind. Chem. Eng. Q. 15(4 (2009 227-236

    Ibrić Svetlana

    2011-01-01

    Full Text Available This article has been retracted at the request of the authors. The retraction has been made because the authors admitted that they took the text and rawings from the review article written by R. Rowe and E. Colbourn, Future Medicinal Chemistry 1(4 (2009 713-726, without their permission and even did not include this article in the list of references. One of the conditions of submission of a paper for publication are that authors confirm that their work is entirely originally written, someone else’s data and/or text are appropriately cited or quoted and permission has been obtained for use of copyrighted material from other sources. Therefore, the retracted article represents a severe improperly usage of the scientific publishing system. Apologies are offered to readers of the Chem. Ind. Chem. Eng. Q. that this abuse was not detected during the submission process.

    Link to the retracted article 10.2298/CICEQ0904227I

  4. Baduel Pierre-Robert (dir., Construire un monde ? Mondialisation, pluralisme et universalisme, Paris, Maisonneuve & Larose, IRMC (coll. connaissance du Maghreb, 2008, 227 p.

    Sylvie Mazzella

    2010-01-01

    Full Text Available Depuis la fin des années 1990, la notion de civilisation revient en force, à un moment où le débat sur la question de l’islam et de ses relations avec l’Occident ne cesse de s’amplifier, et où les positions idéologiques se radicalisent. La montée en force en sciences sociales, durant ces mêmes dix dernières années, de la notion concurrente de mondialisation, n’a pas aidé à clarifier les idées. Le programme du livre dirigé par Pierre Robert Baduel, Construire un monde ? avec son sous-titre exp...

  5. Direct liquefaction Proof-of-Concept Program, Hydrocarbon Technologies, Inc., Lawrenceville, New Jersey. Final topical report, Bench Run 02 (227-91)

    Comolli, A.G.; Pradhan, V.R.; Lee, T.L.K.; Karolkiewicz, W.F.; Popper, G.

    1996-09-01

    This report presents the results of Bench Run PB-02, conducted under the DOE Proof of Concept - Bench Option Program in direct coal liquefaction at Hydrocarbon Technologies, Inc. in Lawrenceville, New Jersey. Bench Run PB-02 was the second of the nine runs planned in the POC Bench Option Contract between the U.S. DOE and Hydrocarbon Technologies, Inc. The primary goal of this bench run was to evaluate the hybrid catalyst system, consisting of a dispersed slurry catalyst in one of the hydroconversion reactors and conventional supported extrudate catalyst in the other hydroconversion reactor, in a high-low two-stage temperature sequence, similar to the one operated at Wilsonville. This hybrid mode of operation with the high-low temperature sequence was studied during direct liquefaction of coal and in coprocessing of coal with Hondo resid and/or waste plastics under high space velocity operating conditions. Another important objective of Bench Run PB-02 was to investigate the novel {open_quotes}interstage internal recycle{close_quotes} of the second stage reactor slurry back to the first stage reactor. Other features of PB-02 included the use of an interstage separator and an in-line fixed bed hydrotreater. In general, it was found during Bench Run PB-02 that the {open_quote}hybrid type{close_quote} catalyst system was not effective for obtaining high levels of process performance as the {open_quote}all dispersed{close_quote} catalyst system, tested earlier, especially at high coal space velocities. The interstage internal recycle of second stage reactor slurry to the first stage reactor feed line was found to improve cracking of liquefaction products. The addition of small amounts of mixed plastics was found to improve the hydrogen utilization in both coal conversion and heavy oil hydrocracking reactions, i.e., plastics resulted in improving the overall distillate yield while at the same time reducing the light gas make and chemical hydrogen consumption.

  6. Mouton Jean-Michel édit., Le Sinaï de la conquête arabe à nos jours, Le Caire, IFAO 870, 2001, 227 p.

    Thierry Bianquis

    2011-12-01

    Full Text Available Contributions : Katia Cytryn-Siverman, The settlement in Northern Sinai in Islamic period. Pascal Ballet, Un atelier de potiers aux « sources de Moïse » (‘Uyûn Mûsâ. Sâmî Sâlih ‘Abd al-Malik, Une inscription du sultan mamelouk Kitbuga découverte à al-Qurrays. Béatrice Dansette, Le Sinaï, lieu de solitude, centre de relations et d’échanges spirituels ? Essai d’interprétation des récits de pèlerins occidentaux au Sinaï aux derniers siècles du Moyen-Âge. Deltev Kraack, Chivalrous adventures...

  7. Guillem Peire de Cazals, “Be·m plagr’ueymais qu’ab vos dona·m valgues” (BdT 227.6)

    Alessio Collura

    2011-01-01

    This paper proposes a new edition with commentary of the poem “Be·m plagr’ueymais qu’ab vos, dona, ·m valgues” by Guillem Peire de Cazals and represents a first critical and hermeneutical reassessment of the poetry of the troubadour from Cahors, that has long been neglected. The text presents the classical structure of a love-story (springtime exordium, singing brought on by love, the theme of improvement, courting with no hope of a reward, a request for mercé) and invites the fin aman to be ...

  8. Guillem Peire de Cazals, “Be·m plagr’ueymais qu’ab vos dona·m valgues” (BdT 227.6

    Alessio Collura

    2011-12-01

    Full Text Available This paper proposes a new edition with commentary of the poem “Be·m plagr’ueymais qu’ab vos, dona, ·m valgues” by Guillem Peire de Cazals and represents a first critical and hermeneutical reassessment of the poetry of the troubadour from Cahors, that has long been neglected. The text presents the classical structure of a love-story (springtime exordium, singing brought on by love, the theme of improvement, courting with no hope of a reward, a request for mercé and invites the fin aman to be patient. The song is examined from the viewpoint of its metrical and stylistic relations to other troubadour poems (Bernart de Ventadorn, “Can par la flors josta·l vert folh” [BdT 70.41] and “La dousa votz ai auzida” [BdT 70.23] and Lanfranc Cigala, “Ioios d’amor farai de ioi senblan” [BdT 282.12], and represents an early example of the mannerisms and experimental tendencies that characterize Guillem Peire’s poems. The article also attempts to date the composition to the twenties or thirties of the 13th century.

  9. I. The metabolic properties of plutonium and allied materials

    Hamilton, J.G.

    1948-05-24

    This report on the metabolic properties of plutonium and related radioactive materials presents experimental information in the following areas: radioautographic studies; tracer studies (with tables of accumulation in tissues) of actinium, radio-zirconium, technetium, radio-rubidium, radio-germanium, beryllium, and cadmium; decontamination and bone metabolism studies; and radio-chemical isolation.

  10. Estimates of tidal mixing in the Indonesian archipelago from multidisciplinary INDOMIX in-situ data

    Koch-Larrouy, Ariane; Atmadipoera, Agus; van Beek, Pieter; Madec, Gurvan; Aucan, Jérôme; Lyard, Florent; Grelet, Jacques; Souhaut, Marc

    2015-12-01

    The Indonesian Mixing program (INDOMIX) was designed to quantify the very strong mixing that transforms Pacific waters into isohaline Indonesian Waters in the Indonesian archipelago. The turbulent dissipation rates and associated mixing were estimated and analyzed using a multidisciplinary approach that combines physical and geochemical in-situ observations: (1) direct measurements of the dissipation using a microstructure profiler, (2) use of density-based fine-scale methods applied to CTD and XCTD data, and (3) study of the vertical distribution of natural radionuclides (radium isotopes and actinium-227). Data were collected at five contrasting stations within the Indonesian archipelago, found above energetic straits or in relatively quiescent large basins. Strong instabilities, inversions of the density profiles and a very strong water mass transformation were observed. A wide range of dissipation values were obtained (between [10-10, 10-4] W kg-1) with spots of higher dissipation in the ocean interior correlated with a strong internal tide signal. Both the fine-scale and micro-scale methods allow us to identify very strong energy dissipation levels above the straits, ranging between [10-7, 10-4] W kg-1, in contrast to lower values at stations further away from the generation sites. The dissipation for the station located in the center of the Halmahera Sea ([10-9, 10-8] W kg-1) is stronger than for the Banda station ([10-11, 10-10] W kg-1), which is even further away from the generation sites. The three approaches agree relatively well and provide vertical eddy diffusivities values ranging between 5×10-4 and 5×10-1 m2 s-1, except in the Banda Sea where values are similar to the ones found in the open ocean (10-6 m2 s-1). CTD and XCTD profilers (deployed between stations) give estimates of dissipation all along the transit. It is found that enhanced mixing occurs preferentially above rough topography, such as in the Ombai Strait, the Halmahera Sea's northern

  11. The Functional Role of PI3K in Maintenance of Blood Pressure and Baroreflex Suppression in (mRen2)27 and mRen2.Lewis Rat

    Logan, Exazevia M; Aileru, Azeez A; Shaltout, Hossam A.; Averill, David B.; Diz, Debra I.

    2011-01-01

    The phosphatidylinositol 3-kinase (PI3K)-dependent signaling pathway in brain of spontaneously hypertensive rats (SHR), but not Wister-Kyoto (WKY) rats, contributes to elevated mean arterial pressure (MAP). The role of PI3K in regulation of blood pressure or autonomic function in the nucleus solitary tract (NTS) is yet to be established in other AngII-dependent models of hypertension. Thus, we microinjected PI3K inhibitors, wortmannin or LY294002, into the NTS, and measured MAP, baroreflex se...

  12. Thermosalinograph data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 Miles North of Oahu, Hawaii for Cruises HOT219-227 during 2010 (NODC Accession 0087988)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  13. Niskin Bottle Data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 Miles North of Oahu, Hawaii for Cruises HOT218-227 during 2010 (NODC Accession 0087596)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  14. Negociações Multilaterais do Comércio de Serviços, Intervenção Estatal Brasileira e Defesa dos Interesses Nacionais - 10.5102/uri.v4i2.227

    Fátima Faro

    2007-10-01

    Full Text Available The purpose of this article is to discuss the evolution of the multilateral negotiations focused on trade of services, as well as the Brazilian governmental politics to emphasize the development of this economic activity, and to support our participation within the bilateral and multilateral rounds of negotiation, from an individual country perspective, according to the national point of view.

  15. A Comparative Study of Clam and Squid. Biting Flies of the Coastal Region. Diatoms: Nature's Aquatic Gems. Learning Experiences for Coastal and Oceanic Awareness Studies, Nos. 227, 231, 232. [Project COAST].

    Delaware Univ., Newark. Coll. of Education.

    Included are three units related to coastal and oceanic awareness. The units are: (1) A Comparative Study of Clam and Squid; (2) Biting Flies of the Coastal Region; and (3) Diatoms: Nature's Aquatic Gems. All three units were designed for secondary school students. Each unit contains teacher background materials, student activity materials,…

  16. Multibeam collection for TN227: Multibeam data collected aboard Thomas G. Thompson from 2008-11-13 to 2008-11-28, departing from Apia, Western Samoa and returning to Apia, Western Samoa

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  17. CTD Data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 Miles North of Oahu, Hawaii for Cruises HOT218-227 during 2010) (NCEI Accession 0087584)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  18. Water Column Chemical Data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 Miles North of Oahu, Hawaii for Cruises HOT199-227 during 2008-2010 (NCEI Accession 0088839)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  19. Sorption studies of radioelements on geological materials

    Batch sorption experiments have been carried out to study the sorption of uranium, technetium, curium, neptunium, actinium, protactinium, polonium, americium and plutonium onto bentonite, granodiorite and tuff. Mathematical modelling using the HARPHRQ program and the HATCHES database was carried out to predict the speciation of uranium and technetium in the equilibrated seawater, and neptunium, americium and plutonium in the rock equilibrated water. Review of the literature for thermodynamic data for curium, actinium, protactinium and polonium was carried out. Where sufficient data were available, predictions of the speciation and solubility were made. This report is a summary report of the experimental work conducted by AEA Technology during April 1991-March 1998, and the main results have been presented at Material Research Society Symposium Proceedings and published as proceedings of them. (author)

  20. Investigation for determining the retention properties of rock over the ASSE II mine for dissolved radionuclides

    For a model consideration of groundwater movement and the associated transport of dissolved substance in deep groundwater, the retention properties of the ASSE II mine for radionuclides dissolved in water were determined. A series of properties of rocks were examined and described for this purpose. Apart from the chemical, mineralogical and petrophysical characteristics of the rocks, the retention was determined by 3 different methods and stated in the form of distribution coefficients for specific elements. A comparison of the results of vibration and diffusion experiments gave good agreement, while the results in through column experiments only reached the same order of magnitude after an expensive determination with the aid of a place concentration distribution. The distribution coefficients for the elements carbon, selenium, strontium, technetium, iodine, caesium, lead, radium, actinium, proto-actinium, uranium, neptunium, plutonium, americium and curium are listed and collected for model rock packages. (orig./HP)

  1. Sorption studies of radioelements on geological materials

    Berry, J. A; 油井 三和; 北村 暁

    2007-01-01

    Batch sorption experiments have been carried out to study the sorption of uranium, technetium, curium, neptunium, actinium, protactinium, polonium, americium and plutonium onto bentonite, granodiorite and tuff. Mathematical modelling using the HARPHRQ program and the HATCHES database was carried out to predict the speciation of uranium and technetium in the equilibrated seawater, and neptunium, americium and plutonium in the rock equilibrated water. Review of the literature for thermodynamic ...

  2. Purification of cerium, neodymium and gadolinium for low background experiments

    Boiko R.S.; Barabash A.S.; Belli P.; Bernabei R.; Cappella F.; Cerulli R.; Danevich F.A.; Incicchitti A.; Laubenstein M.; Mokina V.M.; Nisi S.; Poda D.V.; Polischuk O.G.; Tretyak V.I.

    2014-01-01

    Cerium, neodymium and gadolinium contain double beta active isotopes. The most interesting are 150Nd and 160Gd (promising for 0ν2β search), 136Ce (2β+ candidate with one of the highest Q2β). The main problem of compounds containing lanthanide elements is their high radioactive contamination by uranium, radium, actinium and thorium. The new generation 2β experiments require development of methods for a deep purification of lanthanides from the radioactive elements. A combination of physical an...

  3. The discoveries of uranium 237 and symmetric fission — From the archival papers of Nishina and Kimura

    IKEDA, Nagao

    2011-01-01

    Shortly before the Second World War time, Nishina reported on a series of prominent nuclear physical and radiochemical studies in collaboration with Kimura. They artificially produced 231Th, a member of the natural actinium series of nuclides, by bombarding thorium with fast neutrons. This resulted in the discovery of 237U, a new isotope of uranium, by bombarding uranium with fast neutrons, and confirmed that 237U disintegrates into element 93 with a mass number of 237. They also identified t...

  4. History of the unraveling of the natural decay series

    Milestones in the subject of radioactivity, which were important to the unraveling of natural decay series, have been identified and described. The interplay between all these issues is very complex, and some aspects of the development of the uranium series is discussed as an example, the thorium and actinium series evolved in a similar way from research by many of the same people. All three series as understood in 1913 are compared with their present-day representation. (orig.)

  5. History of the unraveling of the natural decay series

    Milestones in the subject of radioactivity, which were important to the unraveling of natural decay series, have been identified and described. The interplay between all these issues is very complex, and some aspects of the development of the uranium series is discussed as an example, the thorium and actinium series evolved in a similar way from research by many of the same people. All three series as understood in 1913 are compared with their present-day representation. (author)

  6. System for recovery of daughter isotopes from a source material

    Tranter, Troy J [Idaho Falls, ID; Todd, Terry A [Aberdeen, ID; Lewis, Leroy C [Idaho Falls, ID; Henscheid, Joseph P [Idaho Falls, ID

    2009-08-04

    A method of separating isotopes from a mixture containing at least two isotopes in a solution is disclosed. A first isotope is precipitated and is collected from the solution. A daughter isotope is generated and collected from the first isotope. The invention includes a method of producing an actinium-225/bismuth-213 product from a material containing thorium-229 and thorium-232. A solution is formed containing nitric acid and the material containing thorium-229 and thorium-232, and iodate is added to form a thorium iodate precipitate. A supernatant is separated from the thorium iodate precipitate and a second volume of nitric acid is added to the thorium iodate precipitate. The thorium iodate precipitate is stored and a decay product comprising actinium-225 and bismuth-213 is generated in the second volume of nitric acid, which is then separated from the thorium iodate precipitate, filtered, and treated using at least one chromatographic procedure. A system for producing an actinium-225/bismuth-213 product is also disclosed.

  7. Behaviour of uranium series radionuclides in surface water (Crouzille, Limousin). Geochemical implications

    Understanding natural radionuclides behaviour in surface water is a required step to achieve uranium mine rehabilitation and preserve water quality. The first objective of this thesis is to determine which are the radionuclides sources in a drinking water reservoir. The second objective is to improve the knowledge about the behaviour of uranium series radionuclides, especially actinium. The investigated site is a brook (Sagnes, Limousin, France) which floods a peat bog contaminated by a former uranium mine and which empties into the Crouzille lake. It allows studying radionuclides transport in surface water and radionuclides retention through organic substance or water reservoir. Radionuclides distribution in particulate, colloidal and dissolved phases is determined thanks to ultra-filtrations. Gamma spectrometry allows measuring almost all natural radionuclides with only two counting stages. However, low activities of 235U series radionuclides impose the use of very low background well-type Ge detectors, such as those of the Underground Laboratory of Modane (France). Firstly, this study shows that no or few radionuclides are released by the Sagnes peat bog, although its radioactivity is important. Secondly, it provides details on the behaviour of uranium series radionuclides in surface water. More specifically, it provides the first indications of actinium solubility in surface water. Actinium's behaviour is very close to uranium's even if it is a little less soluble. (author)

  8. DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS

    P. Bernot

    2005-07-13

    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this activity is to predict dissolved concentrations or solubility limits for elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) relevant to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are provided in the form of tabulated functions with pH and log fCO{sub 2} as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. Even though selection of an appropriate set of radionuclides documented in Radionuclide Screening (BSC 2002 [DIRS 160059]) includes actinium, transport of Ac is not modeled in the total system performance assessment for the license application (TSPA-LA) model because of its extremely short half-life. Actinium dose is calculated in the TSPA-LA by assuming secular equilibrium with {sup 231}Pa (Section 6.10); therefore, Ac is not analyzed in this report. The output data from this report are fundamental inputs for TSPA-LA used to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for the actinides discussed in this report. These models cover broad ranges of environmental conditions so they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or

  9. DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS

    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this activity is to predict dissolved concentrations or solubility limits for elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) relevant to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are provided in the form of tabulated functions with pH and log fCO2 as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. Even though selection of an appropriate set of radionuclides documented in Radionuclide Screening (BSC 2002 [DIRS 160059]) includes actinium, transport of Ac is not modeled in the total system performance assessment for the license application (TSPA-LA) model because of its extremely short half-life. Actinium dose is calculated in the TSPA-LA by assuming secular equilibrium with 231Pa (Section 6.10); therefore, Ac is not analyzed in this report. The output data from this report are fundamental inputs for TSPA-LA used to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for the actinides discussed in this report. These models cover broad ranges of environmental conditions so they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or otherwise

  10. Detection of rare earth elements in Powder River Basin sub-bituminous coal ash using laser-induced breakdown spectroscopy (LIBS)

    Tran, Phuoc [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State; Mcintyre, Dustin [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State

    2015-10-01

    We reported our preliminary results on the use of laser-induced breakdown spectroscopy to analyze the rare earth elements contained in ash samples from Powder River Basin sub-bituminous coal (PRB-coal). We have identified many elements in the lanthanide series (cerium, europium, holmium, lanthanum, lutetium, praseodymium, promethium, samarium, terbium, ytterbium) and some elements in the actinide series (actinium, thorium, uranium, plutonium, berkelium, californium) in the ash samples. In addition, various metals were also seen to present in the ash samples

  11. The identification of soil radionuclides in the area of Puspiptek and surrounding

    The area of PUSPIPTEK and the surrounding are potentially exposed by radionuclides, because the operation of the nuclear research plant. The PPTN Serpong was operated long than 10 years, therefore soil radioactivity need to evaluate. The determination of radioactivity in the soil samples which be taken from research location using gamma spectrometry on June-August. The result of the research identified natural radionuclides K-40; Thorium decay series Ac-228, Bi-212, Pb-212, Tl-208, Ra-224 and Rn-220; Uranium decay series Bi-214, Pa-234, Pb-214 and Actinium decay series Bi-211, Po-211. There are no identification radionuclides produce from the activation of PPTN Serpong

  12. Communication Breakdown: Librarian and Student Approaches to Virtual Reference Differ. A review of: Walter, Virginia A. and Cindy Mediavilla. “Teens Are from Neptune, Librarians Are from Pluto: An Analysis of Online Reference Transactions.” Library Trends 54.2 (2005: 209-227.

