Separation of actinium-227 from its daughter products by cationic resins technique
International Nuclear Information System (INIS)
Nastasi, M.J.C.
1976-01-01
A method for separating actinium-227 from its daughter products based on ion exchange principle is shown. Radionuclides mixture in perchloric acid 8,5 N and chloridric acid 0,5 N medium pass by a cationic resin column. Thorium-227 and actinium-227, which are retained by the resin, are eluted with nitric acid 6 N which releases actinium-227 while oxalic acid 7% is used for thorium-227 elution [pt
Separation of Actinium 227 from the uranium minerals
International Nuclear Information System (INIS)
Martinez-Tarango, S.
1991-01-01
The purpose of this work was to separate Actinium 227, whose content is 18%, from the mineral carnotite found in Gomez Chihuahua mountain range in Mexico. The mineral before processing is is pre-concentrated and passed, first through anionic exchange resins, later the eluate obtained is passed through cationic resins. The resins were 20-50 MESH QOWEX and 100-200 MESH 50 X 8-20 in some cased 200-400 MESH AG 50W-X8, 1X8 in other cases. The eluates from the ionic exchange were electrodeposited on stainless steel polished disc cathode and platinum electrode as anode; under a current ODF 10mA for 2.5 to 5 hours and of 100mA for .5 of an hour. it was possible to identify the Actinium 227 by means of its descendents, TH-227 and RA-223, through alpha spectroscopy. Due to the radiochemical purity which the electro deposits were obtained the Actinium 227 was low and was not quantitatively determined. A large majority of the members of the natural radioactive series 3 were identified and even alpha energies reported in the literature with very low percentages of non-identified emissions were observed. We conclude that a more precise study is needed concerning ionic exchange and electrodeposit to obtain an Actinium 227 of radiochemical purity. (Author)
International Nuclear Information System (INIS)
Keller, C.
1977-01-01
There are only very few investigations dealing with the chemical and physical properties of actinium, the lanthanum homologue in the actinide series, 227 Ac, the only long-lived isotope can be produced in gram amounts only by neutron irradiation of 226 Ra, the amounts occurring in nature are too low for isolation (about 1 μg 227 Ac/1 uranium ore). Experimental work with 227 Ac gives rise to a lot of problems due to the radiation characteristics of the 227 Ac daughter nuclides. Therefore, the metal and the only ten solid compounds, prepared up to now, have been isolated in the microgram scale. Due to the high specific activity of 227 Ac, the preparation of a lot of compounds, e.g. metal-organic compounds seems to be very difficult, if not impossible. The properties of actinium in aqueous solutions have been deduced from experiments in the tracer scale only. The present investigations on actinium show that only the oxidation state + 3 exists - only radiopolarographic studies indicate the possibility of a lower valancy state (Ac 2+ ). - This review will give a critical and comprehensive description on the present knowledge about this element. The presently decreasing interest in the development of thermionic batteries using 227 Ac 2 O 3 radionuclide also implies that there will be only small progress in the chemistry of this radio-element in the near future. (orig.) [de
Application of partition chromatography method for separation and analysis of actinium radionuclides
International Nuclear Information System (INIS)
Sinitsina, G.S.; Shestakova, I.A.; Shestakov, B.I.; Plyushcheva, N.A.; Malyshev, N.A.; Belyatskij, A.F.; Tsirlin, V.A.
1979-01-01
The method of partition chromatography is considered with the use of different extractants for the extraction of actinium-227, actinium-225 and actinium-228. It is advisable to extract actinium-227 from the irradiated radium with the help of D2FGFK. The use of 2DEGFK allows us to separate actinium-227 from alkaline and alkaline-earth elements. Amines have a higher radiative stability. An express-method has been developed for the identification of actinium-227 with TOA by its intrinsic α-emission in nonequilibrium preparations of irradiated radium-226 of small activity. Actinium-225 is extracted from uranium-233 with due regard for the fact that U, Th, and Ac are extracted differently by TBP from HNO 3 solutions. With the help of the given procedure one can reach the purifying coefficient of 10 4 . Actinium-228 is extracted from the radiummesothorium preparations by a deposition of decay products, including polonium-210 on the iron hydroxyde. Actinium-228 extraction from the mixture of radium radionuclides is performed by the partition chromatography method on D2EGFK. All the procedures for separation of actinium isotopes by the above methods are described
Radchenko, V; Engle, J W; Wilson, J J; Maassen, J R; Nortier, F M; Taylor, W A; Birnbaum, E R; Hudston, L A; John, K D; Fassbender, M E
2015-02-06
Actinium-225 (t1/2=9.92d) is an α-emitting radionuclide with nuclear properties well-suited for use in targeted alpha therapy (TAT), a powerful treatment method for malignant tumors. Actinium-225 can also be utilized as a generator for (213)Bi (t1/2 45.6 min), which is another valuable candidate for TAT. Actinium-225 can be produced via proton irradiation of thorium metal; however, long-lived (227)Ac (t1/2=21.8a, 99% β(-), 1% α) is co-produced during this process and will impact the quality of the final product. Thus, accurate assays are needed to determine the (225)Ac/(227)Ac ratio, which is dependent on beam energy, irradiation time and target design. Accurate actinium assays, in turn, require efficient separation of actinium isotopes from both the Th matrix and highly radioactive activation by-products, especially radiolanthanides formed from proton-induced fission. In this study, we introduce a novel, selective chromatographic technique for the recovery and purification of actinium isotopes from irradiated Th matrices. A two-step sequence of cation exchange and extraction chromatography was implemented. Radiolanthanides were quantitatively removed from Ac, and no non-Ac radionuclidic impurities were detected in the final Ac fraction. An (225)Ac spike added prior to separation was recovered at ≥ 98%, and Ac decontamination from Th was found to be ≥ 10(6). The purified actinium fraction allowed for highly accurate (227)Ac determination at analytical scales, i.e., at (227)Ac activities of 1-100 kBq (27 nCi to 2.7 μCi). Copyright © 2014 Elsevier B.V. All rights reserved.
A Radium-223 microgenerator from cyclotron-produced trace Actinium-227
International Nuclear Information System (INIS)
Abou, Diane S.; Pickett, Juile; Mattson, John E.; Thorek, Daniel L.J.
2017-01-01
The alpha particle emitter Radium-223 dichloride ("2"2"3RaCl_2) has recently been approved for treatment of late-stage bone metastatic prostate cancer. There is considerable interest in studying this new agent outside of the clinical setting, however the supply of "2"2"3Ra is limited and expensive. We have engineered a "2"2"3Ra microgenerator using traces of "2"2"7Ac previously generated from cyclotron-produced "2"2"5Ac. Radiochemically pure "2"2"3RaCl_2 was made, characterized, evaluated in vivo, and the source was recovered in high yield for regeneration of the microgenerator. - Highlights: • A "2"2"3Ra microgenerator was built using residual "2"2"7Ac from cyclotron-produced "2"2"5Ac. • Following "2"2"5Ac decay, the residual "2"2"7Ac was processed into pure "2"2"3Ra. • "2"2"7Ac and "2"2"7Th were recovered in high yield for a permanent supply of "2"2"3Ra. • Clinically supplied and generator-produced "2"2"3Ra have equivalent in vivo distribution. • Microdose column provides sufficient material for research use.
Separation of protactinum, actinium, and other radionuclides from proton irradiated thorium target
Fassbender, Michael E.; Radchenko, Valery
2018-04-24
Protactinium, actinium, radium, radiolanthanides and other radionuclide fission products were separated and recovered from a proton-irradiated thorium target. The target was dissolved in concentrated HCl, which formed anionic complexes of protactinium but not with thorium, actinium, radium, or radiolanthanides. Protactinium was separated from soluble thorium by loading a concentrated HCl solution of the target onto a column of strongly basic anion exchanger resin and eluting with concentrated HCl. Actinium, radium and radiolanthanides elute with thorium. The protactinium that is retained on the column, along with other radionuclides, is eluted may subsequently treated to remove radionuclide impurities to afford a fraction of substantially pure protactinium. The eluate with the soluble thorium, actinium, radium and radiolanthanides may be subjected to treatment with citric acid to form anionic thorium, loaded onto a cationic exchanger resin, and eluted. Actinium, radium and radiolanthanides that are retained can be subjected to extraction chromatography to separate the actinium from the radium and from the radio lanthanides.
The marine geochemistry of actinium-227: Evidence for its migration through sediment pore water
International Nuclear Information System (INIS)
Nozaki, Yoshiyuki; Yamada, Masatoshi; Nikaido, Hirofumi
1990-01-01
227 Ac with a half life of 21.8 years has a potential utility as a tracer of deep water circulation and mixing studies on time scales less than 100 years. Here the authors present the first measurement of 227 Ac profile in the pore water of Northwest Pacific deep-sea sediment and in the ∼10,000 m long water column of Izu-Ogasawara Trench. The results clearly show that 227 Ac is supplied from the sediment to the overlying water through migration in the pore water. The model calculation indicates that the molecular diffusion alone through sediment porewater can support only a half of the standing crop of excess 227 Ac in the water column and the enhanced supply of 227 Ac by particle mixing is necessary to account for the remainder. Thus, bioturbation in the deep sea plays an important role in controlling the flux of some short-lived radionuclides such as 227 Ac and 228 Ra across the sediment-water interface
Short history of radioactivity. No. XIII. The actinium and thorium series
Energy Technology Data Exchange (ETDEWEB)
Chalmers, T W
1950-06-16
Discussions of the actinium disintegration series (about 1905), the /sup 235/U or actinium series (as it is accepted today), the disintegration of thorium (about 1905), the thorium series in the modern form, and the 4n, 4n + 1, 4n + 2, and 4n + 3 series are presented.
Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232
Energy Technology Data Exchange (ETDEWEB)
Harvey, James T.; Nolen, Jerry; Vandergrift, George; Gomes, Itacil; Kroc, Tom; Horwitz, Phil; McAlister, Dan; Bowers, Del; Sullivan, Vivian; Greene, John
2011-12-30
The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces {approx}100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 Ge
The sorption of polonium, actinium and protactinium onto geological materials
International Nuclear Information System (INIS)
Baston, G.M.N.; Berry, J.A.; Brownsword, M.; Heath, T.G.; Ilett, D.J.; McCrohon, R.; Tweed, C.J.; Yui, M.
1999-01-01
This paper describes a combined experimental and modeling program of generic sorption studies to increase confidence in the performance assessment for a potential high-level radioactive waste repository in Japan. The sorption of polonium, actinium and protactinium onto geological materials has been investigated. Sorption of these radioelements onto bentonite, tuff and granodiorite from equilibrated de-ionized water was studied under reducing conditions at room temperature. In addition, the sorption of actinium and protactinium was investigated at 60 C. Thermodynamic chemical modeling was carried out to aid interpretation of the results
The sorption of polonium, actinium and protactinium onto geological materials
Energy Technology Data Exchange (ETDEWEB)
Baston, G.M.N.; Berry, J.A.; Brownsword, M.; Heath, T.G.; Ilett, D.J.; McCrohon, R.; Tweed, C.J.; Yui, M.
1999-07-01
This paper describes a combined experimental and modeling program of generic sorption studies to increase confidence in the performance assessment for a potential high-level radioactive waste repository in Japan. The sorption of polonium, actinium and protactinium onto geological materials has been investigated. Sorption of these radioelements onto bentonite, tuff and granodiorite from equilibrated de-ionized water was studied under reducing conditions at room temperature. In addition, the sorption of actinium and protactinium was investigated at 60 C. Thermodynamic chemical modeling was carried out to aid interpretation of the results.
International Nuclear Information System (INIS)
2009-02-01
The presence of actinium-227 has been noticed in the Mont d'Arree region (Finistere district) and such a presence in the environment had never been reported before. Thus, a study has been performed to investigate the origin of this element: about 300 samples have been analysed. After an indication of the investigation chronology, the report outlines that there is no relationship between the excess of actinium-227 and land amendment or embankments, that there is no obvious relationship between this presence and radioactive liquid effluents or atmospheric effluents from the Brennilis nuclear site. It shows that there is an obvious relationship with the radiological quality. It states that this excess of actinium 227 is related to the management of rain waters about the Brennilis site. An appendix specifies the location, nature and agenda of samplings (bio-indicators, samplings in sludge, soils, food and tap water, aquatic foams and sediments, ponds, wet lands, and at the vicinity of the power plant channel), presents detailed results obtained by gamma spectrometry, and measurement equipment and methods
International Nuclear Information System (INIS)
Cuillerdier, C.; Musikas, C.
1993-01-01
Present invention is concerned with new amides with nitrogenous heterocyclic substituent utilizable to separate trivalent actinium series from trivalent lanthanides. In these molecules, it is possible to obtain particularly covalent liaison which has more affinity with 5f series, that is to say actinium series; included a manufacturing process for these amides with nitrogenous heterocyclic substituent
Analysis of the gamma spectra of the uranium, actinium, and thorium decay series
International Nuclear Information System (INIS)
Momeni, M.H.
1981-09-01
This report describes the identification of radionuclides in the uranium, actinium, and thorium series by analysis of gamma spectra in the energy range of 40 to 1400 keV. Energies and absolute efficiencies for each gamma line were measured by means of a high-resolution germanium detector and compared with those in the literature. A gamma spectroscopy method, which utilizes an on-line computer for deconvolution of spectra, search and identification of each line, and estimation of activity for each radionuclide, was used to analyze soil and uranium tailings, and ore
International Nuclear Information System (INIS)
2007-01-01
This study resumes the discovery of an excess of actinium 227 found around by EL4 nuclear reactor actually in dismantling. The search for the origin of this excess revealed a real inquiry of investigation during three years. Because a nuclear reactor existed in this area a particular attention will have concerned this region. The doubt became the line of conduct to find the answer to the human or natural origin of this excess. Finally and against any evidence, it appears that the origin of this phenomenon was natural, consequence of the particular local geology. The detail of the different investigations is given: search of a possible correlation with the composition of elevations constituent of lanes, search (and underlining) of new sites in the surroundings of the Rusquec pond and the Plouenez station, study of the atmospheric deposits under winds of the nuclear power plant and in the east direction, search of a possible relationship with the gaseous effluents of the nuclear power plant in the past, historical study of radioactive effluents releases in the fifty last years by the analysis of the sedimentary deposits in the Saint-Herbiot reservoir, search of a possible correlation between the excess of actinium 227 and the nuclear power plant activity; search of a possible correlation with a human activity without any relationship with the nuclear activities, search of a correlation with the underground waters, search of a correlation with the geological context, collect of information on the possible transfers in direction of the food chain, determination of the radiological composition of the underground waters ( not perturbed by human activity), search of the cause of an excess of actinium 227 in the old channel of liquid effluents release of the nuclear power plant. The results are given and discussed. And contrary to all expectations the origin of the excess of actinium 227 is completely natural. (N.C.)
Energy Technology Data Exchange (ETDEWEB)
NONE
2007-07-01
This study resumes the discovery of an excess of actinium 227 found around by EL4 nuclear reactor actually in dismantling. The search for the origin of this excess revealed a real inquiry of investigation during three years. Because a nuclear reactor existed in this area a particular attention will have concerned this region. The doubt became the line of conduct to find the answer to the human or natural origin of this excess. Finally and against any evidence, it appears that the origin of this phenomenon was natural, consequence of the particular local geology. The detail of the different investigations is given: search of a possible correlation with the composition of elevations constituent of lanes, search (and underlining) of new sites in the surroundings of the Rusquec pond and the Plouenez station, study of the atmospheric deposits under winds of the nuclear power plant and in the east direction, search of a possible relationship with the gaseous effluents of the nuclear power plant in the past, historical study of radioactive effluents releases in the fifty last years by the analysis of the sedimentary deposits in the Saint-Herbiot reservoir, search of a possible correlation between the excess of actinium 227 and the nuclear power plant activity; search of a possible correlation with a human activity without any relationship with the nuclear activities, search of a correlation with the underground waters, search of a correlation with the geological context, collect of information on the possible transfers in direction of the food chain, determination of the radiological composition of the underground waters ( not perturbed by human activity), search of the cause of an excess of actinium 227 in the old channel of liquid effluents release of the nuclear power plant. The results are given and discussed. And contrary to all expectations the origin of the excess of actinium 227 is completely natural. (N.C.)
Actinium-225 and Bismuth-213 Alpha Particle Immunotherapy of Cancer
International Nuclear Information System (INIS)
Scheinberg, D.
2013-01-01
Nuclides with appropriate half-lives and emission characteristics that would be potent enough to kill neoplastic cells in the small quantities that reach targets in vivo, include the high linear energy transfer (LET) alpha emitters such as Actinium-225 and Bi-213. We developed methods for the attachment of radiometals via bifunctional chelates to monoclonal antibodies (mAb) without loss of immunoreactivity. We developed alphaemitting Bi-213 lintuzumab constructs, characterized and qualified them in preclinical models, and took them into human clinical trials in patients with AML. Safety, anti-leukemic activity, and complete responses (CR’s) have been demonstrated through phase 2 trilas. Bi-213 is produced in a portable small generator device based on Ac- 225 in the hospital nuclear medicine lab. The isotope is then purified, attached to the antibody, and the product is qualified and processed. Despite this success, the major obstacle to the widespread use of these drugs remains the short 213 Bi half-life (46 minutes), which poses a large logistical hurdle before injection and limits its delivery to only the most accessible cancer cells after injection
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Introduction. 227.1 Section 227.1 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT COMPUTING SUPPLEMENTAL ANNUITIES § 227.1 Introduction. This part explains how to compute a supplemental annuity. A supplemental...
2010-01-01
... 7 Agriculture 4 2010-01-01 2010-01-01 false Administration. 227.3 Section 227.3 Agriculture... CHILD NUTRITION PROGRAMS NUTRITION EDUCATION AND TRAINING PROGRAM General § 227.3 Administration. (a) Within the Department, FNS shall act on behalf of the Department in the administration of the Program. (b...
LASL experience in decontamination of the environment
International Nuclear Information System (INIS)
Ahlquist, A.J.
1981-01-01
This discussion represents one part of a major effort in soil decontamination at the Los Alamos site. A contaminated industrial waste line in the Los Alamos townsite was removed, and a plutonium incineration facility, and a filter building contaminated with actinium-227 were dismantled. The former plutonium handling facility has been decontaminated, and canyons and an old firing site contaminated with strontium-90 have been surveyed
48 CFR 227.7207 - Contractor data repositories.
2010-10-01
... repositories. 227.7207 Section 227.7207 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS... Computer Software and Computer Software Documentation 227.7207 Contractor data repositories. Follow 227.7108 when it is in the Government's interests to have a data repository include computer software or to...
49 CFR 227.7 - Preemptive effect.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Preemptive effect. 227.7 Section 227.7 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION OCCUPATIONAL NOISE EXPOSURE General § 227.7 Preemptive effect. Under 49 U.S.C...
Shape of intrinsic alpha pulse height spectra in lanthanide halide scintillators
Wolszczak, W.; Dorenbos, P.
2017-06-01
Internal contamination with actinium-227 and its daughters is a serious drawback in low-background applications of lanthanide-based scintillators. In this work we showed the important role of nuclear γ de-excitations on the shape of the internal alpha spectrum measured in scintillators. We calculated with Bateman equations the activities of contamination isotopes and the time evolution of actinium-227 and its progenies. Next, we measured the intrinsic background spectra of LaBr3(Ce), LaBr3(Ce,Sr) and CeBr3 with a digital spectroscopy technique, and we analyzed them with a pulse shape discrimination method (PSD) and a time-amplitude analysis. Finally, we simulated the α background spectrum with Geant4 tool-kit, consequently taking into account complex α-γ-electron events, the α / β ratio dependence on the α energy, and the electron/γ nonproportionality. We found that α-γ mixed events have higher light yield than expected for alpha particles alone, which leads to overestimation of the α / β ratio when it is measured with internal 227Th and 223Ra isotopes. The time-amplitude analysis showed that the α peaks of 219Rn and 215Po in LaBr3(Ce) and LaBr3(Ce,Sr) are not symmetric. We compared the simulation results with the measured data and provided further evidence of the important role of mixed α-γ-electron events for understanding the shape of the internal α spectrum in scintillators.
12 CFR 227.2 - Consumer complaint procedure.
2010-01-01
... convenience of the user, the revised text is set forth as follows: § 227.2 Consumer-complaint procedure. (a... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Consumer complaint procedure. 227.2 Section 227... SYSTEM UNFAIR OR DECEPTIVE ACTS OR PRACTICES (REGULATION AA) General Provisions § 227.2 Consumer...
Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL
International Nuclear Information System (INIS)
Raeder, S.; Bastin, B.; Block, M.; Creemers, P.; Delahaye, P.; Ferrer, R.; Fléchard, X.; Franchoo, S.; Ghys, L.; Gaffney, L.P.; Granados, C.; Heinke, R.; Hijazi, L.
2016-01-01
To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.
Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL
Energy Technology Data Exchange (ETDEWEB)
Raeder, S., E-mail: s.raeder@gsi.de [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Bastin, B. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Block, M. [Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Institut für Kernchemie, Johannes Gutenberg Universität, 55128 Mainz (Germany); Creemers, P. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Delahaye, P. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Ferrer, R. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Fléchard, X. [LPC Caen, ENSICAEN, Université de Caen, CNRS/IN2P3, Caen (France); Franchoo, S. [Institute de Physique Nucléaire (IPN) d’Orsay, 91406 Orsay, Cedex (France); Ghys, L. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); SCK-CEN, Belgian Nuclear Research Center, Boeretang 200, 2400 Mol (Belgium); Gaffney, L.P.; Granados, C. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Heinke, R. [Institut für Physik, Johannes Gutenberg Universität, 55128 Mainz (Germany); Hijazi, L. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); and others
2016-06-01
To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.
47 CFR 25.227-25.249 - [Reserved
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false [Reserved] 25.227-25.249 Section 25.227-25.249 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Technical Standards §§ 25.227-25.249 [Reserved] ...
48 CFR 227.7108 - Contractor data repositories.
2010-10-01
... repositories. 227.7108 Section 227.7108 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS... Technical Data 227.7108 Contractor data repositories. (a) Contractor data repositories may be established when permitted by agency procedures. The contractual instrument establishing the data repository must...
7 CFR 1280.227 - Confidentiality.
2010-01-01
... statistical data collected therefrom, which statements do not identify the information furnished by any person... 7 Agriculture 10 2010-01-01 2010-01-01 false Confidentiality. 1280.227 Section 1280.227 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING...
2010-10-01
... the general railroad system of transportation; (2) A rapid transit operation in an urban area that is... 49 Transportation 4 2010-10-01 2010-10-01 false Application. 227.3 Section 227.3 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF...
7 CFR 227.41 - Recovery of funds.
2010-01-01
... 7 Agriculture 4 2010-01-01 2010-01-01 false Recovery of funds. 227.41 Section 227.41 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS NUTRITION EDUCATION AND TRAINING PROGRAM Miscellaneous § 227.41 Recovery of...
48 CFR 227.7103-6 - Contract clauses.
2010-10-01
... software or computer software documentation (see 227.72), commercial items (see 227.7102-3), existing works...-engineer and construction contracts. (b)(1) Use the clause at 252.227-7013 with its Alternate I in research... Software Previously Delivered to the Government, in solicitations when the resulting contract will require...
48 CFR 252.227-7000 - Non-estoppel.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Non-estoppel. 252.227-7000... Clauses 252.227-7000 Non-estoppel. As prescribed at 227.7009-1, insert the following clause in patent releases, license agreements, and assignments: Non-Estoppel (OCT 1966) The Government reserves the right at...
48 CFR 227.7206 - Contracts for architect-engineer services.
2010-10-01
... Rights in Computer Software and Computer Software Documentation 227.7206 Contracts for architect-engineer services. Follow 227.7107 when contracting for architect-engineer services. ...-engineer services. 227.7206 Section 227.7206 Federal Acquisition Regulations System DEFENSE ACQUISITION...
20 CFR 227.5 - Employer tax credits.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Employer tax credits. 227.5 Section 227.5... SUPPLEMENTAL ANNUITIES § 227.5 Employer tax credits. Employers are entitled to tax credits if they pay non.... The tax credits for each month equal the sum of the reductions for employer pensions in the...
48 CFR 252.227-7020 - Rights in special works.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Rights in special works... of Provisions And Clauses 252.227-7020 Rights in special works. As prescribed in 227.7105-3, 227.7106(a) or 227.7205(a), use the following clause: Rights in Special Works (JUN 1995) (a) Applicability...
40 CFR 227.21 - Uses considered.
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Uses considered. 227.21 Section 227.21 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) OCEAN DUMPING CRITERIA FOR THE... living marine resources; (k) Actual or anticipated exploitation of non-living resources, including...
40 CFR 227.18 - Factors considered.
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Factors considered. 227.18 Section 227.18 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) OCEAN DUMPING CRITERIA FOR... in the material of any constituents which might significantly affect living marine resources of...
40 CFR 227.4 - Criteria for evaluating environmental impact.
2010-07-01
... impact. 227.4 Section 227.4 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) OCEAN... Impact § 227.4 Criteria for evaluating environmental impact. This subpart B sets specific environmental... of direct environmental impact. ...
48 CFR 227.7107 - Contracts for architect-engineer services.
2010-10-01
...-engineer services. 227.7107 Section 227.7107 Federal Acquisition Regulations System DEFENSE ACQUISITION... Rights in Technical Data 227.7107 Contracts for architect-engineer services. This section sets forth... of construction and architect-engineer services. ...
36 CFR 223.227 - Sale advertisement.
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Sale advertisement. 223.227... DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER Special Forest Products Advertisement and Bids § 223.227 Sale advertisement. (a) The Forest Service shall advertise any special forest products sales with an appraised value...
27 CFR 44.227 - Customs procedure.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Customs procedure. 44.227..., WITHOUT PAYMENT OF TAX, OR WITH DRAWBACK OF TAX Drawback of Tax § 44.227 Customs procedure. The customs... having inspected the articles and supervised the lading thereof on the export carrier, the customs...
48 CFR 52.227-19 - Commercial Computer Software License.
2010-10-01
... Software License. 52.227-19 Section 52.227-19 Federal Acquisition Regulations System FEDERAL ACQUISITION... Clauses 52.227-19 Commercial Computer Software License. As prescribed in 27.409(g), insert the following clause: Commercial Computer Software License (DEC 2007) (a) Notwithstanding any contrary provisions...
18 CFR 284.227 - Certain transportation by intrastate pipelines.
2010-04-01
... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Certain transportation by intrastate pipelines. 284.227 Section 284.227 Conservation of Power and Water Resources FEDERAL... Interstate Pipelines on Behalf of Others and Services by Local Distribution Companies § 284.227 Certain...
40 CFR 227.17 - Basis for determination.
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Basis for determination. 227.17 Section 227.17 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) OCEAN DUMPING... living marine resources. (b) For all proposed dumping, full consideration will be given to such...
25 CFR 227.22 - Diligence and prevention of waste.
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Diligence and prevention of waste. 227.22 Section 227.22... IN WIND RIVER INDIAN RESERVATION, WYOMING, FOR OIL AND GAS MINING Operations § 227.22 Diligence and prevention of waste. The lessee shall exercise diligence in drilling and operating wells for oil and gas on...
42 CFR 93.227 - Secretary or HHS.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Secretary or HHS. 93.227 Section 93.227 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON RESEARCH...
48 CFR 227.7102-3 - Contract clause.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Contract clause. 227.7102..., DEPARTMENT OF DEFENSE GENERAL CONTRACTING REQUIREMENTS PATENTS, DATA, AND COPYRIGHTS Rights in Technical Data 227.7102-3 Contract clause. (a)(1) Except as provided in paragraph (b) of this subsection, use the...
40 CFR 227.22 - Assessment of impact.
2010-07-01
... FOR THE EVALUATION OF PERMIT APPLICATIONS FOR OCEAN DUMPING OF MATERIALS Impact of the Proposed Dumping on Other Uses of the Ocean § 227.22 Assessment of impact. The assessment of impact on other uses... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Assessment of impact. 227.22 Section...
Energy Technology Data Exchange (ETDEWEB)
NONE
2006-07-01
In a previous study which concerned the catchment basin of the harbour of Brest, the A.C.R.O. put in evidence a marking by artificial radioelements around the power plant of Brennilis which can be imputed without ambiguities to the nuclear installation. It also put in evidence abnormalities concerning the natural radioactivity which justifies this new study. In the area of the Monts d'Arree, actinium 227 ({sup 227}Ac), non born by its ascendents which are {sup 235}U and {sup 231}Pa is observed. This phenomenon is characterized by mass activities superior to these ones of {sup 235}U and able to reach these ones of {sup 238}U. Its presence corresponds with the drainage of the Ellez river since the former channel of radioactive effluents releases from the nuclear power plant EL-4 up to the reservoir Saint-Herblot situated 6 km downstream. The strongest values of radioactivity are registered near the disused power plant, at this place a relationship exists between the level of actinium 227 and this one of the artificial radioactivity as it exists a relationship with the decay products of radon exhaled from the subsoil ({sup 210}Pb). But its presence is not limited to a part of the Ellez river, it is equally observed in terrestrial medium, in places in priori not influenced by the direct liquid effluents of the power plant. This place is situated at more than 4 km and without any connection with the Ellez waters. At this stage of the study, it is not possible to answer with certainty the question of the origin of this phenomenon. A new reorientation is considered indispensable to clarify definitively the origin of this unknown phenomenon in the scientific publications and the environmental monitoring. (N.C.)
International Nuclear Information System (INIS)
2006-01-01
In a previous study which concerned the catchment basin of the harbour of Brest, the A.C.R.O. put in evidence a marking by artificial radioelements around the power plant of Brennilis which can be imputed without ambiguities to the nuclear installation. It also put in evidence abnormalities concerning the natural radioactivity which justifies this new study. In the area of the Monts d'Arree, actinium 227 ( 227 Ac), non born by its ascendents which are 235 U and 231 Pa is observed. This phenomenon is characterized by mass activities superior to these ones of 235 U and able to reach these ones of 238 U. Its presence corresponds with the drainage of the Ellez river since the former channel of radioactive effluents releases from the nuclear power plant EL-4 up to the reservoir Saint-Herblot situated 6 km downstream. The strongest values of radioactivity are registered near the disused power plant, at this place a relationship exists between the level of actinium 227 and this one of the artificial radioactivity as it exists a relationship with the decay products of radon exhaled from the subsoil ( 210 Pb). But its presence is not limited to a part of the Ellez river, it is equally observed in terrestrial medium, in places in priori not influenced by the direct liquid effluents of the power plant. This place is situated at more than 4 km and without any connection with the Ellez waters. At this stage of the study, it is not possible to answer with certainty the question of the origin of this phenomenon. A new reorientation is considered indispensable to clarify definitively the origin of this unknown phenomenon in the scientific publications and the environmental monitoring. (N.C.)
48 CFR 52.227-17 - Rights in Data-Special Works.
2010-10-01
....227-17 Rights in Data—Special Works. As prescribed in 27.409(e), insert the following clause: Rights... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Rights in Data-Special Works. 52.227-17 Section 52.227-17 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION...
48 CFR 1852.227-17 - Rights in data-Special works.
2010-10-01
... and Clauses 1852.227-17 Rights in data—Special works. As prescribed in 1827.409(i), add the following... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Rights in data-Special works. 1852.227-17 Section 1852.227-17 Federal Acquisition Regulations System NATIONAL AERONAUTICS AND...
48 CFR 52.227-18 - Rights in Data-Existing Works.
2010-10-01
....227-18 Rights in Data—Existing Works. As prescribed in 27.409(f), insert the following clause: Rights... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Rights in Data-Existing Works. 52.227-18 Section 52.227-18 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION...
20 CFR 227.2 - Initial supplemental annuity rate.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Initial supplemental annuity rate. 227.2... COMPUTING SUPPLEMENTAL ANNUITIES § 227.2 Initial supplemental annuity rate. The supplemental annuity rate... supplemental annuity rate is $43 for an employee with 30 or more years of service. ...
22 CFR 227.300 - Professional and technical services.
2010-04-01
... and analysis directly applying any professional or technical discipline. For example, drafting or a... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Professional and technical services. 227.300... Activities by Other Than Own Employees § 227.300 Professional and technical services. (a) The prohibition on...
40 CFR 86.227-94 - Test procedures; overview.
2010-07-01
... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Test procedures; overview. 86.227-94 Section 86.227-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS... 1994 and Later Model Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium...
40 CFR 227.6 - Constituents prohibited as other than trace contaminants.
2010-07-01
... trace contaminants. 227.6 Section 227.6 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... Environmental Impact § 227.6 Constituents prohibited as other than trace contaminants. (a) Subject to the..., of materials containing the following constituents as other than trace contaminants will not be...