    Stephanie Hall

    2006-09-01

    Full Text Available Objective – To evaluate the effectiveness of an online reference and referral service for students (primarily those in middle school and high school seeking homework help. Design – Analysis of 114 transcripts of reference transactions. Setting – A centralized homework reference and tutor referral service provided on behalf of the California State Library by the Metropolitan Cooperative Library System. Subjects – Virtual reference librarians at a large urban library system and middle and high school students in California. Methods – One hundred fourteen virtual reference transactions recorded between October 12 and November 8, 2003 were evaluated against the Reference and User Services Association’s (RUSA “Guidelines for Behavioral Performance of Reference and Information Service Providers.” Secondly, the transcripts were subjected to discourse analysis. Main results Performance of virtual reference librarians vis‐àvis RUSA guidelines In the majority of cases, there was some evidence that librarians communicated clearly (110 out of 114 transactions. In 78 cases, it appeared that a librarian was available quickly, and in 92 of the transactions a friendly greeting was given. What was striking, however, was that in a clear majority of cases, some of the classic reference interview strategies were not employed. In 100 or more cases each, the following strategies were not observed: repeating or paraphrasing the question; helping to interpret the question; verifying mutual understanding; asking if the question has been answered; asking if the student needs more information. Furthermore, in 75 cases librarians did not probe for further information to clarify the question, while in 87 cases they did not check that information had been clearly understood. Possibly related to these findings, the researchers felt that the transcripts revealed “a conviction that homework questions are not the proper content for reference transactions” (222. In addition, librarians were found to be frequently too quick to refer students to a tutor, when a query might have been better answered as a reference question. Findings of discourse analysis In general, the virtual reference librarians used impersonal, formal language to “reinforce the professional’s superior position vis‐à‐vis the help‐seeker” (217. There were repeated attempts by the students to interject a lighter or warmer tone (using humour, emoticons, informal language, introducing a personal note, etc.. These attempts were rarely reciprocated, with librarians continuing to use impersonal language, including stock messages such as: “we are experiencing a very busy time right now,” (217; or, “I am going to send you a page which will give you some help with your homework. After we disconnect this session, click on this link and follow the instructions to be connected with a tutor. Please do not click on any links on this page until after we have disconnected” (217. In several cases librarians were preoccupied with defining their roles—for example, specifying that they could give reference help but not advice. In all, the distancing mechanisms used by librarians, combined with occasional inaccurate referrals and technical problems with the software, were seen to create an enormous potential forfrustration on the part of the student. Conclusions – The most important implication of the study was that librarians and students were worlds (or planets apart in their approach to the reference interaction. While “teens attempted to create meaningby recreating the chat discourse environment in which they were most at home”, librarians “tried to create meaning in a parallel discourse environment that duplicated as much as possible the standard impersonal protocols of a face‐to‐face reference counter” (223. One suggested way to alleviate the disconnect between librarians and students was to involve students in the planning of the services. For now, however, the authors conclude that “teens are from Neptune, librarians are from Pluto. Better services would result if they could meet somewhere closer together” (224.

  13. Digestible lysine requirement of Nile tilapia from 86 to 227 g fed arginine to lysine balanced dietsExigência de lisina digestível para a tilápia-do-Nilo de 87 a 226 g alimentada com dietas balanceadas para a relação arginina: lisina

    Tadeu Orlandi Xavier

    2013-09-01

    Full Text Available This study was conducted out to determine the dietary digestible lysine requirements of Nile tilapia from 87 to 226 g. Fish (n = 170; average initial weight = 86.62 ± 4.89 g were distributed 15 1000-L cages, in a completely randomized design with five treatments and three replicates, and fed extruded diets containing 0.88; 1.12; 1.36; 1.59 and 1.83% of digestible lysine, balanced to keep the arginine to lysine ratio as 1.43:1. There was no effect of the dietary lysine levels on whole body moisture and ash. By Linear Response Plateau analysis of lysine levels on daily gain, feed conversion, protein efficiency ratio and rate of protein deposition was estimated requirement of 1.31, 1.03, 1.16 and 1.31 % of lysine, respectively. A quadratic effect of lysine levels on whole body fat deposition ratio and whole body ether extract composition were observed, and the lowest values were estimated with 1.16% and 1.43% of dietary lysine, respectively. An increase of the dietary lysine levels resulted in linear increase on the fillet yield. The digestible lysine requirements of Nile tilapia (87 to 226 g is 1.31%, in diets balanced for arginine to lysine ratio.Este estudo foi realizado com o objetivo de determinar a exigência de lisina digestível em dietas para alevinos de tilápia-do-Nilo de 87 a 226 g. Os peixes (n=300; peso inicial médio = 86,62 ± 4,89 g foram distribuídos em 15 tanques-rede de 1000 L cada, em delineamento inteiramente casualizado com cinco tratamentos e três repetições e alimentados com dietas extrusadas contendo 0,88; 1,12; 1,36; 1,59 e 1,83% de lisina digestível, balanceadas para relação arginina:lisina em 1,43:1. Não foi observado efeito dos níveis de lisina na dieta sobre os teores de umidade e proteína corporal. Pela análise Linear Response Plateau dos níveis de lisina sobre o ganho de peso diário, conversão alimentar, taxa de eficiência proteica e taxa de deposição de proteína, estimou-se exigência de 1,31; 1,03; 1,16 e 1,31% de lisina digestível, respectivamente. Foi observado efeito quadrático dos níveis de lisina sobre a taxa de deposição de gordura e teor de extrato etéreo corporal, em que os menores valores dessas variáveis foram estimados com 1,16% e 1,43% de lisina, respectivamente. Com o incremento nos teores de lisina na dieta ocorreu aumento linear no rendimento de filé e nível de proteína corporal. Concluiu-se que a tilápia-do-Nilo (87 a 226 g exige 1,31% de lisina digestível, em dietas balanceadas para a relação arginina:lisina.

  14. Public Libraries in Norway Help Non-Western Immigrant Women to Integrate into Society. A Review of: Audunson, R., Essmat, S., & Aabø, S. (2011. Public libraries: A meeting place for immigrant women? Library & Information Science Research, 33(3, 220-227. doi: 10.1016/j.lisr.2011.01.003

    Kathryn Oxborrow

    2012-03-01

    Full Text Available Objectives – To discover the ways in which the public library was used by immigrant women, with a particular focus on the library as a meeting place.Design – Semi-structured qualitative interviews conducted in the participants’ native languages.Setting – Public libraries in Norway. Participants lived in one of two cities both with a population of approximately 40,000 and a somewhat lower number of immigrants than the national average.Subjects – Nine non-western women who had immigrated to Norway between 8 months and 17 years prior to the study. Three women were from Iran, Kurdistan and Afghanistan respectively. All identified themselves as public library users.Methods – Participants were interviewed in their native languages and the qualitative results were analyzed in accordance with the theoretical framework set out by the authors. The main areas of focus were the role of the library in the generation of social capital, and the library as a high intensive versus low intensive meeting place.Main Results – Participants used public libraries in various ways. In the initial stages of life in a new country they were used to observe and learn about the majority culture and language. They were also used as a safe place to openly grieve and provide comfort among close friends without fear of being seen by other fellow countrymen. Over time, participants came to use the library space in more traditional ways such as for information, social, and professional needs. The study also revealed that using public libraries built trust in the institution of libraries and librarians as employees.Conclusions – The public library plays a key role in the generation of social capital, both in terms of integrating into the majority culture through observation and spontaneous interactions (bridging social capital and connecting with others from participants’ home cultures (bonding social capital for example through the provision of social space and other links to home such as native language materials. The public library was used initially by participants as a high intensive meeting place, for meeting with friends and consoling one another. In time, however, the public library became a medium- to low-intensive meeting place, with participants engaging in library programmes or in spontaneous interactions with other library customers. Moreover, the study refutes the Swedish Library Association’s conclusion that library is used more often by immigrants that have lived in the country for long periods of time.

  15. Primary production and sediment trap flux measurements and calculations by the Hawaii Ocean Time-series (HOT) program at Station ALOHA in the North Pacific 100 miles north of Oahu, Hawaii for Cruises HOT1-227 during 1988-2010 (NODC Accession 0089168)

    National Oceanic and Atmospheric Administration, Department of Commerce — The Hawaii Ocean Time-series (HOT) program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii....

  16. ‘A dialogue about the art of portraiture’ Originally published as ‘Gespräch von der Bildniskunst’, Österreichische Rundschau, Volume 6, 1906, 502—516, and republished: Julius Schlosser, Präludien Vorträge und Aufsätze, Berlin: Bard 1927, 227—247. Translated with an introduction by Karl Johns

    Julius Schlosser

    2011-12-01

    Full Text Available In an unusually popular and readable dialogue form, Schlosser alludes to the classical education he takes for granted in any reader approaching his favourite ‘thorny’ questions from aesthetics and history. These involve the problems of naturalism, impressionism, portrait likeness, psychology of perception and numerous others being bandied around academic circles at the turn of the century. It is of further interest in directly referring critically to his recently deceased friend (Alois Riegl, and being written just at a moment in his career when Schlosser had been casting around the ideas of Ernst Brücke, Konrad Lange, even Henri Bergson, but had discovered the recent contribution of Benedetto Croce, which would colour his approach with an increasing intensity for the remainder of his life. He became what might be seen as the archetypical art historical theorist, but continues to distinguish himself from his successors by his greater consistency.

  17. ‘A dialogue about the art of portraiture’ Originally published as ‘Gespräch von der Bildniskunst’, Österreichische Rundschau, Volume 6, 1906, 502—516, and republished: Julius Schlosser, Präludien Vorträge und Aufsätze, Berlin: Bard 1927, 227—247. Translated with an introduction by Karl Johns

    Julius Schlosser

    2011-01-01

    In an unusually popular and readable dialogue form, Schlosser alludes to the classical education he takes for granted in any reader approaching his favourite ‘thorny’ questions from aesthetics and history. These involve the problems of naturalism, impressionism, portrait likeness, psychology of perception and numerous others being bandied around academic circles at the turn of the century. It is of further interest in directly referring critically to his recently deceased friend (Alois Riegl)...

  18. An aerial radiological survey of the Sandia National Laboratories and surrounding area

    A team from the Remote Sensing Laboratory conducted an aerial radiological survey of the area surrounding the Sandia National Laboratories and Kirtland Air Force Base in Albuquerque, New Mexico, during March and April 1993. The survey team measured the terrestrial gamma radiation at the site to determine the levels of natural and man-made radiation. This survey includes the areas covered by a previous survey in 1981. The results of the aerial survey show a background exposure rate which varies between 5 and 18 μR/h plus an approximate 6 μR/h contribution from cosmic rays. The major radioactive isotopes found in this survey were: potassium-40, thallium-208, bismuth-214, and actinium-228, which are all naturally-occurring isotopes, and cobalt-60, cesium-137, and excess amounts of thallium-208 and actinium-228, which are due to human actions in the survey area. In regions away from man-made activity, the exposure rates inferred from this survey's gamma ray measurements agree almost exactly with the exposure rates inferred from the 1981 survey. In addition to the aerial measurements, another survey team conducted in situ and soil sample radiation measurements at three sites within the survey perimeter. These ground-based measurements agree with the aerial measurements within ± 5%

  19. Mixed valency of the RE and Ac ions in solid states

    Full text: This review is devoted to consideration of the methods and results of the theoretical and experimental investigations of the electronic state of the rare earths and actinium ions in the separate compound. The methods of the high resolution X ray spectroscopy were used for our consideration. Energy of the X ray lines of the rare earths and actinium ions in free state and solid states was study carefully. Valency shifts of X Ray lines under change of electronic state of nf - ions in different oxide, fluoride and chloride compounds were determined for K -, L- and M - lines for these ions with accuracy near 10 -100 MeV. We studied the electronic state of nf- ions which is changed from '+2' to '+4' and determined the concentration of ions in different electronic state. Relative error for theoretical energy of the most lines for HFP - approach in comparison with experiment is less than 0.5%, and deviation for concentration is less than 5%

  20. A study of uranium and thorium migration at the Koongarra uranium deposit with application to actinide transport from nuclear waste repositories

    One way to gain confidence in modelling possible radionuclide releases is to study natural systems which are similar to components of the multibarrier waste repository. Several such analogues are currently under study and these provide useful data about radionuclide behaviour in the natural environment. One such system is the Koongarra uranium deposit in the Northern Territory. In this dissertation, the migration of actinides, primarily uranium and thorium, has been studied as an analogue for the behaviour of transuranics in the far-field of a waste repository. The major findings of this study are: 1. the main process retarding uranium migration in the dispersion fan at Koongarra is sorption, which suppresses dissolved uranium concentrations well below solubility limits, with ferrihydrite being a major sorbing phase; 2. thorium is extremely immobile, with very low dissolved concentrations and corresponding high distribution ratios for 230Th. Overall, it is estimated that colloids are relatively unimportant in Koongarra groundwater. Uranium migrates mostly as dissolved species, whereas thorium and actinium are mostly adsorbed to larger, relatively immobile particles and the stationary phase. However, of the small amount of 230Th that passes through a 1μm filter, a significant proportion is associated with colloidal particles. Actinium appears to be slightly more mobile than thorium and is associated with colloids to a greater extent, although generally present in low concentrations. These results support the possibility of colloidal transport of trivalent and tetravalent actinides in the vicinity of a nuclear waste repository. 112 refs., 23 tabs., 32 figs

  1. Purification of cerium, neodymium and gadolinium for low background experiments

    Boiko R.S.

    2014-01-01

    Full Text Available Cerium, neodymium and gadolinium contain double beta active isotopes. The most interesting are 150Nd and 160Gd (promising for 0ν2β search, 136Ce (2β+ candidate with one of the highest Q2β. The main problem of compounds containing lanthanide elements is their high radioactive contamination by uranium, radium, actinium and thorium. The new generation 2β experiments require development of methods for a deep purification of lanthanides from the radioactive elements. A combination of physical and chemical methods was applied to purify cerium, neodymium and gadolinium. Liquid-liquid extraction technique was used to remove traces of Th and U from neodymium, gadolinium and for purification of cerium from Th, U, Ra and K. Co-precipitation and recrystallization methods were utilized for further reduction of the impurities. The radioactive contamination of the samples before and after the purification was tested by using ultra-low-background HPGe gamma spectrometry. As a result of the purification procedure the radioactive contamination of gadolinium oxide (a similar purification efficiency was reached also with cerium and neodymium oxides was decreased from 0.12 Bq/kg to 0.007 Bq/kg in 228Th, from 0.04 Bq/kg to <0.006 Bq/kg in 226Ra, and from 0.9 Bq/kg to 0.04 Bq/kg in 40K. The purification methods are much less efficient for chemically very similar radioactive elements like actinium, lanthanum and lutetium.

  2. The Technological Enhancement of Normally Occurring Radioactive Materials in Red Mud due to the Production of Alumina

    Maurice O. Miller

    2016-01-01

    Full Text Available This study investigates the level of technological enhancement of normally occurring radioactive materials (TENORM in the red mud waste due to the production of alumina in Jamaica. Technological enhancements factors (TEF were determined for the uranium, thorium, actinium series, their progenies, and the nonseries potassium-40 using gamma spectrometry. The study concluded that bauxite production technologically enhances the uranium progenies Th-234, Pb-214, Bi-214, and Pa-234 and the thorium-232 progenies Ac-228, Pb-212, and Bi-212 in red mud. The actinium series was technologically enhanced, but K-40 and the thorium daughter, Tl-208, were reduced. The spectrometric comparison of Tl-208 (at 510 keV was unexpected since its other photopeaks at 583 keV, 934 keV, and 968 keV were markedly different. An explanation for this anomaly is discussed. An explanation regarding the process of accumulation and fractionation of organically derived phosphate deposits and potassium-feldspar is offered to explain the spectrometric differences between the alumina product and its waste material, red mud.

  3. Low background counting of 222Rn, 220Rn and 219Rn with electrostatic counters

    Mong, Brian; EXO-200 Collaboration; nEXO Collaboration

    2014-09-01

    The radon counting technique based on electrostatic precipitation of progenies in gas followed by alpha spectroscopy has been applied to support the material selection programs of low background, neutrino and dark matter experiments with emphasis on EXO. An array of 8 counters operated by Laurentian University at SNOLAB and the Waste Isolation Pilot Plant have reached the sensitivity of 10 atoms/day in the uranium, thorium and actinium chains. Hardware improvements are underway to further increase the capacity and sensitivity in support of nEXO. The radon counting technique based on electrostatic precipitation of progenies in gas followed by alpha spectroscopy has been applied to support the material selection programs of low background, neutrino and dark matter experiments with emphasis on EXO. An array of 8 counters operated by Laurentian University at SNOLAB and the Waste Isolation Pilot Plant have reached the sensitivity of 10 atoms/day in the uranium, thorium and actinium chains. Hardware improvements are underway to further increase the capacity and sensitivity in support of nEXO. Supported by NSERC Project Grants ``Search for Double Beta Decay with EXO.''

  4. Purification of cerium, neodymium and gadolinium for low background experiments

    Boiko, R. S.; Barabash, A. S.; Belli, P.; Bernabei, R.; Cappella, F.; Cerulli, R.; Danevich, F. A.; Incicchitti, A.; Laubenstein, M.; Mokina, V. M.; Nisi, S.; Poda, D. V.; Polischuk, O. G.; Tretyak, V. I.

    2014-01-01

    Cerium, neodymium and gadolinium contain double beta active isotopes. The most interesting are 150Nd and 160Gd (promising for 0ν2β search), 136Ce (2β+ candidate with one of the highest Q2β). The main problem of compounds containing lanthanide elements is their high radioactive contamination by uranium, radium, actinium and thorium. The new generation 2β experiments require development of methods for a deep purification of lanthanides from the radioactive elements. A combination of physical and chemical methods was applied to purify cerium, neodymium and gadolinium. Liquid-liquid extraction technique was used to remove traces of Th and U from neodymium, gadolinium and for purification of cerium from Th, U, Ra and K. Co-precipitation and recrystallization methods were utilized for further reduction of the impurities. The radioactive contamination of the samples before and after the purification was tested by using ultra-low-background HPGe gamma spectrometry. As a result of the purification procedure the radioactive contamination of gadolinium oxide (a similar purification efficiency was reached also with cerium and neodymium oxides) was decreased from 0.12 Bq/kg to 0.007 Bq/kg in 228Th, from 0.04 Bq/kg to <0.006 Bq/kg in 226Ra, and from 0.9 Bq/kg to 0.04 Bq/kg in 40K. The purification methods are much less efficient for chemically very similar radioactive elements like actinium, lanthanum and lutetium.

  5. Back to the St. Petersburg paradox?

    Blavatskyy, Pavlo R.

    -, č. 227 (2004), s. 1-5. ISSN 1211-3298 Institutional research plan: CEZ:AV0Z7085904 Keywords : cumulative prospect theory * St. Petersburg paradox * power utility Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp227.pdf

  6. Overexpression of gamma-tubulin in non small cell lung cancer

    Maounis, N.; Mahera, E.; Dráberová, Eduarda; Chorti, M.; Riga, D.; Trakas, N.; Demonakou, M.; Emmanouilidou, A.; Dráber, Pavel; Katsetos, C.D.

    2010-01-01

    Roč. 57, č. 1 (2010), s. 227-227. ISSN 0309-0167. [International Congress of the International Academy of Pathology /28./. 10.10.10.-15.10.10, San Paolo] Institutional research plan: CEZ:AV0Z50520514 Subject RIV: EB - Genetics ; Molecular Biology

  7. 40 CFR 228.15 - Dumping sites designated on a final basis.

    2010-07-01

    ... Ocean Dumping Regulations in 40 CFR part 227. (9) Jacksonville, FL Dredged Material Site. (i) Location... practicable alternatives (as defined in 40 CFR 227.16(b)) to open-water disposal in Long Island Sound and that...) Restrictions: See 40 CFR 228.15(b)(4)(vi). (c) Region I Final Other Wastes Sites. (1) No final sites. (2)...

  8. AcEST: BP919927 [AcEST

    Full Text Available tr|B7S227|B7S227_9GAMM Molybdate ABC transporter, periplasmic mo... 33 7.2 >tr|A9... OS=Trichomonas vagina... 33 5.5 tr|B4JN38|B4JN38_DROGR GH24212 OS=Drosophila grimshawi GN=GH2421... 33 7.2

  9. bu ke kao xu shu zhe zhi zai shen shi (不可靠叙述者之再审视)

    Hansen, Per Krogh

    2008-01-01

    Kinesisk oversættelse af "Reconsidering the Unreliable Narrator" in Semiotica 165 - 1/4 2007: 227-246. Oversætter: Shang Biwu.......Kinesisk oversættelse af "Reconsidering the Unreliable Narrator" in Semiotica 165 - 1/4 2007: 227-246. Oversætter: Shang Biwu....

  10. 50 CFR 17.42 - Special rules-reptiles.

    2010-10-01

    ... 50 CFR 227.72(e). (vi) The prohibition against taking within the United States or the territorial sea of the United States shall not apply to subsistence taking, as specified in 50 CFR 227.72(f). (2... population (see also 50 CFR part 23). (3) Take. Incidental take, that is, take that results from, but is...

  11. Značení steroidního skeletu isotopy vodíku

    Marek, Aleš; Patil, Mahadeo Rajshekhar; Elbert, Tomáš

    2011-01-01

    Roč. 7, č. 13 (2011), s. 227-227. ISSN 1336-7242. [Zjazd Chemikov /63./. 05.09.2011-09.09.2011, Vysoké Tatry ] R&D Projects: GA AV ČR IAA400550801 Institutional research plan: CEZ:AV0Z40550506 Keywords : brassinosteroids * double bond * vicinal diol Subject RIV: CC - Organic Chemistry

  12. 48 CFR 212.7003 - Technical data and computer software.

    2010-10-01

    ... computer software. 212.7003 Section 212.7003 Federal Acquisition Regulations System DEFENSE ACQUISITION... data and computer software. For purposes of establishing delivery requirements and license rights for technical data under 227.7102 and for computer software under 227.7202, there shall be a...

  13. 21 CFR 520.1872 - Praziquantel, pyrantel pamoate, and febantel tablets.

    2010-04-01

    ... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Praziquantel, pyrantel pamoate, and febantel... § 520.1872 Praziquantel, pyrantel pamoate, and febantel tablets. (a) Specifications. Each tablet or chewable tablet contains either: (1) Tablet No. 1: 22.7 milligrams praziquantel, 22.7 milligrams...

  14. Dicty_cDB: [Dicty_cDB

    Full Text Available VF (Link to library) VFC227 (Link to dictyBase) - - - Contig-U16444-1 VFC227Z (Link... to Original site) - - VFC227Z 622 - - - - Show VFC227 Library VF (Link to library) Clone ID VFC227 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16444-1 Original site URL http://dict...y vs DNA Score E Sequences producing significant alignments: (bits) Value N AC116978 |AC116978.1 Dictyosteli...um discoideum chromosome 2 map 4846697-4874480 strain AX4, *** SEQUENCING IN PROGRESS ***. 876 0.0 5 AC117076 |AC117076.2 Dict

  15. Monte Carlo Simulations of Necrotic Cell Targeted Alpha Therapy

    Full text: Hypoxic tumour cells are radioresistant and are significant contributors to the locoregional recurrences and distant metastases that mark treatment failure. Due to restricted circulatory supply, hypoxic tumor cells frequently become necrotic and thus necrotic areas often lie near hypoxic tumour areas. In this study we investigate the feasibility of binding an alpha-emitting conjugate to necrotic cells located in the proximity of hypoxic, viable tumour cells. Monte Carlo radiation transport simulations were performed to investigate the dose distribution resulting from the thorium 227 (Th227) decay chain in a representative tumour geometry. The Geant4 software toolkit was used to simulate the decay and interactions of the Th227 decay chain. The distribution of Th227 was based on a study by Thomlinson and Gray of human lung cancer histological samples (Thomlinson RH, Gray LH. Br J Cancer 1955; 9:539). The normalized dose distribution obtained with Geant4 from a cylindrical Th227 source in water is illustrated in Fig. I. The relative contribution of the different decay channels is displayed, together with a profile through the centre of the accumulated dose map. The results support the hypothesis that significant α-particle doses will be deposited in the hypoxic tumor tissue immediately surrounding the necrotic core (where the majority of Th227 will be located). As an internal a-particle generator, the Th227-radioimmunoconjugate shows potential as an efficient hypoxic tumour sterilizer.

  16. Dicty_cDB: CHG421 [Dicty_cDB

    Full Text Available e testis cDN... 227 6e-58 AK145000_1( AK145000 |pid:none) Mus musculus mamma...cw*t fslqsfeislini*risissylpwpqitsii*sivkinslrnqkqsvlklyyslmmalql vwlis*ny*ikikisilfigsivfn*nvklikrecwlkqmqk...rr*ctn*sw*iitiyd*fisick*mlfin--- ---*iictfpelvtelerdirqlgvsetgltfldhfrllithignamgyirlvrsgglhy csnaikfvpdlkkipkfqdltskdals...46157 |BU746157.1 CH3#002_C07T7 Canine heart normalized cDNA Library in pBluescript Canis fam... 227 6e-58 (Q3UMB9) RecName: Full=UPF0681 protein KIAA1033; 227 6e-58 AK161247_1( AK161247 |pid:none) Mus musculus adult mal

  17. AcEST: BP915100 [AcEST

    Full Text Available t : Swiss-Prot sp_hit_id O61308 Definition sp|O61308|PUMA_PARUN 227 kDa spindle- and centromere-associated p....done Score E Sequences producing significant alignments: (bits) Value sp|O61308|PUMA_PARUN 227 kDa spindle-...Paramyosin OS=Brugia malayi PE=2 SV=2 37 0.083 >sp|O61308|PUMA_PARUN 227 kDa spin...dle- and centromere-associated protein OS=Parascaris univalens GN=PUMA1 PE=2 SV=1 Length = 1955 Score = 44.7

  18. Purification system of gram-amount neptunium using anion exchange chromatography

    To develop a purification system of gram-amount neptunium using anion exchange chromatography, adsorption elution of excess amount of actinium in 6M HNO3 aqueous solution was studied using thorium and uranium tracer. The partition coefficient (Kd) of Th (IV) decreased from Kd=99.1 of tracer to Kd=44.0, 5% load. By decreasing the partition coefficient, we can wash until 30 Vs under the purification conditions of 1% load and 95% recovery. The retention volume of U (IV) was about 300 Vs, a large value. The partition coefficient of Np (IV) may be larger than it and the large amount of washable eluting solution may be obtained. Washing of impurity of 3d transition metal and actinide (VI) can be done until 20Vs. With washing of 150Vs, impurity of alkali earth metal, metals (III) and platinum group metals decreased less than 0.1%. (S.Y.)

  19. Radionuclide interactions with marine sediments

    A critical review of the literature on the subject of the interactions of radionuclides with marine sediments has been carried out. On the basis of the information available, an attempt has been made to give ranges and 'best estimates' for the distribution ratios between seawater and sediments. These estimates have been based on an understanding of the sediment seawater system and the porewater chemistry and mineralogy. Field measurements, laboratory measurements and estimates based on stable-element geochemical data are all taken into account. Laboratory measurements include distribution-ratio and diffusion-coefficient determinations. The elements reviewed are carbon, chlorine, calcium, nickel, selenium, strontium, zirconium, niobium, technetium, tin, iodine, caesium, lead, radium, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium and curium. (author)

  20. Formerly utilized MED/AEC sites Remedial Action Program. Radiological survey of the St. Louis Airport Storage Site, St. Louis, Missouri. Final report

    Results of two radiological surveys of the St. Louis-Lambert Airport property, formerly known as the Airport Storage Site, St. Louis, Missouri, are presented. Uranium- and radium-bearing waste materials were stored from the 1940's to the late 1960's in this area. The surveys included direct measurements of beta-gamma radiation; determination of uranium, actinium, and radium concentrations in soil samples and from bore holes; determination of radionuclide concentrations in groundwater and surface water; measurement of radon flux from the ground surface; and measurements of 222Rn in air near the site. Results indicate that some offsite drainage pathways are becoming contaminated, probably by runoff from the site; no migration of 222Rn from the site was observed

  1. JAEA thermodynamic database for performance assessment of geological disposal of high-level and TRU wastes. Refinement of thermodynamic data for trivalent actinoids and samarium

    Within the scope of the JAEA thermodynamic database project for performance assessment of geological disposal of high-level radioactive and TRU wastes, the refinement of the thermodynamic data for the inorganic compounds and complexes of trivalent actinoids (actinium(III), plutonium(III), americium(III) and curium(III)) and samarium(III) was carried out. Refinement of thermodynamic data for these elements was based on the thermodynamic database for americium published by the Nuclear Energy Agency in the Organisation for Economic Co-operation and Development (OECD/NEA). Based on the similarity of chemical properties among trivalent actinoids and samarium, complementary thermodynamic data for their species expected under the geological disposal conditions were selected to complete the thermodynamic data set for the performance assessment of geological disposal of radioactive wastes. (author)

  2. Theoretical Study on Properties of New Isotope 265Bh

    2006-01-01

    The properties of nuclei belonging to the newly observed α-decay chain starting from 265Bh have been studied. The axially deformed relativistic mean-field calculation with the force NL-Z2 has been performed in the blockedBCS approximation. Some ground state properties such as binding energies, deformations, spins, and parities, as well as Q-values of the α-decay for this decay chain have been calculated and compared with known experimental data. Good agreement is found. The single-particle spectrum of the nucleus 265 Bh is studied and some new magic numbers are found,while the magnitudes of the shell gaps in superheavy nuclei are much smaller than those of nuclei before the actinium region, and the Fermi surfaces are close to the continuum. Thus the superheavy nuclei are usually not stable. The The methods which give good agreement with the data are selected.

  3. Proposed training program for construction personnel involved in remedial action work at sites contaminated by naturally occurring radionuclides

    Many sites used during the early days of the US atomic energy program are contaminated with radionuclides of the primordial decay chains (uranium, thorium, and actinium series). This contamination consists of residues resulting from refining and processing uranium and thorium. Preparation of these sites for release to unrestricted private use will involve the assistance of construction workers, many of whom have limited knowledge of the hazards associated with radioactive materials. Therefore, there is a need to educate these workers in the fundamentals of radioactive material handling to minimize exposures and possible spread of contamination. This training should disseminate relevant information at an appropriate educational level and should instill a cautious, common-sense attitude toward the handling of radioactive materials. The training should emphasize basic information concerning environmental radiation within a context of relative risk. A multi-media format, including colorful visual aids, demonstration, and discussion, should be used to maximize motivation and retention. A detailed, proposed training program design is presented

  4. Physical Measurements and Clinical Findings of Persons with Radium Burdens

    Results of physical measurements and some clinical findings of persons with radium burdens are reported and discussed. Ten workers of the dial painting industry, two chemists, who have been working for between 10 and 20 yr in the radium- industry, one technician, who has been- working for over 20 yr with high-emanation radium preparations and one person with high radium intake of rather unknown history were measured in a whole-body counter for evaluation of the body burdens of radium-226 and radium-228+ actinium-228. In some cases the radon concentration of expired air was also measured. For four of the measured persons the radium-226 burden is of the order of the maximum permissible amount (MPA : 10-7 c) or more. In one case the burden amounts to more than three times the MPA, (3.4 x 10-7 c), in another case to more than 100 times the MPA (160 x 10-7 c). In one case the radium-228 + actinium-228 burden exceeds the MPA (6 x 10-8 c in bone). The measured radon concentrations in the expired air were used to calculate the excretion rate of radon. The average was 67%. Clinical findings with some of the measured persons are related to the measured body burdens. The patient with the high body burden of 160 x 10-7 c radium-226 shows heavy bone changes leading to spontaneous bone fractures. The blood picture shows a decrease in the number of erythrocytes and a low haemoglobin content but puncture of the sternum indicates normal haematopoiesis. It seems that the low number of erythrocytes is caused by chronic nephropathia, the reason for which might be an additional intake of uranium because.uranium was found in the urine by gamma spectroscopy. The results are discussed with respect to the MPA of radium-226 recommended by the International Commission on Radiological Protection. (author)

  5. Colonization of marine snow aggregates by invertebrate zooplankton : Abundance, scaling, and possible role

    Kiørboe, Thomas

    2000-01-01

    I compiled literature observations of abundances of invertebrate zooplankters associated with marine snow aggregates in the euphotic zone. Abundances, normalized with ambient concentrations of colonizers, scale with equivalent aggregate radius raised to power 2.27. Different taxonomic groups show...

  6. Carcinoma of the thyroid

    The natural history and the clinical findings in 227 patients with thyroid carcinoma are described and the etiology discussed. The need for uniform pathologic classification and staging is emphasized. (Auth.)

  7. 77 FR 64837 - Federal Aviation Administration

    2012-10-23

    ... Federal Aviation Administration Fourth Meeting: RTCA Special Committee 227, Standards of Navigation Performance AGENCY: Federal Aviation Administration (FAA), U.S. Department of Transportation (DOT). ACTION... 15, 2012. Kathy Hitt, Management Analyst, Business Operations Group, Federal Aviation...

  8. Partial Molar Volumes of Air-Component Gases in Several Liquid n-Alkanes and 1-Alkanols at 313.15 K

    Izák, Pavel; Cibulka, I.; Heintz, A.

    1995-01-01

    Roč. 109, č. 2 (1995), s. 227-234. ISSN 0378-3812 Keywords : data density * partial molar volume * gas-liquid mixture Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 1.024, year: 1995

  9. Get Tested for Colon Cancer: Here's How

    Full Text Available ... 800-227-2345 Home Learn About Cancer Stay Healthy Find Support & Treatment Explore Research Get Involved Find Local ACS Stay Healthy » Tools and Calculators » Videos » Get Tested for Colon ...

  10. EST Table: FS796464 [KAIKOcDNA[Archive

    Full Text Available ar to putative lysosomal glucocerebrosidase [Tribolium castaneum] 10/09/09 32 %/334 aa FBpp0237202|DvirGJ227...milar to putative lysosomal glucocerebrosidase [Tribolium castaneum] FS796494 ffbm ...

  11. InterProScan Result: FS913424 [KAIKOcDNA[Archive

    Full Text Available FS913424 FS913424_2_ORF2 176542EC4019F227 PANTHER PTHR11669 REPLICATION FACTOR C / ...03677)|Cellular Component: nucleus (GO:0005634)|Biological Process: DNA replication (GO:0006260) ...

  12. 78 FR 9731 - Gulf of Mexico, Outer Continental Shelf (OCS), Central Planning Area (CPA) Oil and Gas Lease Sale...

    2013-02-11

    ...: Notice of Availability (NOA) of a Record of Decision (ROD) for CPA Lease Sale 227 in the Gulf of Mexico... Statement (Multisale FEIS). Authority: This NOA is published pursuant to the regulations (40 CFR...

  13. Reversible formation of charge carrier traps in poly(phenylenevinylene) derivative due to the phototransformation of a photochromic additive

    Weiter, M.; Vala, M.; Salyk, O.; Zmeškal, O.; Nešpůrek, Stanislav; Sworakowski, J.

    2005-01-01

    Roč. 430, - (2005), s. 227-233. ISSN 1542-1406 Institutional research plan: CEZ:AV0Z40500505 Keywords : electrical properties * photoconductivity * photochromism Subject RIV: CF - Physical ; Theoretical Chemistry

  14. 78 FR 49370 - Inflation Adjustment of Maximum Forfeiture Penalties

    2013-08-14

    ... Job Creation Act of 2012, 72 FR 71131, 71134 (November 29, 2012). Accordingly, the only penalties... Records & 9,600/day. Accounts. Sec. 223(b) Dial-a-Porn 80,000/day. ] Sec. 227(e) 10,000/violation....

  15. Pediatric Palliative Care: A Personal Story

    Full Text Available ... count__/__total__ Find out why Close Pediatric Palliative Care: A Personal Story NINRnews Subscribe Subscribed Unsubscribe 227 ... and her family. The story demonstrates how palliative care can positively influence a patient's and family's experience ...

  16. Infrared spectroscopy of trapped molecular dications below 4 K

    Jašík, J.; Žabka, Ján; Roithová, J.; Gerlich, D.

    354-355, SI (2013), s. 204-210. ISSN 1387-3806 Institutional support: RVO:61388955 Keywords : Buffer gas cooling * Dications * Helium Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.227, year: 2013

  17. Assembly and iron-binding properties of human frataxin, the protein deficient in Friedreich ataxia

    Cavadini, P.; ONeill, H.; Benada, Oldřich; Isaya, G.

    2002-01-01

    Roč. 11, č. 3 (2002), s. 217-227. ISSN 0964-6906 Institutional research plan: CEZ:AV0Z5020903 Keywords : assembly * human * frataxin Subject RIV: EE - Microbiology, Virology Impact factor: 8.726, year: 2002

  18. 76 FR 66754 - Federal Bureau of Prisons

    2011-10-27

    ...,227 to 239,344. Of the approximately 29,000 inmates to be added to the Federal prison system during.... That mission is to protect society by confining offenders in the controlled environments of prison...

  19. Biscayne Bay, FL (S200) Bathymetric Digital Elevation Model(30 meter resolution) Derived From Source Hydrographic SurveySoundings Collected by NOAA

    National Oceanic and Atmospheric Administration, Department of Commerce — Bathymetry for Biscayne Bay was derived from twelve surveys containing149,227 soundings. The overlap from three older, less accurate surveys wasomitted before...

  20. Profesor Bohumil Ryba, mezi vědou a vězením

    Dvořáčková, Věra

    -, č. 8 (2010), s. 227-274. ISSN 2336-1387 Institutional support: RVO:68378092 Keywords : Bohumil Ryba * linguistics * history * classical philology * political persecution * political trials Subject RIV: AI - Linguistics

  1. Atheismus v prostředí rané analytické filosofie

    Sousedík, Prokop

    2010-01-01

    Roč. 7, č. 2 (2010), s. 227-241. ISSN 1335-8081 Institutional research plan: CEZ:AV0Z90090514 Keywords : atheism * logica l positivism * therapeutic justification Subject RIV: AA - Philosophy ; Religion

  2. The Middle Paleolithic of Southern Baharyia Oasis, Western Desert, Egypt

    Svoboda, Jiří

    2004-01-01

    Roč. 42, - (2004), s. 227-241. ISSN 0323-1119 Institutional research plan: CEZ:AV0Z8001916 Keywords : Middle Paleolithic cummulative settlements * lithic workshop, episodic sites * Egypt Subject RIV: AC - Archeology, Anthropology, Ethnology

  3. Chronologie mladoneolitických objektů a soubor kosterních zvířecích pozůstatků ze sídelního areálu s rondelem ve Vchynicích (okr. Litoměřice)

    Řídký, Jaroslav; Kovačiková, L.; Půlpán, M.

    2013-01-01

    Roč. 65, č. 2 (2013), s. 227-284. ISSN 0323-1267 Institutional support: RVO:67985912 Keywords : Late Neolithic * formation processes * animal skeletal remains Subject RIV: AC - Archeology, Anthropology, Ethnology

  4. Crypsis aculeata (L.) Ait

    Hroudová, Zdenka; Lustyk, P.

    2009-01-01

    Roč. 44, č. 2 (2009), s. 227-228. ISSN 1211-5258 Institutional research plan: CEZ:AV0Z60050516 Keywords : endangered species * halophile vegetation * restoration of saline habitat Subject RIV: EF - Botanics

  5. Die Traditionen von Jan Hus und des Hl. Wenzel als Objekt politischer und nationaler Instrumentalisierungen in den böhmischen Ländern im 19. und 20. Jahrhundert

    Šebek, Jaroslav

    München : Kubon & Sagner, 2015 - (Gleixner, J.; Hölzlwimmer, L.; Preusse, C.), s. 227-256 ISBN 978-3-86688-502-8 Institutional support: RVO:67985963 Keywords : Nationalism * Jan Hus * Saint Wenceslas Subject RIV: AB - History

  6. Design, synthesis and characterization of bioinspired nanomaterials for engineering and biomedicine

    Ceylan, Hakan

    2014-01-01

    Ankara : The Materials Science and Nanotechnology Program and the Graduate School of Engineering and Science of Bilkent University, 2014. Thesis (Ph. D.) -- Bilkent University, 2014. Includes bibliographical references leaves 227-247. Ceylan, Hakan Ph. D.