20 CFR 227.4 - Reduction for employer pension.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Reduction for employer pension. 227.4 Section... COMPUTING SUPPLEMENTAL ANNUITIES § 227.4 Reduction for employer pension. (a) General. The supplemental annuity for each month is reduced by the amount of any private pension the employee is receiving for that...
22 CFR 227.205 - Professional and technical services.
2010-04-01
..., drafting of a legal document accompanying a bid or proposal by a lawyer is allowable. Similarly, technical... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Professional and technical services. 227.205... Activities by Own Employees § 227.205 Professional and technical services. (a) The prohibition on the use of...
48 CFR 52.227-13 - Patent Rights-Ownership by the Government.
2010-10-01
... domestic subsidiaries and affiliates within the corporate structure of which the Contractor is a part, and... the Government. 52.227-13 Section 52.227-13 Federal Acquisition Regulations System FEDERAL ACQUISITION... Clauses 52.227-13 Patent Rights—Ownership by the Government. As prescribed at 27.303(e), insert the...
25 CFR 227.16 - Crediting advance annual payments.
2010-04-01
... equal such advance payment; nor will any part of the moneys so paid be refunded to the lessee because of... 25 Indians 1 2010-04-01 2010-04-01 false Crediting advance annual payments. 227.16 Section 227.16... Crediting advance annual payments. In the event of discovery of minerals in paying quantities all advance...
48 CFR 227.7204 - Contracts under the Small Business Innovative Research Program.
2010-10-01
... Business Innovative Research Program. 227.7204 Section 227.7204 Federal Acquisition Regulations System... under the Small Business Innovative Research Program. When contracting under the Small Business Innovative Research Program, follow the procedures at 227-7104. ...
Preparation of 227Ac/223Ra by neutron irradiation of 226Ra
International Nuclear Information System (INIS)
Ekaterina Kukleva; Jan Kozempel; Martin Vlk; Petra Micolova; Dusan Vopalka
2015-01-01
Radium-223 is a prospective alpha-emitter for targeted radionuclide therapy. Although 223 Ra is formed naturally by the decay of 235 U, for practical reasons its preparation involves neutron irradiation of 226 Ra. The β - decay of the 227 Ra (T ½ = 43 min) produced via 226 Ra(n,γ) 227 Ra reaction leads to 227 Ac, a mother nuclide of 227 Th and subsequently 223 Ra. Radium target material is generally available in multigram quantities from historical stock. The main aim of this study was to experimentally as well as theoretically evaluate and verify the available literature data on production of 227 Ac/ 223 Ra. According to the data obtained from the γ-spectra, the approximate yield values were determined and effective cross section value for the 227 Ac production was calculated to 14 ± 4 b. (author)
Levels in 223Th populated by α decay of 227U
Kalaninová, Z.; Antalic, S.; Heßberger, F. P.; Ackermann, D.; Andel, B.; Kindler, B.; Laatiaoui, M.; Lommel, B.; Maurer, J.
2015-07-01
Levels in 223Th populated by the α decay of 227U were investigated using α -γ decay spectroscopy. The 227U isotope was produced in the fusion-evaporation reaction 22Ne +208Pb at the velocity filter separator for heavy-ion reaction products at Gesellschaft für Schwerionenforschung in Darmstadt (Germany). Several new excited levels and γ transitions were identified in 223Th . An improved α -decay scheme of 227U was suggested. The experimental α -decay energy spectrum of 227U was compared with the Monte Carlo simulation performed using the toolkit geant4.
Journal of Naval Science. Volume 2. Number 3. July 1976
1976-07-01
supplementary food to the beakers containing stage VI nauplii: cyprids do not feed. The larvae in each beaker were con- fined within a close-fitting plastic...99-274% of Natural U) Uranium-234 (234U) (0-006% of Natural U) 2-48 X 10"’yrs Thorium-230 (230Th) Polonium -218(2I8Po) /through short lived...Natural U) Actinium-227 (--7Ac) FIG. 1. Nuclide chart. 4-51 X 10’Yrs 7 hours P 8 X 10’ Yrs 4 days Lead- 210 (210Pb) (22 yrs,/3"). 1-39 X 10
40 CFR 98.227 - Records that must be retained.
2010-07-01
... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Records that must be retained. 98.227 Section 98.227 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS... significant changes to process. (b) Documentation of how process knowledge was used to estimate abatement...
48 CFR 252.227-7007 - License term-running royalty.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false License term-running... of Provisions And Clauses 252.227-7007 License term—running royalty. As prescribed at 227.7009-4(b), insert the following clause in patent releases, license agreements, and assignments: License Term—Running...
48 CFR 227.7102-2 - Rights in technical data.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Rights in technical data... Technical Data 227.7102-2 Rights in technical data. (a) The clause at 252.227-7015, Technical Data—Commercial Items, provides the Government specific license rights in technical data pertaining to commercial...
Preparation of 227Ac by neutron irradiation of 226Ra
International Nuclear Information System (INIS)
Kukleva, E.; Kozempel, J.; Vlk, M.; Micolova, P.; Vopalka, D.
2015-01-01
Radium-223 is prospective alpha-emitting therapeutic radionuclide for targeted radionuclide therapy. Although 223 Ra is formed naturally by the decay of 235 U, for practical reasons its preparation involves neutron irradiation of 226 Ra. The α-decay of the 227 Ra (T 12 = 43 min.) produced via 226 Ra(n,γ) 227 Ra reaction leads to 227 Ac, a mother nuclide of 227 Th and 223 Ra subsequently. Irradiation target radium material is generally available in multi-gram quantities from historical stock. Main aim of this study was to experimentally and theoretically evaluate and verify available literature data on production of 223 Ra. According to data obtained from γ-spectra, the approximate yield values were determined and effective cross-section for the 223 Ra production was calculated. (authors)
48 CFR 252.227-7006 - License grant-running royalty.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false License grant-running... of Provisions And Clauses 252.227-7006 License grant—running royalty. As prescribed at 227.7009-4(a...—Running Royalty (AUG 1984) (a) The Contractor hereby grants to the Government, as represented by the...
48 CFR 252.227-7033 - Rights in shop drawings.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Rights in shop drawings... of Provisions And Clauses 252.227-7033 Rights in shop drawings. As prescribed in 227.7107-(1)(c), use the following clause: Rights in Shop Drawings (APR 1966) (a) Shop drawings for construction means...
48 CFR 227.7104 - Contracts under the Small Business Innovation Research (SBIR) Program.
2010-10-01
... Business Innovation Research (SBIR) Program. 227.7104 Section 227.7104 Federal Acquisition Regulations... Data and Computer Software—Small Business Innovation Research (SBIR) Program, when technical data or... PATENTS, DATA, AND COPYRIGHTS Rights in Technical Data 227.7104 Contracts under the Small Business...
48 CFR 252.227-7012 - Patent license and release contract.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Patent license and release contract. 252.227-7012 Section 252.227-7012 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text...
20 CFR 725.227 - Time of determination of relationship and dependency of survivors.
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Time of determination of relationship and dependency of survivors. 725.227 Section 725.227 Employees' Benefits EMPLOYMENT STANDARDS ADMINISTRATION... Benefits) § 725.227 Time of determination of relationship and dependency of survivors. The determination as...
New method for large scale production of medically applicable Actinium-225 and Radium-223
International Nuclear Information System (INIS)
Aliev, R.A.; Vasilyev, A.N.; Ostapenko, V.; Kalmykov, S.N.; Zhuikov, B.L.; Ermolaev, S.V.; Lapshina, E.V.
2014-01-01
Alpha-emitters ( 211 At, 212 Bi, 213 Bi, 223 Ra, 225 Ac) are promising for targeted radiotherapy of cancer. Only two alpha decays near a cell membrane result in 50% death of cancer cell and only a single decay inside the cell is required for this. 225 Ac may be used either directly or as a mother radionuclide in 213 Bi isotope generator. Production of 225 Ac is provided by three main suppliers - Institute for Transuranium Elements in Germany, Oak Ridge National Laboratory in USA and Institute of Physics and Power Engineering in Obninsk, Russia. The current worldwide production of 225 Ac is approximately 1.7 Ci per year that corresponds to only 100-200 patients that could be treated annually. The common approach for 225 Ac production is separation from mother 229 Th or irradiation of 226 Ra with protons in a cyclotron. Both the methods have some practical limitations to be applied routinely. 225 Ac can be also produced by irradiation of natural thorium with medium energy protons . Cumulative cross sections of 225 Ac, 227 Ac, 227 Th, 228 Th formations have been obtained recently. Thorium targets (1-9 g) were irradiated by 114-91 MeV proton beam (1-50 μA) at INR linear accelerator. After dissolution in 8 M HNO 3 + 0.004 M HF thorium was removed by double LLX by HDEHP in toluene (1:1). Ac and REE were pre-concentrated and separated from Ra and most fission products by DGA-Resin (Triskem). After washing out by 0.01 M HNO 3 Ac was separated from REE by TRU Resin (Triskem) in 3 M HNO 3 media. About 6 mCi 225 Ac were separated in hot cell with chemical yield 85%. The method may be upscaled for production of Ci amounts of the radionuclide. The main impurity is 227 Ac (0.1% at the EOB) but it does not hinder 225 Ac from being used for medical 225 Ac/ 213 Bi generators. (author)
48 CFR 252.227-7027 - Deferred ordering of technical data or computer software.
2010-10-01
... technical data or computer software. 252.227-7027 Section 252.227-7027 Federal Acquisition Regulations... data or computer software. As prescribed at 227.7103-8(b), use the following clause: Deferred Ordering of Technical Data or Computer Software (APR 1988) In addition to technical data or computer software...
48 CFR 252.227-7026 - Deferred delivery of technical data or computer software.
2010-10-01
... technical data or computer software. 252.227-7026 Section 252.227-7026 Federal Acquisition Regulations... data or computer software. As prescribed at 227.7103-8(a), use the following clause: Deferred Delivery of Technical Data or Computer Software (APR 1988) The Government shall have the right to require, at...
2010-10-01
... holds a royalty-free license or charges for data which it has a right to use and disclose to others, or which is in the public domain, or which the Government has acquired without restriction upon its use and...) and the International Traffic in Arms Regulations (see 227.675). ...
2010-10-01
..., otolaryngologist, or a physician with experience and expertise in hearing and hearing loss. Qualified Technician is a person who is certified by the Council for Accreditation in Occupational Hearing Conservation or... TRANSPORTATION OCCUPATIONAL NOISE EXPOSURE General § 227.5 Definitions. As used in this part— Action level means...
25 CFR 227.10 - Minerals other than oil and gas.
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Minerals other than oil and gas. 227.10 Section 227.10 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND MINERALS LEASING OF CERTAIN LANDS... Minerals other than oil and gas. Unreserved, unwithdrawn, and unallotted lands which have not been leased...
2010-10-01
... Contracts 227.304-1 General. Interim and final invention reports and notification of all subcontracts for... of Inventions and Subcontracts. [56 FR 36389, July 31, 1991, as amended at 57 FR 53600, Nov. 12, 1992] ...
In vivo detection of prion amyloid plaques using [11C]BF-227 PET
International Nuclear Information System (INIS)
Okamura, Nobuyuki; Yanai, Kazuhiko; Shiga, Yusei; Itoyama, Yasuhito; Furumoto, Shozo; Tashiro, Manabu; Tsuboi, Yoshio; Furukawa, Katsutoshi; Arai, Hiroyuki; Iwata, Ren; Kudo, Yukitsuka; Doh-ura, Katsumi
2010-01-01
In vivo detection of pathological prion protein (PrP) in the brain is potentially useful for the diagnosis of transmissible spongiform encephalopathies (TSEs). However, there are no non-invasive ante-mortem means for detection of pathological PrP deposition in the brain. The purpose of this study is to evaluate the amyloid imaging tracer BF-227 with positron emission tomography (PET) for the non-invasive detection of PrP amyloid in the brain. The binding ability of BF-227 to PrP amyloid was investigated using autoradiography and fluorescence microscopy. Five patients with TSEs, including three patients with Gerstmann-Straeussler-Scheinker disease (GSS) and two patients with sporadic Creutzfeldt-Jakob disease (CJD), underwent [ 11 C]BF-227 PET scans. Results were compared with data from 10 normal controls and 17 patients with Alzheimer's disease (AD). The regional to pons standardized uptake value ratio was calculated as an index of BF-227 retention. Binding of BF-227 to PrP plaques was confirmed using brain samples from autopsy-confirmed GSS cases. In clinical PET study, significantly higher retention of BF-227 was detected in the cerebellum, thalamus and lateral temporal cortex of GSS patients compared to that in the corresponding tissues of normal controls. GSS patients also showed higher retention of BF-227 in the cerebellum, thalamus and medial temporal cortex compared to AD patients. In contrast, the two CJD patients showed no obvious retention of BF-227 in the brain. Although [ 11 C]BF-227 is a non-specific imaging marker of cerebral amyloidosis, it is useful for in vivo detection of PrP plaques in the human brain in GSS, based on the regional distribution of the tracer. PET amyloid imaging might provide a means for both early diagnosis and non-invasive disease monitoring of certain forms of TSEs. (orig.)
12 CFR Supplement I to Part 227 - Official Staff Commentary
2010-01-01
... balance at the previously disclosed variable rate determined using a 5-point margin (pursuant to § 227.24... purchase balance (which remains at the variable rate determined using the 6-point margin) or the $200... points and applies that rate to any remaining portion of the $3,000 purchase balance (pursuant to § 227...
48 CFR 252.227-7021 - Rights in data-existing works.
2010-10-01
... of Provisions And Clauses 252.227-7021 Rights in data—existing works. As prescribed at 227.7105-2(a), use the following clause: Rights in Data—Existing Works (MAR 1979) (a) The term works as used herein... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Rights in data-existing...
2010-04-01
... RESERVATION, WYOMING, FOR OIL AND GAS MINING § 227.1 Definitions. (a) The term “superintendent” in this part... may have jurisdiction over the Shoshone or Wind River Reservation. (b) The term “supervisor” in this... gas mining leases, to furnish scientific and technical information and advice, to ascertain and record...
48 CFR 227.7107-2 - Contracts for construction supplies and research and development work.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Contracts for construction supplies and research and development work. 227.7107-2 Section 227.7107-2 Federal Acquisition Regulations... PATENTS, DATA, AND COPYRIGHTS Rights in Technical Data 227.7107-2 Contracts for construction supplies and...
2010-10-01
... OF DEFENSE GENERAL CONTRACTING REQUIREMENTS PATENTS, DATA, AND COPYRIGHTS Rights in Computer Software and Computer Software Documentation 227.7202-1 Policy. (a) Commercial computer software or commercial computer software documentation shall be acquired under the licenses customarily provided to the public...
30 CFR 227.101 - What royalty management functions may MMS delegate to a State?
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What royalty management functions may MMS delegate to a State? 227.101 Section 227.101 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF... § 227.101 What royalty management functions may MMS delegate to a State? (a) If there are oil and gas...
7 CFR 227.5 - Program funding.
2010-01-01
... Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS NUTRITION EDUCATION AND TRAINING PROGRAM General § 227.5 Program funding. (a... related support personnel costs including fringe benefits and travel expenses, (ii) Undertaking a needs...
In vivo detection of prion amyloid plaques using [{sup 11}C]BF-227 PET
Energy Technology Data Exchange (ETDEWEB)
Okamura, Nobuyuki; Yanai, Kazuhiko [Tohoku University School of Medicine, Department of Pharmacology, Sendai (Japan); Shiga, Yusei; Itoyama, Yasuhito [Tohoku University School of Medicine, Department of Neurology, Sendai (Japan); Furumoto, Shozo [Tohoku University School of Medicine, Department of Pharmacology, Sendai (Japan); Tohoku University, Division of Radiopharmaceutical Chemistry, Cyclotron and Radioisotope Center, Sendai (Japan); Tashiro, Manabu [Tohoku University, Division of Cyclotron Nuclear Medicine, Cyclotron and Radioisotope Center, Sendai (Japan); Tsuboi, Yoshio [Fukuoka University School of Medicine, Department of Neurology, Fukuoka (Japan); Furukawa, Katsutoshi; Arai, Hiroyuki [Institute of Development, Aging, and Cancer, Tohoku University, Department of Geriatrics and Gerontology, Division of Brain Sciences, Sendai (Japan); Iwata, Ren [Tohoku University, Division of Radiopharmaceutical Chemistry, Cyclotron and Radioisotope Center, Sendai (Japan); Kudo, Yukitsuka [Tohoku University, Innovation of New Biomedical Engineering Center, Sendai (Japan); Doh-ura, Katsumi [Tohoku University School of Medicine, Department of Prion Research, 2-1 Seiryo-machi, Aoba-ku, Sendai (Japan)
2010-05-15
In vivo detection of pathological prion protein (PrP) in the brain is potentially useful for the diagnosis of transmissible spongiform encephalopathies (TSEs). However, there are no non-invasive ante-mortem means for detection of pathological PrP deposition in the brain. The purpose of this study is to evaluate the amyloid imaging tracer BF-227 with positron emission tomography (PET) for the non-invasive detection of PrP amyloid in the brain. The binding ability of BF-227 to PrP amyloid was investigated using autoradiography and fluorescence microscopy. Five patients with TSEs, including three patients with Gerstmann-Straeussler-Scheinker disease (GSS) and two patients with sporadic Creutzfeldt-Jakob disease (CJD), underwent [{sup 11}C]BF-227 PET scans. Results were compared with data from 10 normal controls and 17 patients with Alzheimer's disease (AD). The regional to pons standardized uptake value ratio was calculated as an index of BF-227 retention. Binding of BF-227 to PrP plaques was confirmed using brain samples from autopsy-confirmed GSS cases. In clinical PET study, significantly higher retention of BF-227 was detected in the cerebellum, thalamus and lateral temporal cortex of GSS patients compared to that in the corresponding tissues of normal controls. GSS patients also showed higher retention of BF-227 in the cerebellum, thalamus and medial temporal cortex compared to AD patients. In contrast, the two CJD patients showed no obvious retention of BF-227 in the brain. Although [{sup 11}C]BF-227 is a non-specific imaging marker of cerebral amyloidosis, it is useful for in vivo detection of PrP plaques in the human brain in GSS, based on the regional distribution of the tracer. PET amyloid imaging might provide a means for both early diagnosis and non-invasive disease monitoring of certain forms of TSEs. (orig.)
48 CFR 227.7203-9 - Copyright.
2010-10-01
... Software and Computer Software Documentation 227.7203-9 Copyright. (a) Copyright license. (1) The clause at... rights licenses obtained under the clause. When non-standard license rights in computer software or computer software documentation will be negotiated, negotiate the extent of the copyright license...
40 CFR 227.16 - Basis for determination of need for ocean dumping.
2010-07-01
... and methods of disposal or recycling available, including without limitation, storage until treatment facilities are completed, which have less adverse environmental impact or potential risk to other parts of... ocean dumping. 227.16 Section 227.16 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY...
48 CFR 227.7009-3 - Additional clauses-contracts except running royalty contracts.
2010-10-01
...-contracts except running royalty contracts. 227.7009-3 Section 227.7009-3 Federal Acquisition Regulations...—contracts except running royalty contracts. The following clauses are examples for use in patent release and settlement agreements, and license agreements not providing for payment by the Government of a running...
48 CFR 952.227-84 - Notice of right to request patent waiver.
2010-10-01
... patent waiver. 952.227-84 Section 952.227-84 Federal Acquisition Regulations System DEPARTMENT OF ENERGY... Notice of right to request patent waiver. Include this provision in all appropriate solicitations in accordance with 48 CFR 927.409(t). Right To Request Patent Waiver (FEB 1998) Offerors have the right to...
48 CFR 227.7203-5 - Government rights.
2010-10-01
... Software and Computer Software Documentation 227.7203-5 Government rights. The standard license rights in..., or restricted rights. The standard license in computer software documentation conveys unlimited...) Unlimited rights. The Government obtains an unlimited rights license in— (1) Computer software developed...
40 CFR 227.13 - Dredged materials.
2010-07-01
... by the U.S. Army Corps of Engineers using the criteria of applicable sections of parts 227 and 228... material with particle sizes larger than silt, and the material is found in areas of high current or wave energy such as streams with large bed loads or coastal areas with shifting bars and channels; or (2...
Measurements of multipolarities in 227Ra as tests of evidence for stable octupole deformation
International Nuclear Information System (INIS)
Borge, M.J.G.; Burke, D.G.; Gietz, H.; Hill, P.; Kaffrell, N.
1987-01-01
Multipolarities of ∝30 transitions in 227 Ra have been established by measuring conversion electrons following the β - decay of 227 Fr. For this purpose a 'mini-orange'-type electron spectrometer has been constructed. The 227 Fr isotopes were produced by the ISOLDE on-line separator at the CERN Synchro-cyclotron. Internal conversion coefficients were obtained from singles spectra and also from simultaneous γe - and γγ coincidence measurements. The new results support the placement of levels and transitions in the earlier level scheme but require changes in the previously assigned parities for four of the levels. Also, one E0 transition was identified. The results are consistent with previous interpretations for most of the levels that have been used to argue in favour of a small permanent octupole deformation for 227 Ra. (orig.)
25 CFR 227.14 - Government reserves right to purchase oil and gas.
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Government reserves right to purchase oil and gas. 227.14... § 227.14 Government reserves right to purchase oil and gas. In time of war or other public emergency any... posted market price on the date of sale all or any part of the minerals produced under any lease. Rents...
48 CFR 227.7103-5 - Government rights.
2010-10-01
... performance of a contract when the study, analysis, test, or similar work was specified as an element of..., DEPARTMENT OF DEFENSE GENERAL CONTRACTING REQUIREMENTS PATENTS, DATA, AND COPYRIGHTS Rights in Technical Data... 252.227-7013, Rights in Technical Data—Noncommercial Items. In unusual situations, the standards...
48 CFR 227.7203-4 - License rights.
2010-10-01
... Software and Computer Software Documentation 227.7203-4 License rights. (a) Grant of license. The... license, under an irrevocable license granted or obtained by the contractor which developed the software... granted to the Government. The scope of a computer software license is generally determined by the source...
49 CFR 227.101 - Scope and applicability.
2010-10-01
..., DEPARTMENT OF TRANSPORTATION OCCUPATIONAL NOISE EXPOSURE Occupational Noise Exposure for Railroad Operating Employees. § 227.101 Scope and applicability. (a) This subpart shall apply to the noise-related working... service laws governing “train employees” (see 49 U.S.C. 21101(5) and 21103), but, subject to a railroad's...
40 CFR 227.19 - Assessment of impact.
2010-07-01
..., reduction in use days of recreational areas, or dollars lost in commercial fishery profits or the... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Assessment of impact. 227.19 Section... FOR THE EVALUATION OF PERMIT APPLICATIONS FOR OCEAN DUMPING OF MATERIALS Impact of the Proposed...
48 CFR 52.227-6 - Royalty Information.
2010-10-01
... the response relating to each separate item of royalty or license fee: (1) Name and address of... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Royalty Information. 52....227-6 Royalty Information. As prescribed in 27.202-5(a)(1), insert the following provision: Royalty...
2010-10-01
... at one site or multiple site licenses, and the format and media in which the software or... noncommercial computer software and computer software documentation. 227.7203-2 Section 227.7203-2 Federal... CONTRACTING REQUIREMENTS PATENTS, DATA, AND COPYRIGHTS Rights in Computer Software and Computer Software...
48 CFR 1852.227-70 - New technology.
2010-10-01
... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true New technology. 1852.227-70... New technology. As prescribed in 1827.303-70(b), insert the following clause: New Technology (NOV 1998... administration of this New Technology clause within six months of conception and/or first actual reduction to...
48 CFR 252.227-7005 - License term.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false License term. 252.227-7005..., DEPARTMENT OF DEFENSE CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions And... referred to in the “License Grant” clause of this contract and any and all patents hereafter issued on...
7 CFR 227.1 - General purpose and scope.
2010-01-01
... management training of school foodservice personnel, and (c) the conduct of nutrition education activities in... Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND NUTRITION SERVICE, DEPARTMENT OF AGRICULTURE CHILD NUTRITION PROGRAMS NUTRITION EDUCATION AND TRAINING PROGRAM General § 227.1 General purpose...
48 CFR 352.227-70 - Publications and publicity.
2010-10-01
... article the Contractor submits for publication shall be promptly sent to the Contracting Officer's... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Publications and publicity... AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and Clauses 352.227-70...
40 CFR 227.30 - High-level radioactive waste.
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false High-level radioactive waste. 227.30...-level radioactive waste. High-level radioactive waste means the aqueous waste resulting from the operation of the first cycle solvent extraction system, or equivalent, and the concentrated waste from...
40 CFR 264.227 - Emergency repairs; contingency plans.
2010-07-01
... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Emergency repairs; contingency plans... FACILITIES Surface Impoundments § 264.227 Emergency repairs; contingency plans. (a) A surface impoundment... days after detecting the problem. (c) As part of the contingency plan required in subpart D of this...
48 CFR 3452.227-72 - Advertising of awards.
2010-10-01
... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Advertising of awards... Clauses 3452.227-72 Advertising of awards. As prescribed in 3427.472, insert the following clause in all solicitations and contracts other than purchase orders: Advertising of Awards (AUG 1987) The contractor agrees...
International Nuclear Information System (INIS)
Ivanov, P.I.; Collins, S.M.; Es, E.M. van; García-Miranda, M.; Jerome, S.M.; Russell, B.C.
2017-01-01
Thorium-227 is currently undergoing evaluation as a potential radionuclide for targeted cancer therapy, and as such a high chemical purity of the material is required. To establish a reliable procedure for radiochemical isolation of 227 Th from the parent 227 Ac and decay progeny, which includes the radiotherapeutic 223 Ra, the performance of three different separation schemes based on ion-exchange and extraction chromatography have been evaluated. The results suggest that both ion exchange and extraction chromatographic techniques can be successfully used for the separation of 227 Th from its decay progeny, however extraction chromatographic resins demonstrate favourable performance in terms of Th recovery and purification from radionuclide impurities. - Highlights: • Development of a radiochemical separation of 227 Th from residual 227Ac as well as from decay progeny. • Evaluation of ion-exchange and extraction chromatography techniques. • TEVA resin demonstrates favourable performance in terms of Th recovery and purification. • Developed method is applicable to both nuclear medicine and environmental analysis.
48 CFR 227.7009-4 - Additional clauses-contracts providing for payment of a running royalty.
2010-10-01
...-contracts providing for payment of a running royalty. 227.7009-4 Section 227.7009-4 Federal Acquisition... clauses—contracts providing for payment of a running royalty. The clauses set forth below are examples... desired to cover the subject matter thereof and the contract provides for payment of a running royalty. (a...
International Nuclear Information System (INIS)
Dahle, Jostein; Krogh, Cecilie; Melhus, Katrine B.; Borrebaek, Jorgen; Larsen, Roy H.; Kvinnsland, Yngve
2009-01-01
Purpose: To determine whether the low-dose-rate α-particle-emitting radioimmunoconjugate 227 Th-1,4,7,10-p-isothiocyanato-benzyl-tetraazacyclododecane-1,4,7, 10-tetraacetic acid (DOTA)-rituximab can be used to inactivate lymphoma cells growing as single cells and small colonies. Methods and Materials: CD20-positive lymphoma cell lines were treated with 227 Th-DOTA-rituximab for 1-5 weeks. To simulate the in vivo situation with continuous but decreasing supply of radioimmunoconjugates from the blood pool, the cells were not washed after incubation with 227 Th-DOTA-rituximab, but half of the medium was replaced with fresh medium, and cell concentration and cell-bound activity were determined every other day after start of incubation. A microdosimetric model was established to estimate the average number of hits in the nucleus for different localizations of activity. Results: There was a specific targeted effect on cell growth of the 227 Th-DOTA-rituximab treatment. Although the cells were not washed after incubation with 227 Th-DOTA-rituximab, the average contribution of activity in the medium to the mean dose was only 6%, whereas the average contribution from activity on the cells' own surface was 78%. The mean dose rates after incubation with 800 Bq/mL 227 Th-DOTA-rituximab varied from 0.01 to 0.03 cGy/min. The average delay in growing from 10 5 to 10 7 cells/mL was 15 days when the cells were treated with a mean absorbed radiation dose of 2 Gy α-particle radiation from 227 Th-DOTA-rituximab, whereas it was 11 days when the cells were irradiated with 6 Gy of X-radiation. The relative biologic effect of the treatment was estimated to be 2.9-3.4. Conclusions: The low-dose-rate radioimmunoconjugate 227 Th-DOTA-rituximab is suitable for inactivation of single lymphoma cells and small colonies of lymphoma cells.
International Nuclear Information System (INIS)
Gascoyne, M.
1985-01-01
The 227 Th/ 230 Th dating method is described in detail and its usefulness investigated by comparing ages of sixteen Pleistocene carbonates (mainly cave deposits) with those determined by the 231 Pa/ 235 U and 230 Th/ 234 U methods. The 227 Th/ 230 Th ages are found to be critically dependent on corrections for decay of 227 Th prior to alpha counting and ingrowth of daughter isotopes of 232 Th derived from clastic detritus. Of nineteen sets of ages determined for the sixteen samples, good agreement is found for only seven sets. Differences are attributed to low U content of some samples and the possibility of excess 227 Th in the calcite of samples younger than approx. 50 ky, possibly due to the coprecipitation of 231 Pa during formation. Calculated 'negative' 227 Th/ 230 Th ages may be a direct result of this process and the fact that unlike the other methods, the activity ratio is non-zero at zero age. Nevertheless, the 227 Th/ 230 Th is found to be a useful alternative dating technique for carbonates which are between approx. 50 and 300 ky, because no spiking is required. It also serves as a check for partial concordancy with ages dated by the other methods. (author)
48 CFR 227.7103-2 - Acquisition of technical data.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Acquisition of technical... Rights in Technical Data 227.7103-2 Acquisition of technical data. (a) Contracting officers shall work... personnel are responsible for identifying the Government's minimum needs for technical data. Data needs must...
48 CFR 52.227-4 - Patent Indemnity-Construction Contracts.
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Patent Indemnity... Clauses 52.227-4 Patent Indemnity—Construction Contracts. As prescribed in 27.201-2(d)(1), insert the following clause: Patent Indemnity—Construction Contracts (DEC 2007) Except as otherwise provided, the...
2010-07-01
... and Reports, the MMS Minerals Production Reporter Handbook, any interagency memorandum of... processes production reports or royalty reports? 227.401 Section 227.401 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT DELEGATION TO STATES States...
40 CFR 227.31 - Applicable marine water quality criteria.
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Applicable marine water quality... § 227.31 Applicable marine water quality criteria. Applicable marine water quality criteria means the criteria given for marine waters in the EPA publication “Quality Criteria for Water” as published in 1976...
29 CFR 779.227 - Conditions which must be met for exception.
2010-07-01
... STATEMENTS OF GENERAL POLICY OR INTERPRETATION NOT DIRECTLY RELATED TO REGULATIONS THE FAIR LABOR STANDARDS... Coverage Leased Departments, Franchise and Other Business Arrangements § 779.227 Conditions which must be...
48 CFR 227.7009 - Patent releases, license agreements, and assignments.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Patent releases, license... ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE GENERAL CONTRACTING REQUIREMENTS PATENTS, DATA, AND COPYRIGHTS Infringement Claims, Licenses, and Assignments 227.7009 Patent releases, license agreements, and...
50 CFR 665.227 - Allowable gear and gear restrictions.
2010-10-01
... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Allowable gear and gear restrictions. 665... Fisheries § 665.227 Allowable gear and gear restrictions. (a) Hawaii coral reef ecosystem MUS may be taken only with the following allowable gear and methods: (1) Hand harvest; (2) Spear; (3) Slurp gun; (4...
48 CFR 52.227-14 - Rights in Data-General.
2010-10-01
... (regardless of the form or method of the recording) of a scientific or technical nature (including computer... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Rights in Data-General. 52....227-14 Rights in Data—General. As prescribed in 27.409(b)(1), insert the following clause with any...
CSAR 81-001 addendum 2: Use of a plexiglass contamination barrier in HC-227-T
International Nuclear Information System (INIS)
Chiao, T.