  7. 75 FR 18240 - Comment Request: National Science Foundation-Applicant Survey

    2010-04-09

    ... mammal, or native bird. Use of the Information The purpose of the regulations (45 CFR 670) is to conserve... by the Antarctic Science, Tourism, and Conservation Act of 1996, Public Law 104-227. Burden on...

  8. Polska w polityczno-wojskowej strategii Czecho-Słowacji (październik 1938 – marzec 1939 r.). Protektorat Czech i Moraw oraz emigracja czechosłowacka wobec Polski (marzec – październik 1939 r.)

    Friedl, Jiří

    Warszawa : Neriton, 2013 - (Deszczyński, M.; Pawłowski, T.), s. 227-239 ISBN 978-83-7543-282-4 Institutional support: RVO:67985963 Keywords : Poland * Czechoslovakia * relations 1938-1939 Subject RIV: AB - History

  9. ECM in brain aging and dementia

    Morawski, M.; Filippov, M.; Tzinia, A.; Tsilibary, E.; Vargová, Lýdia

    Amsterdam: ELSEVIER SCIENCE BV, 2014 - (Dityatev, A. - WehrleHaller, B. - Pitkanen, A.), s. 207-227 ISBN 978-0-444-63486-3 Institutional support: RVO:68378041 Keywords : Alzheimer's disease * extracellular space * perineuronal nets Subject RIV: FH - Neurology

  10. Dicty_cDB: Contig-U13541-1 [Dicty_cDB

    Full Text Available 4e-73 AY466445_1( AY466445 |pid:none) Macrobrachium rosenbergii heat sho... 237 5e-73 AB206478_1( AB206478 |pid:none) Chilo...5e-69 DQ898165_1( DQ898165 |pid:none) Cryptosporidium baileyi strain ABH... 227 5...e-69 EU741862_1( EU741862 |pid:none) Cryptosporidium baileyi strain ZJJ... 227 5e-69 EU741860_1( EU741860 |pid:none) Cryptos...poridium baileyi strain ZJJ... 227 5e-69 EU741855_1( EU741855 |pid:none) Cryptosporidium baileyi strai...n ZJJ... 227 5e-69 EU741854_1( EU741854 |pid:none) Cryptosporidium baileyi strai

  11. [Wilhelm Lenz. Theodor Schiemanns Revaler Jahre (1883-1887)] / Paul Kaegbein

    Kaegbein, Paul

    2008-01-01

    Arvustus: Wilhelm Lenz. Theodor Schiemanns Revaler Jahre (1883-1887). - Ostseeprovinzen, baltische Staaten und das Nationale. Münster : LIT, 2005. Lk. 227-250. Tallinna linnaarhiivi esimesest linnaarhivaarist

  12. Spatial and temporal changes in endogenous cytokinins in developing pea roots

    Stirk, W.A.; Novák, Ondřej; Václavíková, Kateřina; Tarkowski, Petr; Strnad, Miroslav; van Staden, J.

    2008-01-01

    Roč. 227, č. 6 (2008), s. 1279-1289. ISSN 0032-0935 Institutional research plan: CEZ:AV0Z50380511 Keywords : cytokinins * germination * Pisum Subject RIV: CE - Biochemistry Impact factor: 3.088, year: 2008

  13. 24 CFR 35.1320 - Lead-based paint inspections, paint testing, risk assessments, lead-hazard screens, and...

    2010-04-01

    ... by a State or Tribal program authorized by the EPA under 40 CFR 745.324, or by the EPA at 40 CFR 745... either by a state or tribal program authorized by the EPA, or by the EPA at 40 CFR 745.227(c), (d), and... promulgated by the EPA at 40 CFR 745.227(h) or, if such standards are not in effect, the following levels...

  14. AcEST: DK958572 [AcEST

    Full Text Available |O76463|NFT1_CAEEL Nitrilase and fragile histidine triad fusio... 34 0.83 sp|O61308|PUMA_PARUN 227 kDa spind...S NDL NF +++ AG Sbjct: 8 RTMATGRHF-IAVCQMTSDNDLEKNFQAAKNMIERAG 43 >sp|O61308|PUMA_PARUN 227 kDa spindle- and... centromere-associated protein OS=Parascaris univalens GN=PUMA1 PE=2 SV=1 Length

  15. AcEST: DK947480 [AcEST

    Full Text Available NDC80 OS=Cand... 32 2.6 sp|O61308|PUMA_PARUN 227 kDa spindle- and centromere-associated ... 32 3.3 sp|P40460...LVKFQKYVDSMKAKSEEWPIKLSKIEDELNEKKENIKLITEEISQIQDSLQRKGLS 438 Query: 289 EEQ 297 EQ Sbjct: 439 VEQ 441 >sp|O61308|PUMA..._PARUN 227 kDa spindle- and centromere-associated protein OS=Parascaris univalens GN=PUMA

  16. A novel Sarcocystis neurona genotype XIII is associated with severe encephalitis in an unexpectedly broad range of marine mammals from the northeastern Pacific Ocean

    Barbosa, L; Johnson, CK; Lambourn, DM; Gibson, AK; Haman, KH; Huggins, JL; Sweeny, AR; Sundar, N.; Raverty, SA; Grigg, ME.

    2015-01-01

    © 2015 . Sarcocystis neurona is an important cause of protozoal encephalitis among marine mammals in the northeastern Pacific Ocean. To characterise the genetic type of S. neurona in this region, samples from 227 stranded marine mammals, most with clinical or pathological evidence of protozoal disease, were tested for the presence of coccidian parasites using a nested PCR assay. The frequency of S. neurona infection was 60% (136/227) among pinnipeds and cetaceans, including seven marine mamma...

  17. Migration, Career and Educational Strategies of Students in Rural Kazakhstan

    Aygul Kurmangalieva; Galina Abdrakhmanova

    2012-01-01

    Aygul Kurmangaliyeva, Ph.D. in Economics, Director of the Education Development Institute, International Business Academy, Almaty, the Republic of Kazakhstan. Email: Address: 227 Rozybakiyeva St., Almaty, 050060, the Republic of Kazakhstan.Galina Abdrakhmanova, Ph.D. in Economics, Professor at the Finance Chair of the International Business Academy, Almaty, the Republic of Kazakhstan. Email: Address: 227 Rozybakiyeva St., Almaty, 050060, the Republic of Kaza...

  18. Preparation of porous materials for radionuclides capture

    Porous materials showing promise for radionuclide capture from water at contaminated sites were prepared. Nanoporous materials (size of pores 1-100 nm) and some polymers are well suited to this purpose owing their affinity for selected radionuclides. Nanoporous metal oxides and silica gel with styrene-divinylbenzene-TODGA-modified surface were prepared, characterized and tested for radionuclide (227Ac, 227Th, 223Ra) capture efficiency. (orig.)

  19. Dicty_cDB: VHD126 [Dicty_cDB

    Full Text Available msc**trawyhh*ificitslrnakgrqitswlyftrifnqsyrfprsr*fq frsnccppcy*wcfsryrlrrrclrtnrncitssrr*tyqtslirqqsrsflir-...-- ---*veiycprkrywwyllctqss*rycyw*rtsyrfpiilcqssftsirilrfhr*ftf phcrssfptmclrslgf...actor 2; Short=EF-2;... 228 2e-58 DQ357217_1( DQ357217 |pid:none) Leishmania brazili...ensis elongation... 227 5e-58 AM494972_26( AM494972 |pid:none) Leishmania braziliensis chromosom... 227 5...sivsy*--- ---LSRNLLPQKTLLVVFTLYSIVVEVLLLVKNVVSVPHYSLSKLIYQY*npsvspliyv ptlpvklshnvssiiglqlvlstkirkplksl*pperekv*pqksqil

  20. Minor Actinide Burning in Thermal Reactors. A Report by the Working Party on Scientific Issues of Reactor Systems

    The actinides (or actinoids) are those elements in the periodic table from actinium upwards. Uranium (U) and plutonium (Pu) are two of the principal elements in nuclear fuel that could be classed as major actinides. The minor actinides are normally taken to be the triad of neptunium (Np), americium (Am) and curium (Cm). The combined masses of the remaining actinides (i.e. actinium, thorium, protactinium, berkelium, californium, einsteinium and fermium) are small enough to be regarded as very minor trace contaminants in nuclear fuel. Those elements above uranium in the periodic table are known collectively as the transuranics (TRUs). The operation of a nuclear reactor produces large quantities of irradiated fuel (sometimes referred to as spent fuel), which is either stored prior to eventual deep geological disposal or reprocessed to enable actinide recycling. A modern light water reactor (LWR) of 1 GWe capacity will typically discharge about 20-25 tonnes of irradiated fuel per year of operation. About 93-94% of the mass of uranium oxide irradiated fuel is comprised of uranium (mostly 238U), with about 4-5% fission products and ∼1% plutonium. About 0.1-0.2% of the mass is comprised of neptunium, americium and curium. These latter elements accumulate in nuclear fuel because of neutron captures, and they contribute significantly to decay heat loading and neutron output, as well as to the overall radio-toxic hazard of spent fuel. Although the total minor actinide mass is relatively small - approximately 20-25 kg per year from a 1 GWe LWR - it has a disproportionate impact on spent fuel disposal, and thus the longstanding interest in transmuting these actinides either by fission (to fission products) or neutron capture in order to reduce their impact on the back end of the fuel cycle. The combined masses of the trace actinides actinium, thorium, protactinium, berkelium and californium in irradiated LWR fuel are only about 2 parts per billion, which is far too low for

  1. TRASH TO TREASURE: CONVERTING COLD WAR LEGACY WASTE INTO WEAPONS AGAINST CANCER

    As part of its commitment to clean up Cold War legacy sites, the U.S. Department of Energy (DOE) has initiated an exciting and unique project to dispose of its inventory of uranium-233 (233U) stored at Oak Ridge National Laboratory (ORNL), and extract isotopes that show great promise in the treatment of deadly cancers. In addition to increasing the supply of potentially useful medical isotopes, the project will rid DOE of a nuclear concern and cut surveillance and security costs. For more than 30 years, DOE's ORNL has stored over 1,200 containers of fissile 233U, originally produced for several defense-related projects, including a pilot study that looked at using 233U as a commercial reactor fuel. This uranium, designated as special nuclear material, requires expensive security, safety, and environmental controls. It has been stored at an ORNL facility, Building 3019A, that dates back to the Manhattan Project. Down-blending the material to a safer form, rather than continuing to store it, will eliminate a $15 million a year financial liability for the DOE and increase the supply of medical isotopes by 5,700 percent. During the down-blending process, thorium-229 (229Th) will be extracted. The thorium will then be used to extract actinium-225 (225Ac), which will ultimately supply its progeny, bismuth-213 (213Bi), for on-going cancer research. The research includes Phase II clinical trials for the treatment of acute myelogenous leukemia at Sloan-Kettering Memorial Cancer Center in New York, as well as other serious cancers of the lungs, pancreas, and kidneys using a technique known as alpha-particle radioimmunotherapy. Alpha-particle radioimmunotherapy is based on the emission of alpha particles by radionuclides. 213Bi is attached to a monoclonal antibody that targets specific cells. The bismuth then delivers a high-powered but short-range radiation dose, effectively killing the cancerous cells but sparing the surrounding tissue. Production of the actinium and

  2. TRASH TO TREASURE: CONVERTING COLD WAR LEGACY WASTE INTO WEAPONS AGAINST CANCER

    Nicholas, R.G.; Lacy, N.H.; Butz, T.R.; Brandon, N.E.

    2004-10-06

    As part of its commitment to clean up Cold War legacy sites, the U.S. Department of Energy (DOE) has initiated an exciting and unique project to dispose of its inventory of uranium-233 (233U) stored at Oak Ridge National Laboratory (ORNL), and extract isotopes that show great promise in the treatment of deadly cancers. In addition to increasing the supply of potentially useful medical isotopes, the project will rid DOE of a nuclear concern and cut surveillance and security costs. For more than 30 years, DOE's ORNL has stored over 1,200 containers of fissile 233U, originally produced for several defense-related projects, including a pilot study that looked at using 233U as a commercial reactor fuel. This uranium, designated as special nuclear material, requires expensive security, safety, and environmental controls. It has been stored at an ORNL facility, Building 3019A, that dates back to the Manhattan Project. Down-blending the material to a safer form, rather than continuing to store it, will eliminate a $15 million a year financial liability for the DOE and increase the supply of medical isotopes by 5,700 percent. During the down-blending process, thorium-229 (229Th) will be extracted. The thorium will then be used to extract actinium-225 (225Ac), which will ultimately supply its progeny, bismuth-213 (213Bi), for on-going cancer research. The research includes Phase II clinical trials for the treatment of acute myelogenous leukemia at Sloan-Kettering Memorial Cancer Center in New York, as well as other serious cancers of the lungs, pancreas, and kidneys using a technique known as alpha-particle radioimmunotherapy. Alpha-particle radioimmunotherapy is based on the emission of alpha particles by radionuclides. 213Bi is attached to a monoclonal antibody that targets specific cells. The bismuth then delivers a high-powered but short-range radiation dose, effectively killing the cancerous cells but sparing the surrounding tissue. Production of the actinium and

  3. Octupole Deformed Nuclei in the Actinide Region

    Thorsteinsen, T; Rubio barroso, B; Simpson, J; Gulda, K; Sanchez-vega, M; Cocks, J; Nybo, K; Garcia borge, M; Aas, A; Fogelberg, B; Honsi, J; Smith, G; Naumann, R; Grant, I

    2002-01-01

    The aim of the present study is to investigate the limits of the "island" of octupole deformation in the mass region A=225. It is of particular importance to demonstrate experimentally the sudden disappearance of the stable octupole deformation in the presence of a well developed quadrupole field. \\\\ \\\\In order to establish the upper border line the $\\beta$ -decay chains of $^{227}$Rn $\\rightarrow ^{227}$Fr $\\rightarrow ^{227}$Ra and $^{231}$Fr $\\rightarrow ^{231}$Ra $\\rightarrow ^{231}$Ac were studied at PSB-ISOLDE using advanced fast timing and $\\gamma$-ray spectroscopy techniques. The lifetimes of the excited states have been measured in the picosecond range using the time-delayed $\\beta\\gamma\\gamma$(t) method.

  4. Dig-face monitoring during excavation of a radioactive plume at Mound Laboratory, Ohio

    A dig-face monitoring system consists of onsite hardware for collecting information on changing chemical, radiological, and physical conditions in the subsurface soil during the hazardous site excavation. A prototype dig-face system was take to Mount Laboratory for a first trial. Mound Area 7 was the site of historical disposals of 232Th, 227Ac, and assorted debris. The system was used to monitor a deep excavation aimed at removing 227Ac-contaminated soils. Radiological, geophysical, and topographic sensors were used to scan across the excavation dig-face at four successive depths as soil was removed. A 3-D image of the contamination plumes was developed; the radiation sensor data indicated that only a small portion of the excavated soil volume was contaminated. The spatial information produced by the dig-face system was used to direct the excavation activities into the area containing the 227Ac and to evaluate options for handling the separate 232Th plume

  5. AcEST: BP914944 [AcEST

    Full Text Available iss-Prot sp_hit_id O61308 Definition sp|O61308|PUMA_PARUN 227 kDa spindle- and ce... Score E Sequences producing significant alignments: (bits) Value sp|O61308|PUMA_...|CE290_MOUSE Centrosomal protein of 290 kDa OS=Mus musc... 41 0.002 >sp|O61308|PUMA_PARUN 227 kDa spindle- a...nd centromere-associated protein OS=Parascaris univalens GN=PUMA1 PE=2 SV=1 Lengt

  6. Investigations of mechanism of laser radiation absorption at PALS

    Kalinowska, Z.; Kasperczuk, A.; Pisarczyk, T.; Chodukowski, T.; Gus’kov, S.Yu.; Demchenko, N. N.; Ullschmied, Jiří; Krouský, Eduard; Pfeifer, Miroslav; Skála, Jiří

    2012-01-01

    Roč. 57, č. 2 (2012), s. 227-230. ISSN 0029-5922. [International Conference on Research and Applications of Plasmas (PLASMA)2011. Warsaw, 12.09.2011-16.09.2011] R&D Projects: GA MŠk(CZ) LC528 Institutional research plan: CEZ:AV0Z20430508 Keywords : collisional absorption * crater volume * electron density distribution * interferometry * iodine laser * resonance absorption * Laser radiation * inverse bremsstrahlung * laser interferometry * PALS laser Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 0.507, year: 2012 http://www.nukleonika.pl/www/back/full/vol57_2012/v57n2p227f.pdf

  7. THE EFFECT OF RATIONALIZATION OF GROWING SYSTEMS ON INTAKE OF IRON, POTASSIUM INTO BARLEY GRAIN

    Pavol Trebichalsky; Juliana Molnarova; Peter Lazor; Tomas Toth; Julius Arvay

    2013-01-01

    The influence of applied inorganic nutrients in soil, the method of tillage (conventional and minimalization) on accumulation of Fe and K into the grain of selected varieties of barley was observed. Small-parcel experiments were carried out on fields with size 14 m2 in three parallels. Four levels of fertilization were done: 1) control – not fertilized variant; 2) N70 + P4,36 + K16,6; 3) N60 + P22,7 + K36; 4) N60 + P22,7 + K36 + Ca25. Fe, K in grain of barley were mineralized by the method of...

  8. Confiabilidad del análisis de ADN en pruebas de paternidad para bovinos Brahman y Brangus en México

    RIOJAS VALDÉS, VÍCTOR M.; Gómez de la Fuente, Juan Carlos, 1966-; SALINAS MELÉNDEZ, JOSÉ A.; Montes de Oca Luna, Roberto.; Wong González, Alfredo.

    2006-01-01

    En el presente estudio se calcularon las probabilidades de exclusión (PE) de ocho microsatélites de ADN (BM1824, BM 2113, SPS 115, ETH 3, ETH 10, ETH 225, TGLA122 y TGLA 227) para determinar la confiabilidad del análisis de ADN como método para la realización de pruebas de paternidad. Los microsatélites de ADN más informativos dentro del panel analizado para la raza Brahman fueron: BM 2113, SPS 115, ETH 10, ETH 225, TGLA 122 y TGLA 227 (PE´s de 0.72, 0.54, 0.45, ...

  9. A phosphoserine-regulated docking site in the protein kinase RSK2 that recruits and activates PDK1

    Frödin, M; Jensen, Claus Antonio Juel; Merienne, K; Gammeltoft, S

    2000-01-01

    PDK1 to the Ser386-phosphorylated hydrophobic motif and phosphorylation of RSK2 at Ser227. A RSK2-S386K mutant showed no interaction with PDK1 or phosphorylation at Ser227. Interaction with Ser386-phosphorylated RSK2 induced autophosphorylation of PDK1. Addition of a synthetic phosphoSer386 peptide...... (RSK2(373-396)) increased PDK1 activity 6-fold in vitro. Finally, mutants of RSK2 and MSK1, a RSK-related kinase, with increased affinity for PDK1, were constitutively active in vivo and phosphorylated histone H3. Our results suggest a novel regulatory mechanism based on phosphoserine...

  10. Reactor production of Thorium-229.

    Hogle, Susan; Boll, Rose Ann; Murphy, Karen; Denton, David; Owens, Allison; Haverlock, Tamara J; Garland, Marc; Mirzadeh, Saed

    2016-08-01

    Limited availability of (229)Th for clinical applications of (213)Bi necessitates investigation of alternative production routes. In reactor production, (229)Th is produced from neutron transmutation of (226)Ra, (228)Ra, (227)Ac and (228)Th. Irradiations of (226)Ra, (228)Ra, and (227)Ac targets at the Oak Ridge National Laboratory High Flux Isotope Reactor result in yields of (229)Th at 26 days of 74.0±7.4MBq/g, 260±10MBq/g, and 1200±50MBq/g, respectively. Intermediate radionuclide yields and cross sections are also studied. PMID:27163437

  11. Gclust Server: 137076 [Gclust Server

    Full Text Available 137076 PoTR_587240 Cluster Sequences - 227 eugene3.209210001 1 1.00e-99 14.29 0.0 0....0 0.0 0.0 0.0 Show 137076 Cluster ID 137076 Sequence ID PoTR_587240 Link to cluster sequences Cluster Seque...nces Link to related sequences - Sequence length 227 Representative annotation eugene3.209210001 Number of S...es not appearing in this cluster ATH: 0 OSA: 0 PPT: 0 CRE: 0 OTAU: 0 CME: 0 GTH: 0 PFA: 0 PTR: 0 TPS: 0 Ter:

  12. DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS

    NA

    2004-11-22

    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) important to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are in the form of tabulated functions with pH and log (line integral) CO{sub 2} as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. The output data from this report are fundamental inputs for Total System Performance Assessment for the License Application (TSPA-LA) to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for all of the actinides. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or otherwise addressed.