1994-01-01
Plutonium Finish Plant (PFP) Engineering requested a criticality safety evaluation (Appendix 1) to support a revision of Criticality Prevention Specification CPS-Z-165-80601 allowing a plexiglass enclosure (PGE) to be placed inside the HC-227T hood as a contamination barrier. The HC-227T hood is the receiving/transfer enclosure for Pu nitrate solution contained in Product Removal containers (PR Cans), L10 Containers (L10, Fl-10, 10 L) or L-3 Containers. Within the HC-227T, a 1.349 square meter (15 square foot) enclosure, PGE, has been created to provide contamination control around the weighing scale. Two or more standard criticality drains shall be installed on this enclosure prior to beneficial usage. The evaluation considered the normal process, spillage scenarios, waste/container accumulations within the enclosure, and interactions of Pu within the enclosure as well as other containers external to the enclosure. The results from the criticality safety analysis by CRA shows that such as contamination barrier can be placed inside the HC-227T Hood if the PGE is equipped with adequate criticality drains. In addition, other limits as well as administrative controls listed in CPS-Z-165-80601 Rev./Mod. B/0 and CPS-Z-165-80010 Rev./Mod. C/1 shall also apply
International Nuclear Information System (INIS)
Davidsaver, S.B.; Fyfitch, S.; Whitaker, D.E.; Doss, R.L.
2015-01-01
The U.S. PWR industry has pro-actively developed generic inspection requirements and standards for reactor vessel (RV) internals. The Electric Power Research Institute (EPRI) Pressurized Water Reactor (PWR) Materials Reliability Program (MRP) has issued MRP-227-A and MRP-228 with mandatory and needed requirements based on the Nuclear Energy Institute (NEI) document NEI 03-08. The inspection and evaluation guidelines contained in MRP-227-A consider eight age-related degradation mechanisms: stress corrosion cracking (SCC), irradiation-assisted stress corrosion cracking (IASCC), wear, fatigue, thermal aging embrittlement, irradiation embrittlement, void swelling and irradiation growth, and thermal and irradiation-enhanced stress relaxation or irradiation-enhanced creep. This paper will discuss the decision planning efforts required for implementing the MRP-227-A and MRP-228 requirements and the results of these initial inspections at the Oconee Nuclear power station (ONS) units. Duke Energy and AREVA overcame a significant technology and NDE challenge by successfully completing the first-of-a-kind MRP-227-A scope requirements at ONS-1 in one outage below the estimated dose and with zero safety issues or events. This performance was repeated at ONS-2 a year later. The remote NDE tooling and processes developed to examine the MRP-227-A scope for ONS-1 and ONS-2 are transferable to other PWRs
J. Genet. classic 227 NOTE: The pagination in the original included ...
Indian Academy of Sciences (India)
Unknown
, December 2005. 227. NOTE: The pagination in the original included the reverse of plate 1 on p. 445, which was a blank. The blank is not included here, but the original page numbers have been retained.
Extraction and purification of {sup 227}Ac and development of solid {sup 219}Rn source
Energy Technology Data Exchange (ETDEWEB)
Tang, Quan; Qiu, Shoukang; Xiao, Detao; Zhou, Yaohui; An, Xiaogang [University of South China, Hengyang (China). Radon Key Laboratory of Hunan Province/School of Nuclear Science and Technology
2014-04-01
The method of {sup 227}Ac extraction and purification from high-grade uranium ore and the test results of solid {sup 219}Rn source made from {sup 227}Ac are reported in this paper. With five years of follow-up monitoring, radiochemical purity of {sup 227}Ac and the emanation power of solid {sup 219}Rn source has been checked by emanation method and γ-spectrometry, the results showed that {sup 228}Th, {sup 231}Pa and {sup 226}Ra have been effectively removed and the emanation power of {sup 219}Rn source is about 80%. The long-term test results also showed that the {sup 219}Rn emanation rate remains stable in a wide air humidity range (40% ∝ 90%). Though the {sup 219}Rn source has not been accurately calibrated yet, it has been applied in the research for delay coincidence measurement of {sup 223}Ra. (orig.)
25 CFR 227.25 - Inspection of premises, books and accounts.
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Inspection of premises, books and accounts. 227.25... Inspection of premises, books and accounts. Lessee shall agree to allow the lessor and his agents or any... Department; and their books and records, showing manner of operations and persons interested, shall be open...
48 CFR 52.227-20 - Rights in Data-SBIR Program.
2010-10-01
... means recorded information (regardless of the form or method of the recording) of a scientific or... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Rights in Data-SBIR....227-20 Rights in Data—SBIR Program. As prescribed in 27.409(h), insert the following clause: Rights in...
Simultaneous IR and optical light curves of 2A0311-227
International Nuclear Information System (INIS)
Bailey, J.; Hough, J.H.; Axon, D.J.
1983-01-01
It is reported that the optical and IR flickering of the AM Herculis type binary 2A0311 - 227 are highly correlated indicating that in this object the dominant source of cyclotron radiation at both wavelengths is the same accretion column. (U.K.)
48 CFR 252.227-7019 - Validation of asserted restrictions-Computer software.
2010-10-01
..., creates or implies privity of contract between the Government and the Contractor's subcontractors or... AND CONTRACT CLAUSES Text of Provisions And Clauses 252.227-7019 Validation of asserted restrictions..., unless otherwise specifically indicated, the term “Contractor” means the Contractor and its...
21 CFR 1.227 - What definitions apply to this subpart?
2010-04-01
...) Pesticides as defined in 7 U.S.C. 136(u). (ii) Examples of food include fruits, vegetables, fish, dairy... (including pet food), food and feed ingredients, food and feed additives, dietary supplements and dietary... 21 Food and Drugs 1 2010-04-01 2010-04-01 false What definitions apply to this subpart? 1.227...
7 CFR 227.37 - State plan for nutrition education and training.
2010-01-01
... State program; (iii) criteria and procedure for selection of such representatives; (6) Plans to solicit....37 Section 227.37 Agriculture Regulations of the Department of Agriculture (Continued) FOOD AND... evaluation of the previous years' State plans for: (i) Inservice training of food service personnel, (ii...
30 CFR 227.103 - What must a State's delegation proposal contain?
2010-07-01
... the delegation: (1) Personnel, including hiring, employee salaries and benefits, travel and training... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What must a State's delegation proposal contain... MINERALS REVENUE MANAGEMENT DELEGATION TO STATES Delegation Proposals § 227.103 What must a State's...
Stanley, Scott E; Faulkenberry, Jason B
2014-01-01
On 3 November 2012, in the wake of Superstorm Sandy, the 227th Preventive Medicine Medical Detachment deployed to support relief operations in New Jersey and New York State. The unit was on the severe weather support mission (SWRF) and ordered to provide preventive medicine support to relief personnel within the affected area. In addition, teams from the 227th conducted environmental surveillance in the two-state region where Army Corps of Engineers were pumping floodwaters from affected neighborhoods. The 227th rapid deployment highlights the complexities associated with defense support to civil authorities and provides excellent teaching points that may enhance units expeditionary posture, regardless of mission. 2014.
37 CFR 2.27 - Pending trademark application index; access to applications.
2010-07-01
... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Pending trademark application... Registration § 2.27 Pending trademark application index; access to applications. (a) An index of pending... particular pending application will be permitted prior to publication under § 2.80 upon written request. (c...
The half-life of 227Th by direct and indirect measurements
International Nuclear Information System (INIS)
Collins, S.M.; Pommé, S.; Jerome, S.M.; Ferreira, K.M.; Regan, P.H.; Pearce, A.K.
2015-01-01
Utilising a chemically purified solution the radioactive half-life of 227 Th has been determined indirectly by observation of the ingrowth of 223 Ra using an ionisation chamber (IC) and for the first time by direct observation of the change in activity with time using a high-purity germanium (HPGe) γ-ray spectrometer. The radioactive decay was observed for ~104 days (~5.6 half-lives) by γ-ray spectrometry and approximately 63 days and 72 days (~3.4 and ~3.9 half-lives) using an ionisation chamber (IC). The resulting half-life values – 18.695 (4) days (IC) and 18.683 (20) days (HPGe) – are consistent and detailed uncertainty budgets are presented for the two measurement techniques. A weighted mean of our results of 18.695 (4) days is inconsistent with the most precise published half-life value of 18.7176 (52) days (Jordan and Blanke, 1967). A critical evaluation of literature data has been performed, indicating a paucity of reliable and independent measurements. Selected independent published values have been used to determine a recommended half-life of 18.697 (7) days. A method has been introduced in the course of this work so that the recommended half-life of 227 Th as determined by ingrowth can be modified if a different 223 Ra half-life has been determined, evaluated and adopted. - Highlights: • First direct measurement of 227 Th half-life by HPGe γ-ray spectrometry. • Precision half-life measurement by ionisation chamber. • New half-life of 18.695 (4) days determined. • Critical evaluation of published half-lives and recommended value determined
25 CFR 1000.227 - What happens if the Secretary denies the waiver request?
2010-04-01
... INTERIOR ANNUAL FUNDING AGREEMENTS UNDER THE TRIBAL SELF-GOVERNMENT ACT AMENDMENTS TO THE INDIAN SELF-DETERMINATION AND EDUCATION ACT Waiver of Regulations § 1000.227 What happens if the Secretary denies the waiver...
48 CFR 252.227-7037 - Validation of restrictive markings on technical data.
2010-10-01
.... However, this clause neither creates nor implies privity of contract between the Government and... AND CONTRACT CLAUSES Text of Provisions And Clauses 252.227-7037 Validation of restrictive markings on... following clause: Validation of Restrictive Markings on Technical Data (SEP 1999) (a) Definitions. The terms...
5 CFR 591.227 - What adjustment factors does OPM add to the price indexes?
2010-01-01
... CIVIL SERVICE REGULATIONS ALLOWANCES AND DIFFERENTIALS Cost-of-Living Allowance and Post Differential-Nonforeign Areas Cost-Of-Living Allowances § 591.227 What adjustment factors does OPM add to the price...
Energy Technology Data Exchange (ETDEWEB)
Poemsl, H
1974-08-06
After incorporation of 5 and 50 ..mu..Ci/kg thorium 227 as well as 25 ..mu..Ci/kg radium 224, the tibia and lumbar vertebrae of the mouse were histologically and, using cell counting, morphometrically investigated within a period of 12 weeks. Osteoblasts and mesenchymal cells proved to be the most sensitive to radiation. They were temporarily decimated after 25 ..mu..Ci/kg radium 224 in the tibial metaphysis, but soon regenerated. After 5 ..mu..Ci/kg thorium 227, osteoblasts and mesenchymal cells were only slightly reduced, but more so in the lumbar vertebrae than in the tibia. The cells of osteogenic tissue were almost completely killed by 50 ..mu..Ci/kg thorium 227. In the subsequent regeneration phase, larger regions of atypical bone occured in the tibia metaphysis which was pushed off in the further course by newly formed compact substance of epiphysial cartilage.
Jesu, meine Freude BWV 227 van Johann Sebastian Bach : een praedicatio sonora
Eikelboom, A.
2007-01-01
In the oeuvre of Johann Sebastian Bach the motets take only a modest position. According to Bach's early biographers he must have written many motets, but only few have been preserved. Among these motets Jesu, meine Freude BWV 227 occupies a special position. It is the only one which combines a
30 CFR 227.802 - How will MMS terminate a State's delegation agreement?
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false How will MMS terminate a State's delegation... MINERALS REVENUE MANAGEMENT DELEGATION TO STATES Performance Review § 227.802 How will MMS terminate a State's delegation agreement? This section explains the procedures MMS will use to terminate all or a...
27 CFR 24.227 - Transfer of spirits by pipeline for immediate use.
2010-04-01
... TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Spirits § 24.227 Transfer of spirits... wine in a spirits addition tank and has determined the quantity of spirits to be added, the spirits may... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Transfer of spirits by...
48 CFR 1852.227-72 - Designation of new technology representative and patent representative.
2010-10-01
... CONTRACT CLAUSES Texts of Provisions and Clauses 1852.227-72 Designation of new technology representative... of New Technology Representative and Patent Representative (JUL 1997) (a) For purposes of administration of the clause of this contract entitled “New Technology” or “Patent Rights—Retention by the...
Kohler, Susanna
2016-01-01
Editors Note:This week were at the 227th AAS Meeting in Kissimmee, FL. Along with several fellow authors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting at the end of each day. Follow along here or at astrobites.com, or catch ourlive-tweeted updates from the @astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Things kicked off last night at our undergraduate reception booth. Thanks to all of you who stopped by we were delightedto have so many people tell us that they already know about and useastrobites, and we were excited to introduce a new cohort of students at AAS to astrobites for the first time.Tuesday morning was the official start of the meeting. Here are just a few of the talks and workshops astrobiters attended today.Opening Address (by Becky Smethurst)The President of the AAS, aka our fearless leader Meg Urry kicked off the meeting this morning at the purely coffee powered hour of 8am this morning. She spoke about the importance of young astronomers at the meeting (heres looking at you reader!) and also the importance of the new Working Group for Accessibility and Disabilities (aka WGAD pronounced like wicked) at the AAS. The Society has made extra effort this year to make the conference accessible to all,a message which was very well received by everyone in attendance.Kavli Lecture: New Horizons Alan Stern (by Becky Smethurst)We were definitely spoilt with the first Plenary lecture at this years conference Alan Stern gave us a a review of the New Horizons mission of the Pluto Fly By (astrobites covered the mission back in July with this post). We were treated to beautiful images, wonderful results and a foray into geology.Before (Hubble) and after #NewHorizons. #thatisall #science #astro alanstern #aas227 pic.twitter.com/kkMt6RsSIR Science News (@topsciencething) January 5, 2016Some awesome facts from the lecture that blew my mind:New Horizons is now 2AU (!) beyond Pluto
A modified method of 3D-SSP analysis for amyloid PET imaging using [¹¹C]BF-227.
Kaneta, Tomohiro; Okamura, Nobuyuki; Minoshima, Satoshi; Furukawa, Katsutoshi; Tashiro, Manabu; Furumoto, Shozo; Iwata, Ren; Fukuda, Hiroshi; Takahashi, Shoki; Yanai, Kazuhiko; Kudo, Yukitsuka; Arai, Hiroyuki
2011-12-01
Three-dimensional stereotactic surface projection (3D-SSP) analyses have been widely used in dementia imaging studies. However, 3D-SSP sometimes shows paradoxical results on amyloid positron emission tomography (PET) analyses. This is thought to be caused by errors in anatomical standardization (AS) based on an (18)F-fluorodeoxyglucose (FDG) template. We developed a new method of 3D-SSP analysis for amyloid PET imaging, and used it to analyze (11)C-labeled 2-(2-[2-dimethylaminothiazol-5-yl]ethenyl)-6-(2-[fluoro]ethoxy)benzoxazole (BF-227) PET images of subjects with mild cognitive impairment (MCI) and Alzheimer's disease (AD). The subjects were 20 with MCI, 19 patients with AD, and 17 healthy controls. Twelve subjects with MCI were followed up for 3 years or more, and conversion to AD was seen in 6 cases. All subjects underwent PET with both FDG and BF-227. For AS and 3D-SSP analyses of PET data, Neurostat (University of Washington, WA, USA) was used. Method 1 involves AS for BF-227 images using an FDG template. In this study, we developed a new method (Method 2) for AS: First, an FDG image was subjected to AS using an FDG template. Then, the BF-227 image of the same patient was registered to the FDG image, and AS was performed using the transformation parameters calculated for AS of the corresponding FDG images. Regional values were normalized by the average value obtained at the cerebellum and values were calculated for the frontal, parietal, temporal, and occipital lobes. For statistical comparison of the 3 groups, we applied one-way analysis of variance followed by the Bonferroni post hoc test. For statistical comparison between converters and non-converters, the t test was applied. Statistical significance was defined as p SSP analysis of amyloid PET imaging possible. This new method of 3D-SSP analysis for BF-227 PET could prove useful for detecting differences between normal groups and AD and MCI groups, and between converters and non-converters.
30 CFR 227.301 - What are a State's responsibilities if it performs audits?
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What are a State's responsibilities if it... Functions § 227.301 What are a State's responsibilities if it performs audits? If you perform audits you must: (a) Comply with the MMS Audit Procedures Manual and the Government Auditing Standards issued by...
30 CFR 250.227 - What environmental impact analysis (EIA) information must accompany the EP?
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What environmental impact analysis (EIA... and Information Contents of Exploration Plans (ep) § 250.227 What environmental impact analysis (EIA... requirements. Your EIA must: (1) Assess the potential environmental impacts of your proposed exploration...
30 CFR 227.108 - How will MMS notify a State of its decision?
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false How will MMS notify a State of its decision... MINERALS REVENUE MANAGEMENT DELEGATION TO STATES Delegation Process § 227.108 How will MMS notify a State of its decision? MMS will notify you in writing of its decision on your delegation proposal. If MMS...
Levels in {sup 227}Ac populated in the {sup 230}Th(p,{alpha}) reaction
Energy Technology Data Exchange (ETDEWEB)
Burke, D.G. E-mail: dgb@physics.mcmaster.ca; Garrett, P.E.; Qu, Tao
2003-09-08
The {sup 230,232}Th(p,{alpha}){sup 227,229}Ac reactions were studied using 20 MeV protons and a magnetic spectrograph to analyze the reaction products. Relative populations of levels in {sup 229}Ac correlated well with previously published (t,{alpha}) results for the same final levels, showing that the similarity of the two reactions observed empirically in the deformed rare earth region extends to actinides. The most strongly populated level in {sup 227}Ac is at 639 keV, and is assigned as the 1/2{sup +}[4 0 0] bandhead. The 435 keV level, previously adopted as the 1/2{sup +}[6 6 0] bandhead, also has a significant intensity that is attributed to {delta}N=2 mixing between these two K=1/2 proton orbitals. The {delta}N=2 matrix element estimated from these data is {approx}80 keV, similar to values observed for the same two Nilsson states as neutron orbitals in the dysprosium isotopes.
Quantitative kinetic analysis of PET amyloid imaging agents [11C]BF227 and [18F]FACT in human brain
International Nuclear Information System (INIS)
Shidahara, Miho; Watabe, Hiroshi; Tashiro, Manabu; Okamura, Nobuyuki; Furumoto, Shozo; Watanuki, Shoichi; Furukawa, Katsutoshi; Arakawa, Yuma; Funaki, Yoshihito; Iwata, Ren; Gonda, Kohsuke; Kudo, Yukitsuka; Arai, Hiroyuki; Ishiwata, Kiichi; Yanai, Kazuhiko
2015-01-01
Introduction: The purpose of this study was to compare two amyloid imaging agents, [ 11 C]BF227 and [ 18 F]FACT (derivative from [ 11 C]BF227) through quantitative pharmacokinetics analysis in human brain. Methods: Positron emission tomography studies were performed on six elderly healthy control (HC) subjects and seven probable Alzheimer’s disease (AD) patients with [ 11 C]BF227 and 10 HC subjects and 10 probable AD patients with [ 18 F]FACT. Data from nine regions of interest were analyzed by several approaches, namely non-linear least-squared fitting methods with arterial input functions (one-tissue compartment model(1TCM), two-tissue compartment model (2TCM)), Logan plot, and linearized methods with reference region (Reference Logan plot (RefLogan), MRTM0, MRTM2). We also evaluated SUV and SUVR for both tracers. The parameters estimated by several approaches were compared between two tracers for detectability of differences between HC and AD patients. Results: For [ 11 C]BF227, there were no significant difference of V T (2TCM, 1TCM) and SUV in all regions (Student t-test; p < 0.05) and significant differences in the DVRs (Logan, RefLogan, and MRTM2) and SUVRs in six neocortical regions (p < 0.05) between the HC and AD groups. For [ 18 F]FACT, significant differences in DVRs (RefLogan, MRTM0, and MRTM2) were observed in more than four neocortical regions between the HC and AD groups (p < 0.05), and the significant differences were found in SUVRs for two neocortical regions (inferior frontal coretex and lateral temporal coretex). Our results showed that both tracers can clearly distinguish between HC and AD groups although the pharmacokinetics and distribution patterns in brain for two tracers were substantially different. Conclusion: This study revealed that although the PET amyloid imaging agents [ 11 C]BF227 and [ 18 F]FACT have similar chemical and biological properties, they have different pharmacokinetics, and caution must be paid for usage of the
30 CFR 227.800 - How will MMS monitor a State's performance of delegated functions?
2010-07-01
... visits and Office of the Inspector General, General Accounting Office, and MMS audits of your performance... 30 Mineral Resources 2 2010-07-01 2010-07-01 false How will MMS monitor a State's performance of... THE INTERIOR MINERALS REVENUE MANAGEMENT DELEGATION TO STATES Performance Review § 227.800 How will...
Ac, La, and Ce radioimpurities in {sup 225}Ac produced in 40-200 MeV proton irradiations of thorium
Energy Technology Data Exchange (ETDEWEB)
Engle, Jonathan W.; Ballard, Beau D. [Los Alamos National Laboratory, NM (United States); Weidner, John W. [Air Force Institute of Technology, Wright Patterson Air Force Base, OH (United States); and others
2014-10-01
Accelerator production of {sup 225}Ac addresses the global supply deficiency currently inhibiting clinical trials from establishing {sup 225}Ac's therapeutic utility, provided that the accelerator product is of sufficient radionuclidic purity for patient use. Two proton activation experiments utilizing the stacked foil technique between 40 and 200 MeV were employed to study the likely co-formation of radionuclides expected to be especially challenging to separate from {sup 225}Ac. Foils were assayed by nondestructive γ-spectroscopy and by α-spectroscopy of chemically processed target material. Nuclear formation cross sections for the radionuclides {sup 226}Ac and {sup 227}Ac as well as lower lanthanide radioisotopes {sup 139}Ce, {sup 141}Ce, {sup 143}Ce, and {sup 140}La whose elemental ionic radii closely match that of actinium were measured and are reported. The predictions of the latest MCNP6 event generators are compared with measured data, as they permit estimation of the formation rates of other radionuclides whose decay emissions are not clearly discerned in the complex spectra collected from {sup 232}Th(p,x) fission product mixtures. (orig.)
Kohler, Susanna
2016-01-01
Editors Note:This week were at the 227th AAS Meeting in Kissimmee, FL. Along with several fellow authors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting at the end of each day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Welcome to Day 3 of the winter American Astronomical Society (AAS) meeting in Kissimmee! Several of us are attending the conference this year, and we will report highlights from each day here on astrobites. If youd like to see more timely updates during the day, we encourage you to follow @astrobites on twitter or search the #aas227 hashtag.Henry Norris Russell Lecture: Viewing the Universe with Infrared Eyes: The Spitzer Space Telescope (by Erika Nesvold)The Henry Norris Russell Award is the highest honor given by the AAS, for a lifetime of eminence in astronomy research. This years award went to Giovanni Fazio of the Harvard-Smithsonian Center for Astrophysics. Fazio became a leader in gamma ray astronomy before switching mid-career to the study of infrared astronomy, and he gave his award lecture on the latter subject, specifically on the Spitzer Space Telescope, one of the most successful infrared telescopes of all time.Artists rendering of the Spitzer space telescope. [NASA/JPL-Caltech]Spitzer has been operating for more than twelve years, and has resulted in over six thousand papers in refereed journals in that time. The telescope sits in an Earth-trailing orbit around the Sun, and is now farther from the Earth (1.4 AU) than the Earth is from the Sun. Fazio gave the audience a fascinating overview of the science done by Spitzer over more than a decade. One of the most productive areas of research for Spitzer is the study of exoplanets, which hadnt even been discovered when the Spitzer Telescope was first conceived. Spitzers high sensitivity and ability to observe exoplanets over
Forgan, Duncan H.; Ilee, John D.; Meru, Farzana
2018-06-01
The spiral waves detected in the protostellar disk surrounding Elias 2-27 have been suggested as evidence of the disk being gravitationally unstable. However, previous work has shown that a massive, stable disk undergoing an encounter with a massive companion are also consistent with the observations. We compare the spiral morphology of smoothed particle hydrodynamic simulations modeling both cases. The gravitationally unstable disk produces symmetric, tightly wound spiral arms with constant pitch angle, as predicted by the literature. The companion disk’s arms are asymmetric, with pitch angles that increase with radius. However, these arms are not well-fitted by standard analytic expressions, due to the high disk mass and relatively low companion mass. We note that differences (or indeed similarities) in morphology between pairs of spirals is a crucial discriminant between scenarios for Elias 2-27, and hence future studies must fit spiral arms individually. If Elias 2-27 continues to show symmetric tightly wound spiral arms in future observations, then we posit that it is the first observed example of a gravitationally unstable protostellar disk.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Conformity, acceptance... Software Documentation 227.7203-14 Conformity, acceptance, and warranty of computer software and computer...) Conformity and acceptance. Solicitations and contracts requiring the delivery of computer software shall...
49 CFR Appendix F to Part 227 - Calculations and Application of Age Corrections to Audiograms
2010-10-01
... 1 1 1 3 3 d. The difference represents the amount of hearing loss that may be attributed to aging in...) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION OCCUPATIONAL NOISE EXPOSURE Pt. 227, App. F... the contribution of aging to the change in hearing level by adjusting the most recent audiogram. If...
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Architectural designs and... construction involving architect-engineer services, is to obtain a unique architectural design of a building, a... CONTRACTING REQUIREMENTS PATENTS, DATA, AND COPYRIGHTS Rights in Technical Data 227.7107-1 Architectural...
Yamagami, Mai
2012-01-01
Using the frameworks of critical discourse analysis, representation theory, and legitimization theory, this study examines the political discourse of the campaign for Proposition 227 in California--particularly, the key social representations of languages, their speakers, and the main political actors in the campaign. The analysis examines the…
Energy Technology Data Exchange (ETDEWEB)
Brabban, A.D.; Orcutt, E.N.; Zinder, S.H. [Cornell Univ., Ithaca, NY (United States). Section of Microbiology
1999-03-01
The nitrogenase enzyme complex of Methanosarcina barkeri 227 was found to be more sensitive to NaCl than previously studied molybdenum nitrogenases are, with total inhibition of activity occurring at 190 mM NaCl, compared with >600 mM NaCl for Azotobacter vinelandii and Clostridium pasteurianum nitrogenases. Na{sup +} and K{sup +} had equivalent effects, whereas Mg{sup 2+} was more inhibitory than either monovalent cation, even on a per-charge basis. The anion Cl{sup {minus}} was more inhibitory than acetate was. Because M. barkeri 227 is a facultative halophile, the authors examined the effects of external salt on growth and diazotrophy and found that inhibition of growth was not greater with N{sub 2} than with NH{sub 4}{sup +}. Cells grown with N{sub 2} and cells grown with NH{sub 4}{sup +} produced equal concentrations of {alpha}-glutamate at low salt concentrations and equal concentrations of N{sup {var_epsilon}}-acetyl-{beta}-lysine at NaCl concentrations greater than 500 mM. Despite the high energetic cost of fixing nitrogen for these osmolytes, the authors obtained no evidence that there is a shift towards nonnitrogenous osmolytes during diazotrophic growth. In vitro nitrogenase enzyme assays showed that at a low concentration potassium glutamate enhanced activity but at higher concentrations this compound inhibited activity; 50% inhibition occurred at a potassium glutamate concentration of approximately 400 mM.
2010-10-01
... operation of the software to display a restrictive rights legend or other license notice; and (2) Requires a... and marking of computer software or computer software documentation to be furnished with restrictive... Rights in Computer Software and Computer Software Documentation 227.7203-10 Contractor identification and...
Kohler, Susanna
2016-01-01
Editors Note:This week were at the 227th AAS Meeting in Kissimmee, FL. Along with several fellow authors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting at the end of each day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Welcome to Day 4 of the winter American Astronomical Society (AAS) meeting in Kissimmee! Several of us are attending the conference this year, and we will report highlights from each day here on astrobites. If youd like to see more timely updates during the day, we encourage you to follow @astrobites on twitter or search the #aas227 hashtag.Helen B. Warner Prize: Origins of Structure in Planetary Systems (by Erika Nesvold)Another excellent prize lecture started off todays sessions. The Helen B. Warner Prize is awarded for achievement in observational or theoretical astrophysics by a young researcher (no more than eight years after their Ph.D.). This years Warner Prize was presented to Ruth Murray-Clay of UC Santa Barbara. For her award lecture, Murray-Clay told us all about planetary system architecture: the number, masses, and orbits of planets in a given system.Ruth Murray-Clay [photo from http://web.physics.ucsb.edu/ ~murray/biocv.html]The underlying question motivating this type of research is: How rare is the Solar System? In other words, how likely is it that a given planetary system will have rocky planets close to their star, gas giants farther out, and ice giants at the outer reaches of the system? Answering this question will help us solve the physics problem of how and where planets form, and will also help us on our search for other planets like Earth.The data on exoplanet population from transit and radial velocity observations and from direct imaging tell us that our Solar System is not common (many systems we observe have much more eccentric gas giants), but that doesnt
Energy Technology Data Exchange (ETDEWEB)
Heyerdahl, Helen, E-mail: Helen.Heyerdahl@rr-research.no [Department of Radiation Biology, Institute for Cancer Research, Oslo University Hospital - The Norwegian Radium Hospital, Oslo (Norway); Røe, Kathrine [Department of Oncology, Division of Medicine, Akershus University Hospital, Lørenskog (Norway); Brevik, Ellen Mengshoel [Department of Research and Development, Algeta ASA, Oslo (Norway); Dahle, Jostein [Nordic Nanovector AS, Oslo (Norway)
2013-09-01
Purpose: The purpose of this study was to investigate the effect of α-particle-emitting {sup 227}Th-trastuzumab radioimmunotherapy on tumor vasculature to increase the knowledge about the mechanisms of action of {sup 227}Th-trastuzumab. Methods and Materials: Human HER2-expressing SKOV-3 ovarian cancer xenografts were grown bilaterally in athymic nude mice. Mice with tumor volumes 253 ± 36 mm{sup 3} (mean ± SEM) were treated with a single injection of either {sup 227}Th-trastuzumab at a dose of 1000 kBq/kg body weight (treated group, n=14 tumors) or 0.9% NaCl (control group, n=10 tumors). Dynamic T1-weighted contrast-enhanced magnetic resonance imaging (DCEMRI) was used to study the effect of {sup 227}Th-trastuzumab on tumor vasculature. DCEMRI was performed before treatment and 1, 2, and 3 weeks after therapy. Tumor contrast-enhancement curves were extracted voxel by voxel and fitted to the Brix pharmacokinetic model. Pharmacokinetic parameters for the tumors that underwent radioimmunotherapy were compared with the corresponding parameters of control tumors. Results: Significant increases of k{sub ep}, the rate constant of diffusion from the extravascular extracellular space to the plasma (P<.05), and k{sub el,} the rate of clearance of contrast agent from the plasma (P<.01), were seen in the radioimmunotherapy group 2 and 3 weeks after injection, compared with the control group. The product of k{sub ep} and the amplitude parameter A, associated with increased vessel permeability and perfusion, was also significantly increased in the radioimmunotherapy group 2 and 3 weeks after injection (P<.01). Conclusions: Pharmacokinetic modeling of MRI contrast-enhancement curves evidenced significant alterations in parameters associated with increased tumor vessel permeability and tumor perfusion after {sup 227}Th-trastuzumab treatment of HER2-expressing ovarian cancer xenografts.
Directory of Open Access Journals (Sweden)
Pratchaya Pramoj Na Ayutthaya
Full Text Available Honey from the European honeybee, Apis mellifera, is produced by α-glucosidases (HBGases and is widely used in food, pharmaceutical, and cosmetic industries. Categorized by their substrate specificities, HBGases have three isoforms: HBGase I, II and III. Previous experimental investigations showed that wild-type HBGase III from Apis mellifera (WT preferred sucrose to maltose as a substrate, while the Y227H mutant (MT preferred maltose to sucrose. This mutant can potentially be used for malt hydrolysis because it can efficiently hydrolyze maltose. In this work, to elucidate important factors contributing to substrate specificity of this enzyme and gain insight into how the Y227H mutation causes substrate specificity change, WT and MT homology models were constructed, and sucrose/maltose was docked into active sites of the WT and MT. AMBER14 was employed to perform three independent molecular dynamics runs for these four complexes. Based on the relative binding free energies calculated by the MM-GBSA method, sucrose is better than maltose for WT binding, while maltose is better than sucrose for MT binding. These rankings support the experimentally observed substrate specificity that WT preferred sucrose to maltose as a substrate, while MT preferred maltose to sucrose, suggesting the importance of binding affinity for substrate specificity. We also found that the Y227H mutation caused changes in the proximities between the atoms necessary for sucrose/maltose hydrolysis that may affect enzyme efficiency in the hydrolysis of sucrose/maltose. Moreover, the per-residue binding free energy decomposition results show that Y227/H227 may be a key residue for preference binding of sucrose/maltose in the WT/MT active site. Our study provides important and novel insight into the binding of sucrose/maltose in the active site of Apis mellifera HBGase III and into how the Y227H mutation leads to the substrate specificity change at the molecular level. This
International Nuclear Information System (INIS)
Kuesters, H.; Lalovic, M.