  13. Formerly utilized MED/AEC sites remedial action program. Radiological survey of the E. I. Du Pont de Nemours and Co. , Deepwater, New Jersey. Final report

    None

    1978-12-01

    The results of a radiological survey of the E. I. Du Pont Company, Deepwater, New Jersey, are presented in this report. During the 1940's this site was used for development of a process for the conversion of uranium oxide to produce uranium tetrafluoride and small quantities of uranium metal. The survey included measurements of the following: residual alpha and beta--gamma contamination levels, both fixed and transferable, in the one remaining uranium tetrafluoride operations building; external gamma radiation levels at 1 m above the surface inside this building and at outdoor locations where radioactive materials were handled; radon and radon daughter concentrations in the air in the operations building; uranium, radium, actinium, and thorium concentrations in soil and water on and near the site; and the airborne concentrations of uranium, thorium, and radium in the operations building. Elevated concentrations of uranium were found in residues from the operations building and in some surface and subsurface soil samples. Alpha and beta--gamma contamination levels in some areas of the operations building were above the limits of current federal guidelines set for the release of property for unrestricted use. 18 figures, 11 tables.

  14. Geological disposal: security and R and D. Security of 'second draft for R and D of geological disposal'

    The second draft for R and D of geological disposal (second draft) was arranged in 1999. The idea of security of geological disposal in the second draft is explained. The evaluation results of the uncertainty analysis and an example of evaluation of the effect of separation nuclear transmutation on the geological disposal are shown. The construction of strong engineered barrier is a basic idea of geological disposal system. Three processes such as isolation, engineering countermeasures and safety evaluation are carried out for the security of geological disposal. The security of geological environment for a long time of 12 sites in Japan was studied by data. Provability of production and enforcement of engineered barrier were confirmed by trial of over pack, tests and the present and future technologies developed. By using the conditions of reference case in the second draft, the evaluation results of dose effects in the two cases: 1) 90 to 99% Cs and Sr removed from HLW (High Level radioactive Waste) and 2) high stripping ratio of actinium series are explained. (S.Y.)

  15. Selective Decontamination Effect of Metal Ions in Soil Using Supercritical CO{sub 2} and TBP Complex

    Park, Jihye; Park, Kwangheon; Jung, Wonyoung [Kyunghee Univ., Yongin (Korea, Republic of)

    2014-10-15

    Decontamination of soil pollution is difficult because the type of contamination largely depends on the characteristics of the pollutant and the area. Also, existing soil decontamination methods generate large quantities of secondary waste and additional process costs. For this reason, new decontamination methods are always under active investigation. A method involving the use of supercritical carbon dioxide with excellent permeability in place of chemical solvents is currently being studied. Unlike other heavy metals in fission products, uranium is used as fuel, and must be handled carefully. Therefore, in this paper, we studied a supercritical carbon dioxide method for decontaminating heavy metal ions in soil using tri-n-butyl phosphate(TBP), which is well known as a ligand for the extraction of metal ions of actinium. We investigated the decontamination effect of heavy metal ions in the soil using TBP-HNO{sub 3} Complex and supercritical carbon dioxide. The study results showed that when heavy metals in soil are extracted using supercritical carbon dioxide, the extraction efficiency is different according to the type of pollutant metal ions in the soil. When TBP-HNO{sub 3} Complex is used with an extractant, uranium extraction is very effective, but lithium, strontium, and cesium extraction is not effective. Therefore, in the case of a mixture of uranium and other metals such as lithium, strontium, cesium, and so on in soil contaminated by fission product leaks from nuclear power plants, we can selectively decontaminate uranium with supercritical carbon dioxide and TBP-HNO{sub 3} Complex.

  16. Tumor immunotargeting using innovative radionuclides.

    Kraeber-Bodéré, Françoise; Rousseau, Caroline; Bodet-Milin, Caroline; Mathieu, Cédric; Guérard, François; Frampas, Eric; Carlier, Thomas; Chouin, Nicolas; Haddad, Ferid; Chatal, Jean-François; Faivre-Chauvet, Alain; Chérel, Michel; Barbet, Jacques

    2015-01-01

    This paper reviews some aspects and recent developments in the use of antibodies to target radionuclides for tumor imaging and therapy. While radiolabeled antibodies have been considered for many years in this context, only a few have reached the level of routine clinical use. However, alternative radionuclides, with more appropriate physical properties, such as lutetium-177 or copper-67, as well as alpha-emitting radionuclides, including astatine-211, bismuth-213, actinium-225, and others are currently reviving hopes in cancer treatments, both in hematological diseases and solid tumors. At the same time, PET imaging, with short-lived radionuclides, such as gallium-68, fluorine-18 or copper-64, or long half-life ones, particularly iodine-124 and zirconium-89 now offers new perspectives in immuno-specific phenotype tumor imaging. New antibody analogues and pretargeting strategies have also considerably improved the performances of tumor immunotargeting and completely renewed the interest in these approaches for imaging and therapy by providing theranostics, companion diagnostics and news tools to make personalized medicine a reality. PMID:25679452

  17. Tumor Immunotargeting Using Innovative Radionuclides

    Françoise Kraeber-Bodéré

    2015-02-01

    Full Text Available This paper reviews some aspects and recent developments in the use of antibodies to target radionuclides for tumor imaging and therapy. While radiolabeled antibodies have been considered for many years in this context, only a few have reached the level of routine clinical use. However, alternative radionuclides, with more appropriate physical properties, such as lutetium-177 or copper-67, as well as alpha-emitting radionuclides, including astatine-211, bismuth-213, actinium-225, and others are currently reviving hopes in cancer treatments, both in hematological diseases and solid tumors. At the same time, PET imaging, with short-lived radionuclides, such as gallium-68, fluorine-18 or copper-64, or long half-life ones, particularly iodine-124 and zirconium-89 now offers new perspectives in immuno-specific phenotype tumor imaging. New antibody analogues and pretargeting strategies have also considerably improved the performances of tumor immunotargeting and completely renewed the interest in these approaches for imaging and therapy by providing theranostics, companion diagnostics and news tools to make personalized medicine a reality.

  18. Purification of lanthanides for double beta decay experiments

    Polischuk, O. G.; Barabash, A. S.; Belli, P.; Bernabei, R.; Boiko, R. S.; Cappella, F.; Cerulli, R.; Danevich, F. A.; Incicchitti, A.; Laubenstein, M.; Mokina, V. M.; Nisi, S.; Poda, D. V.; Tretyak, V. I.

    2013-08-01

    There are several potentially double beta active isotopes among the lanthanide elements. However, even high purity grade lanthanide compounds contain 238U, 226Ra and 232,228Th typically on the level of ˜ (0.1 - 1) Bq/kg. The liquid-liquid extraction technique was used to remove traces of U, Ra and Th from CeO2, Nd2O3 and Gd2O3. The radioactive contamination of the samples before and after the purification was tested by using ultra-low-background HPGe γ spectrometry at the underground Gran Sasso National Laboratories of the INFN (Italy). After the purification the radioactive contamination of gadolinium oxide by Ra and Th was decreased at least one order of magnitude. The efficiency of the approach to purify cerium oxide from Ra was on same level, while the radioactive contamination of neodymium sample before and after the purification is below the sensitivity of analytical methods. The purification method is much less efficient for chemically very similar radioactive elements like lanthanum, lutetium and actinium. R&D of the methods to remove the pollutions with improved efficiency is in progress.

  19. Radionuclides in coastal swampland soils in South Australia - An unusual distribution?

    A plant processing uranium ore was constructed during the 1950's on coastal swamplands at Port Pirie, South Australia, with tailings and chemical residues stored in clay-lined dams on site. Environmental soil samples collected recently from this area showed an unusual radionuclide distribution which suggested possible contamination from the former uranium plant nearby. On subsequent investigation it appears this distribution is a general property of swampland soils. The concentration of uranium in these soils is significantly greater (2-10 times) than that of its decay products, with an observed range of uranium concentrations from 50 to 300 Bq/kg. In contrast, 'normal' soils in South Australia contain between 5 and 60 Bq/kg, with decay products close to secular equilibrium. In addition, actinium (and its parent, protactinium) occur in sediments in greater concentration than expected - 6 to 36 Bq/kg compared with a 'normal soil' range of 0.2 to 3 Bq/kg. Results obtained suggest: organic residues in the sediments play a major part in the concentration of radionuclides; and the probable source of radionuclides is sea-water. These observations are consistent with results of other workers who examined the incorporation of stable trace metals into coastal swampland sediments in South Australia. Representative data are presented and discussed

  20. Study of Thorium Utilization in a Large Scale Sodium Cooled Fast Reactor

    The breeding performance of 232Th in fast reactor is better than 238U, since the capture cross section of 232Th is slightly higher than 238U under the fast neutron spectrum. There are much less fission neutrons in the blanket, so the proportion of neutron with energy above 6MeV (the threshold energy of (n,2n) reaction of 232Th) is very small. Therefore, the 233U produced in fast reactor blanket would have high purity. In this paper, an large scale fast reactor core was taken as the reference core for 232Th utilization study. In the calculation results, the whole capability of 233U production is about 443kg/(GWe•a) in the blanket; at the end of the first cycle (160EFPD), the 233U production per unit mass of 232Th is about 10.71g/(kgTh), and the weight fraction of 232U in actinium is less than 0.019%. It is an attractive technology option to produce 233U in the blanket. (author)

  1. A Critical Review of Alpha Radionuclide Therapy-How to Deal with Recoiling Daughters?

    de Kruijff, Robin M; Wolterbeek, Hubert T; Denkova, Antonia G

    2015-01-01

    This review presents an overview of the successes and challenges currently faced in alpha radionuclide therapy. Alpha particles have an advantage in killing tumour cells as compared to beta or gamma radiation due to their short penetration depth and high linear energy transfer (LET). Touching briefly on the clinical successes of radionuclides emitting only one alpha particle, the main focus of this article lies on those alpha-emitting radionuclides with multiple alpha-emitting daughters in their decay chain. While having the advantage of longer half-lives, the recoiled daughters of radionuclides like 224Ra (radium), 223Ra, and 225Ac (actinium) can do significant damage to healthy tissue when not retained at the tumour site. Three different approaches to deal with this problem are discussed: encapsulation in a nano-carrier, fast uptake of the alpha emitting radionuclides in tumour cells, and local administration. Each approach has been shown to have its advantages and disadvantages, but when larger activities need to be used clinically, nano-carriers appear to be the most promising solution for reducing toxic effects, provided there is no accumulation in healthy tissue. PMID:26066613

  2. A Critical Review of Alpha Radionuclide Therapy—How to Deal with Recoiling Daughters?

    de Kruijff, Robin M.; Wolterbeek, Hubert T.; Denkova, Antonia G.

    2015-01-01

    This review presents an overview of the successes and challenges currently faced in alpha radionuclide therapy. Alpha particles have an advantage in killing tumour cells as compared to beta or gamma radiation due to their short penetration depth and high linear energy transfer (LET). Touching briefly on the clinical successes of radionuclides emitting only one alpha particle, the main focus of this article lies on those alpha-emitting radionuclides with multiple alpha-emitting daughters in their decay chain. While having the advantage of longer half-lives, the recoiled daughters of radionuclides like 224Ra (radium), 223Ra, and 225Ac (actinium) can do significant damage to healthy tissue when not retained at the tumour site. Three different approaches to deal with this problem are discussed: encapsulation in a nano-carrier, fast uptake of the alpha emitting radionuclides in tumour cells, and local administration. Each approach has been shown to have its advantages and disadvantages, but when larger activities need to be used clinically, nano-carriers appear to be the most promising solution for reducing toxic effects, provided there is no accumulation in healthy tissue. PMID:26066613

  3. A Critical Review of Alpha Radionuclide Therapy—How to Deal with Recoiling Daughters?

    Robin M. de Kruijff

    2015-06-01

    Full Text Available This review presents an overview of the successes and challenges currently faced in alpha radionuclide therapy. Alpha particles have an advantage in killing tumour cells as compared to beta or gamma radiation due to their short penetration depth and high linear energy transfer (LET. Touching briefly on the clinical successes of radionuclides emitting only one alpha particle, the main focus of this article lies on those alpha-emitting radionuclides with multiple alpha-emitting daughters in their decay chain. While having the advantage of longer half-lives, the recoiled daughters of radionuclides like 224Ra (radium, 223Ra, and 225Ac (actinium can do significant damage to healthy tissue when not retained at the tumour site. Three different approaches to deal with this problem are discussed: encapsulation in a nano-carrier, fast uptake of the alpha emitting radionuclides in tumour cells, and local administration. Each approach has been shown to have its advantages and disadvantages, but when larger activities need to be used clinically, nano-carriers appear to be the most promising solution for reducing toxic effects, provided there is no accumulation in healthy tissue.

  4. Background radiation and individual dosimetry in the coastal area of Tamil Nadu (India)

    South coast of India is known as the high-level background radiation area (HBRA) mainly due to beach sands that contain natural radionuclides as components of the mineral monazite. The rich deposit of monazite is unevenly distributed along the coastal belt of Tamil Nadu and Kerala. An HBRA site that laid in 2x7 m along the sea was found in the beach of Chinnavillai, Tamil Nadu, where the maximum ambient dose equivalent reached as high as 162.7 mSv y-1. From the sands collected at the HBRA spot, the high-purity germanium semi-conductor detector identified six nuclides of thorium series, four nuclides of uranium series and two nuclides belonging to actinium series. The highest radioactivity observed was 43.7 Bq g-1 of Th-228. The individual dose of five inhabitants in Chinnavillai, as measured by the radiophotoluminescence glass dosimetry system, demonstrated the average dose of 7.17 mSv y-1 ranging from 2.79 to 14.17 mSv y-1. (authors)

  5. Emanations and 'induced' radioactivity: from mystery to (mis)use

    The natural Rn isotopes were discovered within the period 1899-1902 and at that time referred to as emanations because they came out (emanated) of sources/materials containing actinium, thorium and radium, respectively. The (somewhat mysterious) emanations appeared to disintegrate into radioactive decay products which by depositing at solid surfaces gave rise to 'induced' radioactivity i.e. radioactive substances with various half-lives. Following the discovery of the emanations the volume of the research involving them and their disintegration products grew steeply. The identity of a number of these radioactive products was soon established. Radium emanation was soon used as a source of RaD (210Pb) to be applied as an 'indicator' (radiotracer) for lead in a study on the solubility of lead sulphide and lead chromate. Moreover, radium and its emanation were introduced into the medical practice. Inhaling radon and drinking radon-containing water became an accepted medicinal use (or misuse?) of that gas. Shortly after the turn of the century, the healing (?) action of natural springs (spas) was attributed to their radium emanation, i.e. radon. Bathing in radioactive spring water and drinking it became very popular. Even today, bathing in radon-containing water is still a common medical treatment in Jachymov, Czech Republic. (author)

  6. Liquid Scintillation Counting of Environmental Radioisotopes: A Review of the Impact of Background Reduction

    Douglas, Matthew; Bernacki, Bruce E.; Erchinger, Jennifer L.; Finn, Erin C.; Fuller, Erin S.; Hoppe, Eric W.; Keillor, Martin E.; Morley, Shannon M.; Mullen, Crystal A.; Orrell, John L.; Panisko, Mark E.; Warren, Glen A.; Wright, Michael E.

    2016-03-09

    Liquid scintillation counting (LSC) is a versatile and commonplace method for radiometric measurement of charged particle emitting radionuclides. The LSC method provides utility in a range of environmental science applications including hydrological studies of water transport, anthropogenic releases of radionuclides into the environment, and vertical mixing rates within oceans. Instrumental measurement background is one limiting factor of radiometric measurement sensitivity. As part of the development of a custom low background LSC system located in a shallow underground laboratory at Pacific Northwest National Laboratory, a number of measurement applications of LSC have been considered and are summarized here. The focus is on determining which aspects of such measurements would gain the greatest benefit from the reduction of LSC backgrounds by a factor of 10-100 relative to values reported in the literature. Examples of benefits include lowering the minimum detectable activity, reducing the sample size required, and shortening the elapsed timeline of the processing and analysis sequence. In particular tritium, strontium, and actinium isotopes are examined as these isotopes cover a range of requirements related to the LSC measurement method (e.g., 3H: low energy; Sr: spectral deconvolution; Ac: alpha/beta discrimination).

  7. Neutron measurements with miniature fission chambers

    This report analyses the use and qualification of miniature fission chambers for two types of neutron measurements: 1) relative measurements in nuclear power reactors, or nuclear irradiation reactors. We consider the problem of burnable fissile material in detectors, under important neutron exposures and conclude on recommending the use of regenerating neutron detectors. 2) Measurements of integral physical parameters in experimental reactors. This method has been applied to measurements of fission rates in detectors with strong alpha-rays emitter deposits in order to establish standard tables of physical parameters. It has been used in particular for detectors including very radioactive actinium series. After a discussion of the instrumentation choice and data processing, specific to each measurements, we provide results on: 1) the technological and neutron behaviour of regenerating miniature fission chambers, in the swimming pool reactor 'TRITON', under a neutron exposure of 7.1020 n cm-2 and a gamma-rays exposure of 1,5.1011 rads about. The fissile material is 235U and the fertile material 234U. 2) The integral measurements of effective cross sections for 241Am and 238Pu in the experimental reactor 'MINERVE' use for study of problems of fast neutron reactors

  8. Quantification of radionuclide transfer in terrestrial and freshwater environments: A summary

    Exposure may occur as a result of incidental releases and discharges from all stages of the nuclear fuel cycle. This includes uranium mines, fuel fabrication facilities, reactors, reprocessing plants and low, intermediate and high level radioactive waste repository sites. Each of these releases involves mainly fission and neutron activation products as well as actinides. Uranium mining and fuel fabrication also involve radionuclides of the uranium, actinium and thorium decay series. In addition, some industries such as mineral sands production and processing, phosphate ore processing, coal burning and oil and gas production can generate naturally occurring radioactive materials (NORMs) as waste. Other sources of human exposure include nuclear weapon testing and radiation accidents or incidents. Any radiological assessments are based on an analysis of radionuclide transport patterns and processes governing radionuclide behaviour in the environment. Therefore, it is an aim of the IAEA to support Member States to enhance their capability for evaluating radionuclide transport, geochemical and biochemical enrichment, and radiation effects on human beings and other biota

  9. Study of Soil Decontamination Method Using Supercritical Carbon Dioxide and TBP

    The result of this study means that we have a possible new method for cheap and less wasteful nuclear waste decontamination. When severe accidents such as the incident at the Fukushima nuclear site occur, the soil near the power plant is contaminated with fission products or the activation metal structure of the power plant. The soil pollution form depends on the environment and soil characteristics of the contaminated areas. Thus, a- single-decontamination method is not effective for site cleanup. In addition, some soil decontamination methods are expensive and large amounts of secondary waste are generated. Therefore, we need new soil decontamination methods. In this study, instead of using a conventional solvent method that generates secondary waste, supercritical carbon dioxide was used to remove metal ions from the soil. Supercritical carbon dioxide is known for good permeation characteristics. We expect that we will reduce the cost of soil pollution management. Supercritical carbon dioxide can decontaminate soil easily, as it has the ability to penetrate even narrow gaps with very good moisture permeability. We used TBP, which is a known for extractant of actinium metal. TBP is usually used for uranium and strontium extraction. Using TBP-HNO3 complex and supercritical carbon dioxide, we did extraction experiments for several heavy metals in contaminated soil

  10. Selective Decontamination Effect of Metal Ions in Soil Using Supercritical CO2 and TBP Complex

    Decontamination of soil pollution is difficult because the type of contamination largely depends on the characteristics of the pollutant and the area. Also, existing soil decontamination methods generate large quantities of secondary waste and additional process costs. For this reason, new decontamination methods are always under active investigation. A method involving the use of supercritical carbon dioxide with excellent permeability in place of chemical solvents is currently being studied. Unlike other heavy metals in fission products, uranium is used as fuel, and must be handled carefully. Therefore, in this paper, we studied a supercritical carbon dioxide method for decontaminating heavy metal ions in soil using tri-n-butyl phosphate(TBP), which is well known as a ligand for the extraction of metal ions of actinium. We investigated the decontamination effect of heavy metal ions in the soil using TBP-HNO3 Complex and supercritical carbon dioxide. The study results showed that when heavy metals in soil are extracted using supercritical carbon dioxide, the extraction efficiency is different according to the type of pollutant metal ions in the soil. When TBP-HNO3 Complex is used with an extractant, uranium extraction is very effective, but lithium, strontium, and cesium extraction is not effective. Therefore, in the case of a mixture of uranium and other metals such as lithium, strontium, cesium, and so on in soil contaminated by fission product leaks from nuclear power plants, we can selectively decontaminate uranium with supercritical carbon dioxide and TBP-HNO3 Complex

  11. Radium-228 determination of natural waters via concentration on manganese dioxide and separation using Diphonix ion exchange resin

    The objective of this work was to establish a new procedure for 228Ra determination of natural waters via preconcentration of radium on MnO2 and separation of its daughter, 228Ac, using Diphonix ion exchange resin. Following removal of potential interferences via passage through an initial Diphonix Resin column, the first daughter of 228Ra, 228Ac, is isolated by chromatographic separation via a second Diphonix column. A holding time of >30 h for 228Ac ingrowth in between the two column separations ensures secular equilibrium. Barium-133 is used as a yield tracer. Actinium-228 is eluted from the second Diphonix Resin with 5 ml 1 M 1-Hydroxyethane-1,1-diphosphonic acid (HEDPA) and quantified by addition of scintillation cocktail and LSC counting. Radium (and 133Ba) from the load and rinse solutions from the 2nd Diphonix column may be prepared for alpha spectrometry (for determination of 223Ra, 224Ra, and 226Ra) by BaSO4 microprecipitation and filtration. Decontamination tests indicate that U, Th, and Ra series nuclides do not interfere with these measurements, although high contents of 90Sr (90Y) require additional treatment for accurate measurement of 228Ra. Addition of stable Sr as a 'hold back' carrier during the initial MnO2 preconcentration step was shown to remove most 90Sr interference

  12. Soil and river sediments radionuclides monitoring at Aramar Experimental Center: an historical overview

    In order to evaluate possible effects to the environment resulting from the implementation of the Centro Tecnologico da Marinha - Centro Experimental Aramar (CTMSP-CEA) at Ipero in Sao Paulo state, Brazil, which came into operation in 1989, an Environmental Monitoring Program (PMA) was established in October, 1987. One of the aims of this program is to monitor the soil and river sediments radionuclides levels at CEA and beyond its boundary. The utilization of statistical tools to evaluate the results of radiometric environmental monitoring is a procedure required by National Nuclear Energy Commission (CNEN). The box plot is a simple statistical tool for displaying data. The central tendency and dispersion of the results as well as the observation of unusual results (outliers) in the dataset are easily visualized. Control chart is a graph that maps data and provides a picture of how a process is performing over time. A control chart always has a central line for the mean, an upper line for the upper control limit and a lower line for the lower control limit. Box plots and control charts were used to visualize the annual amount of natural uranium, lead-214, actinium-228 and lead-212 in soil and river sediment detected between 1987 and 2011, considering the measurements of all monitored places each year. This historical observation shows that, in average, the results obtained are below than the 1987-1988 levels (CEA's pre-operational) or below than the backgrounds radionuclides values. (author)

  13. Theoretical Study on Properties of New Isotope 265Bh

    The properties of nuclei belonging to the newly observed α-decay chain starting from 265Bh have been studied. The axially deformed relativistic mean-field calculation with the force NL-Z2 has been performed in the blocked BCS approximation. Some ground state properties such as binding energies, deformations, spins, and parities, as well as Q-values of the α-decay for this decay chain have been calculated and compared with known experimental data. Good agreement is found. The single-particle spectrum of the nucleus 265Bh is studied and some new magic numbers are found, while the magnitudes of the shell gaps in superheavy nuclei are much smaller than those of nuclei before the actinium region, and the Fermi surfaces are close to the continuum. Thus the superheavy nuclei are usually not stable. The α-decay lifetimes in the 265Bh decay chain are evaluated by different formulae, and compared with experimental data. The methods which give good agreement with the data are selected.

  14. Workplace monitoring and related health hazard evaluation in South African mining and mineral processing industries by application of nuclear and related analytical techniques

    The South African Government notice R 849 (23 April 1994) requires application to the South African Council for Nuclear Safety (CNS) for a nuclear licence if materials are dealt with that contain more than 0,2 but less than 1 Becquerel per gram of any radionuclide of the natural uranium, thorium and actinium decay series. If the material is to be used in the construction of buildings the application should have been made before 1 April 1996, otherwise before 31 March 1999. The first phase of the monitoring programme assesses the observed radioactivity levels of waste products and the possible radiological impact on people working on site and living in the direct environment of the operational site. Information has been obtained on the radionuclide content and elemental composition of the various sources of the coal, waste ash, ash related products, crusher materials and effluent water. Except for the effluent and coal samples all other materials showed activity levels for one or more nuclides above the 0,2 Bq/g but not exceeding the 1 Bq/g level. Accordingly a first order assessment of the possible radiological impact on workers and the public has been performed for water consumption and dust inhalation. Actual dust concentrations recorded at various sites within the operational area are used to evaluate the yearly dose to workers. (author)

  15. Purification of lanthanides for double beta decay experiments

    Polischuk, O. G. [Institute for Nuclear Research, MSP 03680 Kyiv, Ukraine and INFN, Section of Rome, La Sapienza, I-00185 Rome (Italy); Barabash, A. S. [Institute of Theoretical and Experimental Physics, 117259 Moscow (Russian Federation); Belli, P. [INFN, Section of Rome Tor Vergata, I-00133 Rome (Italy); Bernabei, R. [INFN, Section of Rome Tor Vergata, I-00133 Rome, Italy and Department of Physics, University of Rome Tor Vergata, I-00133 Rome (Italy); Boiko, R. S.; Danevich, F. A.; Mokina, V. M.; Poda, D. V.; Tretyak, V. I. [Institute for Nuclear Research, MSP 03680 Kyiv (Ukraine); Cappella, F.; Incicchitti, A. [INFN, Section of Rome La Sapienza, I-00185 Rome, Italy and Department of Physics, University of Rome La Sapienza, I-00185 Rome (Italy); Cerulli, R.; Laubenstein, M.; Nisi, S. [INFN, Gran Sasso National Laboratories, I-67100 Assergi (Aq) (Italy)

    2013-08-08

    There are several potentially double beta active isotopes among the lanthanide elements. However, even high purity grade lanthanide compounds contain {sup 238}U, {sup 226}Ra and {sup 232,228}Th typically on the level of ∼ (0.1 - 1) Bq/kg. The liquid-liquid extraction technique was used to remove traces of U, Ra and Th from CeO{sub 2}, Nd{sub 2}O{sub 3} and Gd{sub 2}O{sub 3}. The radioactive contamination of the samples before and after the purification was tested by using ultra-low-background HPGe γ spectrometry at the underground Gran Sasso National Laboratories of the INFN (Italy). After the purification the radioactive contamination of gadolinium oxide by Ra and Th was decreased at least one order of magnitude. The efficiency of the approach to purify cerium oxide from Ra was on same level, while the radioactive contamination of neodymium sample before and after the purification is below the sensitivity of analytical methods. The purification method is much less efficient for chemically very similar radioactive elements like lanthanum, lutetium and actinium. R and D of the methods to remove the pollutions with improved efficiency is in progress.

  16. Selected endocrine disrupting compounds (vinclozolin, flutamide, ketoconazole and dicofol): Effects on survival, occurrence of males, growth, molting and reproduction of Daphnia magna

    Haeba, M. H.; Hilscherová, Klára; Mazurová, E.; Bláha, Luděk

    2008-01-01

    Roč. 15, č. 3 (2008), s. 222-227. ISSN 0944-1344 Institutional research plan: CEZ:AV0Z60050516 Keywords : Daphnia magna * dicofol * endocrine disruption Subject RIV: EF - Botanics Impact factor: 2.492, year: 2008

  17. Association of gastric lymphoid follicles and Helicobacter pylori infection

    Afzal Mohammad; Baez-Giangreco Atilio; Joarder Mohamad Amin; Laajam Mohamed

    1999-01-01

    Lymphoid tissue is normally absent in the gastric mucosa; however, lymphoid follicles are very frequently noted in Helicobacter-associated gastritis. We reviewed 237 cases of chronic gastritis with lymphoid follicles. Out of this 227 cases (95.8%) were found to have H. pylori infection. The significance of this finding and its possible relationship to primary gastric lymphoma are discussed.

  18. Participation Patterns of Korean Adolescents in School-Based Career Exploration Activities

    Rojewski, Jay W.; Lee, In Heok; Hill, Roger B.

    2014-01-01

    Variations in the school-based career exploration activities of Korean high school students were examined. Data represented 5,227 Korean adolescents in Grade 11 contained in the Korean Education Longitudinal Study of 2005, a nationally representative longitudinal database administered by the Korean Educational Development Institute. Latent class…

  19. EST Table: FY000066 [KAIKOcDNA[Archive

    Full Text Available FY000066 bmov1d01 11/12/09 n.h 11/11/04 83 %/227 aa ref|XP_001599258.1| PREDICTED: similar to Dscam... [Nasonia vitripennis] 11/11/04 76 %/226 aa FBpp0234977|DvirDscam-PA 11/11/04 low homology 1

  20. Reproduction in Balanus amphitrite Darwin (Cirripedia: Thoracica); influence of temperature and food concentration

    Desai, D.V.; Anil, A.C.; Venkat, K.

    Biol Ecol 19:227-232 Barnes H, Crisp DJ (1956) Evidence of self-fertilization in certain species of barnacles. J Mar Biol Ass U K 35:631-639 Charnov EL (1987) Sexuality and hermaphroditism in barnacles: a natural selection approach. In: Southward...

  1. Whole-Genome Sequence of "Candidatus Liberibacter asiaticus" from a Huanglongbing-Affected Citrus Tree in Central Florida.

    Zheng, Z; Sun, X; Deng, X; Chen, J

    2015-01-01

    Here, we report the draft genome sequence of "Candidatus Liberibacter asiaticus" strain FL17, isolated from a huanglongbing (HLB)-affected citrus tree in central Florida. The FL17 genome comprised 1,227,253 bp, with a G+C content of 36.5%, 1,175 predicted open reading frames, and 53 RNA genes. PMID:25792067

  2. Whole-Genome Sequence of “Candidatus Liberibacter asiaticus” from a Huanglongbing-Affected Citrus Tree in Central Florida

    Z. Zheng; X. Sun; Deng, X.; J. Chen

    2015-01-01

    Here, we report the draft genome sequence of “Candidatus Liberibacter asiaticus” strain FL17, isolated from a huanglongbing (HLB)-affected citrus tree in central Florida. The FL17 genome comprised 1,227,253 bp, with a G+C content of 36.5%, 1,175 predicted open reading frames, and 53 RNA genes.

  3. Rose Atoll Site 29P 3/9/2006 5-6M

    US Fish and Wildlife Service, Department of the Interior — Onemetersquare 1 meter x 1 meter benthic substrate at Rose Atoll, site 29P 14 32.227S, 168 09.122W, between 5 and 6 meters along a permanent transect.

  4. ARP2 and ARP3 are localized to sites of actin filament nucleation in tobacco BY-2 cells

    Fišerová, J.; Schwarzerová, K.; Petrášek, Jan; Opatrný, Z.

    2006-01-01

    Roč. 227, 2-4 (2006), s. 119-128. ISSN 0033-183X Institutional research plan: CEZ:AV0Z50380511 Keywords : Nicotiana tabacum * BY-2 cells * actin filament Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.333, year: 2006

  5. Do Nice Guys Really Finish Last? Exploring the Relations between Ethical Conduct, Motivation and Satisfaction among Undergraduates in the Domains of Academics and Athletics

    Yukhymenko, Mariya A.

    2012-01-01

    This study explored patterns of the ethical conduct of collegiate students in academic and athletic domains employing social cognitive theory (Bandura, 1986, 1997) using non-experimental, comparative and correlational designs. The study explored response patterns on anonymous surveys between varsity (N = 1151) and non-varsity (N = 227)…

  6. Photoacoustic Spectroscopy

    Zelinger, Zdeněk; Střižík, Michal

    Weinheim : Wiley-VCH Verlag GmbH & Co. KGaA, 2008 - (Lackner, M.), s. 227-254 ISBN 978-3-527-31997-8 Institutional research plan: CEZ:AV0Z40400503 Keywords : lasers * chemistry * photoacoustic spectroscopy Subject RIV: CF - Physical ; Theoretical Chemistry

  7. Rubicon crossed in acute hospital design?

    Baillie, Jonathan

    2008-06-01

    With construction work now underway on the new pound sterling 227 million PFI-funded Pembury Hospital near Tunbridge Wells in Kent, Jonathan Baillie talks to John Cooper of architects Anshen + Allen, who is convinced that this exciting new acute facility will become the first of a new generation of 100% single-bedroom hospitals in the UK. PMID:18655662

  8. Intencionalita zážitkov

    Hvorecký, Juraj

    Bratislava : Slovenská technická univerzita, 2007 - (Kvasnička, V.; Trebatický, P.; Pospíchal, J.; Kelemen, J.), s. 89-93 ISBN 978-80-227-2643-6 Institutional research plan: CEZ:AV0Z90090514 Keywords : intencionality * sensations * Brentano's thesis Subject RIV: AA - Philosophy ; Religion

  9. Eutrophication trends in the Vltava catchment area, Czech Republic

    Hejzlar, Josef; Vyhnálek, V.; Kopáček, Jiří; Procházková, Lidmila; Komárková, Jaroslava

    Prague: CAIUAPPA, 2000, s. 223-227. ISBN 80-01-02239-0. [Regional Central European Conference IUAPPA /12./ and International Conference on Environmental Impact Assessment Prague 2000 /4./. Prague (CZ), 11.09.2000-14.09.2000] R&D Projects: GA ČR GA206/98/0727; GA AV ČR IAA3042903 Subject RIV: DA - Hydrology ; Limnology

  10. Metodika psychoreologického zkoumání jedlých tuků

    Štern, Petr; Panovská, Z.; Pokorný, J.

    Bratislava : Palma Group, 2009, s. 163-166. ISBN 987-80-227-3097-6. [Medzinárodná konferencia z technológie a analytiky tukov /47./. Tatranská Lomnica (SK), 20.05.2009-22.05.2009] Institutional research plan: CEZ:AV0Z20600510 Keywords : emulsified fats * rheology * sensory analysis * texture Subject RIV: BK - Fluid Dynamics

  11. Whole-Genome Sequence of “Candidatus Liberibacter asiaticus” from a Huanglongbing-Affected Citrus Tree in Central Florida

    Zheng, Z.; Sun, X.

    2015-01-01

    Here, we report the draft genome sequence of “Candidatus Liberibacter asiaticus” strain FL17, isolated from a huanglongbing (HLB)-affected citrus tree in central Florida. The FL17 genome comprised 1,227,253 bp, with a G+C content of 36.5%, 1,175 predicted open reading frames, and 53 RNA genes. PMID:25792067

  12. Determination of penicillin-G procaine in kidney, muscle, serum, and urine of heavy sows after intramuscular administration

    The United States Department of Agriculture Food Safety and Inspection Service (FSIS) recently adapted the use of the Charm Kidney Inhibition Swab (KIS) test for screening antibiotics on-site, along with a LC-MS/MS method for confirmation of KIS-positive samples. A study with 126 heavy sows (227.0 ...

  13. Selective synthesis of linear alkylbenzene by alkylation of benzene with 1-dodecene over desilicated zeolites

    Aslam, W.; Siddiqui, M. A. B.; Jermy, B. R.; Aitani, A.; Čejka, Jiří; Al-Khattaf, S.

    2014-01-01

    Roč. 227, MAY 2014 (2014), s. 187-197. ISSN 0920-5861 R&D Projects: GA ČR GBP106/12/G015 Institutional support: RVO:61388955 Keywords : zeolites * benzene alkylation * long-chain olefin Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.893, year: 2014

  14. 24 CFR 35.115 - Exemptions.

    2010-04-01

    ... life, health or safety, or to protect property from further structural damage (such as when a property..., removed, and clearance has been achieved in accordance with 40 CFR 745.227(b)(e) before September 15, 2000... dwelling unit, including a single room occupancy (SRO) dwelling unit. (3) Housing for the elderly, or...

  15. Structure-function relationship of a plant NCS1 member--homology modeling and mutagenesis identified residues critical for substrate specificity of PLUTO, a nucleobase transporter from Arabidopsis.

    Witz, Sandra; Panwar, Pankaj; Schober, Markus; Deppe, Johannes; Pasha, Farhan Ahmad; Lemieux, M Joanne; Möhlmann, Torsten

    2014-01-01

    Plastidic uracil salvage is essential for plant growth and development. So far, PLUTO, the plastidic nucleobase transporter from Arabidopsis thaliana is the only known uracil importer at the inner plastidic membrane which represents the permeability barrier of this organelle. We present the first homology model of PLUTO, the sole plant NCS1 member from Arabidopsis based on the crystal structure of the benzyl hydantoin transporter MHP1 from Microbacterium liquefaciens and validated by molecular dynamics simulations. Polar side chains of residues Glu-227 and backbones of Val-145, Gly-147 and Thr-425 are proposed to form the binding site for the three PLUTO substrates uracil, adenine and guanine. Mutational analysis and competition studies identified Glu-227 as an important residue for uracil and to a lesser extent for guanine transport. A differential response in substrate transport was apparent with PLUTO double mutants E227Q G147Q and E227Q T425A, both of which most strongly affected adenine transport, and in V145A G147Q, which markedly affected guanine transport. These differences could be explained by docking studies, showing that uracil and guanine exhibit a similar binding mode whereas adenine binds deep into the catalytic pocket of PLUTO. Furthermore, competition studies confirmed these results. The present study defines the molecular determinants for PLUTO substrate binding and demonstrates key differences in structure-function relations between PLUTO and other NCS1 family members. PMID:24621654

  16. SENSITIVITY OF AN INFAUNAL AMPHIPOD, EOHAUSTORIUS ESTUARIUS, TO ACUTE WATER-BORN EXPOSURES OF 4-NONYLPHENOL (NP): EVIDENCE OF A TOXIC HANGOVER

    Three independent trials were conducted using mortality and burial as endpoints. Mean LC50 was 227 ug/l. One hour burial as a sub-lethal endpoint increased the sensitivity of the toxicity test by 40%; however most amphipods that survived exposure were able to recover within 24-48...

  17. Nadpozemský rozměr lásky mladého Karla Hynka aneb O romantické mentalitě

    Pokorný, Martin Z.

    2012-01-01

    Roč. 30, č. 93 (2012), s. 215-227. ISSN 0862-7045 Institutional support: RVO:67985955 Keywords : romantic ism * historical mentality * romantic love * the position of man in the world * the crisis in faith Subject RIV: AA - Philosophy ; Religion

  18. Ruby Splendor nectarine

    The Agricultural Research Service hereby releases for propagation the new nectarine variety ‘Ruby Splendor,’ tested previously as Y426-227. ‘Ruby Splendor’ was first selected in 2001 among 70 seedlings from the planned hybridization of two unnamed nectarine selections. Fruit of ‘Ruby Splendor’ ripen...

  19. Aldol condensation of furfural and acetone on zeolites

    Kikhtyanin, O.; Kelbichová, V.; Vitvarová, Dana; Kubů, Martin; Kubička, D.