1976-04-01
In this report a review is given on the actinium isotope build-up and decay in LWRs, LMFBRs and HTRs. The dependence of the corresponding physical aspects on reactor type, fuel cycle strategy, calculational methods and cross section uncertainties is discussed. Results from postirradiation analyses and from integral experiments in fast zero power assemblies are compared with theoretical predictions. Some sensitivity studies about the influence of actinium nuclear data uncertainties on the isotopic concentration, decay heat, and the radiation out-put in fuel and waste are presented. In a second part, the main results of the IAEA-Advisory Group Meeting on Transactinium Nuclear Data are summarized and discussed. (orig.) [de
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Suspension of running of... Limitations § 70.227 Suspension of running of period of limitation; wrongful seizure of property of third party. The running of the period of limitations on collection after assessment prescribed in 26 U.S.C...
27 CFR 28.227 - Removals of beer by persons other than the brewer or agent of the brewer.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Removals of beer by... ALCOHOL Exportation of Beer With Benefit of Drawback Execution of Claims § 28.227 Removals of beer by persons other than the brewer or agent of the brewer. Where there is a removal of taxpaid beer by a person...
International Nuclear Information System (INIS)
Chiao, T.
1995-12-01
This report defines the maximum space allowed between the floor surface and the lower edge of an official criticality drain which is to be installed on the plexiglas contamination barrier in HC-227T Hood
Revilla, Anita Tijerina; Asato, Jolynn
2002-01-01
Explored the relationship between race and language as related to bilingual students' educational experiences. Used Latino/a critical theory, Asian American legal scholarship, and critical race theory as frameworks to examine the aftermath of California's Proposition 227. Data from teachers and administrators highlighted significant variance in…
HEU age determination by the activity ratio {sup 227}Th/{sup 235}U
Energy Technology Data Exchange (ETDEWEB)
Li, Junjie; Zeng, Lina; Wu, Jian; Zheng, Chun; Li, Jiansheng, E-mail: lastljj@hotmail.com
2014-02-15
It is important to measure the age of a highly enriched uranium (HEU) assembly for authentication of the material in the frame of arms control inspections. A new non-destructive gamma spectrometric method for HEU age-dating is reported. This method relies on measuring the daughter/parent activity ratio {sup 227}Th/{sup 235}U by high-resolution gamma spectrometry. Only a narrow gamma range of energy of uranium from 230 keV to 242 keV will be used for analysis. The relative efficiency of every characteristic gamma ray changes in a small range because it has a near energy, which makes the results more accurate in theory. It provides a quick and reliable method for HEU age determination. Several gamma spectra of the same HEU assembly have been measured with different conditions (gain settings, distance and measurement time). When a branching ratio of 12.6% was chosen for the 235.96 keV line of {sup 227}Th, we obtained the activity ratios of (5.61 ± 0.40) × 10{sup −4}, (5.17 ± 0.39) × 10{sup −4}, (5.26 ± 0.39) × 10{sup −4}, (5.10 ± 0.35) × 10{sup −4}, (5.50 ± 0.44) × 10{sup −4} and (5.47 ± 0.42) × 10{sup −4}, respectively. These ratios correspond to ages of 52.2 ± 2.4 years, 49.7 ± 2.3 years, 50.1 ± 2.3 years, 49.3 ± 2.2 years, 51.6 ± 2.5 years and 51.5 ± 2.4 years, respectively, which are consistent with the known age of this material and the results of the U–Bi method.
Garrity, Sarah; Aquino-Sterling, Cristian R.; Van Liew, Charles; Day, Ashley
2018-01-01
Despite the well-documented benefits of bilingualism, current educational practices in the United States reflect the deeply held belief that because the United States is an English speaking country, English should be the language of instruction. This belief was codified into law in California via the 1998 passage of Proposition 227, which banned…
The eclipsing AM Herculis star 2A 0311 - 227
International Nuclear Information System (INIS)
Allen, D.A.; Wright, A.E.; Ward, M.J.
1981-01-01
Infrared photometry and optical spectrophotometry of the AM Herculis star 2A 0311 - 227 are described. In its 81-min orbit there are two eclipses at infrared wavelengths and a third, intermittent eclipse of the optical emission lines. One of these eclipses is caused by an M dwarf which orbits a magnetic white dwarf. Much of the geometry of the system can be specified. An inclination near 80 0 is found, and a mass of the M dwarf which corresponds to a spectral type of M7 or M8. Accretion appears to occur on to two magnetic poles of the white dwarf, but the field strengths differ so that one pole emits preferentially at optical wavelengths and the other mostly in the infrared. The location of the redder-emitting magnetic pole can be specified because of its eclipse by the white dwarf, but there remains some uncertainty in the location of the bluer pole. All interpretations seem to require that the magnetic poles are not symmetrically disposed about the white dwarf, and some evidence suggests that like poles are less than 60 0 apart. (author)
International Nuclear Information System (INIS)
Ford, W.E. III; Diggs, B.R.; Knight, J.R.; Greene, N.M.; Petrie, L.M.; Webster, C.C.; Westfall, R.M.; Wright, R.Q.; Williams, M.L.
1982-01-01
Characteristics and contents of the CSRL-V (Criticality Safety Reference Library based on ENDF/B-V data) 227-neutron-group AMPX master and pointwise cross-section libraries are described. Results obtained in using CSRL-V to calculate performance parameters of selected thermal reactor and criticality safety benchmarks are discussed
Transit Timing Variation analysis with Kepler light curves of KOI 227 and Kepler 93b
Dulz, Shannon; Reed, Mike
2017-01-01
By searching for transit signals in approximately 150,000 stars, NASA’s Kepler Space telescope found thousands of exoplanets over its primary mission from 2009 to 2013 (Tenenbaum et al. 2014, ApJS, 211, 6). Yet, a detailed follow-up examination of Kepler light curves may contribute more evidence on system dynamics and planetary atmospheres of these objects. Kepler’s continuous observing of these systems over the mission duration produced light curves of sufficient duration to allow for the search for transit timing variations. Transit timing variations over the course of many orbits may indicate a precessing orbit or the existence of a non-transiting third body such as another exoplanet. Flux contributions of the planet just prior to secondary eclipse may provide a measurement of bond albedo from the day-side of the transiting planet. Any asymmetries of the transit shape may indicate thermal asymmetries which can measure upper atmosphere motion of the planet. These two factors can constrain atmospheric models of close orbiting exoplanets. We first establish our procedure with the well-documented TTV system, KOI 227 (Nesvorny et al. 2014, ApJ, 790, 31). Using the test case of KOI 227, we analyze Kepler-93b for TTVs and day-side flux contributions. Kepler-93b is likely a rocky planet with R = 1.50 ± 0.03 Earth Radii and M = 2.59 ± 2.0 Earth Masses (Marcy et al. 2014, ApJS, 210, 20). This research is funded by a NASA EPSCoR grant.
International Nuclear Information System (INIS)
Thompson, D.A.; Macauley-Newcombe, R.G.
1996-04-01
This report contains results of thermal absorption and ion-beam analysis experiments performed in 1995 for ITER task T227. The materials studies were Be, BeO and W. The Be samples used are single crystals provided by Dr. H. Kawamura of J.A.E.R.I.; the BeO samples are polycrystalline semiconductor substrates provided by the Brush Wellman Company (USA); and the W samples are single crystals and are-melted polycrystals from the Johnson-Matthey Company (USA). All samples are very high purity and 100% density. (author) 16 refs., 1 tab., 10 figs
International Nuclear Information System (INIS)
Moulin, J.
2008-06-01
Understanding natural radionuclides behaviour in surface water is a required step to achieve uranium mine rehabilitation and preserve water quality. The first objective of this thesis is to determine which are the radionuclides sources in a drinking water reservoir. The second objective is to improve the knowledge about the behaviour of uranium series radionuclides, especially actinium. The investigated site is a brook (Sagnes, Limousin, France) which floods a peat bog contaminated by a former uranium mine and which empties into the Crouzille lake. It allows studying radionuclides transport in surface water and radionuclides retention through organic substance or water reservoir. Radionuclides distribution in particulate, colloidal and dissolved phases is determined thanks to ultra-filtrations. Gamma spectrometry allows measuring almost all natural radionuclides with only two counting stages. However, low activities of 235 U series radionuclides impose the use of very low background well-type Ge detectors, such as those of the Underground Laboratory of Modane (France). Firstly, this study shows that no or few radionuclides are released by the Sagnes peat bog, although its radioactivity is important. Secondly, it provides details on the behaviour of uranium series radionuclides in surface water. More specifically, it provides the first indications of actinium solubility in surface water. Actinium's behaviour is very close to uranium's even if it is a little less soluble. (author)
Kohler, Susanna
2016-01-01
Editors Note:This week were at the 227th AAS Meeting in Kissimmee, FL. Along with several fellow authors from astrobites.com, I will bewritingupdates on selectedevents at themeeting and posting at the end of each day. Follow along here or atastrobites.com, or catch ourlive-tweeted updates from the@astrobites Twitter account. The usual posting schedule for AAS Nova will resumenext week.Welcome to Day 2 of the winter American Astronomical Society (AAS) meeting in Kissimmee! Several of us are attending the conference this year, and we will report highlights from each day here on astrobites. If youd like to see more timely updates during the day, we encourage you to follow @astrobites on twitter or search the #aas227 hashtag.Plenary Session: Black Hole Physics with the Event Horizon Telescope (by Susanna Kohler)If anyone needed motivation to wake up early this morning, they got it in the form of Feryal Ozel (University of Arizona) enthralling us all with exciting pictures, videos, and words about black holes and the Event Horizon Telescope. Ozel spoke to a packed room (at 8:30am!) about where the project currently stands, and where its heading in the future.The EHT has pretty much the coolest goal ever: actually image the event horizons of black holes in our universe. The problem is that the largest black hole we can look at (Sgr A*, in the center of our galaxy) has an event horizon size of 50 as. For this kind of resolution roughly equivalent to trying to image a DVD on the Moon! wed need an Earth-sized telescope. EHT has solved this problem by linking telescopes around the world, creating one giant, mm-wavelength effective telescope with a baseline the size of Earth.Besides producing awesome images, the EHT will be able to test properties of black-hole spacetime, the no-hair theorem, and general relativity (GR) in new regimes.Ozel walked us through some of the theory prep work we need to do now in order to get the most science out of the EHT, including devising new
Sorption studies of radioelements on geological materials
International Nuclear Information System (INIS)
Berry, John A.; Yui, Mikazu; Kitamura, Akira
2007-11-01
Batch sorption experiments have been carried out to study the sorption of uranium, technetium, curium, neptunium, actinium, protactinium, polonium, americium and plutonium onto bentonite, granodiorite and tuff. Mathematical modelling using the HARPHRQ program and the HATCHES database was carried out to predict the speciation of uranium and technetium in the equilibrated seawater, and neptunium, americium and plutonium in the rock equilibrated water. Review of the literature for thermodynamic data for curium, actinium, protactinium and polonium was carried out. Where sufficient data were available, predictions of the speciation and solubility were made. This report is a summary report of the experimental work conducted by AEA Technology during April 1991-March 1998, and the main results have been presented at Material Research Society Symposium Proceedings and published as proceedings of them. (author)
Norton, Parker A.; Anderson, Mark T.; Stamm, John F.
2014-01-01
The Missouri River and its tributaries are an important resource that serve multiple uses including agriculture, energy, recreation, and municipal water supply. Understanding historical streamflow characteristics provides relevant guidance to adaptive management of these water resources. Streamflow records in the Missouri River watershed were examined for trends in time series of annual, seasonal, and monthly streamflow. A total of 227 streamgages having continuous observational records for water years 1960–2011 were examined. Kendall’s tau nonparametric test was used to determine statistical significance of trends in annual, seasonal, and monthly streamflow. A trend was considered statistically significant for a probability value less than or equal to 0.10 that the Kendall’s tau value equals zero. Significant trends in annual streamflow were indicated for 101 out of a total of 227 streamgages. The Missouri River watershed was divided into six watershed regions and trends within regions were examined. The western and the southern parts of the Missouri River watershed had downward trends in annual streamflow (56 streamgages), whereas the eastern part of the watershed had upward trends in streamflow (45 streamgages). Seasonal and monthly streamflow trends reflected prevailing annual streamflow trends within each watershed region.
小林, ひろみ
2009-01-01
Public criticism of bilingual education or bilingualism in the United States has been growing since the early 1990s. As part of the argument against bilingual education, Hispanic immigrants have been portrayed as a monolithic group clinging to their own language and culture and reluctant to assimilate into American society. Proposition 227, which officially ended bilingual education programs in California public schools, was passed on June 2, 1998. Race and ethnicity were reflected in the ...
Contribution to the study of disintegration schemes of "2"2"7Th and of "2"1"9Rn
International Nuclear Information System (INIS)
Cluzeau, Serge
1965-01-01
After some theoretical recalls on the unified model, notably for regions of complete layers, for regions far from these layers, and for intermediate regions, and on angular correlations (γ ray shower, α-γ ray shower), this research thesis reports the study of total angular moments and of nucleus parities for some excitation states, for some elements of the "2"2"7Ac family. For this purpose, an alpha-gamma and gamma-gamma coincidence spectrometer has been developed. The author reports the study of the spectrometer performance, and discusses experimental results [fr
Vollmer, M. K.; Miller, B. R.; Rigby, M. L.; Reimann, S.; Muhle, J.; Agage, Soge, Snu Members, Kopri Members
2010-12-01
We report on the atmospheric measurements and global emissions of the hydrofluorocarbons (HFCs) HFC-365mfc (CH3CH2CF2CF3, 1,1,1,3,3-pentafluorobutane), HFC-245fa (CHF2CH2CF3, 1,1,1,3,3-pentafluoropropane), HFC-227ea (CF3CHFCF3, 1,1,1,2,3,3,3-heptafluoropropane), and HFC-236fa (CF3CH2CF3, 1,1,1,3,3,3-hexafluoropropane). These measurements are from in-situ observations at stations of AGAGE (Advanced Global Atmospheric Gases Experiment) and SOGE (System for Observations of Halogenated Greenhouse Gases in Europe), and from the Korean station Gosan. We also report on flask sample measurements from the Antarctic stations King Sejong and Troll, and extend our records back to the 1970s using archived air samples of both hemispheres. All data are used in a global 12-box 2-dimensional atmospheric transport model to derive global abundances and emission estimates. All four HFCs have strongly increased in the atmosphere in recent years with growth rates at nearly 10 %, resulting in dry air mole fractions at the end of 2009 of 0.49 ppt for HFC-365mfc, 1.00 ppt for HFC-245fa, and 0.51 ppt for HFC-227ea. HFC-236fa, for which we report the first atmospheric measurements, is less abundant and has grown to 0.069 ppt at the end of 2009. Our model results show rapidly growing emissions of HFC-365mfc and HFC-245fa after 2002 but surprisingly these have now started to decline to globally 2.7 kt/yr (HFC-365mfc) and 6.1 kt/yr (HFC-245fa). On the other hand HFC-227ea and HFC-236fa show uninterrupted growth in their emissions of 2.5 kt/yr and 0.2 kt/yr at the end of 2009.
Directory of Open Access Journals (Sweden)
Helen Heyerdahl
Full Text Available BACKGROUND: The aim of this study was to investigate therapeutic efficacy and normal tissue toxicity of single dosage and fractionated targeted alpha therapy (TAT in mice with HER2-expressing breast and ovarian cancer xenografts using the low dose rate radioimmunoconjugate (227Th-DOTA-p-benzyl-trastuzumab. METHODOLOGY/PRINCIPAL FINDINGS: Nude mice carrying HER2-overexpressing subcutaneous SKOV-3 or SKBR-3 xenografts were treated with 1000 kBq/kg (227Th-trastuzumab as single injection or four injections of 250 kBq/kg with intervals of 4-5 days, 2 weeks, or 4 weeks. Control animals were treated with normal saline or unlabeled trastuzumab. In SKOV-3 xenografts tumor growth to 10-fold size was delayed (p<0.01 and survival with tumor diameter less than 16 mm was prolonged (p<0.05 in all TAT groups compared to the control groups. No statistically significant differences were seen among the treated groups. In SKBR-3 xenografts tumor growth to 10-fold size was delayed in the single injection and 4-5 days interval groups (p<0.001 and all except the 4 weeks interval TAT group showed improved survival to the control groups (p<0.05. Toxicity was assessed by blood cell counts, clinical chemistry measurements and body weight. Transient reduction in white blood cells was seen for the single injection and 4-5 days interval groups (p<0.05. No significant changes were seen in red blood cells, platelets or clinical chemistry parameters. Survival without life threatening loss of body weight was significantly prolonged in 4 weeks interval group compared to single injection group (p<0.05 for SKOV-3 animals and in 2 weeks interval group compared with the 4-5 days interval groups (p<0.05 for SKBR-3 animals. CONCLUSIONS/SIGNIFICANCE: The same concentration of radioactivity split into several fractions may improve toxicity of (227Th-radioimmunotherapy while the therapeutic effect is maintained. Thus, it might be possible to increase the cumulative absorbed radiation dose
Formation and evolution of ultrafine particles produced by radiolysis and photolysis
International Nuclear Information System (INIS)
Madelaine, G.J.; Perrin, M.L.; Renoux, A.
1980-01-01
Results are presented, concerning the formation, the size distribution, and the behavior of ultrafine particles produced by alpha disintegration of actinium and uv irradiation in filtered and natural atmospheric air. The characterization of these particles is obtained by electrical aerosol analyzer and diffusion battery method. Measurements are made in the range between 0.003 and 0.5 micrometer. Some qualitative indications are obtained on the different mechanisms which govern the evolution of ultrafine particles in the atmosphere (nucleation, coagulation, and condensation). It is now well established that the photo-oxydation of SO 2 in the atmosphere leads to the production of sulphuric acid and of sulphate, which are usually found in the form of submicronic particles. This paper concerns the evolution of ultrafine particles generated in the presence of a preexisting aerosol. They are either instantaneously produced by the alpha disintegrations of actinium 219 or continuously produced by the transformation of SO 2 under uv irradiation
Energy Technology Data Exchange (ETDEWEB)
Brown, Paul L. [Geochem Australia, Kiama, NSW (Australia); Ekberg, Christian [Chalmers Univ. of Technology, Goeteborg (Sweden). Nuclear Chemistry/Industrial Materials Recycling
2016-07-01
All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO{sub 2}OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH{sup 2+} for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.
Status of liquid metal reactor development in the United States of America
International Nuclear Information System (INIS)
Griffith, J.D.; Horton, K.E.
1991-01-01
An existing network of government and industry research facilities and engineering test centers in the United States is currently providing test capabilities and the technical expertise required to conduct an aggressive advanced reactor development program. Subsequent to the directive to shut down the Fast Flux Test Facility in early 1990, a variety of activities were undertaken to provide support for continued operation. The United States has made substantial progress in achieving ALMR program objectives. The metal fuel cycle is designed to recycle and burn its own actiniums, and has the potential to be a very effective burner of actiniums generated in the LWRs. The current emphasis in the IFR Program is on the comprehensive development of the IFR (Integral Fast Reactor) technology, to be followed by a period of technology demonstration which would verify the economic feasibility of the concept. The United States has been active in international cooperative activities in the fast reactor sector since 1969. (author). 11 figs, 1 tab
International Nuclear Information System (INIS)
Brown, Paul L.; Ekberg, Christian
2016-01-01
All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO 2 OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH 2+ for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.
Outcomes From AAS Hack Day at the 227th AAS Meeting
Kohler, Susanna
2016-01-01
Editors Note:This is a final post from the 227th AAS Meeting in Kissimmee, FL. This special summary of AAS Hack Day, a meeting of AAS members to collaboratively work on various small projects, was written by Meredith Rawls (@Merrdiff) and was originally posted on astrobites.com.As the 227thAmerican Astronomical Society meeting drew to a close (see highlights from Day 1, Day 2, Day 3, and Day 4), a group of at least 50 attendees spent Day 4working on small projects fondly called hacks. Thanks to sponsorship from LSST and Northrup Grumman, the industrious hackers werewell-caffeinated and fed so we could devote time and energy toworking in groups on one-day projects.TheHack Day beganat 10am with pitches. Anybody with a project idea was welcome to briefly speak and try to convince others to work with them. Only someideas panned out, but the enthusiasm was palpable. Its not every day you get a full room of astronomers and affiliates eager to spend hours working on fun and useful projects to benefit the community.#hackAAS is getting underway! #aas227 pic.twitter.com/yX7jlOnSCK James R A Davenport (@jradavenport) January 8, 2016Here is a rundown of what we accomplished. Pretty impressive for a single day! Many thanks to fellow astrobiter Erika Nesvold (now at Carnegie DTM; @erikanesvold) whose hack was live-documenting all the other hacks. Her tweets as @astrobites appeared with the #hackaas hashtag, and her notes made this recap post infinitely easier to write.Interested in joining the fun? Sign up for Hack Day at the 2017 JanuaryAAS meeting (its free with meeting registration), and consider applying for the .Astronomy conference this summer.Towards Optimal Session Scheduling:Adrian Price-Whelan (Columbia), David Hogg (NYU), and Scott Idem (AAS) began writing a program to take all submitted abstracts to a conference like AAS and sort them using keywords to avoid scheduling similar talks in parallel sessions. Its impossible to make everyone happy, but minimizing conflicts
Directory of Open Access Journals (Sweden)
Stefania Dall'Olio
2014-09-01
Full Text Available The myostatin (MSTN gene encodes a protein known to be a negative regulator of muscle mass in mammalian species. Different polymorphisms of the horse (Equus caballus MSTN gene have been identified, including single nucleotide polymorphisms and a short interspersed nuclear element (SINE insertion of 227 bp within the promoter of the gene. The SINE insertion has been associated with performance traits in Thoroughbred racehorses and it was proposed as a predictor of optimum racing distance. The aims of this study were to perform in silico analysis to identify putative gains or abrogation of transcription-factor binding sites (TFBSs generated by the SINE allele of the promoter and to analyse the frequency of the SINE insertion in horses used for racing (gallop and trot and other purposes. The SINE insertion was genotyped in 227 horses from 10 breeds belonging to different morphological types (brachimorphic, mesomorphic, meso-dolichomorphic and dolichomorphic. The presence of the insertion was confirmed in the Quarter Horse (SINE allele frequency of 0.81 and in the Thoroughbred (0.51, whereas the SINE allele did not segregate in any of the other analysed breeds. As the SINE MSTN gene polymorphism may be population or breed specific, it is not a useful marker for association studies in all breeds.
Dall'Olio, Stefania; Scotti, Emilio; Fontanesi, Luca; Tassinari, Marco
2014-01-01
The myostatin (MSTN) gene encodes a protein known to be a negative regulator of muscle mass in mammalian species. Different polymorphisms of the horse (Equus caballus) MSTN gene have been identified, including single nucleotide polymorphisms and a short interspersed nuclear element (SINE) insertion of 227 bp within the promoter of the gene. The SINE insertion has been associated with performance traits in Thoroughbred racehorses and it was proposed as a predictor of optimum racing distance. The aims of this study were to perform in silico analysis to identify putative gains or abrogation of transcription-factor binding sites (TFBSs) generated by the SINE allele of the promoter and to analyse the frequency of the SINE insertion in horses used for racing (gallop and trot) and other purposes. The SINE insertion was genotyped in 227 horses from 10 breeds belonging to different morphological types (brachimorphic, mesomorphic, meso-dolichomorphic and dolichomorphic). The presence of the insertion was confirmed in the Quarter Horse (SINE allele frequency of 0.81) and in the Thoroughbred (0.51), whereas the SINE allele did not segregate in any of the other analysed breeds. As the SINE MSTN gene polymorphism may be population or breed specific, it is not a useful marker for association studies in all breeds.
Vollmer, Martin K.; Miller, Benjamin R.; Rigby, Matthew; Reimann, Stefan; Mühle, Jens; Krummel, Paul B.; O'Doherty, Simon; Kim, Jooil; Rhee, Tae Siek; Weiss, Ray F.; Fraser, Paul J.; Simmonds, Peter G.; Salameh, Peter K.; Harth, Christina M.; Wang, Ray H. J.; Steele, L. Paul; Young, Dickon; Lunder, Chris R.; Hermansen, Ove; Ivy, Diane; Arnold, Tim; Schmidbauer, Norbert; Kim, Kyung-Ryul; Greally, Brian R.; Hill, Matthias; Leist, Michael; Wenger, Angelina; Prinn, Ronald G.
2011-04-01
We report on ground-based atmospheric measurements and emission estimates of the four anthropogenic hydrofluorocarbons (HFCs) HFC-365mfc (CH3CF2CH2CF3, 1,1,1,3,3-pentafluorobutane), HFC-245fa (CHF2CH2CF3, 1,1,1,3,3-pentafluoropropane), HFC-227ea (CF3CHFCF3, 1,1,1,2,3,3,3-heptafluoropropane), and HFC-236fa (CF3CH2CF3, 1,1,1,3,3,3-hexafluoropropane). In situ measurements are from the global monitoring sites of the Advanced Global Atmospheric Gases Experiment (AGAGE), the System for Observations of Halogenated Greenhouse Gases in Europe (SOGE), and Gosan (South Korea). We include the first halocarbon flask sample measurements from the Antarctic research stations King Sejong and Troll. We also present measurements of archived air samples from both hemispheres back to the 1970s. We use a two-dimensional atmospheric transport model to simulate global atmospheric abundances and to estimate global emissions. HFC-365mfc and HFC-245fa first appeared in the atmosphere only ˜1 decade ago; they have grown rapidly to globally averaged dry air mole fractions of 0.53 ppt (in parts per trillion, 10-12) and 1.1 ppt, respectively, by the end of 2010. In contrast, HFC-227ea first appeared in the global atmosphere in the 1980s and has since grown to ˜0.58 ppt. We report the first measurements of HFC-236fa in the atmosphere. This long-lived compound was present in the atmosphere at only 0.074 ppt in 2010. All four substances exhibit yearly growth rates of >8% yr-1 at the end of 2010. We find rapidly increasing emissions for the foam-blowing compounds HFC-365mfc and HFC-245fa starting in ˜2002. After peaking in 2006 (HFC-365mfc: 3.2 kt yr-1, HFC-245fa: 6.5 kt yr-1), emissions began to decline. Our results for these two compounds suggest that recent estimates from long-term projections (to the late 21st century) have strongly overestimated emissions for the early years of the projections (˜2005-2010). Global HFC-227ea and HFC-236fa emissions have grown to average values of 2.4 kt yr-1
DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS
Energy Technology Data Exchange (ETDEWEB)
P. Bernot
2005-07-13
The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this activity is to predict dissolved concentrations or solubility limits for elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) relevant to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are provided in the form of tabulated functions with pH and log fCO{sub 2} as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. Even though selection of an appropriate set of radionuclides documented in Radionuclide Screening (BSC 2002 [DIRS 160059]) includes actinium, transport of Ac is not modeled in the total system performance assessment for the license application (TSPA-LA) model because of its extremely short half-life. Actinium dose is calculated in the TSPA-LA by assuming secular equilibrium with {sup 231}Pa (Section 6.10); therefore, Ac is not analyzed in this report. The output data from this report are fundamental inputs for TSPA-LA used to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for the actinides discussed in this report. These models cover broad ranges of environmental conditions so they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or
DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS
International Nuclear Information System (INIS)
P. Bernot
2005-01-01
The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this activity is to predict dissolved concentrations or solubility limits for elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) relevant to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are provided in the form of tabulated functions with pH and log fCO 2 as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. Even though selection of an appropriate set of radionuclides documented in Radionuclide Screening (BSC 2002 [DIRS 160059]) includes actinium, transport of Ac is not modeled in the total system performance assessment for the license application (TSPA-LA) model because of its extremely short half-life. Actinium dose is calculated in the TSPA-LA by assuming secular equilibrium with 231 Pa (Section 6.10); therefore, Ac is not analyzed in this report. The output data from this report are fundamental inputs for TSPA-LA used to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for the actinides discussed in this report. These models cover broad ranges of environmental conditions so they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or otherwise
Kinetics of radioisotope exchange between brine and rock in a geothermal system
International Nuclear Information System (INIS)
Hammond, D.E.; Zukin, J.G.; Teh-Lung Ku
1988-01-01
A wide range of isotopes in the /sup 238/U, /sup 235/U, and /sup 232/Th decay chains was measured in geothermal brines collected from two production zones at 1898 and 3220 m in the Salton Sea Scientific Drilling Project well. High concentrations of radium, radon, and lead isotopes are generated and maintained by the input of these isotopes from solid phases into brine by both recoil and leaching processes, by the high chloride content of the brine which complexes radium and lead, and by the apparent absence of suitable unoccupied adsorption sites. In contrast, uranium, thorium, actinium, bismuth, and polonium isotopes all have low concentrations due to their efficient sorption from brine to rock. Measurements of short-lived isotopes in these decay series yield insights regarding the mechanisms controlling radioisotope exchange, and they permit estimation of rates of brine-rock interaction. For example, the /sup 228/Ac//sup 228/Ra activity ratio of 0.2 in brines indicates that the mean residence time of actinium in solution before sorption onto solid surfaces is less than 2.5 hours
Directory of Open Access Journals (Sweden)
David Mandler
2015-01-01
Full Text Available Nopcsa, Baron Franz. 2014. Traveler, Scholar, Politician, Adventurer – A Transylvanian Baron at the Birth of Albanian Independence (ed. and trans. from German Robert Elsie. Budapest: Central European University Press. 227 pp. Reviewed by David Mandler, Independent Scholar
Emmen, H.H.; Hoogendijk, E.M.G.; Klöpping-Ketelaars, W.A.A.; Muijser, H.; Duistermaat, E.; Ravensberg, J.C.; Alexander, D.J.; Borkhataria, D.; Rusch, G.M.; Schmit, B.
2000-01-01
HFC 134a (1,1,1,2-tetrafluoroethane) and HFC 227 (1,1,1,2,3,3,3-heptafluoropropane) are used to replace chlorofluorocarbons (CFCs) in refrigerant and aerosol applications, including medical use in metered-dose inhalers. Production and consumption of CFCs are being phased out under the Montreal
Rheumatologic complications in a cohort of 227 patients with common variable immunodeficiency.
Azizi, G; Kiaee, F; Hedayat, E; Yazdani, R; Dolatshahi, E; Alinia, T; Sharifi, L; Mohammadi, H; Kavosi, H; Jadidi-Niaragh, F; Ziaee, V; Abolhassani, H; Aghamohammadi, A
2018-05-01
Common variable immunodeficiency (CVID) is the most prevalent symptomatic type of human primary immunodeficiency diseases (PID). Clinically, CVID is characterized by increased susceptibility to infections and a wide variety of autoimmune and rheumatologic disorders. All patients with CVID registered in Iranian PID Registry (IPIDR) were enrolled in this retrospective cohort study. We investigated the frequency of rheumatologic diseases and its association with immunological and clinical phenotypes in patients with CVID. A total of 227 patients with CVID were enrolled in this study. The prevalence of rheumatologic disorders was 10.1% with a higher frequency in women than men. Most common rheumatologic manifestations were juvenile idiopathic arthritis (JIA) and adult rheumatoid arthritis (RA) followed by juvenile spondyloarthritis (JSpA) and undifferentiated inflammatory arthritis (UIA). Septic arthritis in patients with CVID with a history of RA and JIA was higher than patients without rheumatologic complication. Patients with CVID with a history of autoimmunity (both rheumatologic and non-rheumatologic autoimmunity) had lower regulatory T cells counts in comparison with patients without autoimmune disorders. There was an association between defect in specific antibody responses and negative serologic test results in patients with rheumatologic manifestations. JIA, RA, JSpA and UIA are the most frequent rheumatologic disorders in patients with CVID. Due to antibody deficiency, serologic tests may be negative in these patients. Therefore, these conditions pose significant diagnostic and therapeutic challenges for immunologists and rheumatologists in charge of the care for these patients. © 2018 The Foundation for the Scandinavian Journal of Immunology.
International Nuclear Information System (INIS)
Heidenreich, W.F.; Rosemann, M.
2012-01-01
We explore the potential for the biologically based two-stage clonal expansion model to make statements about the influence of genetic factors on the steps in the model. We find evidence that the different susceptibility of BALB/C and CBA/Ca mice to bone cancer after 227 Thorium injection may be mostly due to different promotional responses to radiation. In BALB/C x CBA/Ca back-crossed mice, we analyzed the specific contribution of two individual loci in the carcinogenic process. This analysis suggests that the two high- or low-risk alleles are acting on promotion or on the background parameters, but not on radiation-induced initiation. Taken together with the comparison of CBA/Ca and BALB/C mice, this hints at the possibility that the two loci are candidates for modifying radiation-induced promotion. (orig.)
Determination of radionuclides in discharged water from gold ...
African Journals Online (AJOL)
Long-lived radionuclides from the Uranium-, Thorium- and Actinium-decay chains in the discharged water into the environment were radiochemically separated and the activity concentrations determined for 238U-series ranged from 3.8 ± 1.5 to 178 ± 19 mBqL-1, 232Th-series ranged from < 2.0 to 47.8 ± 7.3 mBqL-1 and ...
International Nuclear Information System (INIS)
Rolison, J.M.; Treinen, K.C.; McHugh, K.C.; Gaffney, A.M.; Williams, R.W.
2017-01-01
Uranium certified reference materials (CRM) issued by New Brunswick Laboratory were subjected to dating using four independent uranium-series radiochronometers. In all cases, there was acceptable agreement between the model ages calculated using the 231 Pa- 235 U, 230 Th- 234 U, 227 Ac- 235 U or 226 Ra- 234 U radiochronometers and either the certified 230 Th- 234 U model date (CRM 125-A and CRM U630), or the known purification date (CRM U050 and CRM U100). The agreement between the four independent radiochronometers establishes these uranium certified reference materials as ideal informal standards for validating dating techniques utilized in nuclear forensic investigations in the absence of standards with certified model ages for multiple radiochronometers. (author)
An aerial radiological survey of the Sandia National Laboratories and surrounding area
International Nuclear Information System (INIS)
Riedhauser, S.R.
1994-06-01
A team from the Remote Sensing Laboratory conducted an aerial radiological survey of the area surrounding the Sandia National Laboratories and Kirtland Air Force Base in Albuquerque, New Mexico, during March and April 1993. The survey team measured the terrestrial gamma radiation at the site to determine the levels of natural and man-made radiation. This survey includes the areas covered by a previous survey in 1981. The results of the aerial survey show a background exposure rate which varies between 5 and 18 μR/h plus an approximate 6 μR/h contribution from cosmic rays. The major radioactive isotopes found in this survey were: potassium-40, thallium-208, bismuth-214, and actinium-228, which are all naturally-occurring isotopes, and cobalt-60, cesium-137, and excess amounts of thallium-208 and actinium-228, which are due to human actions in the survey area. In regions away from man-made activity, the exposure rates inferred from this survey's gamma ray measurements agree almost exactly with the exposure rates inferred from the 1981 survey. In addition to the aerial measurements, another survey team conducted in situ and soil sample radiation measurements at three sites within the survey perimeter. These ground-based measurements agree with the aerial measurements within ± 5%
MUC1 (CD227) interacts with lck tyrosine kinase in Jurkat lymphoma cells and normal T cells.
Mukherjee, P; Tinder, T L; Basu, G D; Gendler, S J
2005-01-01
MUC1 (CD227) is a large transmembrane epithelial mucin glycoprotein, which is aberrantly overexpressed in most adenocarcinomas and is a target for immune therapy for epithelial tumors. Recently, MUC1 has been detected in a variety of hematopoietic cell malignancies including T and B cell lymphomas and myelomas; however, its function in these cells is not clearly defined. Using the Jurkat T cell lymphoma cell line and normal human T cells, we demonstrate that MUC1 is not only expressed in these cells but is also phosphorylated upon T cell receptor (TCR) ligation and associates with the Src-related T cell tyrosine kinase, p56lck. Upon TCR-mediated activation of Jurkat cells, MUC1 is found in the low-density membrane fractions, where linker of T cell activation is contained. Abrogation of MUC1 expression in Jurkat cells by MUC1-specific small interfering RNA resulted in defects in TCR-mediated downstream signaling events associated with T cell activation. These include reduction in Ca2+ influx and extracellular signal-regulated kinase 1/2 phosphorylation, leading to a decrease in CD69 expression, proliferation, and interleukin-2 production. These results suggest a regulatory role of MUC1 in modulating proximal signal transduction events through its interaction with proteins of the activation complex.
Directory of Open Access Journals (Sweden)
Hao Li
2016-01-01
Full Text Available 1,1,1,2,3,3,3-Heptafluoropropane (R227ea is a good refrigerant that reduces greenhouse effects and ozone depletion. In practical applications, we usually have to know the compressed liquid densities at different temperatures and pressures. However, the measurement requires a series of complex apparatus and operations, wasting too much manpower and resources. To solve these problems, here, Song and Mason equation, support vector machine (SVM, and artificial neural networks (ANNs were used to develop theoretical and machine learning models, respectively, in order to predict the compressed liquid densities of R227ea with only the inputs of temperatures and pressures. Results show that compared with the Song and Mason equation, appropriate machine learning models trained with precise experimental samples have better predicted results, with lower root mean square errors (RMSEs (e.g., the RMSE of the SVM trained with data provided by Fedele et al. [1] is 0.11, while the RMSE of the Song and Mason equation is 196.26. Compared to advanced conventional measurements, knowledge-based machine learning models are proved to be more time-saving and user-friendly.
The prevalence of ABCB1:c.227_230delATAG mutation in affected dog breeds from European countries.
Firdova, Zuzana; Turnova, Evelina; Bielikova, Marcela; Turna, Jan; Dudas, Andrej
2016-06-01
Deletion of 4-base pairs in the canine ABCB1 (MDR1) gene, responsible for encoding P-glycoprotein, leads to nonsense frame-shift mutation, which causes hypersensitivity to macrocyclic lactones drugs (e.g. ivermectin). To date, at least 12 purebred dog breeds have been found to be affected by this mutation. The aim of this study was to update information about the prevalence of ABCB1 mutation (c.227_230delATAG) in predisposed breeds in multiple European countries. This large scale survey also includes countries which were not involved in previous studies. The samples were collected in the period from 2012 to 2014. The overview is based on genotyping data of 4729 individuals. The observed mutant allele frequencies were 58.5% (Smooth Collie), 48.3% (Rough Collie), 35% (Australian Shepherd), 30.3% (Shetland Sheepdog), 28.1% (Silken Windhound), 26.1% (Miniature Australian Shepherd), 24.3% (Longhaired Whippet), 16.2% (White Swiss Shepherd) and 0% (Border Collie). The possible presence of an ABCB1 mutant allele in Akita-Inu breed has been investigated with negative results. This information could be helpful for breeders in optimization of their breeding strategy and for veterinarians when prescribing drug therapy for dogs of predisposed breeds. Copyright © 2016 Elsevier Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Harangozo, M; Toelgyessy, J; Lesny, J; Cik, G [Slovak Technical Univ., Bratislava (Slovakia). Fac. of Chemical Technology, Dept. of Environmental Science
1996-12-31
In this paper the activities of radium-226, actinium-228 and potassium-40 in fly ashes and building materials of Slovakia were determined. Different origin of coals combusted results in significant differences in specific activities of radium-226 and activities-228 of measured fly-ashes and building materials. The knowledge of the specific activity of selected nuclides contained in fly-ashes is, therefore, very important and in specific cases can indicate the possibilities of their further technological use. (J.K.) 1 tab., 3 refs.
Directory of Open Access Journals (Sweden)
Skogerbø Geir
2007-09-01
Full Text Available Abstract Background The 2,2,7-trimethylguanosine (TMG cap structure is an important functional characteristic of ncRNAs with critical cellular roles, such as some snRNAs. Here we used immunoprecipitation with both K121 and R1131 anti-TMG antibodies to systematically identify the TMG cap structures for all presently characterized ncRNAs in C. elegans. Results The two anti-TMG antibodies precipitated a similar group of the C. elegans ncRNAs. All snRNAs known to have a TMG cap structure were found in the precipitate, indicating that our identification system was efficient. Other ncRNA families related to splicing, such as SL RNAs and Sm Y RNAs, were also found in the precipitate, as were 7 C/D box snoRNAs. Further analysis showed that the SL RNAs and the Sm Y RNAs shared a very similar Sm binding site element (AAU4–5GGA, which sequence composition differed somewhat from those of other U snRNAs. There were also 16 ncRNAs without an Sm binding site element in the precipitate, suggesting that for these ncRNAs, TMG formation may occur independently of Sm proteins. Conclusion Our results showed that most ncRNAs predicted to be transcribed by RNA polymerase II had a TMG cap, while those predicted to be transcribed by RNA plymerase III or located in introns did not have a TMG cap structure. Compared to ncRNAs without a TMG cap, TMG-capped ncRNAs tended to have higher expression levels. Five functionally non-annotated ncRNAs also have a TMG cap structure, which might be helpful for identifying the cellular roles of these ncRNAs.
African Journals Online (AJOL)
2003-05-01
, the ... care workers in addition to immunization hospital safety practices are encouraged(4,5). ... observed, anaesthetists, circulating nursing personnel and others ..... after percutaneous injuries caused by hollow injection.
Purification of cerium, neodymium and gadolinium for low background experiments
Directory of Open Access Journals (Sweden)
Boiko R.S.
2014-01-01
Full Text Available Cerium, neodymium and gadolinium contain double beta active isotopes. The most interesting are 150Nd and 160Gd (promising for 0ν2β search, 136Ce (2β+ candidate with one of the highest Q2β. The main problem of compounds containing lanthanide elements is their high radioactive contamination by uranium, radium, actinium and thorium. The new generation 2β experiments require development of methods for a deep purification of lanthanides from the radioactive elements. A combination of physical and chemical methods was applied to purify cerium, neodymium and gadolinium. Liquid-liquid extraction technique was used to remove traces of Th and U from neodymium, gadolinium and for purification of cerium from Th, U, Ra and K. Co-precipitation and recrystallization methods were utilized for further reduction of the impurities. The radioactive contamination of the samples before and after the purification was tested by using ultra-low-background HPGe gamma spectrometry. As a result of the purification procedure the radioactive contamination of gadolinium oxide (a similar purification efficiency was reached also with cerium and neodymium oxides was decreased from 0.12 Bq/kg to 0.007 Bq/kg in 228Th, from 0.04 Bq/kg to <0.006 Bq/kg in 226Ra, and from 0.9 Bq/kg to 0.04 Bq/kg in 40K. The purification methods are much less efficient for chemically very similar radioactive elements like actinium, lanthanum and lutetium.
International Nuclear Information System (INIS)
Keller, C.
1988-01-01
Fifty years after the discovery of fission, the scientific community is aware that this type of nuclear reaction could have been discovered more than a decade earlier. Noddack, Tacke and Berg announced in 1925 the discovery of elements Z = 43 (masurium) and rhenium (Z = 75), the first one could be detected only in U-bearing minerals. A recent re-examination by P.H.M. von Assche of the published data clearly showed that the original claim for element Z = 43 of the authors in 1925 was correct and, therefore, they detected not only element Z = 43 but also the first fission product. Because this discovery of element Z = 43 could not be repeated by other authors as that time, the scientific credibility of Noddack-Tacke was very low in order to give credit to her proposal that the 'early' transuranium elements by Enrico Fermi might also be fragments of known (lighter) elements. Enrico Fermi in 1934 obtained these 'early' (and as we today know: wrong) transuranium isotopes by irradiation of uranium with neutrons. A 'wrong' periodic system in the thirties which placed Th, Pa and U as 6d-elements and not as 5f-actinides chemically helped to consider these fission products as transuranium elements Z = 93/94. In 1937/38 I. Curie and P. Savitch discovered an 'actinium-nuclide' with 3,5 h half-life which, however, had properties similar to lanthanium and not to actinium, as they stated. (orig.) [de
International Nuclear Information System (INIS)
Martinot, L.; Fuger, J.
1985-01-01
The oxidation behavior of the actinides is explained on the basis of their electronic structure. The actinide elements, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium, curium, berkelium, californium, einsteinium, fermium, mendelevium, nobelium, and laurencium are included. For all except the last three elements, the points of discussion are oxidation states, Gibbs energies and potentials, and potential diagram for the element in acid solution; and thermodynamic properties of these same elements are tabulated. References are cited following discussion of each element with a total of 97 references being cited. 13 tables
International Nuclear Information System (INIS)
Tekuchev, V.V.; Barashkov, B.I.; Rygalov, L.N.; Dolzhikov, Yu.S.
2001-01-01
For the first time one obtained the polytherms of ultrasound velocity for liquid high-melting metals within wide temperature range. In terms of the rigid sphere model on the basis of the acoustic data one calculated the entropy values for 34 liquid metals at the melting point. The average discrepancy of the calculated values of entropy with the published one constitutes 8.2%. With increase of metal valency the error increases from 2.8 up to 13%. In case of francium, radium, promethium, actinium, hafnium, polonium, rhenium one obtained data for the first time [ru
Status of the lanthanides and actinides in the periodic table
International Nuclear Information System (INIS)
Holden, N.E.
1985-01-01
In extended discussions and correspondence with Ekkehard Fluck, the author was made aware of a problem with the Periodic Table, i.e., which element should be shown in the main table as the representative of the lanthanide series and the actinide series. In earlier discussion, he came to the conclusion that lanthanum and actinium are not the elements which should appear, but rather lutetium and lawrencium are more appropriate for inclusion in their place. This paper will attempt to justify the reasons for the above conclusions. 4 refs
International Nuclear Information System (INIS)
Ford, W.E. III; Diggs, B.R.; Petrie, L.M.; Webster, C.C.; Westfall, R.M.
1982-01-01
A P 3 227-neutron-group cross-section library has been processed for the subsequent generation of problem-dependent fine- or broad-group cross sections for a broad range of applications, including shipping cask calculations, general criticality safety analyses, and reactor core and shielding analyses. The energy group structure covers the range 10 -5 eV - 20 MeV, including 79 thermal groups below 3 eV. The 129-material library includes processed data for all materials in the ENDF/B-V General Purpose File, several data sets prepared from LENDL data, hydrogen with water- and polyethyelene-bound thermal kernels, deuterium with C 2 O-bound thermal kernels, carbon with a graphite thermal kernel, a special 1/V data set, and a dose factor data set. The library, which is in AMPX master format, is designated CSRL-V (Criticality Safety Reference Library based on ENDF/B-V data). Also included in CSRL-V is a pointwise total, fission, elastic scattering, and (n,γ) cross-section library containing data sets for all ENDF/B-V resonance materials. Data in the pointwise library were processed with the infinite dilute approximation at a temperature of 296 0 K
International Nuclear Information System (INIS)
Sarlar, Kagan; Kucuk, Ilker
2015-01-01
The effect of Fe concentration on the glass forming ability (GFA) and magnetic properties in Co (40.2−x) Fe (20.1+x) Ni 6.7 B 22.7 Si 5.3 Nb 5 (x=0–10) bulk metallic glasses were investigated. By suction casting method, the bulk metallic glasses with diameters up to 2 mm were produced. We try to find out which Fe concentration makes an influence on Co based system's magnetic properties and glass forming ability. The curves of thermal analysis, obtained using differential scanning calorimetry (DSC), show that the Co (40.2−x) Fe (20.1+x) Ni 6.7 B 22.7 Si 5.3 Nb 5 (x=0–10) have a supercooled liquid region (∆T x ) of about 44 K. The saturation magnetizations (J s ) for as-cast BMG alloys were in the range of 0.62 T−0.81 T. - Highlights: • The effect of Fe concentration on the glass forming ability. • The substitution of an appropriate amount of Fe can enhance the GFA. • The substitution of Fe for Co also improves soft magnetic properties of the BMGs. • The high of J s 0.62−0.81 T with a low H c of 2−289 A/m of the alloys
International Nuclear Information System (INIS)
Payne, T.E.
1991-01-01
One way to gain confidence in modelling possible radionuclide releases is to study natural systems which are similar to components of the multibarrier waste repository. Several such analogues are currently under study and these provide useful data about radionuclide behaviour in the natural environment. One such system is the Koongarra uranium deposit in the Northern Territory. In this dissertation, the migration of actinides, primarily uranium and thorium, has been studied as an analogue for the behaviour of transuranics in the far-field of a waste repository. The major findings of this study are: 1. the main process retarding uranium migration in the dispersion fan at Koongarra is sorption, which suppresses dissolved uranium concentrations well below solubility limits, with ferrihydrite being a major sorbing phase; 2. thorium is extremely immobile, with very low dissolved concentrations and corresponding high distribution ratios for 230 Th. Overall, it is estimated that colloids are relatively unimportant in Koongarra groundwater. Uranium migrates mostly as dissolved species, whereas thorium and actinium are mostly adsorbed to larger, relatively immobile particles and the stationary phase. However, of the small amount of 230 Th that passes through a 1μm filter, a significant proportion is associated with colloidal particles. Actinium appears to be slightly more mobile than thorium and is associated with colloids to a greater extent, although generally present in low concentrations. These results support the possibility of colloidal transport of trivalent and tetravalent actinides in the vicinity of a nuclear waste repository. 112 refs., 23 tabs., 32 figs
An eighteen-membered macrocyclic ligand for actinium-225 targeted alpha therapy
International Nuclear Information System (INIS)
Thiele, Nikki A.; MacMillan, Samantha N.; Wilson, Justin J.; Rodriguez-Rodriguez, Cristina
2017-01-01
The 18-membered macrocycle H 2 macropa was investigated for 225 Ac chelation in targeted alpha therapy (TAT). Radiolabeling studies showed that macropa, at submicromolar concentration, complexed all 225 Ac (26 kBq) in 5 min at RT. [ 225 Ac(macropa)] + remained intact over 7 to 8 days when challenged with either excess La 3+ ions or human serum, and did not accumulate in any organ after 5 h in healthy mice. A bifunctional analogue, macropa-NCS, was conjugated to trastuzumab as well as to the prostate-specific membrane antigen-targeting compound RPS-070. Both constructs rapidly radiolabeled 225 Ac in just minutes at RT, and macropa-Tmab retained >99 % of its 225 Ac in human serum after 7 days. In LNCaP xenograft mice, 225 Ac-macropa-RPS-070 was selectively targeted to tumors and did not release free 225 Ac over 96 h. These findings establish macropa to be a highly promising ligand for 225 Ac chelation that will facilitate the clinical development of 225 Ac TAT for the treatment of soft-tissue metastases. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)
An eighteen-membered macrocyclic ligand for actinium-225 targeted alpha therapy
Energy Technology Data Exchange (ETDEWEB)
Thiele, Nikki A.; MacMillan, Samantha N.; Wilson, Justin J. [Cornell Univ., Ithaca, NY (United States). Chemistry and Chemical Biology; Brown, Victoria; Jermilova, Una; Ramogida, Caterina F.; Robertson, Andrew K.H.; Schaffer, Paul; Radchenko, Valery [TRIUMF, Vancouver, BC (Canada). Life Science Div.; Kelly, James M.; Amor-Coarasa, Alejandro; Nikolopoulou, Anastasia; Ponnala, Shashikanth; Williams, Clarence Jr.; Babich, John W. [Radiology, Weill Cornell Medicine, New York, NY (United States); Rodriguez-Rodriguez, Cristina [British Columbia Univ., Vancouver, BC (Canada). Dept. of Physics and Astronomy and Centre for Comparative Medicine
2017-11-13
The 18-membered macrocycle H{sub 2}macropa was investigated for {sup 225}Ac chelation in targeted alpha therapy (TAT). Radiolabeling studies showed that macropa, at submicromolar concentration, complexed all {sup 225}Ac (26 kBq) in 5 min at RT. [{sup 225}Ac(macropa)]{sup +} remained intact over 7 to 8 days when challenged with either excess La{sup 3+} ions or human serum, and did not accumulate in any organ after 5 h in healthy mice. A bifunctional analogue, macropa-NCS, was conjugated to trastuzumab as well as to the prostate-specific membrane antigen-targeting compound RPS-070. Both constructs rapidly radiolabeled {sup 225}Ac in just minutes at RT, and macropa-Tmab retained >99 % of its {sup 225}Ac in human serum after 7 days. In LNCaP xenograft mice, {sup 225}Ac-macropa-RPS-070 was selectively targeted to tumors and did not release free {sup 225}Ac over 96 h. These findings establish macropa to be a highly promising ligand for {sup 225}Ac chelation that will facilitate the clinical development of {sup 225}Ac TAT for the treatment of soft-tissue metastases. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)
Vasilescu, C; Herlea, V; Tidor, S; Ivanov, B; Stănciulea, Oana; Mănuc, M; Gheorghe, C; Ionescu, M; Diculescu, M; Popescu, I
2006-01-01
The main objective of the study was to evaluate the postoperative mortality and 5 year survival in gastric cancer patients undergoing a minimum of D2 lymphadenectomy. A retrospective study was conducted on 1170 patients operated for gastric adenocarcinoma in the Department of General Surgery and Liver Transplantation of Fundeni Clinical Institute, between 1997 and April 2005. Only 443 patients underwent a curative resection, from which 216 patients had D1 resection and in 227 cases a D2 or D3/D4 lymphadenectomy was performed. Information about survival was available for 189 patients of those who had a D1 resection and for 210 of those who underwent a D2 or D3/D4 lymphadenectomy. Postoperative mortality was 6.5% in the group of curative resection, with 9.2% for D1 and 3.9% for D2/D3 D4. Five year survival according to Kaplan Meier curves was 32 % in the D1 group vs. 51,8% in D2/D3-D4 (p <0.0001). Significant differences were noted in the median survival-- D2/D3-D4 group 63 months vs. 28 months in D1 group. Our data support the gastric resection with a minimum of D2 lymphadenectomy in the radical surgery of gastric cancer. However, an accurate interpretation of the statistical interpretation between the different groups of patients is difficult, mainly because of the retrospective character of the study.
Lin, Chun-Yu; Chiu, Chun-Ching; Cheng, Ju; Lin, Chia-Yun; Shi, Ya-Fang; Tsai, Chun-Chou; Tzang, Bor-Show; Hsu, Tsai-Ching
2018-01-01
Mounting evidence suggests a connection between human parvovirus B19 (B19) and autoimmune diseases, and especially an association between the B19-VP1 unique region (VP1u) and anti-phospholipid syndrome (APS). However, little is known about the antigenicity of B19-VP1u in the induction of APS-like syndrome. To elucidate the antigenicity of B19-VP1u in the induction of APS, N-terminal truncated B19-VP1u (tVP1u) proteins were prepared to immunize Balb/c mice to generate antibodies against B19-tVP1u proteins. The secreted phospholipase A2 (sPLA2) activities and binding specificity of mice anti-B19-tVP1u antibodies with cardiolipin (CL) and beta-2-glycoprotein I (β2GPI) were evaluated by performing immunoblot, ELISA and absorption experiments. A mice model of passively induced APS was adopted. Although sPLA2 activities were identified in all B19-tVP1u proteins, only amino acid residues 61-227 B19-tVP1u exhibited a higher sPLA2 activity. Autoantibodies against CL and β2GPI exhibited binding activities with all B19-tVP1u proteins. IgG that was purified from mice that had been immunized with amino acid residues 21-227 to 121-227 B19-tVP1u proteins exhibited significantly higher binding activity with CL. IgG that was purified from mice that had been immunized with amino acid residues 21-227, 31-227, 82-227 and 91-227 B19-tVP1u proteins exhibited significantly higher binding activity with β2GPI. Accordingly, significantly higher binding inhibition of CL was detected in the presence of amino acid residues 61-227 and 101-227 B19-tVP1u. Significantly higher binding inhibition of β2GPI was detected in the presence of amino acid residues 21-227, 31-227, 82-227 and 91-227 B19-tVP1u. The mice that received amino acid residues 31-227 or 61-227 anti-tB19-VP1u IgG revealed significant thrombocytopenia and those that received amino acid residues 21-227, 31-227, 61-227, 71-227, 82-227, 91-227, 101-227 or 114-227 anti-tB19-VP1u IgG exhibited significantly prolonged aPTT. These
Energy Technology Data Exchange (ETDEWEB)
Marx, Sebastian Markus
2014-09-23
The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.
Energy Technology Data Exchange (ETDEWEB)
Sarlar, Kagan [Physics Department, Faculty of Arts and Sciences, Uludag University, Gorukle Campus, 16059 Bursa (Turkey); Physics Department, Kamil Ozdag Faculty of Sciences, Karamanoglu Mehmetbey University, YunusEmre Campus, 70100 Karaman (Turkey); Kucuk, Ilker, E-mail: ikucuk@uludag.edu.tr [Physics Department, Faculty of Arts and Sciences, Uludag University, Gorukle Campus, 16059 Bursa (Turkey)
2015-01-15
The effect of Fe concentration on the glass forming ability (GFA) and magnetic properties in Co{sub (40.2−x)}Fe{sub (20.1+x)}Ni{sub 6.7}B{sub 22.7}Si{sub 5.3}Nb{sub 5} (x=0–10) bulk metallic glasses were investigated. By suction casting method, the bulk metallic glasses with diameters up to 2 mm were produced. We try to find out which Fe concentration makes an influence on Co based system's magnetic properties and glass forming ability. The curves of thermal analysis, obtained using differential scanning calorimetry (DSC), show that the Co{sub (40.2−x)}Fe{sub (20.1+x)}Ni{sub 6.7}B{sub 22.7}Si{sub 5.3}Nb{sub 5} (x=0–10) have a supercooled liquid region (∆T{sub x}) of about 44 K. The saturation magnetizations (J{sub s}) for as-cast BMG alloys were in the range of 0.62 T−0.81 T. - Highlights: • The effect of Fe concentration on the glass forming ability. • The substitution of an appropriate amount of Fe can enhance the GFA. • The substitution of Fe for Co also improves soft magnetic properties of the BMGs. • The high of J{sub s} 0.62−0.81 T with a low H{sub c} of 2−289 A/m of the alloys.
2011-03-08
..., Washington 98057-3356; telephone 425-227- 2136; fax 425-227-1149; e-mail [email protected] ; or Robert...-1149; e-mail [email protected] . SUPPLEMENTARY INFORMATION: On February 10, 2011, we issued AD..., Washington 98057-3356; telephone (425) 227-2136; fax (425) 227-1149; e-mail [email protected] . (ii...
Radionuclide interactions with marine sediments
International Nuclear Information System (INIS)
Higgo, J.J.W.
1987-09-01
A critical review of the literature on the subject of the interactions of radionuclides with marine sediments has been carried out. On the basis of the information available, an attempt has been made to give ranges and 'best estimates' for the distribution ratios between seawater and sediments. These estimates have been based on an understanding of the sediment seawater system and the porewater chemistry and mineralogy. Field measurements, laboratory measurements and estimates based on stable-element geochemical data are all taken into account. Laboratory measurements include distribution-ratio and diffusion-coefficient determinations. The elements reviewed are carbon, chlorine, calcium, nickel, selenium, strontium, zirconium, niobium, technetium, tin, iodine, caesium, lead, radium, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium and curium. (author)
Calculation technique of free and impurity ion electronic structures
International Nuclear Information System (INIS)
Kulagin, N.A.; Sviridov, D.T.
1986-01-01
The monograph deals with calculation technique of free and impurity ion spectra with completed nl N -shell. The principles of the theory of irreducible tensor operators, genealogical coefficients, calculation technique of angular and radial parts of matrix elements operators are stated. The correlation accounting methods in free ions are considered in detail. The principles of the theory of crystal field and ligand field, the method of self-consistent field for impurity ions are reported. The technique efficiency based on example of lanthanum and actinium group ions is shown. Experimental data by nf N -ion spectra are given. The tables of angular coefficients, energy values of X-ray lines of rare earth ions and genealogical coefficients are given in the appendix
International Nuclear Information System (INIS)
Kitamura, Akira; Fujiwara, Kenso; Yui, Mikazu
2010-01-01
Within the scope of the JAEA thermodynamic database project for performance assessment of geological disposal of high-level radioactive and TRU wastes, the refinement of the thermodynamic data for the inorganic compounds and complexes of trivalent actinoids (actinium(III), plutonium(III), americium(III) and curium(III)) and samarium(III) was carried out. Refinement of thermodynamic data for these elements was based on the thermodynamic database for americium published by the Nuclear Energy Agency in the Organisation for Economic Co-operation and Development (OECD/NEA). Based on the similarity of chemical properties among trivalent actinoids and samarium, complementary thermodynamic data for their species expected under the geological disposal conditions were selected to complete the thermodynamic data set for the performance assessment of geological disposal of radioactive wastes. (author)
Energy Technology Data Exchange (ETDEWEB)
None
1979-09-01
Results of two radiological surveys of the St. Louis-Lambert Airport property, formerly known as the Airport Storage Site, St. Louis, Missouri, are presented. Uranium- and radium-bearing waste materials were stored from the 1940's to the late 1960's in this area. The surveys included direct measurements of beta-gamma radiation; determination of uranium, actinium, and radium concentrations in soil samples and from bore holes; determination of radionuclide concentrations in groundwater and surface water; measurement of radon flux from the ground surface; and measurements of /sup 222/Rn in air near the site. Results indicate that some offsite drainage pathways are becoming contaminated, probably by runoff from the site; no migration of /sup 222/Rn from the site was observed.
Dissolved Concentration Limits of Radioactive Elements
Energy Technology Data Exchange (ETDEWEB)
Y. Chen; E.R. Thomas; F.J. Pearson; P.L. Cloke; T.L. Steinborn; P.V. Brady
2003-06-20
The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of radioactive elements under possible repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, and measurements made in laboratory experiments and field work. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 radioactive elements (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium), which are important to calculated dose. Model outputs are mainly in the form of look-up tables plus one or more uncertainty terms. The rest are either in the form of distributions or single values. The results of this analysis are fundamental inputs for total system performance assessment to constrain the release of these elements from waste packages and the engineered barrier system. Solubilities of plutonium, neptunium, uranium, americium, actinium, thorium, protactinium, lead, and radium have been re-evaluated using the newly updated thermodynamic database (Data0.ymp.R2). For all of the actinides, identical modeling approaches and consistent environmental conditions were used to develop solubility models in this revision. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, activity coefficients, and selection of solubility controlling phase have been quantified or otherwise addressed. Moreover, a new blended plutonium solubility model has been developed in this revision, which gives a mean solubility that is three orders of magnitude lower than the plutonium solubility model used for the Total System Performance Assessment for the Site Recommendation. Two alternative neptunium solubility models have also been
Dissolved Concentration Limits of Radioactive Elements
International Nuclear Information System (INIS)
Y. Chen; E.R. Thomas; F.J. Pearson; P.L. Cloke; T.L. Steinborn; P.V. Brady
2003-01-01
The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of radioactive elements under possible repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, and measurements made in laboratory experiments and field work. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 radioactive elements (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium), which are important to calculated dose. Model outputs are mainly in the form of look-up tables plus one or more uncertainty terms. The rest are either in the form of distributions or single values. The results of this analysis are fundamental inputs for total system performance assessment to constrain the release of these elements from waste packages and the engineered barrier system. Solubilities of plutonium, neptunium, uranium, americium, actinium, thorium, protactinium, lead, and radium have been re-evaluated using the newly updated thermodynamic database (Data0.ymp.R2). For all of the actinides, identical modeling approaches and consistent environmental conditions were used to develop solubility models in this revision. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, activity coefficients, and selection of solubility controlling phase have been quantified or otherwise addressed. Moreover, a new blended plutonium solubility model has been developed in this revision, which gives a mean solubility that is three orders of magnitude lower than the plutonium solubility model used for the Total System Performance Assessment for the Site Recommendation. Two alternative neptunium solubility models have also been
International Nuclear Information System (INIS)
Fluegge, S.
1989-01-01
After the great survey of neutron induced radioactivity by Fermi and co-workers, the laboratories in Paris and Berlin-Dahlen tried to disentangle the complex results found in uranium. At that time neutron sources were small, activities low, and equipment very simple. Chemistry beyond uranium still was unknown. Hahn and Meitner believed to have observed three transuranic isomeric chains, a doubtful result even then. Early in 1938, Curie and Savic in Paris found an activity interpreted to be actinium, and Hahn and Meitner another to be radium. Both interpretations seemed impossible from energy considerations. Hahn and Strassmann, therefore, continued this work and succeeded to separate the new activity from radium. There remained no doubt that a barium isotope had been produced, the uranium nucleus splitting in the yet-unknown process we now call fission
227 - 233_Yahaya_Antimicrobial
African Journals Online (AJOL)
pc
PREVALENCE OF PATHOGENIC MICR ... hygiene, it serves as an abrasive that aids in remov the dental plaque and food ... plaque, dental caries and periodontal disease (Clar. 1924). ...... dental caries in children and adolescents. (Review).