    2014-01-01

    Roč. 227, MAY 2014 (2014), s. 154-162. ISSN 0920-5861 R&D Projects: GA ČR GBP106/12/G015 Institutional support: RVO:61388955 Keywords : aldol condensation * oligomerization * zeolites Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.893, year: 2014

  20. A Survey of Toxoplasma gondii and Neospora caninum Infecting House Mice from a Hybrid Zone

    Hůrková-Hofmannová, L.; Qablan, M. A.; Juránková, J.; Modrý, David; Piálek, Jaroslav

    2014-01-01

    Roč. 100, č. 1 (2014), s. 139-141. ISSN 0022-3395 R&D Projects: GA ČR GA206/08/0640 Institutional support: RVO:60077344 ; RVO:68081766 Keywords : mouse Mus musculus * feral rodents * wild rodents Subject RIV: EB - Genetics ; Molecular Biology; EB - Genetics ; Molecular Biology (UBO-W) Impact factor: 1.227, year: 2014

  1. Modeling and Analysis of Dynamic Properties of Electromechanical Drive Systems

    Kratochvíl, Ctirad; Grepl, Robert; Procházka, František; Březina, Tomáš

    Trnava: Slovak University of Technology, 2005, s. 610-618. ISBN 80-227-2286-3. [CO-MA-TECH 2005. Trnava (SK), 20.10.2005-21.10.2005] Institutional research plan: CEZ:AV0Z20760514 Keywords : modelling * drive system Subject RIV: JC - Computer Hardware ; Software

  2. On the impact of model resolution and time frequency of outputs on renewable energy prediction

    Eben, Kryštof; Juruš, Pavel; Resler, Jaroslav; Krč, Pavel; Pelikán, Emil

    Prague: The University of Economics, 2011. s. 227. ISSN 1997-4116. [ISF'2011. International Symposium on Forecasting /31./. 26.06.2011-29.06.2011, Prague] Institutional research plan: CEZ:AV0Z10300504 Keywords : numerical weather prediction * solar radiation * forecasting Subject RIV: DG - Athmosphere Sciences, Meteorology

  3. Growth of muscle cells on plasma-treated and gold nanoparticles-grafted polytetrafluoroethylene

    Řezníčková, A.; Makajová, Z.; Kasálková-Slepičková, N.; Kolská, Z.; Bačáková, Lucie; Švorčík, V.

    2014-01-01

    Roč. 23, č. 3 (2014), s. 227-236. ISSN 1026-1265 R&D Projects: GA ČR(CZ) GBP108/12/G108 Institutional support: RVO:67985823 Keywords : polytetrafluoroethylene (PTFE) * nanoparticles * biocompatibility Subject RIV: EI - Biotechnology ; Bionics Impact factor: 1.806, year: 2014

  4. 20.9.Extrapyramidal disorder

    1992-01-01

    920191 Effect of 6-hydroxydopamine oncerebral catecholamines,lipid peroxidationand antioxidant enzymes in rat-concernedwith pathogensis of Parkinson’s disease.LIANG Liping (梁立平),JIANG Dehua (江德华).Dept Neurol,Neurolgic Instit,Tianjing,300052.Chin J Neurol and Psychiat 1991; 24 (4): 223-227.As an animal model of human Parkinson’s

  5. Jerzy Izrael, pierwszy biskup braci czeskich w Wielkopolsce

    Bečková, Marta

    Lublin : Wydawnictwo UMCS, 2004, s. 103-111 ISBN 83-227-2217-6. [Polacy w Czechach - Czesi w Polsce X-XVIII wiek. Wlodawa (PL), 11.10.2002-13.10.2002] Institutional research plan: CEZ:AV0Z9009908 Keywords : Jiří Izrael Subject RIV: AA - Philosophy ; Religion

  6. A MORPHOLOGICAL AND MOLECULAR STUDY OF SPECTATUS SPECTATUS (KATHLANIIDAE), INCLUDING REDESCRIPTION OF THE SPECIES AND AMENDMENT OF GENUS DIAGNOSIS

    Pereira, F.B.; Tavares, L.E.R.; Paiva, F.; Scholz, Tomáš; Luque, J.L.

    2015-01-01

    Roč. 101, č. 4 (2015), s. 468-475. ISSN 0022-3395 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : Nematoda * fishes * Brazil Subject RIV: EG - Zoology Impact factor: 1.227, year: 2014

  7. SOA Direct Modulation in Wavelength-Selectable Laser Array Light Sources

    Kazuo; Kasaya; Ken; Tsuzuki; Hiroaki; Sanjoh; Yasuo; Shibata; Yuichi; Tohmori

    2003-01-01

    We demonstrated, for the first time, 2.5-Gb/s SOA direct modulation in the wavelength-selectable DFB laser array. The SOA direct modulation was achieved in the wide tuning range of 22.7nm by selecting arrayed laser and tuning the temperature. 40-km transmission was also confirmed..

  8. Metaphor Perceptions of Pre-Service Teachers towards Mathematics and Mathematics Education in Preschool Education

    Keles, Oguz; Tas, Isil; Aslan, Durmus

    2016-01-01

    The aim of this study was to identify the thoughts of pre-service teachers, who play an important role in the early preschool experience of children in mathematics, towards the concepts of mathematics and education of mathematics with the help of metaphors. The study group of the research consists of a total of 227 pre-service teachers at the…

  9. How Well Can the Theory of Planned Behavior Account for Occupational Intentions?

    Arnold, John; Loan-Clarke, John; Coombs, Crispin; Wilkinson, Adrian; Park, Jennifer; Preston, Diane

    2006-01-01

    We tested the capacity of an extended version of the theory of planned behavior (TPB) to account for intentions to work for the UK's National Health Service (NHS) as a nurse, physiotherapist or radiographer amongst three groups: professionally unqualified (N=507), in professional training (N=244), and professionally qualified (N=227). We found…

  10. Experimentální měření řízeného stržení šroubu v kostní tkáni

    Hlavoň, Pavel

    Bratislava: STU, 2003 - (Peciar, M.; Čerňanský, A.; Juriga, M.), s. 77-77 ISBN 80-227-1960-9. [International Scientific Conference Mechanical Engineering 2003 /7./. Bratislava (SK), 06.11.2003] Institutional research plan: CEZ:AV0Z2076919 Keywords : experimental measuring * stripping of a screw * Screw capacity Subject RIV: JB - Sensors, Measurment, Regulation

  11. Experimentální měření řízeného stržení šroubu v kostní tkáni

    Hlavoň, Pavel; Florián, Z.; Návrat, T.

    Bratislava: STU Bratislava, 2003 - (Peciar, M.; Čerňanský, A.; Juriga, M.), s. 1-5 ISBN 80-227-1960-9. [Mechanical Engineering 2003. Bratislava (SK), 05.11.2003-06.11.2003] Institutional research plan: CEZ:AV0Z2076919 Keywords : Spine screws * Cervi Lok and Morscher * spine fixator * experimental modelling Subject RIV: AA - Philosophy ; Religion

  12. Do protozoa control the elimination of Vibrio cholerae in brackish water?

    Martínez-P., M. E.; Macek, Miroslav; Castro-G., M. T.

    2004-01-01

    Roč. 89, č. 2 (2004), s. 215-227. ISSN 1434-2944 R&D Projects: GA MŠk(CZ) ME 296 Grant ostatní: UNAM/DGAPA/PAPIT(MX) IN216796 Keywords : ciliate feeding * selectivity * toxin producing bacteria Subject RIV: EE - Microbiology, Virology Impact factor: 0.742, year: 2004

  13. Size selective feeding in ICyclidium glaucoma/I (Ciliophora, Scuticociliatida) and its effects on bacterial community structure: a study from a continuous cultivation system

    Posch, T.; Jezbera, Jan; Vrba, Jaroslav; Šimek, Karel; Pernthaler, J.; Andreatta, S.; Sonntag, B.

    2001-01-01

    Roč. 42, - (2001), s. 217-227. ISSN 0095-3628 Grant ostatní: ANB(AT) OENB6513; AKTION(AT) projects23p5; AKTION(AT) 2000/22 Keywords : protozoa * bacteria * predator-prey relation Subject RIV: EE - Microbiology, Virology Impact factor: 2.891, year: 2001

  14. CAD architektúra pôdnych profilov a kultúrnych súvrství

    Andrísek, Ľubomír

    Bratislava: STU, 2009. ISBN 978-80-227-3208-6. [GIS v archeológii. Bratislava (SK), 26.11.2009] Institutional research plan: CEZ:AV0Z80020508 Keywords : CAD architecture * soil profiles * cultural layers Subject RIV: AC - Archeology, Anthropology, Ethnology

  15. Get Tested for Colon Cancer: Here's How

    Full Text Available How can we help you? Search Live Chat 800-227-2345 Home Learn About Cancer Stay Healthy Find Support & Treatment Explore ... with a part of the body that’s, shall we say, not easy to talk about. Well, the ...

  16. Egg Yolk Phospholipids Enriched with 1-O-Octadecyl-2-Oleoyl-sn-Glycero-3-Phospho-(N-Palmitoyl) Ethanolamine Inhibit Development of Experimentally Induced Tumours

    Karafiát, Vít; Veselý, Pavel; Dvořák, Michal

    2014-01-01

    Roč. 60, č. 5 (2014), s. 220-227. ISSN 0015-5500 Institutional support: RVO:68378050 Keywords : hen egg phospholipids * phospholipid derivative NAEPE * inhibition of tumour cells * inhibition of liver * lung * kidney tumours * chicken model Subject RIV: CE - Biochemistry Impact factor: 1.000, year: 2014

  17. Measuring Transactional Distance in Web-Based Learning Environments: An Initial Instrument Development

    Huang, Xiaoxia; Chandra, Aruna; DePaolo, Concetta; Cribbs, Jennifer; Simmons, Lakisha

    2015-01-01

    This study was an initial attempt to operationalise Moore's transactional distance theory by developing and validating an instrument measuring the related constructs: dialogue, structure, learner autonomy and transactional distance. Data were collected from 227 online students and analysed through an exploratory factor analysis. Results suggest…

  18. 48 CFR 1204.804-570 - Supporting closeout documents.

    2010-10-01

    ...://www.dior.whs.mil/forms/DD0882.PDF, see (FAR) 48 CFR 52.227-14. (b) The forms listed in paragraph (a...) 48 CFR 52.216-7; (2) Form DOT F 4220.45, Contractor's Assignment of Refunds, Rebates, Credits and Other Amounts, (FAR) 48 CFR 52.216-7; (3) Form DOT F 4220.46, Cumulative Claim and...

  19. 78 FR 65936 - Endangered and Threatened Wildlife and Plants; Proposed Endangered Status for Gunnison Sage...

    2013-11-04

    ... sage-grouse as endangered (78 FR 2486) and a proposed rule to designate critical habitat for the Gunnison sage-grouse (78 FR 2540). We proposed to designate as critical habitat approximately 1,704,227... section for our proposal to designate critical habitat for the Gunnison sage-grouse (78 FR 57604). In...

  20. 77 FR 76537 - Notice of Extension of Public Comment Period: Request for Comments (RFC)-Federal Cybersecurity...

    2012-12-28

    ... November 26, 2012 [FR Volume 77, Number 227, Doc No: 2012-28481] is issued by the Cyber Security and... Notice of Extension of Public Comment Period: Request for Comments (RFC)--Federal Cybersecurity Research...) has extended the public comment period for its Request for ] Comments (RFC)--Federal...

  1. 横浜で観測された酸性雨(1996年9月~1998年3月)

    Murayama, Haruta

    1998-01-01

    Rain samples were collected adequately at the center of Yokohama city from September 1996 to March 1998. Total numbers of samples were 227. pH values and electric conductivity (E. C.) were measured immediately after catched samples and then chemical species were analyzed. This report is contained all observed data. Frequency of acid rain (pH

  2. Phosphorylation of mouse serine racemase regulates D-serine synthesis

    Foltyn, Veronika N; Zehl, Martin; Dikopoltsev, Elena;

    2010-01-01

    Serine racemase (SR) catalyses the synthesis of the transmitter/neuromodulator D-serine, which plays a major role in synaptic plasticity and N-methyl D-aspartate receptor neurotoxicity. We now report that SR is phosphorylated at Thr71 and Thr227 as revealed by mass spectrometric analysis and in v...

  3. Rose Atoll Site 29P 7/31/2004 51-52M

    US Fish and Wildlife Service, Department of the Interior — Onemetersquare 1 meter x 1 meter benthic substrate at Rose Atoll, site 29P 14 32.227S, 168 09.122W, between 51 and 52 meters along a permanent transect.

  4. AcEST: BP913315 [AcEST

    Full Text Available rotein C1orf198 OS=Homo s... 30 6.7 sp|P03123|VE2_PAPVD Probable regulatory protein E2 OS=Deer papil... 29 8...21 GEKVLPP 227 >sp|P03123|VE2_PAPVD Probable regulatory protein E2 OS=Deer papillomavirus GN=E2 PE=3 SV=2 Le

  5. Domain Modeling: NP_003411.3 [SAHG[Archive

    Full Text Available NP_003411.3 chr3 CRYSTAL STRUCTURE OF A DESIGNED ZINC FINGER PROTEIN BOUND TO DNA c1meyf_ chr3/NP_003411.3.../NP_003411.3_holo_219-301.pdb blast 224C,226V,227C,228G,229K,230G,231F,232S,233Q,234S

  6. User Interface of MUDR Electronic Health Record

    Hanzlíček, Petr; Špidlen, Josef; Heroutová, Helena; Nagy, Miroslav

    2005-01-01

    Roč. 74, - (2005), s. 221-227. ISSN 1386-5056 R&D Projects : GA MŠk LN00B107 Institutional research plan: CEZ:AV0Z10300504 Keywords : electronic health record * user interface * data entry * knowledge base Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 1.374, year: 2005

  7. 糙皮侧耳和康氏木霉二步混合发酵生产饲料蛋白的研究%STUDY ON FORAGE PROTEIN PRODUCTION BY TWO-STEP MIXED CULTURE FERMENTATION WITH Pleurotus ostreatus AND Trichoderma koningii

    陈敏

    2002-01-01

    研究了糙皮侧耳(Pleurotus ostreatus)和康氏木霉C-3(Trichoderma Koningii C-3)降解稻草生产饲料蛋白的发酵工艺.发酵产物的粗蛋白含量达到 22.7 %,粗纤维降解率为 34 %.

  8. Structure-function relationship of a plant NCS1 member - Homology modeling and mutagenesis identified residues critical for substrate specificity of PLUTO, a nucleobase transporter from arabidopsis

    Witz, Sandra

    2014-03-12

    Plastidic uracil salvage is essential for plant growth and development. So far, PLUTO, the plastidic nucleobase transporter from Arabidopsis thaliana is the only known uracil importer at the inner plastidic membrane which represents the permeability barrier of this organelle. We present the first homology model of PLUTO, the sole plant NCS1 member from Arabidopsis based on the crystal structure of the benzyl hydantoin transporter MHP1 from Microbacterium liquefaciens and validated by molecular dynamics simulations. Polar side chains of residues Glu-227 and backbones of Val-145, Gly-147 and Thr-425 are proposed to form the binding site for the three PLUTO substrates uracil, adenine and guanine. Mutational analysis and competition studies identified Glu-227 as an important residue for uracil and to a lesser extent for guanine transport. A differential response in substrate transport was apparent with PLUTO double mutants E227Q G147Q and E227Q T425A, both of which most strongly affected adenine transport, and in V145A G147Q, which markedly affected guanine transport. These differences could be explained by docking studies, showing that uracil and guanine exhibit a similar binding mode whereas adenine binds deep into the catalytic pocket of PLUTO. Furthermore, competition studies confirmed these results. The present study defines the molecular determinants for PLUTO substrate binding and demonstrates key differences in structure-function relations between PLUTO and other NCS1 family members. 2014 Witz et al.

  9. Conflict Resolution in Mexican-Origin Couples: Culture, Gender, and Marital Quality

    Wheeler, Lorey A.; Updegraff, Kimberly A.; Thayer, Shawna M.

    2010-01-01

    This study examined associations between Mexican-origin spouses' conflict resolution strategies (i.e., nonconfrontation, solution orientation, and control) and (a) gender-typed qualities and attitudes, (b) cultural orientations, and (c) marital quality in a sample of 227 couples. Results of multilevel modeling revealed that Mexican cultural…

  10. Micro-structural reliability design of brittle materials

    Strnadel, B.; Byczanski, Petr

    2007-01-01

    Roč. 74, č. 11 (2007), s. 1825-1836. ISSN 0013-7944 R&D Projects: GA ČR(CZ) GA106/06/0646 Institutional research plan: CEZ:AV0Z30860518 Keywords : Cleavage strength * Brittle fracture * Fracture toughness Subject RIV: JJ - Other Materials Impact factor: 1.227, year: 2007 www.elsevier.com/locate/engfracmech

  11. 48 CFR 27.201-1 - General.

    2010-10-01

    .... 1498, the exclusive remedy for patent or copyright infringement by or on behalf of the Government is a... from its contractors regarding any claims for patent or copyright infringement by inserting the clause at 52.227-2, Notice and Assistance, Regarding Patent and Copyright Infringement. (d) The...

  12. Martin Creed: "Tahan luua keskkonna, kus on hea olla" / intervjueerinud Maria Arusoo

    Creed, Martin, 1968-

    2011-01-01

    Tallinna Kunstihoones 29. sept.-l publikuga kohtunud inglise kunstnik, muusik ja teoreetik Martin Creed endast, oma loomingust, loomeprotsessist, oma Turner Prize'i pälvinud installatsioonist "Work No 227. Lights going on and off", mis oli väljas näitusel "Continuum_Kunst kui taju. Ruum kui protsess" jm.

  13. Vliv stabilizátoru a obsahu TiO2 na psychoreologii kosmetických emulzí

    Morávková, T.; Štern, Petr; Váchová, A.; Panovská, Z.; Pokorný, J.

    Bratislava : STU, 2008 - (Hojerová, J.), s. 81-84 ISBN 978-80-227-2929-1. [International conference of cosmetology. Bratislava (SK), 01.10.2008-03.10.2008] R&D Projects: GA AV ČR IAA2060404 Institutional research plan: CEZ:AV0Z20600510 Keywords : cosmetic emulsions * stability * rheology * sensory analysis Subject RIV: BK - Fluid Dynamics

  14. Looking for the path: image segmentation

    Coufal, J.; Krejsa, Jiří

    Bratislava: Slovak University of Technology in Bratislava, 2010, s. 229-233. ISBN 978-80-227-3353-3. [Robotics in Education . Bratislava (SK), 16.09.2010-17.09.2010] Institutional research plan: CEZ:AV0Z20760514 Keywords : vision-based navigation * image processing * image segmentation Subject RIV: JD - Computer Applications, Robotics

  15. Bayesian Filters in Practice

    Krejsa, Jiří; Věchet, S.

    Bratislava: Slovak University of Technology in Bratislava, 2010, s. 217-222. ISBN 978-80-227-3353-3. [Robotics in Education . Bratislava (SK), 16.09.2010-17.09.2010] Institutional research plan: CEZ:AV0Z20760514 Keywords : mobile robot localization * bearing only beacons * Bayesian filters Subject RIV: JD - Computer Applications, Robotics

  16. Comparative Evaluation of the Hydrodynamics of an External- and an Internal- Loop Airlift Reactor for Three-Phase Systems

    Freitas, C.; Fialová, Marie; Zahradník, Jindřich; Teixeira, J. A.

    Bratislava: Slovak University of Technology, 2000 - (Markoš, J.; Štefuca, V.). s. 53 ISBN 80-227-1350-3. [International Conference of Slovak Society of Chemical Engineering /27./. 22.05.2000-26.05.2000, Tatranské Matliare] Institutional research plan: CEZ:AV0Z4072921 Subject RIV: CI - Industrial Chemistry, Chemical Engineering

  17. Hydrodynamics of a three-phase external-loop airlift bioreactor

    Freitas, C.; Fialová, Marie; Zahradník, Jindřich; Teixeira, J. A.

    Bratislava: Slovak University of Technology, 1999 - (Markoš, J.; Štefuca, V.), s. 63 ISBN 80-227-1216-7. [International Conference SSChE /26./. Jasná (SK), 24.05.1999-28.05.1999] Grant ostatní: INCO-COPERNICUS(XE) IC15-CT98-0904 Subject RIV: CI - Industrial Chemistry, Chemical Engineering

  18. Spinitectus tabascoensis sp. nov. (Nematoda, Cystidicolidae) from Ictalurus furcatus (Pisces) in southeastern Mexico

    Moravec, František; García-Magana, L.; Salgado-Maldonado, G.

    2002-01-01

    Roč. 47, č. 3 (2002), s. 224-227. ISSN 1230-2821 R&D Projects: GA AV ČR IAA6022901 Institutional research plan: CEZ:AV0Z6022909 Keywords : parasitic nematode * Spinitectus * fish Subject RIV: EG - Zoology Impact factor: 0.732, year: 2002

  19. 21 CFR 558.258 - Fenbendazole.