Process for radioisotope recovery and system for implementing same
Meikrantz, David H [Idaho Falls, ID; Todd, Terry A [Aberdeen, ID; Tranter, Troy J [Idaho Falls, ID; Horwitz, E Philip [Naperville, IL
2009-10-06
A method of recovering daughter isotopes from a radioisotope mixture. The method comprises providing a radioisotope mixture solution comprising at least one parent isotope. The at least one parent isotope is extracted into an organic phase, which comprises an extractant and a solvent. The organic phase is substantially continuously contacted with an aqueous phase to extract at least one daughter isotope into the aqueous phase. The aqueous phase is separated from the organic phase, such as by using an annular centrifugal contactor. The at least one daughter isotope is purified from the aqueous phase, such as by ion exchange chromatography or extraction chromatography. The at least one daughter isotope may include actinium-225, radium-225, bismuth-213, or mixtures thereof. A liquid-liquid extraction system for recovering at least one daughter isotope from a source material is also disclosed.
77 FR 54787 - Airworthiness Directives; M7 Aerospace LLC Airplanes
2012-09-06
... Airworthiness Directives; M7 Aerospace LLC Airplanes AGENCY: Federal Aviation Administration (FAA), DOT. ACTION... Aerospace LLC Models SA226-AT, SA226-T, SA226-T(B), SA226-TC, SA227-AC (C-26A), SA227-BC (C-26A), SA227-CC..., contact M7 Aerospace LP, 10823 NE Entrance Road, San Antonio, Texas 78216; phone: (210) 824- 9421; fax...
Monte Carlo Simulations of Necrotic Cell Targeted Alpha Therapy
International Nuclear Information System (INIS)
Penfold, S.N.; Brown, M.P.; Bezak, E.
2011-01-01
Full text: Hypoxic tumour cells are radioresistant and are significant contributors to the locoregional recurrences and distant metastases that mark treatment failure. Due to restricted circulatory supply, hypoxic tumor cells frequently become necrotic and thus necrotic areas often lie near hypoxic tumour areas. In this study we investigate the feasibility of binding an alpha-emitting conjugate to necrotic cells located in the proximity of hypoxic, viable tumour cells. Monte Carlo radiation transport simulations were performed to investigate the dose distribution resulting from the thorium 227 (Th227) decay chain in a representative tumour geometry. The Geant4 software toolkit was used to simulate the decay and interactions of the Th227 decay chain. The distribution of Th227 was based on a study by Thomlinson and Gray of human lung cancer histological samples (Thomlinson RH, Gray LH. Br J Cancer 1955; 9:539). The normalized dose distribution obtained with Geant4 from a cylindrical Th227 source in water is illustrated in Fig. I. The relative contribution of the different decay channels is displayed, together with a profile through the centre of the accumulated dose map. The results support the hypothesis that significant α-particle doses will be deposited in the hypoxic tumor tissue immediately surrounding the necrotic core (where the majority of Th227 will be located). As an internal a-particle generator, the Th227-radioimmunoconjugate shows potential as an efficient hypoxic tumour sterilizer.
Directory of Open Access Journals (Sweden)
Frank Griscelli
2017-08-01
Full Text Available Heterozygous activating mutation (p.Glu227Lys in KCNJ11 leads to maturity-onset diabetes of the young (MODY type 13, that is a subtype of dominant inherited young-onset non-autoimmune diabetes due to a primary defect in pancreatic beta cells. We generated induced pluripotent stem cells (iPSCs from a patient with KCNJ11p.Glu227Lys mutation who developed MODY at 13 years old. KCNJ11p.Glu227Lys-mutated cells that were reprogrammed by non-integrative viral transduction had normal karyotype, harboured the KCNJ11p.Glu227Lys mutation, expressed pluripotency hallmarks and had the differentiation capacity into the three germ layers.
The chemistry of the actinide elements. Volume I
International Nuclear Information System (INIS)
Katz, J.J.; Seaborg, G.T.; Morss, L.R.
1986-01-01
The Chemistry of the Actinide Elements is a comprehensive, contemporary and authoritative exposition of the chemistry and related properties of the 5f series of elements: actinium, thorium, protactinium, uranium and the first eleven. This second edition has been completely restructured and rewritten to incorporate current research in all areas of actinide chemistry and chemical physics. The descriptions of each element include accounts of their history, separation, metallurgy, solid-state chemistry, solution chemistry, thermo-dynamics and kinetics. Additionally, separate chapters on spectroscopy, magnetochemistry, thermodynamics, solids, the metallic state, complex ions and organometallic compounds emphasize the comparative chemistry and unique properties of the actinide series of elements. Comprehensive lists of properties of all actinide compounds and ions in solution are given, and there are special sections on such topics as biochemistry, superconductivity, radioisotope safety, and waste management, as well as discussion of the transactinides and future elements
A neutron source of variable fluence
International Nuclear Information System (INIS)
Brachet, Guy; Demichel, Pascal; Prigent, Yvon; Riche, J.C.
1975-01-01
The invention concerns a variable fluence neutron source, like those that use in the known way a reaction between a radioactive emitter and a target, particularly of type (α,n). The emitter being in powder form lies in a carrier fluid forming the target, inside a closed containment. Facilities are provided to cause the fluidisation of the emitter by the carrier fluid in the containment. The fluidisation of the emitting powder is carried out by a booster with blades, actuated from outside by a magnetic coupling. The powder emitter is a α emitter selected in the group of curium, plutonium, thorium, actinium and americium oxides and the target fluid is formed of compounds of light elements selected from the group of beryllium, boron, fluorine and oxygen 18. The target fluid is a gas used under pressure or H 2 O water highly enriched in oxygen 18 [fr
Li, Bin; Choi, Hee-Jin; Lee, Dong-Sung; Oh, Hyuncheol; Kim, Youn-Chul; Moon, Jin-Young; Park, Won-Hwan; Park, Sun-Dong; Kim, Jai-Eun
2014-01-01
Amomum tsao-ko Crevost et Lemaire, used as a spice in Asia, is an important source of Chinese cuisine and traditional Chinese medicines. A. tsao-ko is reported to exert a variety of biological and pharmacological activities, including anti-proliferative, anti-oxidative and neuroprotective effects. In this study, NNMBS227, consisting of the ethanol extract of A. tsao-ko, exhibited potent anti-inflammatory activities in RAW264.7 macrophages. We investigated the effect of NNMBS227 in the suppression of pro-inflammatory mediators, including pro-inflammatory enzymes (inducible nitric oxide synthase and cyclooxygenase-2) and cytokines (tumor necrosis factor-α and interleukin-1β) in LPS stimulated macrophages. NNMBS227 also inhibited the phosphorylation and degradation of IκB-α, as well as the nuclear translocation of nuclear factor kappa B (NF-κB) p65 caused by stimulation with LPS. In addition, NNMBS227 induced heme oxygenase (HO)-1 expression through the nuclear translocation of nuclear factor E2-related factor 2 (Nrf2) in macrophages. Using tin protoporphyrin (SnPP), an HO activity inhibitor, we confirmed an association between the anti-inflammatory effects of NNMBS227 and the up-regulation of HO-1. These findings suggest that Nrf2-dependent increases in the expression of HO-1 induced by NNMBS227 conferred anti-inflammatory activities in LPS stimulated RAW264.7 macrophages.
China Report, Agriculture, Number 227
1982-09-20
cannot be sold at once for various subjective reasons unrelated to sales promotion work. These include lack of convenient transportation, shortage...are overproduction, encumbered channels, and lack of vigorous sales promotion . Between January and May this year, Pork sales in the province
49 CFR 227.121 - Recordkeeping.
2010-10-01
... without corruption or loss of data; and (v) Paper copies of electronic records and amendments to those... ceases to do business, it shall transfer to the successor employer all records required to be maintained...
2010-01-01
... purposes under an open-end credit plan that is accessed by a credit card or charge card. The terms “open... the requirements of 12 CFR 226.5b that are accessible by a credit or charge card; (2) Overdraft lines of credit tied to asset accounts accessed by check-guarantee cards or by debit cards; (3) Lines of...
2010-01-01
... handicapped, and unmarried mothers and their infants; group homes; halfway houses; orphanages; temporary... Puerto Rico, the Virgin Islands, Guam, American Samoa, the Trust Territory of the Pacific Islands, and...
Tidally Induced Bars of Galaxies in Clusters
Czech Academy of Sciences Publication Activity Database
Lokas, E.; Ebrová, Ivana; del Pino, A.; Sybilska, A.; Athanassoula, E.; Semczuk, M.; Gajda, G.; Fouquet, S.
2016-01-01
Roč. 286, č. 6 (2016), 227/1-227/13 ISSN 0004-637X Institutional support: RVO:67985815 Keywords : galaxies * clusters * evolution Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 5.533, year: 2016
International Nuclear Information System (INIS)
Marx, Sebastian Markus
2014-01-01
The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.
International Nuclear Information System (INIS)
Ragavan, Anpalaki J.
2006-01-01
Linear free energy relationships for trivalent cations with crystalline M 2 O 3 and, M(OH) 3 phases of lanthanides and actinides were developed from known thermodynamic properties of the aqueous trivalent cations, modifying the Sverjensky and Molling equation. The linear free energy relationship for trivalent cations is as ΔG f,MvX 0 =a MvX ΔG n,M 3+ 0 +b MvX +β MvX r M 3+ , where the coefficients a MvX , b MvX , and β MvX characterize a particular structural family of MvX, r M 3+ is the ionic radius of M 3+ cation, ΔG f,MvX 0 is the standard Gibbs free energy of formation of MvX and ΔG n,M 3+ 0 is the standard non-solvation free energy of the cation. The coefficients for the oxide family are: a MvX =0.2705, b MvX =-1984.75 (kJ/mol), and β MvX =197.24 (kJ/molnm). The coefficients for the hydroxide family are: a MvX =0.1587, b MvX =-1474.09 (kJ/mol), and β MvX =791.70 (kJ/molnm).
Development of ion beam sputtering techniques for actinide target preparation
International Nuclear Information System (INIS)
Aaron, W.S.; Zevenbergen, L.A.; Adair, H.L.
1985-01-01
Ion beam sputtering is a routine method for the preparation of thin films used as targets because it allows the use of minimum quantity of starting material, and losses are much lower than most other vacuum deposition techniques. Work is underway in the Isotope Research Materials Laboratory (IRML) at ORNL to develop the techniques that will make the preparation of actinide targets up to 100 μg/cm 2 by ion beam sputtering a routinely available service from IRML. The preparation of the actinide material in a form suitable for sputtering is a key to this technique, as is designing a sputtering system that allows the flexibility required for custom-ordered target production. At present, development work is being conducted on low-activity in a bench-top system. The system will then be installed in a hood or glove box approved for radioactive materials handling where processing of radium, actinium, and plutonium isotopes among others will be performed. (orig.)
Development of ion beam sputtering techniques for actinide target preparation
Aaron, W. S.; Zevenbergen, L. A.; Adair, H. L.
1985-06-01
Ion beam sputtering is a routine method for the preparation of thin films used as targets because it allows the use of a minimum quantity of starting material, and losses are much lower than most other vacuum deposition techniques. Work is underway in the Isotope Research Materials Laboratory (IRML) at ORNL to develop the techniques that will make the preparation of actinide targets up to 100 μg/cm 2 by ion beam sputtering a routinely available service from IRML. The preparation of the actinide material in a form suitable for sputtering is a key to this technique, as is designing a sputtering system that allows the flexibility required for custom-ordered target production. At present, development work is being conducted on low-activity actinides in a bench-top system. The system will then be installed in a hood or glove box approved for radioactive materials handling where processing of radium, actinium, and plutonium isotopes among others will be performed.
International Nuclear Information System (INIS)
Berven, B.A.; Goldsmith, W.A.; Haywood, F.F.; Schiager, K.J.
1979-01-01
Many sites used during the early days of the US atomic energy program are contaminated with radionuclides of the primordial decay chains (uranium, thorium, and actinium series). This contamination consists of residues resulting from refining and processing uranium and thorium. Preparation of these sites for release to unrestricted private use will involve the assistance of construction workers, many of whom have limited knowledge of the hazards associated with radioactive materials. Therefore, there is a need to educate these workers in the fundamentals of radioactive material handling to minimize exposures and possible spread of contamination. This training should disseminate relevant information at an appropriate educational level and should instill a cautious, common-sense attitude toward the handling of radioactive materials. The training should emphasize basic information concerning environmental radiation within a context of relative risk. A multi-media format, including colorful visual aids, demonstration, and discussion, should be used to maximize motivation and retention. A detailed, proposed training program design is presented
NCBI nr-aa BLAST: CBRC-TTRU-01-1397 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TTRU-01-1397 ref|YP_408932.1| putative 3-phenylpropionic acid transporter [Shigella boy...dii Sb227] gb|ABB67104.1| MFS transporter [Shigella boydii Sb227] YP_408932.1 0.28 20% ...
NCBI nr-aa BLAST: CBRC-MMUR-01-1441 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-MMUR-01-1441 ref|YP_408932.1| putative 3-phenylpropionic acid transporter [Shigella boy...dii Sb227] gb|ABB67104.1| MFS transporter [Shigella boydii Sb227] YP_408932.1 0.32 20% ...
NCBI nr-aa BLAST: CBRC-ETEL-01-1342 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ETEL-01-1342 ref|YP_408708.1| NADH dehydrogenase I chain G [Shigella boydii Sb...227] gb|ABB66880.1| NADH dehydrogenase I chain G [Shigella boydii Sb227] YP_408708.1 3.8 31% ...
L-Glutamic acid production by Bacillus spp. isolated from vegetable ...
African Journals Online (AJOL)
Ogiri” (fermented vegetable proteins) in Nigeria. The isolates were identified as Bacillus subtilis (6), (27.3%), Bacillus pumilus (5), (22.7%), Bacillus licheniformis (5), (27.3%) and Bacillus polymyxa (6), (22.7%). Four species of the Bacillus isolates ...
2010-01-12
..., Standardization Branch, ANM-113, Transport Airplane Directorate, Aircraft Certification Service, 1601 Lind Avenue, SW., Renton, Washington 98057-3356; telephone (425) 227-22793 facsimile (425) 227-1230; or e-mail... December 28, 2009. Ali Bahrami, Manager, Transport Airplane Directorate, Aircraft Certification Service...
Overexpression of gamma-tubulin in non small cell lung cancer
Czech Academy of Sciences Publication Activity Database
Maounis, N.; Mahera, E.; Dráberová, Eduarda; Chorti, M.; Riga, D.; Trakas, N.; Demonakou, M.; Emmanouilidou, A.; Dráber, Pavel; Katsetos, C.D.
2010-01-01
Roč. 57, č. 1 (2010), s. 227-227 ISSN 0309-0167. [International Congress of the International Academy of Pathology /28./. 10.10.10.-15.10.10, San Paolo] Institutional research plan: CEZ:AV0Z50520514 Subject RIV: EB - Genetics ; Molecular Biology
Petroleum hydrocarbons in northwest coastal waters of India
Digital Repository Service at National Institute of Oceanography (India)
Kadam, A.N.; Bhangale, V.P
stream_size 2 stream_content_type text/plain stream_name Indian_J_Mar_Sci_22_227.pdf.txt stream_source_info Indian_J_Mar_Sci_22_227.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...
Indian Academy of Sciences (India)
Rao, Prof. Sumathi Ph.D. (SUNY, Stony Brook), FNASc. Date of birth: 5 December 1956. Specialization: Theoretical Condensed Matter Physics, Quantum field Theory Address: Harish Chandra Research Institute, Chhatnag Road, Jhusi, Allahabad 211 019, U.P.. Contact: Office: (0532) 227 4303. Residence: (0532) 227 4002
NCBI nr-aa BLAST: CBRC-ACAR-01-1054 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-ACAR-01-1054 ref|YP_406984.1| putative transport [Shigella boydii Sb227] sp|Q3...24V2|ENTS_SHIBS Enterobactin exporter entS gb|ABB65156.1| putative transport [Shigella boydii Sb227] YP_406984.1 1.7 27% ...
48 CFR 212.7003 - Technical data and computer software.
2010-10-01
... computer software. 212.7003 Section 212.7003 Federal Acquisition Regulations System DEFENSE ACQUISITION... data and computer software. For purposes of establishing delivery requirements and license rights for technical data under 227.7102 and for computer software under 227.7202, there shall be a rebuttable...
A Review of Flood-Related Storage and Remobilization of Heavy Metal Pollutants in River Systems
Czech Academy of Sciences Publication Activity Database
Ciszewski, D.; Matys Grygar, Tomáš
2016-01-01
Roč. 227, č. 7 (2016), s. 227-239 ISSN 0049-6979 R&D Projects: GA ČR(CZ) GA15-00340S Institutional support: RVO:61388980 Keywords : River * Sediment * Heavy metals * Mobilization * Pollution Subject RIV: DD - Geochemistry Impact factor: 1.702, year: 2016
78 FR 2229 - Health and Human Services Acquisition Regulation
2013-01-10
... information (regardless of the form or method of the recording) of a scientific or technical nature (including... (HHSAR)--to add two clauses, ``Patent Rights-- Exceptional Circumstances'' and ``Rights in Data....227-11 and 352.227-14'' by any of the following methods: Regulations.gov : http://www.regulations.gov...
Directory of Open Access Journals (Sweden)
Nicolau DP
2017-08-01
Full Text Available Nicolau DP, Silberg BN. Infect Drug Resist. 2017;10:227–230.Page 227, affiliations list, the text “Department of Surgery, Sonoma West Medical Center, Sebastopol, CT, USA” should read “Department of Surgery, Sonoma West Medical Center, Sebastopol, CA, USA”. Read the original article
Global weather variability affects avian phenology: a long-term analysis, 1881-2001
Czech Academy of Sciences Publication Activity Database
Hubálek, Zdeněk
2004-01-01
Roč. 53, č. 3 (2004), s. 227-236 ISSN 0139-7893 R&D Projects: GA AV ČR(CZ) KSK6005114 Keywords : migratory birds * spring arrival * North Atlantic Oscillation Subject RIV: EG - Zoology Impact factor: 0.536, year: 2004 http://www.ivb.cz/folia/53/3/227-236.pdf
Disease-Causing Mutations in BEST1 Gene Are Associated with Altered Sorting of Bestrophin-1 Protein
Doumanov, Jordan A.; Zeitz, Christina; Gimenez, Paloma Dominguez; Audo, Isabelle; Krishna, Abhay; Alfano, Giovanna; Diaz, Maria Luz Bellido; Moskova-Doumanova, Veselina; Lancelot, Marie-Elise; Sahel, José-Alain; Nandrot, Emeline F.; Bhattacharya, Shomi S.
2013-01-01
Mutations in BEST1 gene, encoding the bestrophin-1 (Best1) protein are associated with macular dystrophies. Best1 is predominantly expressed in the retinal pigment epithelium (RPE), and is inserted in its basolateral membrane. We investigated the cellular localization in polarized MDCKII cells of disease-associated Best1 mutant proteins to study specific sorting motifs of Best1. Real-time PCR and western blots for endogenous expression of BEST1 in MDCK cells were performed. Best1 mutant constructs were generated using site-directed mutagenesis and transfected in MDCK cells. For protein sorting, confocal microscopy studies, biotinylation assays and statistical methods for quantification of mislocalization were used. Analysis of endogenous expression of BEST1 in MDCK cells revealed the presence of BEST1 transcript but no protein. Confocal microscopy and quantitative analyses indicate that transfected normal human Best1 displays a basolateral localization in MDCK cells, while cell sorting of several Best1 mutants (Y85H, Q96R, L100R, Y227N, Y227E) was altered. In contrast to constitutively active Y227E, constitutively inactive Y227F Best1 mutant localized basolaterally similar to the normal Best1 protein. Our data suggest that at least three basolateral sorting motifs might be implicated in proper Best1 basolateral localization. In addition, non-phosphorylated tyrosine 227 could play a role for basolateral delivery. PMID:23880862
7 CFR 1951.227 - Protective advances.
2010-01-01
... in the best interest of the government. For insurance, factors such as the amount of advance... the rate specified in the most recent debt instrument authorizing such an advance. (b) Protective... securing the debt owed to or insured by FmHA or its successor agency under Public Law 103-354 if the debt...
Reference: 227 [Arabidopsis Phenome Database[Archive
Lifescience Database Archive (English)
Full Text Available biosynthetic enzymes and alpha-amylases was examined by reverse transcription-PCR (RT-PCR) and in situ hybridization.... The mRNAs of AtGA20ox2, AtGA20ox3 and AtGA3ox4 began to be detectable 5-7 d after pollination. In situ hybridization
227-IJBCS-Article-Pauline Bationo-Kando
African Journals Online (AJOL)
RHUMSIKI
BK2 BK4 BK5 BK9 RA3 RA4 RA5 RA6 RA7 RA9 TA2 TA5 TA6. TA7 GA1 GA2 GA4 GA6 GA7 GA8 GA10 GA12 BR1. 4. 28. KA6 SP1 SP3 SP4 SP10 SP12 SK8 SK9 SK20 SK23 BA4 BA5 BA6. BA9 BA11 BA12 NP1 NP4 NP6 NP9 NP14 NP17 BK1 BK11 RA8. GA3 GA5 BR2. Tableau 10: Performances moyennes des groupes ...
30 CFR 22.7 - Specific requirements.
2010-07-01
... ignitions might result shall be covered and protected adequately. All covers shall be sealed adequately or... conditions. (2) Corrosion of battery container. The material of which the container is made shall resist corrosion under conditions of use. (d) Performance. In addition to the general design and safety features...
Publications | Page 227 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Does the distribution of health care benefits in Kenya meet the principles of ... must be located as close as possible to the basic emergency obstetric care. ... Areas through Sustainable Technologies, Gender Integration and Supportive ... and influenced regulatory and policy frameworks in East Africa (Kenya and Uganda).
7 CFR 227.40 - Program information.
2010-01-01
..., New Jersey, New York, Pennsylvania, Puerto Rico, Virginia, Virgin Islands, and West Virginia: Mid-Atlantic Regional Office, FNS, U.S. Department of Agriculture, One Vahlsing Center, Robbinsville, N.J...
Publications | Page 227 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. We share the results of our funded research, and offer free training materials to guide researchers and institutions. Want more? Explore outputs from more than four decades of ...
2010-10-01
... recordings, and other audiovisual works in any medium; sound recordings in any medium; musical, dramatic, and... works, or perform or display the work publicly. When the Government is not responsible for the content... liabilities that may arise out of the content, performance, use, or disclosure of such data. (b) Follow the...
DEFF Research Database (Denmark)
Hervik, Peter; Boisen, Sophie
2013-01-01
’s Danish connections through an analysis of the first 100 days of Danish media coverage. We scrutinised 188 articles in the largest daily newspapers to find out how Danish actors related to ABB’s ideas. The key argument is that the discourses and opinions reflect pre-existing opinions and entrenched...
29 CFR 553.227 - Outside employment.
2010-07-01
... employment. (a) Section 7(p)(1) makes special provision for fire protection and law enforcement employees of public agencies who, at their own option, perform special duty work in fire protection, law enforcement... procedures for the officers to receive their pay for the special details through the agency's payroll system...
48 CFR 927.403 - Negotiations and deviations.
2010-10-01
... clause at 48 CFR 52.227-14, as amended at 48 CFR 927.409(a), the exclusion of specific items from said clause, the exclusion of the Additional Technical Data Requirements clause at 48 CFR 52.227-16, and the..., negotiating, or approving appropriate data and copyright clauses in accordance with the procedures set forth...
Octupole Deformed Nuclei in the Actinide Region
Thorsteinsen, T; Rubio barroso, B; Simpson, J; Gulda, K; Sanchez-vega, M; Cocks, J; Nybo, K; Garcia borge, M; Aas, A; Fogelberg, B; Honsi, J; Smith, G; Naumann, R; Grant, I
2002-01-01
The aim of the present study is to investigate the limits of the "island" of octupole deformation in the mass region A=225. It is of particular importance to demonstrate experimentally the sudden disappearance of the stable octupole deformation in the presence of a well developed quadrupole field. \\\\ \\\\In order to establish the upper border line the $\\beta$ -decay chains of $^{227}$Rn $\\rightarrow ^{227}$Fr $\\rightarrow ^{227}$Ra and $^{231}$Fr $\\rightarrow ^{231}$Ra $\\rightarrow ^{231}$Ac were studied at PSB-ISOLDE using advanced fast timing and $\\gamma$-ray spectroscopy techniques. The lifetimes of the excited states have been measured in the picosecond range using the time-delayed $\\beta\\gamma\\gamma$(t) method.
International Nuclear Information System (INIS)
Shiotsuki, Masao; Miyahara, Kaname
2003-01-01
The second draft for R and D of geological disposal (second draft) was arranged in 1999. The idea of security of geological disposal in the second draft is explained. The evaluation results of the uncertainty analysis and an example of evaluation of the effect of separation nuclear transmutation on the geological disposal are shown. The construction of strong engineered barrier is a basic idea of geological disposal system. Three processes such as isolation, engineering countermeasures and safety evaluation are carried out for the security of geological disposal. The security of geological environment for a long time of 12 sites in Japan was studied by data. Provability of production and enforcement of engineered barrier were confirmed by trial of over pack, tests and the present and future technologies developed. By using the conditions of reference case in the second draft, the evaluation results of dose effects in the two cases: 1) 90 to 99% Cs and Sr removed from HLW (High Level radioactive Waste) and 2) high stripping ratio of actinium series are explained. (S.Y.)
Background radiation and individual dosimetry in the coastal area of Tamil Nadu (India)
International Nuclear Information System (INIS)
Matsuda, N.; Brahmanandhan, G. M.; Yoshida, M.; Takamura, N.; Suyama, A.; Koguchi, Y.; Juto, N.; Raj, Y. L.; Winsley, G.; Selvasekarapandian, S.
2011-01-01
South coast of India is known as the high-level background radiation area (HBRA) mainly due to beach sands that contain natural radionuclides as components of the mineral monazite. The rich deposit of monazite is unevenly distributed along the coastal belt of Tamil Nadu and Kerala. An HBRA site that laid in 2x7 m along the sea was found in the beach of Chinnavillai, Tamil Nadu, where the maximum ambient dose equivalent reached as high as 162.7 mSv y -1 . From the sands collected at the HBRA spot, the high-purity germanium semi-conductor detector identified six nuclides of thorium series, four nuclides of uranium series and two nuclides belonging to actinium series. The highest radioactivity observed was 43.7 Bq g -1 of Th-228. The individual dose of five inhabitants in Chinnavillai, as measured by the radiophotoluminescence glass dosimetry system, demonstrated the average dose of 7.17 mSv y -1 ranging from 2.79 to 14.17 mSv y -1 . (authors)
Soil nuclide distribution coefficients and their statistical distributions
International Nuclear Information System (INIS)
Sheppard, M.I.; Beals, D.I.; Thibault, D.H.; O'Connor, P.
1984-12-01
Environmental assessments of the disposal of nuclear fuel waste in plutonic rock formations require analysis of the migration of nuclides from the disposal vault to the biosphere. Analyses of nuclide migration via groundwater through the disposal vault, the buffer and backfill, the plutonic rock, and the consolidated and unconsolidated overburden use models requiring distribution coefficients (Ksub(d)) to describe the interaction of the nuclides with the geological and man-made materials. This report presents element-specific soil distribution coefficients and their statistical distributions, based on a detailed survey of the literature. Radioactive elements considered were actinium, americium, bismuth, calcium, carbon, cerium, cesium, iodine, lead, molybdenum, neptunium, nickel, niobium, palladium, plutonium, polonium, protactinium, radium, samarium, selenium, silver, strontium, technetium, terbium, thorium, tin, uranium and zirconium. Stable elements considered were antimony, boron, cadmium, tellurium and zinc. Where sufficient data were available, distribution coefficients and their distributions are given for sand, silt, clay and organic soils. Our values are recommended for use in assessments for the Canadian Nuclear Fuel Waste Management Program
Methods of separating short half-life radionuclides from a mixture of radionuclides
International Nuclear Information System (INIS)
Bray, L.A.; Ryan, J.L.
1998-01-01
The present invention is a method of obtaining a radionuclide product selected from the group consisting of 223 Ra and 225 Ac, from a radionuclide ''cow'' of 227 Ac or 229 Th respectively. The method comprises the steps of (a) permitting ingrowth of at least one radionuclide daughter from said radionuclide ''cow'' forming an ingrown mixture; (b) insuring that the ingrown mixture is a nitric acid ingrown mixture; (c) passing the nitric acid ingrown mixture through a first nitrate form ion exchange column which permits separating the ''cow'' from at least one radionuclide daughter; (d) insuring that the at least one radionuclide daughter contains the radionuclide product; (e) passing the at least one radionuclide daughter through a second ion exchange column and separating the at least one radionuclide daughter from the radionuclide product and (f) recycling the at least one radionuclide daughter by adding it to the ''cow''. In one embodiment the radionuclide ''cow'' is the 227 Ac, the at least one daughter radionuclide is a 227 Th and the product radionuclide is the 223 Ra and the first nitrate form ion exchange column passes the 227 Ac and retains the 227 Th. In another embodiment the radionuclide ''cow'' is the 229 Th, the at least one daughter radionuclide is a 225 Ra and said product radionuclide is the 225 Ac and the 225 Ac and nitrate form ion exchange column retains the 229 Th and passes the 225 Ra/Ac. 8 figs
2005 Tri-Service Infrastructure Systems Conference and Exhibition. Volume 3, Track 3
2005-08-04
Performance Measures for Prefabricated Submerged Concrete Breakwaters: Section 227 Cape May Point, New Jersey Demonstration Project, by Donald K Stauble...Slope Stability Evaluation of the Baldhill Dam Right Abutment , by Neil T. Schwanz Design and Construction of Anchored Bulkheads with Synthetic Sheet... Prefabricated Submerged Concrete Breakwaters: Section 227 Cape May Point, New Jersey Demonstration Project Donald K Stauble - Engineer Research
Cross Sections for Electron-Impact Dissociation of Alternative Etching Gas, C3HF7O
Tanaka, Hideyuki; Toyoda, Hirotaka; Sugai, Hideo
1998-09-01
The search for alternative for perfluorocarbon gases from the environmental point of view has resulted in a new etching gas, C3HF7O (1,2,2,2-tetrafluoroethyl-trifluoromethyl ether, abbreviated as HFE-227). In this paper, the first measurement of the absolute cross sections for the dissociation of HFE-227, is reported.The neutral dissociation is measured from the threshold to 250 eV by appearance mass spectrometry in a dual electron beam device.The threshold energies for the neutral dissociation into CF, CF2 and CF3 are 14.7, 12.5 and 11.2 eV, respectively.The cross sections for the dissociation from HFE-227 into CF3 and CF are larger than those from c-C4F8 (octafluorocyclobutane), but not for the dissociation into CF2.Besides the neutral dissociation, the cross sections for the dissociative ionization of HFE-227 are extensively measured for the formation of twelve ionic species, i.e., CO+, CHO+, CF+, CHF+, CFO+, CF2+, CHF2+, CF3+, CHF3+, C2HF2O+, C2HF4+ and C2HF4O+.
TRASH TO TREASURE: CONVERTING COLD WAR LEGACY WASTE INTO WEAPONS AGAINST CANCER
International Nuclear Information System (INIS)
Nicholas, R.G.; Lacy, N.H.; Butz, T.R.; Brandon, N.E.
2004-01-01
As part of its commitment to clean up Cold War legacy sites, the U.S. Department of Energy (DOE) has initiated an exciting and unique project to dispose of its inventory of uranium-233 (233U) stored at Oak Ridge National Laboratory (ORNL), and extract isotopes that show great promise in the treatment of deadly cancers. In addition to increasing the supply of potentially useful medical isotopes, the project will rid DOE of a nuclear concern and cut surveillance and security costs. For more than 30 years, DOE's ORNL has stored over 1,200 containers of fissile 233U, originally produced for several defense-related projects, including a pilot study that looked at using 233U as a commercial reactor fuel. This uranium, designated as special nuclear material, requires expensive security, safety, and environmental controls. It has been stored at an ORNL facility, Building 3019A, that dates back to the Manhattan Project. Down-blending the material to a safer form, rather than continuing to store it, will eliminate a $15 million a year financial liability for the DOE and increase the supply of medical isotopes by 5,700 percent. During the down-blending process, thorium-229 (229Th) will be extracted. The thorium will then be used to extract actinium-225 (225Ac), which will ultimately supply its progeny, bismuth-213 (213Bi), for on-going cancer research. The research includes Phase II clinical trials for the treatment of acute myelogenous leukemia at Sloan-Kettering Memorial Cancer Center in New York, as well as other serious cancers of the lungs, pancreas, and kidneys using a technique known as alpha-particle radioimmunotherapy. Alpha-particle radioimmunotherapy is based on the emission of alpha particles by radionuclides. 213Bi is attached to a monoclonal antibody that targets specific cells. The bismuth then delivers a high-powered but short-range radiation dose, effectively killing the cancerous cells but sparing the surrounding tissue. Production of the actinium and
Methods of separating short half-life radionuclides from a mixture of radionuclides
Bray, Lane A.; Ryan, Jack L.
1998-01-01
The present invention is a method of obtaining a radionuclide product selected from the group consisting of .sup.223 Ra and .sup.225 Ac, from a radionuclide "cow" of .sup.227 Ac or .sup.229 Th respectively. The method comprises the steps of a) permitting ingrowth of at least one radionuclide daughter from said radionuclide "cow" forming an ingrown mixture; b) insuring that the ingrown mixture is a nitric acid ingrown mixture; c) passing the nitric acid ingrown mixture through a first nitrate form ion exchange column which permits separating the "cow" from at least one radionuclide daughter; d) insuring that the at least one radionuclide daughter contains the radionuclide product; e) passing the at least one radionuclide daughter through a second ion exchange column and separating the at least one radionuclide daughter from the radionuclide product and f) recycling the at least one radionuclide daughter by adding it to the "cow". In one embodiment the radionuclide "cow" is the .sup.227 Ac, the at least one daughter radionuclide is a .sup.227 Th and the product radionuclide is the .sup.223 Ra and the first nitrate form ion exchange column passes the .sup.227 Ac and retains the .sup.227 Th. In another embodiment the radionuclide "cow"is the .sup.229 Th, the at least one daughter radionuclide is a .sup.225 Ra and said product radionuclide is the .sup.225 Ac and the .sup.225 Ac and nitrate form ion exchange column retains the .sup.229 Th and passes the .sup.225 Ra/Ac.
33 CFR Schedule II to Subpart A of... - Table of Speeds 1
2010-07-01
..., Lt. 137 Deer Island, Lt. 186 11.5 10.5. 9. Deer Island, Lt. 186 Bartlett Point, Lt. 227 8.5 upb; 10.5 dnb 8 upb; 10.5 dnb. 10. Bartlett Point, Lt. 227 Tibbetts Point 13 10.5. 11. Junction of Canadian.... All other canals 6 6. 1 Maximum speeds at which a vessel may travel in identified areas in both normal...
Preparation of porous materials for radionuclides capture
International Nuclear Information System (INIS)
Bajzikova, Anna; Smrcek, Stanislav; Kozempel, Jan; Vlk, Martin; Barta, Jan
2015-01-01
Porous materials showing promise for radionuclide capture from water at contaminated sites were prepared. Nanoporous materials (size of pores 1-100 nm) and some polymers are well suited to this purpose owing their affinity for selected radionuclides. Nanoporous metal oxides and silica gel with styrene-divinylbenzene-TODGA-modified surface were prepared, characterized and tested for radionuclide ( 227 Ac, 227 Th, 223 Ra) capture efficiency. (orig.)
Czech Academy of Sciences Publication Activity Database
Cihelka, Jaroslav; Matulková, Irena; Sovová, Kristýna; Kamas, Michal; Kubelík, Petr; Ferus, Martin; Juha, Libor; Civiš, Svatopluk
2009-01-01
Roč. 39, 3-4 (2009), s. 227-227 ISSN 0169-6149 R&D Projects: GA MŠk LC510; GA MŠk(CZ) LC528; GA ČR GA203/06/1278; GA MŠk LA08024 Institutional research plan: CEZ:AV0Z40400503; CEZ:AV0Z10100523 Keywords : planetary atmosphere * lasers * spectroscopy Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.053, year: 2009
Heyerdahl, Helen; Røe, Kathrine; Brevik, Ellen Mengshoel; Dahle, Jostein
2013-09-01
The purpose of this study was to investigate the effect of α-particle-emitting (227)Th-trastuzumab radioimmunotherapy on tumor vasculature to increase the knowledge about the mechanisms of action of (227)Th-trastuzumab. Human HER2-expressing SKOV-3 ovarian cancer xenografts were grown bilaterally in athymic nude mice. Mice with tumor volumes 253 ± 36 mm(3) (mean ± SEM) were treated with a single injection of either (227)Th-trastuzumab at a dose of 1000 kBq/kg body weight (treated group, n=14 tumors) or 0.9% NaCl (control group, n=10 tumors). Dynamic T1-weighted contrast-enhanced magnetic resonance imaging (DCEMRI) was used to study the effect of (227)Th-trastuzumab on tumor vasculature. DCEMRI was performed before treatment and 1, 2, and 3 weeks after therapy. Tumor contrast-enhancement curves were extracted voxel by voxel and fitted to the Brix pharmacokinetic model. Pharmacokinetic parameters for the tumors that underwent radioimmunotherapy were compared with the corresponding parameters of control tumors. Significant increases of kep, the rate constant of diffusion from the extravascular extracellular space to the plasma (PTh-trastuzumab treatment of HER2-expressing ovarian cancer xenografts. Copyright © 2013 Elsevier Inc. All rights reserved.
Gender | Page 227 | IDRC - International Development Research ...
International Development Research Centre (IDRC) Digital Library (Canada)
Two years ago, the International Development Research Centre created CIME, a development communication program that reflects the interrelations between Communication at the grassroots level, the exchange of Information, two-way Media, and nonformal Education. This book presents the conceptual framework that led ...
46 CFR 10.227 - Requirements for renewal.
2010-10-01
... part 5 of this chapter or if facts that would render a renewal improper have come to the attention of... this part; (C) Complete an approved refresher training course; or (D) Present evidence of employment in... renewal of an officer endorsement as first-class pilot are contained in § 11.713 of this chapter. (iv) An...
48 CFR 52.227-3 - Patent Indemnity.
2010-10-01
... informed as soon as practicable by the Government of the suit or action alleging such infringement and... delivery or performance, or (3) a claimed infringement that is unreasonably settled without the consent of... to individual communication service authorizations over the simplified acquisition threshold issued...
Viral erythrocytic necrosis: Chapter 2.2.7
Winton, James R.; Hershberger, Paul K.
2014-01-01
Viral erythrocytic necrosis (VEN), originally termed piscine erythrocytic necrosis, is a condition that has been reported to affect the red blood cells (RBCs) of many species of marine and anadromous fishes in both the Atlantic and Pacific Oceans (Nicholson and Reno 1981; Smail 1982; Wolf 1988; Dannevig and Thorud 1999). Fish with VEN may develop a severe anemia that can reduce their stamina, predispose them to other infections or increase the impact of other stressors (MacMillan et al. 1980; Nicholson and Reno 1981; Meyers et al. 1986; Haney et al. 1992) resulting in population-scale impacts in susceptible species (Hershberger et al. 2009).
49 CFR 227.109 - Audiometric testing program.
2010-10-01
... audiologist, otolaryngologist, or other physician who has experience and expertise in hearing and hearing loss... occupational noise in excess of the action level. Hearing protectors may be used as a substitute for the... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION OCCUPATIONAL NOISE EXPOSURE Occupational Noise Exposure for Railroad...
Gender | Page 227 | IDRC - International Development Research ...
International Development Research Centre (IDRC) Digital Library (Canada)
Language English ... In a 12-country study, researchers asked why some children in developing countries are not being vaccinated. ... About 20% of IDRC's project funding in the past year — and the past decade — went to research that aimed ...
One Quarter of California’s Teachers for English Learners Not Fully Certified
Rumberger, Russell W.
2003-01-01
Although the passage of Proposition 227 reduced the demand for bilingual teachers, an acute shortage of teachers qualified to deliver needed instructional services to English learners remains. In 1998, prior to the passage of 227, 43 percent of the teachers providing instructional services to English learners were not fully certified to provide those services—33 percent of teachers were in training to provide English language development (ELD) or Specially Designed Academic Instruction in Eng...
International Nuclear Information System (INIS)
Hesketh, K.; Porsch, D.; Rimpault, G.; Taiwo, T.; Worrall, A.
2013-01-01
The actinides (or actinoids) are those elements in the periodic table from actinium upwards. Uranium (U) and plutonium (Pu) are two of the principal elements in nuclear fuel that could be classed as major actinides. The minor actinides are normally taken to be the triad of neptunium (Np), americium (Am) and curium (Cm). The combined masses of the remaining actinides (i.e. actinium, thorium, protactinium, berkelium, californium, einsteinium and fermium) are small enough to be regarded as very minor trace contaminants in nuclear fuel. Those elements above uranium in the periodic table are known collectively as the transuranics (TRUs). The operation of a nuclear reactor produces large quantities of irradiated fuel (sometimes referred to as spent fuel), which is either stored prior to eventual deep geological disposal or reprocessed to enable actinide recycling. A modern light water reactor (LWR) of 1 GWe capacity will typically discharge about 20-25 tonnes of irradiated fuel per year of operation. About 93-94% of the mass of uranium oxide irradiated fuel is comprised of uranium (mostly 238 U), with about 4-5% fission products and ∼1% plutonium. About 0.1-0.2% of the mass is comprised of neptunium, americium and curium. These latter elements accumulate in nuclear fuel because of neutron captures, and they contribute significantly to decay heat loading and neutron output, as well as to the overall radio-toxic hazard of spent fuel. Although the total minor actinide mass is relatively small - approximately 20-25 kg per year from a 1 GWe LWR - it has a disproportionate impact on spent fuel disposal, and thus the longstanding interest in transmuting these actinides either by fission (to fission products) or neutron capture in order to reduce their impact on the back end of the fuel cycle. The combined masses of the trace actinides actinium, thorium, protactinium, berkelium and californium in irradiated LWR fuel are only about 2 parts per billion, which is far too low for
Liu, Cuimei; Jia, Wei; Hua, Zhendong; Qian, Zhenhua
2017-08-01
Clinical and forensic toxicology laboratories are continuously confronted by analytical challenges when dealing with the new psychoactive substances phenomenon. The number of synthetic cannabinoids, the chemical diversity, and the speed of emergence make this group of compounds particularly challenging in terms of detection, monitoring, and responding. Three indazole 7N positional isomer synthetic cannabinoids, two ethyl 2-amino-3-methylbutanoate-type synthetic cannabinoids, and one 9H-carbazole substituted synthetic cannabinoid were identified in seized materials. These six synthetic cannabinoid derivatives included: 1H-benzo[d] [1,2,3]triazol-1-yl 1-(5-fluoropentyl)-1H-pyrrolo[2,3-b]pyridine-3-carboxylate (NNL-3, 1), quinolin-8-yl 1-(5-fluoropentyl)-1H-pyrrolo[2,3-b]pyridine-3-carboxylate (5F-NPB-22-7N, 2), N-((1 s,3 s)-adamantan-1-yl)-1-(5-fluoropentyl)-1H-pyrrolo[2,3-b]pyridine-3-carboxamide (5F-AKB-48-7N, 3), ethyl 2-(1-(5-fluoropentyl)-1H-indazole-3-carboxamido)-3,3-dimethylbutanoate (5F-EDMB-PINACA, 4), ethyl 2-(1-(4-fluorobenzyl)-1H-indazole-3-carboxamido)-3-methylbutanoate (EMB-FUBINACA, 5), and naphthalen-1-yl(9-pentyl-9H-carbazol-3-yl)methanone (EG-018, 6). The identification was based on ultra-high-performance liquid chromatography-quadrupole time-of-flight-mass spectrometry (UHPLC-QTOF-MS), gas chromatography-mass spectrometry (GC-MS), and nuclear magnetic resonance spectroscopy (NMR). The analytical characterization of these six synthetic cannabinoids was described, so as to assist forensic laboratories in identifying these compounds or other substances with similar structure in their case work. To our knowledge, no analytical data about the compounds 1-5 have appeared until now, making this the first report on these compounds. The GC-MS data of 6 has been reported, but this study added the LC-MS, NMR, and Fourier transform infrared (FTIR), data to render the analytical data collection process more complete. Copyright © 2017 John Wiley & Sons, Ltd
Electronic structure and dynamics of ordered clusters with ME or RE ions on oxide surface
Energy Technology Data Exchange (ETDEWEB)
Kulagin, N.A., E-mail: nkulagin@bestnet.kharkov.u [Kharkiv National University for Radio Electronics, Avenue Shakespeare 6-48, 61045 Kharkiv (Ukraine)
2011-03-15
Selected data of ab initio simulation of the electronic structure and spectral properties of either cluster with ions of iron, rare earth or actinium group elements have been presented here. Appearance of doped Cr{sup +4} ions in oxides, Cu{sup +2} in HTSC, Nd{sup +2} in solids has been discussed. Analysis of experimental data for plasma created ordered structures of crystallites with size of about 10{sup -9} m on surface of separate oxides are given, too. Change in the spectroscopic properties of clusters and nano-structures on surface of strontium titanate crystals discussed shortly using the X-ray line spectroscopy experimental results. - Research highlights: External influence and variation of technology induce changes in valence of nl ions in compounds. Wave function of cluster presented as anti-symmetrical set of ions wave functions. The main equation describes the self-consistent field depending on state of all electrons of cluster. Level scheme of Cr{sup 4+} ions in octo- and tetra-site corresponds to doped oxides spectra after treatment. Plasma treatment effects in appearance of systems of unit crystallites with size of about 10{sup -6}-10{sup -9} m.
Electronic structure and dynamics of ordered clusters with ME or RE ions on oxide surface
International Nuclear Information System (INIS)
Kulagin, N.A.
2011-01-01
Selected data of ab initio simulation of the electronic structure and spectral properties of either cluster with ions of iron, rare earth or actinium group elements have been presented here. Appearance of doped Cr +4 ions in oxides, Cu +2 in HTSC, Nd +2 in solids has been discussed. Analysis of experimental data for plasma created ordered structures of crystallites with size of about 10 -9 m on surface of separate oxides are given, too. Change in the spectroscopic properties of clusters and nano-structures on surface of strontium titanate crystals discussed shortly using the X-ray line spectroscopy experimental results. - Research highlights: → External influence and variation of technology induce changes in valence of nl ions in compounds. → Wave function of cluster presented as anti-symmetrical set of ions wave functions. → The main equation describes the self-consistent field depending on state of all electrons of cluster. → Level scheme of Cr 4+ ions in octo- and tetra-site corresponds to doped oxides spectra after treatment. → Plasma treatment effects in appearance of systems of unit crystallites with size of about 10 -6 -10 -9 m.
Review of radionuclide source terms used for performance-assessment analyses
International Nuclear Information System (INIS)
Barnard, R.W.
1993-06-01
Two aspects of the radionuclide source terms used for total-system performance assessment (TSPA) analyses have been reviewed. First, a detailed radionuclide inventory (i.e., one in which the reactor type, decay, and burnup are specified) is compared with the standard source-term inventory used in prior analyses. The latter assumes a fixed ratio of pressurized-water reactor (PWR) to boiling-water reactor (BWR) spent fuel, at specific amounts of burnup and at 10-year decay. TSPA analyses have been used to compare the simplified source term with the detailed one. The TSPA-91 analyses did not show a significant difference between the source terms. Second, the radionuclides used in source terms for TSPA aqueous-transport analyses have been reviewed to select ones that are representative of the entire inventory. It is recommended that two actinide decay chains be included (the 4n+2 ''uranium'' and 4n+3 ''actinium'' decay series), since these include several radionuclides that have potentially important release and dose characteristics. In addition, several fission products are recommended for the same reason. The choice of radionuclides should be influenced by other parameter assumptions, such as the solubility and retardation of the radionuclides
The 2008 IDA Cost Research Workshop: Contractor Data Reporting Systems
2008-07-01
Consulting Services, Ltd. Mr. Michael Carey, NCCA, (703) 692-4901 Mr. Craig Clark, HVR CSL, 011 44 1420 87977 Ms Mary M. Mertz, NSWC-CD, (301) 227-4012...Services, Ltd Mr. Michael Carey, NCCA, (703) 692-4901 Mr. Craig Clark, HVR CSL, 011 44 1420 87977 Ms Mary M. Mertz, NSWC-CD, (301) 227-4012... Deegan , (202) 781-0959 Size: Professional: 57 Support: 2 Consultants: 0 Subcontractors: 9 collocated or 30 total Focus: O&S Cost Estimating
Energy Technology Data Exchange (ETDEWEB)
Schwartz, J; O' Donoghue, J A; Humm, J L [Department of Medical Physics, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); Jaggi, J S [Bristol-Myers Squibb, Plainsboro, NJ (United States); Ruan, S; Larson, S M [Nuclear Medicine Service Department of Radiology, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); McDevitt, M; Scheinberg, D A, E-mail: schwarj1@mskcc.org [Molecular Pharmacology and Chemistry, Sloan-Kettering Institute, 1275 York Avenue, New York, NY 10065 (United States)
2011-02-07
Clinical therapeutic studies using {sup 225}Ac-labeled antibodies have begun. Of major concern is renal toxicity that may result from the three alpha-emitting progeny generated following the decay of {sup 225}Ac. The purpose of this study was to determine the amount of {sup 225}Ac and non-equilibrium progeny in the mouse kidney after the injection of {sup 225}Ac-huM195 antibody and examine the dosimetric consequences. Groups of mice were sacrificed at 24, 96 and 144 h after injection with {sup 225}Ac-huM195 antibody and kidneys excised. One kidney was used for gamma ray spectroscopic measurements by a high-purity germanium (HPGe) detector. The second kidney was used to generate frozen tissue sections which were examined by digital autoradiography (DAR). Two measurements were performed on each kidney specimen: (1) immediately post-resection and (2) after sufficient time for any non-equilibrium excess {sup 213}Bi to decay completely. Comparison of these measurements enabled estimation of the amount of excess {sup 213}Bi reaching the kidney ({gamma}-ray spectroscopy) and its sub-regional distribution (DAR). The average absorbed dose to whole kidney, determined by spectroscopy, was 0.77 (SD 0.21) Gy kBq{sup -1}, of which 0.46 (SD 0.16) Gy kBq{sup -1} (i.e. 60%) was due to non-equilibrium excess {sup 213}Bi. The relative contributions to renal cortex and medulla were determined by DAR. The estimated dose to the cortex from non-equilibrium excess {sup 213}Bi (0.31 (SD 0.11) Gy kBq{sup -1}) represented {approx}46% of the total. For the medulla the dose contribution from excess {sup 213}Bi (0.81 (SD 0.28) Gy kBq{sup -1}) was {approx}80% of the total. Based on these estimates, for human patients we project a kidney-absorbed dose of 0.28 Gy MBq{sup -1} following administration of {sup 225}Ac-huM195 with non-equilibrium excess {sup 213}Bi responsible for approximately 60% of the total. Methods to reduce renal accumulation of radioactive progeny appear to be necessary for the success of {sup 225}Ac radioimmunotherapy.
International Nuclear Information System (INIS)
Koyama, Mutsuo
1989-01-01
Distribution profiles of trace elements in land plants were studied by neutron activation analysis and radioactivity measurements without activation. Number of botanical samples analyzed were more than three thousand in which more than three hundred botanical species were included. New accumulator plants of Co, Cr, Zn, Cd, rare earth elements, Ac, U, etc., were found. Capabilities of accumulating trace elements can be related to the botanical taxonomy. Discussions are given from view points of inorganic chemistry as well as from botanical physiology
Directory of Open Access Journals (Sweden)
A. K. Maurya
2015-01-01
Full Text Available The reports of nontuberculous mycobacteria (NTM associated with extrapulmonary diseases are increasing in tertiary care hospitals. Despite a significant increase in knowledge about NTM infections, they still represent a diagnostic and therapeutic challenge. The aim of this study is to know the prevalence of NTN among extrapulmonary tuberculosis cases in tertiary care centers in Northern India. A total of 227 culture positive isolates from 756 cases were tested for niacin production and catalase assay. BIO-LINE SD Ag MPT64 TB test and final identification and differentiation between MTBC and different species of NTM were further confirmed by GenoType Mycobacterium CM/AS assay. 71 cases (9.3% were positive for AFB by ZN staining and 227 cases (30.1% were positive for mycobacteria by culture. Niacin production and catalase activity were negative in 62/227 (27.4% strains and after using a panel of different biochemicals and final confirmation by GenoType Mycobacterium CM assay. Out of 227 cultures tested, 165 (72.6% strains were confirmed as M. tuberculosis complex, and 62 (27.4% were confirmed as NTM. The most common NTM species identified were M. fortuitum 17 (27.5% and M. intracellulare 13 (20.9%. The rapid identification of NTM species may help in targeted therapy and management of the diseases.
Dig-face monitoring during excavation of a radioactive plume at Mound Laboratory, Ohio
International Nuclear Information System (INIS)
Josten, N.E.; Gehrke, R.J.; Carpenter, M.V.
1995-12-01
A dig-face monitoring system consists of onsite hardware for collecting information on changing chemical, radiological, and physical conditions in the subsurface soil during the hazardous site excavation. A prototype dig-face system was take to Mount Laboratory for a first trial. Mound Area 7 was the site of historical disposals of 232 Th, 227 Ac, and assorted debris. The system was used to monitor a deep excavation aimed at removing 227 Ac-contaminated soils. Radiological, geophysical, and topographic sensors were used to scan across the excavation dig-face at four successive depths as soil was removed. A 3-D image of the contamination plumes was developed; the radiation sensor data indicated that only a small portion of the excavated soil volume was contaminated. The spatial information produced by the dig-face system was used to direct the excavation activities into the area containing the 227 Ac and to evaluate options for handling the separate 232 Th plume
Witz, Sandra
2014-03-12
Plastidic uracil salvage is essential for plant growth and development. So far, PLUTO, the plastidic nucleobase transporter from Arabidopsis thaliana is the only known uracil importer at the inner plastidic membrane which represents the permeability barrier of this organelle. We present the first homology model of PLUTO, the sole plant NCS1 member from Arabidopsis based on the crystal structure of the benzyl hydantoin transporter MHP1 from Microbacterium liquefaciens and validated by molecular dynamics simulations. Polar side chains of residues Glu-227 and backbones of Val-145, Gly-147 and Thr-425 are proposed to form the binding site for the three PLUTO substrates uracil, adenine and guanine. Mutational analysis and competition studies identified Glu-227 as an important residue for uracil and to a lesser extent for guanine transport. A differential response in substrate transport was apparent with PLUTO double mutants E227Q G147Q and E227Q T425A, both of which most strongly affected adenine transport, and in V145A G147Q, which markedly affected guanine transport. These differences could be explained by docking studies, showing that uracil and guanine exhibit a similar binding mode whereas adenine binds deep into the catalytic pocket of PLUTO. Furthermore, competition studies confirmed these results. The present study defines the molecular determinants for PLUTO substrate binding and demonstrates key differences in structure-function relations between PLUTO and other NCS1 family members. 2014 Witz et al.
Simoes-Barbosa, Augusto; Chakrabarti, Kausik; Pearson, Michael; Benarroch, Delphine; Shuman, Stewart; Johnson, Patricia J.
2012-01-01
The 2,2,7-trimethylguanosine caps of eukaryal snRNAs and snoRNA are formed by the enzyme Tgs1, which catalyzes sequential guanine-N2 methylations of m7G caps. Atypically, in the divergent unicellular eukaryote Trichomonas vaginalis, spliceosomal snRNAs lack a guanosine cap and the recombinant T. vaginalis trimethylguanosine synthase (TvTgs) produces only m2,7G in vitro. Here, we show by direct metabolic labeling that endogenous T. vaginalis RNAs contain m7G, m2,7G, and m2,2,7G caps. Immunodepletion of TvTgs from cell extracts and TvTgs add-back experiments demonstrate that TvTgs produces m2,7G and m2,2,7G caps. Expression of TvTgs in yeast tgs1Δ cells leads to the formation of m2,7G and m2,2,7G caps and complementation of the lethality of a tgs1Δ mud2Δ strain. Whereas TvTgs is present in the nucleus and cytosol of T. vaginalis cells, TMG-containing RNAs are localized primarily in the nucleolus. Molecular cloning of anti-TMG affinity-purified T. vaginalis RNAs identified 16 box H/ACA snoRNAs, which are implicated in guiding RNA pseudouridylation. The ensemble of new T. vaginalis H/ACA snoRNAs allowed us to predict and partially validate an extensive map of pseudouridines in T. vaginalis rRNA. PMID:22847815
ORF Alignment: NC_005296 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available th = 98 ... Query: 227 VHKVADYLEAYWDQPLTVEMLARVSGVSVRTLFHSFRGQFGYSPMEFVRRIRLERARQML... 286 ... VHKVADYLEAYWDQPLTVEMLARVSGVSVRTLFHSFRGQFGYSPMEFVRRIRLERARQML Sbjct: 1 ... VHKVADYLEAYWDQPLTVEMLARVSGVSVRTLFHSFRGQFGYSPMEFVRRIRLERARQML 60 ...
Diabetic peripheral angiopathy treatment using a multi-laser therapy device
Zabulonov, Y.; Chukhraiyeva, O.; Vladimirov, A.; Chukhraiyev, M.; Zukow, W.
2015-01-01
Zabulonov Y., Chukhraiyeva O., Vladimirov A., Chukhraiyev M., Zukow W. Diabetic peripheral angiopathy treatment using a multi-laser therapy device. Journal of Education, Health and Sport. 2015;5(10):227-233. ISSN 2391-8306. DOI http://dx.doi.org/10.5281/zenodo.32801 http://ojs.ukw.edu.pl/index.php/johs/article/view/2015%3B5%2810%29%3A227-233 https://pbn.nauka.gov.pl/works/662978 Formerly Journal of Health Sciences. ISSN 1429-9623 / 2300-665X. Archives 2011–2014 http://journal.rsw....
Diabetic peripheral angiopathy treatment using a multi-laser therapy device
Y. Zabulonov; O. Chukhraiyeva; A. Vladimirov; M. Chukhraiyev; W. Zukow
2015-01-01
Zabulonov Y., Chukhraiyeva O., Vladimirov A., Chukhraiyev M., Zukow W. Diabetic peripheral angiopathy treatment using a multi-laser therapy device. Journal of Education, Health and Sport. 2015;5(10):227-233. ISSN 2391-8306. DOIhttp://dx.doi.org/10.5281/zenodo.32801 http://ojs.ukw.edu.pl/index.php/johs/article/view/2015%3B5%2810%29%3A227-233 https://pbn.nauka.gov.pl/works/662978 Formerly Journal of Health Sciences. ISSN 1429-9623 / 2300-665X. Archives 2011–2014http://journal.rsw.ed...
1983-01-01
WILSON AIR SYSTEMS INC WILSON 1,302 745 557 NCAR WILSON FIRESTONE TIRE a RUBBER CO WILSON 42 42 NCAR WILSON INDUSTRIAL TECH INC ELM CITY 27 27 NCAR...THERMATICS ELM CITY 807 34 773 NCAR WILSON TOTAL COUNTY 3,840 836 359 1,214 1,431 NCAR YADKIN ASTORIA BRAID MFG CO INC BOONVILLE 113 113 NCAR YADKIN TOTAL...INC SLIPPERY ROCK 152 152 PA BUTLER M S A RESEARCH CORP EVANS CITY 227 227 PA BUTLER MINE SAFETY APPLIANCES CO EVANS CITY 8,531 253 311 1,339 6,628 PA
Directory of Open Access Journals (Sweden)
Maria Jacinta M. Coelho Santos
2004-09-01
Full Text Available The aim of the present study was to evaluate the clinical performance of two types of ceramics: a slurry-powder ceramic (Duceram Plus, Degussa - D and a hot-pressed leucite-based glass-ceramic (IPS Empress, Ivoclar Vivadent - IPS. Eighty-six restorations, 44 IPS and 42 D, were made by one operator. A total of 33 onlays and 53 inlays on twenty-seven premolars and 59 molars were cemented in 35 patients of both sexes, mean age 35 years. All restorations were cemented with the dual-resin cement (Variolink, Ivoclar-Vivadent under rubber dam and were evaluated at the baseline and after six months, using the modified U.S.P.H.S. criteria for postoperative sensitivity, secondary caries, fracture, color match, marginal discoloration, marginal integrity and surface texture. Additionally radiographs and intraoral photographs were carried out. At baseline 86 restorations were analyzed and all of them received Alfa rating, except for the following that received Bravo rating for postoperative sensitivity - IPS (2.27%; D (7.14%; for color match - IPS (2.27%; D (2.38% and for surface texture - IPS (2.27%; D (11.90%. After 6 months 100% of the restorations were analyzed and the following received Bravo rating: color match - IPS (4.55% and D (9.52%; surface texture - IPS (2.27% and D (11.9%; marginal discoloration - IPS (6.82% and D (4.76% and marginal integrity - IPS (4.55% and D (7.14%. The results were submitted to the Fisher and McNemar Statistical Tests. No significant differences were noticed between the two ceramics. Both ceramics demonstrated satisfactory clinical performance after six months.Este trabalho se propôs a avaliar a performance clínica de dois tipos de cerâmica: IPS Empress, Ivoclar-Vivadent - IPS e Duceram Plus, Degussa - D. Foram realizadas 86 restaurações por apenas um operador, sendo 44 IPS e 42 D. Vinte e sete pré-molares e 59 molares, num total de 33 onlays e 53 inlays, foram cimentadas em 35 pacientes de ambos os sexos, com idade m
7 CFR 227.30 - Responsibilities of State agencies.
2010-01-01
... addition, the State Coordinator shall have recognized and demonstrated skills in management and education... dollar value of salary requested. The narrative shall also indicate the time frame for hiring the State... be employed on a full-time or part-time basis. The State Coordinator may be a State employee who...
Lifescience Database Archive (English)
Full Text Available GGTA TCCCACCAGATCT sequence update 2002. 9.10 Translated Amino Acid sequence ---xxxxxxxxxxxxxxxxi*xxx...LTGKTITLE VEGSDNIENVKTKIQDKEGIPPD Translated Amino Acid sequence (All Frames) Frame A: ---xxxxxxxxxxxxxxxxi*xxx...ENVKTKIQDKEGIPPD Frame B: ---xxmxxxxxxxxxixxxfsxxxkxwyxxfcxnpxw*xynxxklkvlxxlrmlk...pkxkt kkvfhqinxvsfspvxnwrmvvlslittfkrnplsi*fsd*evvckfl*klslvkplhxk lkvvttlrm*kqkfktkkvshqi Frame C: ---xxxxxxxxxkxxsxxxlvxxxxggxxx
Lifescience Database Archive (English)
Full Text Available um chromoso... 33 7.5 AY698035_1( AY698035 |pid:none) Desmognathus marmoratus isolate 69... 33 7.5 AY612348_...1( AY612348 |pid:none) Desmognathus quadramaculatus vouch... 33 9.9 AY698038_1( AY698038 |pid:none) Desmogna...thus marmoratus isolate T0... 33 9.9 AY612344_1( AY612344 |pid:none) Desmognathus... marmoratus voucher KH... 33 9.9 AY698041_1( AY698041 |pid:none) Desmognathus marmoratus isolate T0... 33 9.
48 CFR 227.675-2 - Review of agreements.
2010-10-01
... source when he has knowledge of any purchase made or to be made from him by or for the Government or by... a corresponding reduction in the purchase price of the article or service. (2) If the agreement... identify any such patents and data in which, to the knowledge of the primary source, the Government may...
14 CFR 135.227 - Icing conditions: Operating limitations.
2010-01-01
... for transport category airplane type certification, no pilot may fly— (1) Under IFR into known or... authorized by the Administrator. (b) No certificate holder may authorize an airplane to take off and no pilot may take off an airplane any time conditions are such that frost, ice, or snow may reasonably be...
1935 15' Quad #227 Aerial Photo Mosaic Index
Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...
25 CFR 227.6 - Corporations and corporate information.
2010-04-01
... CERTAIN LANDS IN WIND RIVER INDIAN RESERVATION, WYOMING, FOR OIL AND GAS MINING How to Acquire Leases... disposition of any such statement, application, prospectus or offering sheet has been made. (c) Affidavits of...
12 CFR 227.11 - Authority, purpose, and scope.
2010-01-01
... credit to consumers. (c) Scope. This subpart applies to all banks and their subsidiaries, except savings... and reserved, effective July 1, 2010. For the convenience of the user, the revised text is set forth...
Brookhaven lecture series No. 227: The Chernobyl accident
International Nuclear Information System (INIS)
Kouts, H.