    2010-04-01

    ... containing selenium must comply with published regulations (see 21 CFR 573.920). 2The percentage of cane... veal. 000061 (ii) (iii) Free-choice feeds—(A) Amount. 5 mg/kg body weight (2.27 mg/lb), including the... be processed for veal. (4) Horses. Amount fenbendazole in grams per ton Indications for...

  20. Resistant to the Message: Are Pupils Unreceptive to Teachers' Anti-Bullying Initiatives and If so Why?

    Boulton, Michael J.; Boulton, Richard

    2012-01-01

    Despite three decades of research and development of anti-bullying intervention, this form of systematic aggression continues to be common in schools. The present study investigated if a contributing factor might be that some pupils are unreceptive to teachers' anti-bullying lessons. It invited 8-11-year-old junior school pupils (N = 227) to…

  1. Intercalation chemistry of layered zeolite precursor IPC-1P

    Mazur, Michal; Eliášová, Pavla; Roth, Wieslaw Jerzy; Čejka, Jiří

    2014-01-01

    Roč. 227, MAY 2014 (2014), s. 37-44. ISSN 0920-5861 R&D Projects: GA ČR(CZ) GAP106/12/0189 Institutional support: RVO:61388955 Keywords : UTL germanosilicate * IPC-1P layered precursor * Two-dimensional zeolites Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.893, year: 2014

  2. N-methyl-D-aspartate improved social recognition potency in rats

    Hliňák, Zdeněk; Krejčí, I.

    2002-01-01

    Roč. 330, č. 3 (2002), s. 227-230. ISSN 0304-3940 R&D Projects: GA ČR GA309/00/1644 Institutional research plan: CEZ:AV0Z5011922 Keywords : N-Metyl-D-aspartate * olfactory stimuly * short-term memory Subject RIV: FH - Neurology Impact factor: 2.100, year: 2002

  3. Antimicrobial Drug–Resistant Escherichia coli in Wild Birds and Free-range Poultry, Bangladesh

    Hasan, Badrul; Sandegren, Linus; Melhus, Åsa; Drobni, Mirva; Hernandez, Jorge; Waldenström, Jonas; Alam, Munirul; Olsen, Björn

    2012-01-01

    Multidrug resistance was found in 22.7% of Escherichia coli isolates from bird samples in Bangladesh; 30% produced extended-spectrum β-lactamases, including clones of CTX-M genes among wild and domestic birds. Unrestricted use of antimicrobial drugs in feed for domestic birds and the spread of resistance genes to the large bird reservoir in Bangladesh are growing problems.

  4. Mood, Anxiety, and Substance-Use Disorders and Suicide Risk in a Military Population Cohort

    Conner, Kenneth R.; McCarthy, Michael D.; Bajorska, Alina; Caine, Eric D.; Tu, Xin M.; Knox, Kerry L.

    2012-01-01

    There are meager prospective data from nonclinical samples on the link between anxiety disorders and suicide or the extent to which the association varies over time. We examined these issues in a cohort of 309,861 U.S. Air Force service members, with 227 suicides over follow-up. Mental disorder diagnoses including anxiety, mood, and substance-use…

  5. School Functioning in Youth with and without Anxiety Disorders: Comparisons by Diagnosis and Comorbidity

    Mychailyszyn, Matthew P.; Mendez, Julia L.; Kendall, Philip C.

    2010-01-01

    This article reports on school functioning for 227 youth ages 7-14 (M = 10.3) with principal diagnoses of separation anxiety disorder (n = 40), social phobia (n = 58), generalized anxiety disorder (n = 76), or no diagnoses (n = 53). School functioning data were gathered via parent and teacher report. Youth with no diagnoses demonstrated…

  6. Cross-Ethnic Friendships and Sense of Social-Emotional Safety in a Multiethnic Middle School: An Exploratory Study

    Munniksma, Anke; Juvonen, Jaana

    2012-01-01

    This exploratory study examined whether cross-ethnic friendships are related to students' sense of social-emotional safety in a multiethnic middle school. The analysis sample (n = 227) consisted of Latino (57%) and White (43%) sixth- and seventh-grade students. Although a strong preference for same-ethnic friendships was found for both ethnic…

  7. Cross-ethnic friendships and sense of social-emotional safety in multi-ethnic middle school: An exploratory study

    Munniksma, A.; Juvonen, J.

    2012-01-01

    This exploratory study examined whether cross-ethnic friendships are related to students’ sense of social-emotional safety in a multiethnic middle school. The analysis sample (n = 227) consisted of Latino (57%) and White (43%) sixth- and seventh-grade students. Although a strong preference for same-

  8. Biological half-life of xenobiotic bromide in the rat is dependent on sodium intake and varies with the metabolic activity of the animals

    Pavelka, Stanislav

    Bratislava : Slovak University of Technology, 2013, s. 232-235. ISBN 978-80-227-3959-7. [Industrial Toxicology 2013 /33./. Svit, Vysoké Tatry (SK), 19.06.2013-21.06.2013] Institutional support: RVO:67985823 Keywords : bromide * sodium intake * biological half-life Subject RIV: FB - Endocrinology, Diabetology, Metabolism, Nutrition

  9. Detection of Ancient DNA of Encephalitozoon intestinalis (Microsporidia) in Archaeological Material

    Myšková, E.; Ditrich, O.; Sak, Bohumil; Kváč, Martin; Cymbalak, T.

    2014-01-01

    Roč. 100, č. 3 (2014), s. 356-359. ISSN 0022-3395 Institutional support: RVO:60077344 Keywords : parasites * Cryptosporidium * amplification * coprolites * Ascaris * Giardia * world * eggs Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.227, year: 2014

  10. NEW CIRCUMSCRIPTION OF FRESHWATER FISH PARASITES MONOBOTHRIUM DIESING, 1863 AND PROMONOBOTHRIUM MACKIEWICZ, 1968 (CESTODA: CARYOPHYLLIDEA) USING MORPHOLOGICAL AND MOLECULAR EVIDENCE

    Scholz, Tomáš; Oros, M.; Choudhury, A.; Brabec, Jan; Waeschenbach, A.

    2015-01-01

    Roč. 101, č. 1 (2015), s. 29-36. ISSN 0022-3395 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : phylogenetic tree selection * Tinca tinca * revision Subject RIV: EG - Zoology Impact factor: 1.227, year: 2014

  11. Development and Validation of a Teaching Practice Scale (TISS) for Instructors of Introductory Statistics at the College Level

    Hassad, Rossi A.

    2009-01-01

    This study examined the teaching practices of 227 college instructors of introductory statistics (from the health and behavioral sciences). Using primarily multidimensional scaling (MDS) techniques, a two-dimensional, 10-item teaching practice scale, TISS (Teaching of Introductory Statistics Scale), was developed and validated. The two dimensions…

  12. Comprehensive two-dimensional liquid chromatography time-of-flight mass spectrometry of Stevia rebaudiana leaves

    Pól, Jaroslav; Hohnová, Barbora; Hyötyläinen, T.

    - : -, 2007. K13-1-K13-3. ISBN 978-80-227-2698-6. [International Symposium on Separation Sciences /13./. 27.06.2007-29.06.2007, Štrbské Pleso] Institutional research plan: CEZ:AV0Z40310501 Keywords : comprehensive two-dimensional liquid chromatography * time-of-flight mass spectrometry * Stevia Rebaudiana Subject RIV: CB - Analytical Chemistry, Separation

  13. 76 FR 46300 - Food and Drug Administration Modernization Act of 1997: Modifications to the List of Recognized...

    2011-08-02

    ... femoral components. J. Radiology 12-227 Ultrasonics--Pulse-echo scanners--Part 1: IEC 61391-1 First... notice published in the Federal Register of February 25, 1998 (63 FR 9561), FDA announced the... February 25, 1998 (63 FR 9561) March 31, 2006 (71 FR 16313). October 16, 1998 (63 FR 55617) June 23,...

  14. Bronsted acidity of H-MCM-22 as probed by variable-temperature infrared spectroscopy of adsorbed CO and N-2

    Delgado, M. R.; Bulánek, R.; Eliášová, Pavla; Arean, C. O.

    2014-01-01

    Roč. 227, MAY 2014 (2014), s. 45-49. ISSN 0920-5861 R&D Projects: GA ČR GBP106/12/G015 Institutional support: RVO:61388955 Keywords : adsorption * hydrogen bonding * IR probe molecules Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.893, year: 2014

  15. Synthesis and catalytic properties of titanium containing extra-large pore zeolite CIT-5

    Přech, Jan; Kubů, Martin; Čejka, Jiří

    2014-01-01

    Roč. 227, MAY 2014 (2014), s. 80-86. ISSN 0920-5861 R&D Projects: GA ČR GBP106/12/G015 Institutional support: RVO:61388955 Keywords : zeolite CIT-5 * titanosilicate * epoxidation Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.893, year: 2014

  16. Photocurrent spectroscopy of semi-insulating GaAs M-S-M diodes with a new contact metallization

    Dubecký, F.; Oswald, Jiří; Kindl, Dobroslav; Hubík, Pavel; Gombia, E.; Šagátová, A.; Boháček, P.; Sekáčová, M.; Nečas, V.; Mudroň, J.

    Bratislava: FEI STU, 2014 - (Vajda, J.; Jamnický, I.), s. 214-218 ISBN 978-80-227-4179-8. [International Conference on Applied Physics of Condensed Matter /20./. Štrbské Pleso (SK), 25.06.2014-27.06.2014] Institutional support: RVO:68378271 Keywords : current-voltage measurements * photocurrent spectroscopy * GaAs Subject RIV: BM - Solid Matter Physics ; Magnetism

  17. 50 CFR 216.45 - General Authorization for Level B harassment for scientific research.

    2010-10-01

    ...) of the ESA and implementing regulations at 50 CFR parts 217-227, particularly at § 222.23 through... et seq.) and implementing regulations (50 CFR part 216), I hereby notify the National Marine... is subject to the requirements of 15 CFR part 904....

  18. Antibacterial activity of marine-derived fungi

    Christophersen, Carsten; Crescente, Oscar; Frisvad, Jens Christian;

    1998-01-01

    A total of 227 marine isolates of ubiqituous fungi were cultivated on different media and the secondary metabolite content of the extracts (ethyl acetate/chlorofonn/methanol 3 : 2 : 1) characterized by HPLC. The fungi were secured from animals, plants and sediments of Venezuelan waters (0-10 m...

  19. 78 FR 61939 - Fisheries of the Caribbean, Gulf of Mexico, and South Atlantic; Snapper-Grouper Resources of the...

    2013-10-07

    ... (NOAA), Commerce. ACTION: Temporary rule; trip limit reduction. SUMMARY: NMFS reduces the commercial... 500 lb (227 kg), gutted weight. This trip limit reduction is necessary to protect the South Atlantic... Conservation and Management Act (Magnuson- Stevens Act) by regulations at 50 CFR part 622. The commercial...

  20. Relaxation processes in gamma-irradiated concrete for nuclear-safety structures:a preliminary study

    Demo, Pavel; Vodák, F.; Tichá, P.; Sveshnikov, Alexey

    Bratislava : Slovak University of Technology, 2006 - (Palacková, A.), s. 22-24 ISBN 80-227-2467-X. [International Workshop "Physical and Material Engineering 2006". Račkova dolina (SK), 05.09.2006-07.09.2006] Institutional research plan: CEZ:AV0Z10100521 Keywords : nucleation * irradated concrete * voids Subject RIV: BJ - Thermodynamics

  1. 76 FR 31598 - Record of Decision for the Barry M. Goldwater Range East Range Enhancements Final Environmental...

    2011-06-01

    ... Environmental Impact Statement ACTION: Notice of Availability (NOA) of a Record of Decision (ROD). SUMMARY: On... to the public on November, 26, 2010 through a NOA in the Federal Register (Volume 75, Number 227...: This NOA is published pursuant to the regulations (40 CFR part 1506.6) implementing the provisions...

  2. Dynamics in Diether Lipid Bilayers and Interdigitated Bilayer Structures Studied by Time-Resolved Emission Spectra and Decay Time and Anisotropy Profiles

    Hutterer, R.; Hof, Martin

    2001-01-01

    Roč. 11, č. 3 (2001), s. 227-236. ISSN 1053-0509 R&D Projects: GA ČR GA203/99/0845 Institutional research plan: CEZ:AV0Z4040901 Keywords : lipid interdigitation * solvent relaxation * time-resolved emission spectra Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 0.702, year: 2001

  3. Jména studánek na Moravě a ve Slezsku

    Komárková, Zina

    2010-01-01

    Roč. 51, č. 1 (2010), s. 227-246. ISSN 1211-4413 R&D Projects: GA ČR GA405/08/0703 Institutional research plan: CEZ:AV0Z90610518 Keywords : small water sources * hydronyms * word-formation * motivation Subject RIV: AI - Linguistics

  4. 77 FR 47399 - Funding Opportunity: Tribal Self-Governance Program; Planning Cooperative Agreement

    2012-08-08

    ... satisfaction of the Tribe. The planning phase must include legal and budgetary research and internal Tribal... workplace and promote the non-use of all tobacco products. In addition, Public Law 103-227, the Pro-Children... submitted as attachments to email messages addressed to IHS employees or offices. Applicants that receive...

  5. 78 FR 37828 - Tribal Self-Governance Program Planning Cooperative Agreement

    2013-06-24

    ... the ISDEAA requires a Tribe or Tribal organization to complete a planning phase to the satisfaction of... workplace and promote the non-use of all tobacco products. In addition, Public Law 103-227, the Pro-Children... addressed to IHS employees or offices. If an applicant receives a waiver to submit paper...

  6. Deception in social psychological experiments: two misconceptions and a research agenda

    Hertwig, R.; Ortmann, Andreas

    2008-01-01

    Roč. 71, č. 3 (2008), s. 222-227. ISSN 0190-2725 R&D Projects: GA MŠk LC542 Institutional research plan: CEZ:MSM0021620846 Keywords : social psychology experiments * deception * misconceptions Subject RIV: AH - Economics Impact factor: 1.143, year: 2008

  7. 78 FR 65190 - Airworthiness Directives; Bombardier, Inc. Airplanes

    2013-10-31

    ... bec H4S 1Y9, Canada; telephone 514-855-5000; fax 514-855-7401; email thd.crj@aero.bombardier.com... this material at the FAA, call 425- 227-1221. FOR FURTHER INFORMATION CONTACT: Cesar Gomez, Aerospace.... SUPPLEMENTARY INFORMATION: Discussion We issued a notice of proposed rulemaking (NPRM) to amend 14 CFR part...

  8. 75 FR 51105 - Proposed Finding Against Federal Acknowledgment of the Central Band of Cherokee

    2010-08-18

    ... Bureau of Indian Affairs Proposed Finding Against Federal Acknowledgment of the Central Band of Cherokee... group known as the ``Central Band of Cherokee'' (CBC), Petitioner 227, c/o Mr. Joe H. White, 1 Public... members are descendants of Cherokee Indians who had not given up their rights to lands in Tennessee...

  9. The Effect of Perspective on Misconceptions in Psychology: A Test of Conceptual Change Theory

    Amsel, Eric; Johnston, Adam; Alvarado, Elly; Kettering, Jack; Rankin, Lauren; Ward, Melissa

    2009-01-01

    To test whether students' knowledge about psychology undergoes a conceptual change when learning about the discipline, 227 Introductory Psychology students from six different classes were given the Psychology as a Science (PAS) Scale in one of two conditions. Students were randomly assigned to complete the questionnaire from their own (Self…

  10. Disease: H00503 [KEGG MEDICUS

    Full Text Available hanet J Rare Dis 2:27 (2007) PMID:19876929 (description, gene) Ruiz-Perez VL, Goodship JA Ellis-van Creveld ... Dallapiccola B, Wright M, Meitinger T, Polymeropoulos MH, Goodship J Mutations in a new gene in Ellis-van C

  11. Comparing Diagnostic Outcomes of Autism Spectrum Disorder Using "DSM-IV-TR" and "DSM-5" Criteria

    Harstad, Elizabeth B.; Fogler, Jason; Sideridis, Georgios; Weas, Sarah; Mauras, Carrie; Barbaresi, William J.

    2015-01-01

    Controversy exists regarding the "DSM-5" criteria for ASD. This study tested the psychometric properties of the "DSM-5" model and determined how well it performed across different gender, IQ, and "DSM-IV-TR" sub-type, using clinically collected data on 227 subjects (median age = 3.95 years, majority had IQ > 70).…

  12. Reactivity and properties of dications generated by photoionization of 2,5-norbornadiene

    Shaffer, Christopher; Schröder, Detlef; Roithová, J.; Zins, E. L.; Alcaraz, C.; Žabka, Ján; Polášek, Miroslav; Ascenzi, D.

    2013-01-01

    Roč. 336, Feb 15 (2013), s. 17-26. ISSN 1387-3806 R&D Projects: GA ČR GA203/09/1223; GA ČR GAP208/11/0446 Institutional support: RVO:61388963 ; RVO:61388955 Keywords : dications * norbornadiene * photoionization * reactive monitoring * synchrotron radiation Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.227, year: 2013

  13. Work-Family Conflict, Resources, and Role Set Density: Assessing Their Effects on Distress among Working Mothers

    Kulik, Liat; Liberman, Gabriel

    2013-01-01

    We explored the relationships between the experience of work-family conflict and levels of distress in the family and at work among a sample of 227 Israeli working mothers. We also examined how role set density (RSD, the number of roles they perform) and personal and environmental resources are related to the women's experience of distress.…

  14. Predictores psicosociales del consumo de tabaco en adolescentes : extensiones de la teoría de la conducta planificada

    Bermúdez Moreno, José; Contreras Felipe, Antonio

    2008-01-01

    En una muestra de 227 adolescentes, esta investigación estudió, primero, la utilidad predictiva incremental de la similaridad al prototipo, una vez controladas las variables de la teoría de la conducta planificada (TCP) y, segundo, la contribución pre

  15. Drug: D01333 [KEGG MEDICUS

    Full Text Available D01333 Drug Urapidil (JP16/INN); Ebrantil (TN) C20H29N5O3 387.227 387.476 D01333.gif Antihypertensive...vascular agents 214 Antihypertensives 2149 Others D01333 Urapidil (JP16/INN) 25 U...tagonists Therapeutic category of drugs in Japan [BR:br08301] 2 Agents affecting individual organs 21 Cardio

  16. Social protection in the enterprises: the case of Slovakia

    Plánovský, Ján; Wörgötter, A.

    Cambridge [u.a.] : Cambridge University Press, 1997 - (Rein, M.; Friedman , B.; Wörgötter, A.), s. 227-260 ISBN 0521584035. [Enterprise and social benefits after communism. Wien (AT), 25.03.1994-26.03.1994] Keywords : social protection * enterprises * Slovakia Subject RIV: AH - Economics

  17. Dva poljusa bytija: anglo-amerikanskij empirizm-pragmatizm i "russkaja tema" u Karla Čapeka

    Pospíšil, Ivo

    Lublin: Uniwersytet Marii CurieSklodowskiej, 1999 - (Kowalczyk, W.), s. 225-233 ISBN 83-227-1394-0. [Zwiazki miedzy literaturami narodów slowianskich v 19. i 20. wieku. Lublin (PL), 19.10.1993-23.10.1993] Subject RIV: AJ - Letters, Mass-media, Audiovision

  18. Antigravity - its manifestations and origin

    Křížek, Michal; Somer, L.

    2013-01-01

    Roč. 3, č. 3 (2013), s. 227-235. ISSN 2161-4717 Institutional support: RVO:67985840 Keywords : Hubble parameter * dark energy * antigravity Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics http://www.scirp.org/journal/PaperInformation.aspx?paperID=36509

  19. Czeska pamięć i wspomnienia przymusowych wysiedleń Niemców (1947-2010)

    Spurný, Matěj

    Zielena Gora : Lubuskie Towarzystwo Naukowe, 2012 - (Müller, H.; Zielińska, M.), s. 227-236 ISBN 978-83-88317-12-5. - (Seria Monograficzna. 8) Institutional research plan: CEZ:AV0Z80630520 Keywords : forced migration * Germans Subject RIV: AB - History

  20. A new gonad-infecting species of Philometra (Nematoda: Philometridae) from the red cusk-eel Genypterus chilensis (Osteichthyes: Ophidiidae) off Chile

    Moravec, František; Chávez, R. A.; Oliva, M. E.

    2011-01-01

    Roč. 108, č. 1 (2011), s. 227-232. ISSN 0932-0113 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Philometra * Genypterus * Chile Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.149, year: 2011