1986-01-01
This lecture discusses the events leading to, during, and following the Chernobyl Reactor number 4 accident. A description of the light water cooled, graphite moderated reactor, the reactor site conditions leading to meltdown is presented. The emission of radioactive effluents and the biological radiation effects is also discussed. (FI)
48 CFR 227.7008 - Settlement of indemnified claims.
2010-10-01
... interests of the Government and is coordinated with the Department of Justice with a view to preserving any... the contractors are obtained, the settlement need not be coordinated with the Department of Justice. ...
48 CFR 252.227-7008 - Computation of royalties.
2010-10-01
... performing under a cost-reimbursement contract. With respect to such articles or materials made by the... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Computation of royalties... REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text...
48 CFR 3452.227-70 - Publication and publicity.
2010-10-01
... promote the results of its work under this contract. A copy of each article or work submitted by the... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Publication and publicity... ACQUISITION REGULATION CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and...
Quantum phase transitions and anomalous Hall effect in frustrated Kondo lattices
Paschen, Silke; Grefe, Sarah Elaine; Ding, Wenxin; Si, Qimiao
Among the pyrochlore iridates, the metallic compound Pr2 Ir2O7 (Pr-227) has shown characteristics of a possible chiral spin liquid state and quantum criticality. An important question surrounding the significant anomalous Hall response observed in Pr-227 is the nature of the f-electron local moments, including their Kondo coupling with the conduction d-electrons. The heavy effective mass and related thermodynamic characteristics indicate the involvement of the Kondo effect in this system's electronic properties. In this work, we study the effects of Kondo coupling on candidate time-reversal-symmetry-breaking spin liquid states on frustrated lattices. Representing the f-moments as slave fermions Kondo-coupled to conduction electrons, we study the competition between Kondo-singlet formation and chiral spin correlations. We derive an effective chiral interaction between the local moments and the conduction electrons and calculate the anomalous Hall response across the quantum phase transition from the Kondo destroyed phase to the Kondo screened phase. We discuss our results' implications for Pr-227 and related frustrated Kondo-lattice systems.
Izquierdo-Sotorrío, Eva; Holgado-Tello, Francisco P; Carrasco, Miguel Á
2016-01-01
This study examines the relationships between perceived parental acceptance and children's behavioral problems (externalizing and internalizing) from a multi-informant perspective. Using mothers, fathers, and children as sources of information, we explore the informant effect and incremental validity. The sample was composed of 681 participants (227 children, 227 fathers, and 227 mothers). Children's (40% boys) ages ranged from 9 to 17 years (M = 12.52, SD = 1.81). Parents and children completed both the Parental Acceptance Rejection/Control Questionnaire (PARQ/Control) and the check list of the Achenbach System of Empirically Based Assessment (ASEBA). Statistical analyses were based on the correlated uniqueness multitrait-multimethod matrix (model MTMM) by structural equations and different hierarchical regression analyses. Results showed a significant informant effect and a different incremental validity related to which combination of sources was considered. A multi-informant perspective rather than a single one increased the predictive value. Our results suggest that mother-father or child-father combinations seem to be the best way to optimize the multi-informant method in order to predict children's behavioral problems based on perceived parental acceptance.
Leedham Elvidge, Emma; Bönisch, Harald; Brenninkmeijer, Carl A. M.; Engel, Andreas; Fraser, Paul J.; Gallacher, Eileen; Langenfelds, Ray; Mühle, Jens; Oram, David E.; Ray, Eric A.; Ridley, Anna R.; Röckmann, Thomas; Sturges, William T.; Weiss, Ray F.; Laube, Johannes C.
2018-03-01
In a changing climate, potential stratospheric circulation changes require long-term monitoring. Stratospheric trace gas measurements are often used as a proxy for stratospheric circulation changes via the mean age of air values derived from them. In this study, we investigated five potential age of air tracers - the perfluorocarbons CF4, C2F6 and C3F8 and the hydrofluorocarbons CHF3 (HFC-23) and HFC-125 - and compare them to the traditional tracer SF6 and a (relatively) shorter-lived species, HFC-227ea. A detailed uncertainty analysis was performed on mean ages derived from these new tracers to allow us to confidently compare their efficacy as age tracers to the existing tracer, SF6. Our results showed that uncertainties associated with the mean age derived from these new age tracers are similar to those derived from SF6, suggesting that these alternative compounds are suitable in this respect for use as age tracers. Independent verification of the suitability of these age tracers is provided by a comparison between samples analysed at the University of East Anglia and the Scripps Institution of Oceanography. All five tracers give younger mean ages than SF6, a discrepancy that increases with increasing mean age. Our findings qualitatively support recent work that suggests that the stratospheric lifetime of SF6 is significantly less than the previous estimate of 3200 years. The impact of these younger mean ages on three policy-relevant parameters - stratospheric lifetimes, fractional release factors (FRFs) and ozone depletion potentials - is investigated in combination with a recently improved methodology to calculate FRFs. Updates to previous estimations for these parameters are provided.
Emanations and 'induced' radioactivity: from mystery to (mis)use
International Nuclear Information System (INIS)
Kolar, Z.I.
1999-01-01
The natural Rn isotopes were discovered within the period 1899-1902 and at that time referred to as emanations because they came out (emanated) of sources/materials containing actinium, thorium and radium, respectively. The (somewhat mysterious) emanations appeared to disintegrate into radioactive decay products which by depositing at solid surfaces gave rise to 'induced' radioactivity i.e. radioactive substances with various half-lives. Following the discovery of the emanations the volume of the research involving them and their disintegration products grew steeply. The identity of a number of these radioactive products was soon established. Radium emanation was soon used as a source of RaD ( 210 Pb) to be applied as an 'indicator' (radiotracer) for lead in a study on the solubility of lead sulphide and lead chromate. Moreover, radium and its emanation were introduced into the medical practice. Inhaling radon and drinking radon-containing water became an accepted medicinal use (or misuse?) of that gas. Shortly after the turn of the century, the healing (?) action of natural springs (spas) was attributed to their radium emanation, i.e. radon. Bathing in radioactive spring water and drinking it became very popular. Even today, bathing in radon-containing water is still a common medical treatment in Jachymov, Czech Republic. (author)
Study of Soil Decontamination Method Using Supercritical Carbon Dioxide and TBP
International Nuclear Information System (INIS)
Park, Jihye; Park, Kwangheon; Jung, Wonyoung
2014-01-01
The result of this study means that we have a possible new method for cheap and less wasteful nuclear waste decontamination. When severe accidents such as the incident at the Fukushima nuclear site occur, the soil near the power plant is contaminated with fission products or the activation metal structure of the power plant. The soil pollution form depends on the environment and soil characteristics of the contaminated areas. Thus, a- single-decontamination method is not effective for site cleanup. In addition, some soil decontamination methods are expensive and large amounts of secondary waste are generated. Therefore, we need new soil decontamination methods. In this study, instead of using a conventional solvent method that generates secondary waste, supercritical carbon dioxide was used to remove metal ions from the soil. Supercritical carbon dioxide is known for good permeation characteristics. We expect that we will reduce the cost of soil pollution management. Supercritical carbon dioxide can decontaminate soil easily, as it has the ability to penetrate even narrow gaps with very good moisture permeability. We used TBP, which is a known for extractant of actinium metal. TBP is usually used for uranium and strontium extraction. Using TBP-HNO 3 complex and supercritical carbon dioxide, we did extraction experiments for several heavy metals in contaminated soil
Study of Soil Decontamination Method Using Supercritical Carbon Dioxide and TBP
Energy Technology Data Exchange (ETDEWEB)
Park, Jihye; Park, Kwangheon; Jung, Wonyoung [Kyunghee Univ., Yongin (Korea, Republic of)
2014-05-15
The result of this study means that we have a possible new method for cheap and less wasteful nuclear waste decontamination. When severe accidents such as the incident at the Fukushima nuclear site occur, the soil near the power plant is contaminated with fission products or the activation metal structure of the power plant. The soil pollution form depends on the environment and soil characteristics of the contaminated areas. Thus, a- single-decontamination method is not effective for site cleanup. In addition, some soil decontamination methods are expensive and large amounts of secondary waste are generated. Therefore, we need new soil decontamination methods. In this study, instead of using a conventional solvent method that generates secondary waste, supercritical carbon dioxide was used to remove metal ions from the soil. Supercritical carbon dioxide is known for good permeation characteristics. We expect that we will reduce the cost of soil pollution management. Supercritical carbon dioxide can decontaminate soil easily, as it has the ability to penetrate even narrow gaps with very good moisture permeability. We used TBP, which is a known for extractant of actinium metal. TBP is usually used for uranium and strontium extraction. Using TBP-HNO{sub 3} complex and supercritical carbon dioxide, we did extraction experiments for several heavy metals in contaminated soil.
Colvin, Stephanie C.; Malik, Raleigh E.; Showalter, Aaron D.; Sloop, Kyle W.; Rhodes, Simon J.
2011-01-01
The etiology of most pediatric hormone deficiency diseases is poorly understood. Children with combined pituitary hormone deficiency (CPHD) have insufficient levels of multiple anterior pituitary hormones causing short stature, metabolic disease, pubertal failure, and often have associated nervous system symptoms. Mutations in developmental regulatory genes required for the specification of the hormone-secreting cell types of the pituitary gland underlie severe forms of CPHD. To better understand these diseases, we have created a unique mouse model of CPHD with a targeted knockin mutation (Lhx3 W227ter), which is a model for the human LHX3 W224ter disease. The LHX3 gene encodes a LIM-homeodomain transcription factor, which has essential roles in pituitary and nervous system development in mammals. The introduced premature termination codon results in deletion of the carboxyl terminal region of the LHX3 protein, which is critical for pituitary gene activation. Mice that lack all LHX3 function do not survive beyond birth. By contrast, the homozygous Lhx3 W227ter mice survive, but display marked dwarfism, thyroid disease, and female infertility. Importantly, the Lhx3 W227ter mice have no apparent nervous system deficits. The Lhx3 W227ter mouse model provides a unique array of hormone deficits and facilitates experimental approaches that are not feasible with human patients. These experiments demonstrate that the carboxyl terminus of the LHX3 transcription factor is not required for viability. More broadly, this study reveals that the in vivo actions of a transcription factor in different tissues are molecularly separable. PMID:21149718
Investigations of mechanism of laser radiation absorption at PALS
Czech Academy of Sciences Publication Activity Database
Kalinowska, Z.; Kasperczuk, A.; Pisarczyk, T.; Chodukowski, T.; Gus’kov, S.Yu.; Demchenko, N. N.; Ullschmied, Jiří; Krouský, Eduard; Pfeifer, Miroslav; Skála, Jiří
2012-01-01
Roč. 57, č. 2 (2012), s. 227-230 ISSN 0029-5922. [International Conference on Research and Applications of Plasmas (PLASMA)2011. Warsaw, 12.09.2011-16.09.2011] R&D Projects: GA MŠk(CZ) LC528 Institutional research plan: CEZ:AV0Z20430508 Keywords : collisional absorption * crater volume * electron density distribution * interferometry * iodine laser * resonance absorption * Laser radiation * inverse bremsstrahlung * laser interferometry * PALS laser Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 0.507, year: 2012 http://www.nukleonika.pl/www/back/full/vol57_2012/v57n2p227f.pdf
Hiedelberg AAF, Germany Revised Uniform Summary of Surface Weather Observations (RUSSWO) Parts A-F.
1981-10-05
P’EE’i 10 Z6 -5 -4 Z - -2v -->2 - . I -l ’A --. 1. 5/16 0 NO CELIN -- 14.9 16.6 17.1 19.8 20*0 21.1 21.3 21.7 22.5 22.5 22.5 22.6 22.7 22.7 22.8 >_000...99.7100.0 00.0100.0100.0 00.000.0 cOo 0o. TOTAL NUMBER OF OBSERVATIONS 9 USAF "TAC ,W 64 0-14-5 (OL A) P.e .OU.. DION OF VNI FON ANN.. ...... . -r4 -A V
ORF Alignment: NC_005966 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... Length = 227 ... Query: 388 LDVTPLSLGLETMGGLVERLISRNTAIPVARRQEFTTYQDGQSAMLIHVVQGERDLVEHC 447 ... LDVT...PLSLGLETMGGLVERLISRNTAIPVARRQEFTTYQDGQSAMLIHVVQGERDLVEHC Sbjct: 1 ... LDVTPLSLGLETM...GGLVERLISRNTAIPVARRQEFTTYQDGQSAMLIHVVQGERDLVEHC 60 ... Query: 508 TERLLLEGFQHAEEDKNLRHLQETKVXXXXXXXXXXXXXKNDAGL
ORF Alignment: NC_002927 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available I] ... Length = 227 ... Query: 409 LDVIPLSLGLETMGGLVERIIPRNSTIPVARAQEFTTFKDGQTAMSVHVVQGERDLVSDC 468 ... ... ... LDVIPLSLGLETMGGLVERIIPRNSTIPVARAQEFTTFKDGQTAMSVHVVQGERDLVSDC Sbjct: 1 ... L...DVIPLSLGLETMGGLVERIIPRNSTIPVARAQEFTTFKDGQTAMSVHVVQGERDLVSDC 60 ... Query: 529 IARMLADSVTQADSDARARMLREQQVEARQLVE
ORF Alignment: NC_002937 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available gth = 227 ... Query: 5 ... EPRVELLAHTPEPLSLLYAAFRQCYHAGFVADMWPRLLSGEIEREKQGAFIASILESG...HS 64 ... EPRVELLAHTPEPLSLLYAAFRQCYHAGFVADMWPRLLSGEIEREKQGAFIASILESGHS Sbjct: 1 ... EPRVELLAHTPEPLSLLYA...AFRQCYHAGFVADMWPRLLSGEIEREKQGAFIASILESGHS 60 ... Query: 125 RFEQFMEDVGSAYRDIKALLEQDGRTGSRANEDARFVLPQAAASKIVVTMN
ORF Alignment: NC_004842 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available es] ... Length = 227 ... Query: 24 ... ELRVLDKGFVRVVDYMGSDESVVQAARVSYGRGTKRTSQDAALIGYLMRHAHTSPFEMCE 83 ... ... ... ELRVLDKGFVRVVDYMGSDESVVQAARVSYGRGTKRTSQDAALIGYLMRHAHTSPFEMCE Sbjct: 1 ... EL...RVLDKGFVRVVDYMGSDESVVQAARVSYGRGTKRTSQDAALIGYLMRHAHTSPFEMCE 60 ... Query: 144 PADAAKRIMELFRRNSELMYEDYEALLEQGLARE
ORF Alignment: NC_000911 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... protein - Synechocystis sp. (strain PCC 6803) ... Length = 227 ... Query: 40 ... SRQTIIVATEPTFPPFEMTDE...ATGQLTGFDVDLIQAIGEAAQVTVDIQGYPFDGIIPALQ 99 ... SRQTIIVATEPTFPPFEMTDEATGQLTGFDVDLIQAIGEAAQVTVDIQGYPFDG...IIPALQ Sbjct: 1 ... SRQTIIVATEPTFPPFEMTDEATGQLTGFDVDLIQAIGEAAQVTVDIQGYPFDGIIPALQ 60
ORF Alignment: NC_001140 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... AAP1-SMF2 intergenic region ... Length = 227 ... Query: 8 ... LLFLHGFLQNGKVFSEKSSGIRKLLKKANVQCDYIDAPVLLEKKDLPFEM...DDEKWQATLD 67 ... LLFLHGFLQNGKVFSEKSSGIRKLLKKANVQCDYIDAPVLLEKKDLPFEMDDEKWQATLD Sbjct: 1 ... ...LLFLHGFLQNGKVFSEKSSGIRKLLKKANVQCDYIDAPVLLEKKDLPFEMDDEKWQATLD 60 ... Query: 128 PDHPQ
227 Globalization, Culture and Human Development in the 21 ...
African Journals Online (AJOL)
issues on globalization and its impact on culture, cultural values .... impose its hegemony on other subjugated and exploited nations. ... The dynamism of culture casts doubt on the possibility of a global culture. Part of this dynamism is that each culture has its own personality. But central to globalization is the idea of a global.
48 CFR 1952.227-77 - Rights in shop drawings.
2010-10-01
... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Rights in shop drawings... Rights in shop drawings. As prescribed in 1927.405(h), insert the following clause: Rights in Shop Drawings (FEB 1985) (a) Shop drawings for construction means drawings, submitted to the Government by the...
227 Home Economics Students' Perception of the Relevance of ...
African Journals Online (AJOL)
Nekky Umera
The purpose of this research work was to appraise Home Economics students' ... 300 and 400 levels Home Economics students enrolled in Delta State. University in the 2008 .... References. Anyakoha, E. ... Spectrum Book Ltd. Oladokun, A.
34 CFR 300.227 - Direct services by the SEA.
2010-07-01
... agency to provide special education and related services directly to children with disabilities residing... Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF SPECIAL EDUCATION... provide special education and related services directly, by contract, or through other arrangements. (ii...
25 CFR 227.17 - Rates of rents and royalties.
2010-04-01
... Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND MINERALS LEASING OF CERTAIN LANDS... same gravity, and gas, and/or natural gasoline, and/or all other hydrocarbon substances produced and... be required by the lessor. The lessee shall not be required to hold such royalty oil in storage...
48 CFR 1852.227-86 - Commercial computer software-Licensing.
2010-10-01
.../contractor proposes its standard commercial software license, those applicable portions thereof consistent... its standard commercial software license until after this purchase order/contract has been issued, or at or after the time the computer software is delivered, such license shall nevertheless be deemed...
48 CFR 252.227-7015 - Technical data-Commercial items.
2010-10-01
... information, regardless of the form or method of recording, of a scientific or technical nature (including... shall have the unrestricted right to use, modify, reproduce, release, perform, display, or disclose... Government under a prior contract or licensing agreement through which the Government has acquired the rights...
All projects related to | Page 227 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
2012-03-01
Malnutrition remains a serious problem in the Philippines, especially among children. Could integrated garden and nutrition programs at schools help address the problem? Start Date: March 1, 2012. End Date: April 1, 2015. Topic: Poverty alleviation, CHILDREN, MALNUTRITION, SOUTHEAST ASIA, EDUCATION, DIET, ...
Directory of Open Access Journals (Sweden)
Eurico Lucas de Sousa Neto
2014-04-01
Full Text Available Soil physical quality is an important factor for the sustainability of agricultural systems. Thus, the aim of this study was to evaluate soil physical properties and soil organic carbon in a Typic Acrudox under an integrated crop-livestock-forest system. The experiment was carried out in Mato Grosso do Sul, Brazil. Treatments consisted of seven systems: integrated crop-livestock-forest, with 357 trees ha-1 and pasture height of 30 cm (CLF357-30; integrated crop-livestock-forest with 357 trees ha-1 and pasture height of 45 cm (CLF357-45; integrated crop-livestock-forest with 227 trees ha-1 and pasture height of 30 cm (CLF227-30; integrated crop-livestock-forest with 227 trees ha-1 and pasture height of 45 cm (CLF227-45; integrated crop-livestock with pasture height of 30 cm (CL30; integrated crop-livestock with pasture height of 45 cm (CL45 and native vegetation (NV. Soil properties were evaluated for the depths of 0-10 and 10-20 cm. All grazing treatments increased bulk density (r b and penetration resistance (PR, and decreased total porosity (¦t and macroporosity (¦ma, compared to NV. The values of r b (1.18-1.47 Mg m-3, ¦ma (0.14-0.17 m³ m-3 and PR (0.62-0.81 MPa at the 0-10 cm depth were not restrictive to plant growth. The change in land use from NV to CL or CLF decreased soil organic carbon (SOC and the soil organic carbon pool (SOCpool. All grazing treatments had a similar SOCpool at the 0-10 cm depth and were lower than that for NV (17.58 Mg ha-1.
Pathogenicity of porcine intestinal spirochetes in gnotobiotic pigs.
Neef, N A; Lysons, R J; Trott, D J; Hampson, D J; Jones, P W; Morgan, J H
1994-06-01
Twelve intestinal spirochete strains of porcine origin were characterized on the basis of their phenotypic properties, by multilocus enzyme electrophoresis, and by pathogenicity testing in gnotobiotic pigs. The spirochetes used included two strains of Serpulina hyodysenteriae (B204 and P18A), two strains of Serpulina innocens (B256 and 4/71), one strain from the proposed new genus and species "Anguillina coli" (P43/6/78), and seven non-S. hyodysenteriae strains recently isolated from United Kingdom pig herds with a history of nonspecific diarrhea and typhlocolitis. By multilocus enzyme electrophoresis, five of these were identified as S. innocens, one was identified as an unspecified Serpulina sp., and one was identified as "A. coli." S. hyodysenteriae B204 and P18A, "A. coli" P43/6/78 and 2/7, and three (22/7, P280/1, and 14/5) of the five S. innocens field isolates induced mucoid feces and typhlocolitis in gnotobiotic pigs. None of the other spirochetes produced clinical signs or large intestinal pathology in this model. The "A. coli" strains induced a more watery diarrhea, with lesions present more proximally in the large intestine, than did the other pathogenic spirochetes. S. innocens 22/7 was also tested for pathogenicity in hysterotomy-derived pigs that had previously been artificially colonized with a spirochete-free intestinal flora and shown to be susceptible to swine dysentery. Despite effective colonization, strain 22/7 did not produce any disease, nor was there any exacerbation of large intestinal pathology or clinical signs when pigs with an experimentally induced existing colitis caused by Yersinia pseudotuberculosis were superinfected with strain 22/7. Certain non-S. hyodysenteriae spirochetes are therefore capable of inducing disease in gnotobiotic pigs, but their role as primary or opportunistic pathogens in conventional pigs remains equivocal.
[Wilhelm Lenz. Theodor Schiemanns Revaler Jahre (1883-1887)] / Paul Kaegbein
Kaegbein, Paul
2008-01-01
Arvustus: Wilhelm Lenz. Theodor Schiemanns Revaler Jahre (1883-1887). - Ostseeprovinzen, baltische Staaten und das Nationale. Münster : LIT, 2005. Lk. 227-250. Tallinna linnaarhiivi esimesest linnaarhivaarist
International Nuclear Information System (INIS)
Mueller, W.A.; Luz, A.; Linzner, U.; Murray, A.B.
1991-01-01
The effect of injection of 1.85kBq/kg of the long-lived radionuclide 227 Ac on the induction of osteosarcomas in female NMRI-mice by different dose levels of the short-lived radionuclide 227 Th (18.5, 74, and 185 kBq/kg), of the short-lived radionuclide 224 Ra (18.5 kBq/kg and 185 kBq/kg) and of the short-lived β-emitter 177 Lu (100 MBq/kg and 200 MBq/kg) was investigated. The results showed in all cases that combined incorporation of two radionuclides at the levels of radioactivity studied has a lower biological effect than the sum of the effects of the components administered singly. (author)
2013-10-31
... modes, and energy absorption characteristics. Therefore, the impact response characteristics of the... (425) 227-1320. SUPPLEMENTARY INFORMATION: Comments Invited We invite interested people to take part in...
DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS
Energy Technology Data Exchange (ETDEWEB)
NA
2004-11-22
The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) important to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are in the form of tabulated functions with pH and log (line integral) CO{sub 2} as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. The output data from this report are fundamental inputs for Total System Performance Assessment for the License Application (TSPA-LA) to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for all of the actinides. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or otherwise addressed.
International Nuclear Information System (INIS)
Johansson, B.; Rosengren, A.
1975-01-01
A ''generalized'' phase diagram is constructed empirically for the lanthanides. This diagram makes it possible, not only in one picture, to assemble a lot of information but also to predict phase transitions not yet experimentally accessible. Further, it clearly illustrates the close relation between the members of the lanthanide group. To account for some of its features, the pseudopotential method is applied. The trend in crystal structure through the lanthanide series can thereby be qualitatively accounted for, as can the trend in crystal structure for an individual element, when compressed. A scaling procedure makes it possible to extend the treatment to elements neighboring the lanthanides in the Periodic Table. In total 25 elements are considered. An atomic parameter f (relatable to the pseudopotential) is introduced, by means of which different phase transitions, both for an individual rare-earth element and intra-rare-earth alloys, can be correlated to certain critical values of this parameter. A nonmagnetic rare-earth series (Sc, Lu, Y, La, and Ac) is introduced and the occurrence of superconductivity is discussed with special emphasis on the pressure dependence of the transition temperature. This temperature can be correlated to the above-mentioned parameter f, both for intra-rare-earth alloys and pure elements at different pressures. The correlation implies that actinium is a superconductor with a critical temperature which could be as high as (11--12) degree K
Emergence of magnetic order in ultra-thin pyrochlore iridate films
Cheema, Suraj; Serrao, Claudy; Mundy, Julia; Patankar, Shreyas; Birgeneau, Robert; Orenstein, Joseph; Salahuddin, Sayeef; Ramesh, Ramamoorthy
We report on thickness-dependent magnetotransport in (111) - oriented Pb2Ir2O7-x (Pb227) epitaxial thin films. For thicknesses greater than 4 nm, the magnetoresistance (MR) of metallic Pb227 is positive, linear and non-saturated up to 14 T. Meanwhile at 4 nm, the conduction turns nonmetallic and the MR becomes negative and asymmetric upon field-cooling; such traits are reminiscent of all-in-all-out (AIAO) magnetic order in the insulating pyrochlore iridates. Hysteretic low-field MR dips and trained-untrained resistivity bifurcations suggest the presence of magnetic conducting domain walls within the chiral AIAO spin structure. Beyond just AIAO order, angular-dependent MR indicates a magnetic phase space hosting 2-in-2-out (2I2O) spin ice order. Such anomalous magnetotransport calls for re-evaluation of the pyrochlore iridate phase diagram, as epitaxially strained Pb227 exhibits traits reminiscent of both the insulating magnetic and metallic spin-liquid members. Furthermore, these results open avenues for realizing topological phase predictions in (111) - oriented pyrochlore slabs of kagome-triangular iridate heterostructures. This work is supported by the Office of Basic Energy Sciences of the US Department of Energy under Contract No. DE-AC02-05CH11231.
Profesor Bohumil Ryba, mezi vědou a vězením
Czech Academy of Sciences Publication Activity Database
Dvořáčková, Věra
-, č. 8 (2010), s. 227-274 ISSN 2336-1387 Institutional support: RVO:68378092 Keywords : Bohumil Ryba * linguistics * history * classical philology * political persecution * political trials Subject RIV: AI - Linguistics
75 FR 4451 - Notification of United States Mint 2010 Commemorative Coin Pricing
2010-01-27
... Dollar and the 2010 Boy Scouts of America Centennial Silver Dollar Programs. Public Laws 110-227 and 110... Scouts of America Centennial Silver Dollar Commemorative Coins, respectively. [[Page 4452
77 FR 43082 - Federal Acquisition Regulation; Information Collection; Commerce Patent Regulations
2012-07-23
... OMB control number. Select the link ``Submit a Comment'' that corresponds with ``Information... dated April 10, 1987. Under the subpart, a contracting officer may insert clauses 52.227-11, Patent...
Na hranici kultur: krymský Chersonésos, místo setkávání klasického a barbarského světa
Czech Academy of Sciences Publication Activity Database
Čechová, Martina
2015-01-01
Roč. 19, 1/2 (2015), s. 227-239 ISSN 1212-5865 Institutional support: RVO:68378017 Keywords : Crimea * Chersonesos * Byzantine Empire * Nomads * Khazars * agriculture * garum * Crimean Goths Subject RIV: AB - History
EST Table: FS796464 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available ar to putative lysosomal glucocerebrosidase [Tribolium castaneum] 10/09/09 32 %/334 aa FBpp0237202|DvirGJ227...milar to putative lysosomal glucocerebrosidase [Tribolium castaneum] FS796494 ffbm ...
Aquatic concentrations of chemical analytes compared to ecotoxicity estimates
U.S. Environmental Protection Agency — We describe screening level estimates of potential aquatic toxicity posed by 227 chemical analytes that were measured in 25 ambient water samples collected as part...
76 FR 291 - Special Conditions: Gulfstream Model GVI Airplane; Single-Occupant Side-Facing Seats
2011-01-04
... to provide energy absorption; body- to-body impacts are unacceptable. 2. The restraint system and the...) 227-1320. SUPPLEMENTARY INFORMATION: Comments Invited We invite interested people to take part in this...
National Research Council Canada - National Science Library
Burch, Ian
2007-01-01
The halogenated extinguishants Halon 1301, HFC-227ea (FM200) and NAF-S-III used within Royal Australian Navy vessels for total flooding fire suppression applications have hydrogen fluoride (HF) toxicity concerns...
Brominated Oxylipins and Oxylipin Glycosides from Red Sea Corals
Czech Academy of Sciences Publication Activity Database
Řezanka, Tomáš; Dembitsk, V. M.
- (2003), s. 309-316 ISSN 1434-193X Institutional research plan: CEZ:AV0Z5020903 Keywords : glycosides * natural products * oxylipins Subject RIV: EE - Microbiology, Virology Impact factor: 2.227, year: 2003
Czech Academy of Sciences Publication Activity Database
Řezanka, Tomáš; Dembitsky, V. M.
- (2003), s. 2144-2152 ISSN 1434-193X Institutional research plan: CEZ:AV0Z5020903 Keywords : glycosides * lactones * natural products Subject RIV: EE - Microbiology, Virology Impact factor: 2.227, year: 2003
Feng, Wenyi; Bachant, Jeff; Collingwood, David; Raghuraman, M K; Brewer, Bonita J
2009-12-01
Yeast replication checkpoint mutants lose viability following transient exposure to hydroxyurea, a replication-impeding drug. In an effort to understand the basis for this lethality, we discovered that different events are responsible for inviability in checkpoint-deficient cells harboring mutations in the mec1 and rad53 genes. By monitoring genomewide replication dynamics of cells exposed to hydroxyurea, we show that cells with a checkpoint deficient allele of RAD53, rad53K227A, fail to duplicate centromeres. Following removal of the drug, however, rad53K227A cells recover substantial DNA replication, including replication through centromeres. Despite this recovery, the rad53K227A mutant fails to achieve biorientation of sister centromeres during recovery from hydroxyurea, leading to secondary activation of the spindle assembly checkpoint (SAC), aneuploidy, and lethal chromosome segregation errors. We demonstrate that cell lethality from this segregation defect could be partially remedied by reinforcing bipolar attachment. In contrast, cells with the mec1-1 sml1-1 mutations suffer from severely impaired replication resumption upon removal of hydroxyurea. mec1-1 sml1-1 cells can, however, duplicate at least some of their centromeres and achieve bipolar attachment, leading to abortive segregation and fragmentation of incompletely replicated chromosomes. Our results highlight the importance of replicating yeast centromeres early and reveal different mechanisms of cell death due to differences in replication fork progression.
77 FR 20051 - Meeting of the Compact Council for the National Crime Prevention and Privacy Compact
2012-04-03
... provides a legal framework for the establishment of a cooperative federal-state system to exchange such... will take place at The St. Anthony Hotel, 330 East Terrace, San Antonio, Texas, telephone (210) 227...
Chagosensine, a New Chlorinated Macrolide from the Red Sea Sponge Leucetta chagosensis
Czech Academy of Sciences Publication Activity Database
Řezanka, Tomáš; Hanuš, L.; Dembitsky, V. M.
- (2003), s. 4073-4079 ISSN 1434-193X Institutional research plan: CEZ:AV0Z5020903 Keywords : chagosensine * sixteen-membered * clorinated macrolide Subject RIV: EE - Microbiology, Virology Impact factor: 2.227, year: 2003
The Struggle for Air Force Independence, 1943-1947
1997-01-01
222 7. EPILOGUE .............................................. 227 A PPENDICES .............................................. 251 1. Operational...Arnold, acutely sensitive to the connection between operations--especially the impact of major air cam- paigns-and postwar plans, felt this was the time
High resolution genome-wide analysis of chromosomal alterations in Burkitt's lymphoma.
Directory of Open Access Journals (Sweden)
Saloua Toujani
Full Text Available Additional chromosomal abnormalities are currently detected in Burkitt's lymphoma. They play major roles in the progression of BL and in prognosis. The genes involved remain elusive. A whole-genome oligonucleotide array CGH analysis correlated with karyotype and FISH was performed in a set of 27 Burkitt's lymphoma-derived cell lines and primary tumors. More than half of the 145 CNAs2 Mb, gains were found in 1q (12/27, 13q (7/27, 7q (6/27, 8q(4/27, 2p (3/27, 11q (2/27 and 15q (2/27. Losses were found in 3p (5/27, 4p (4/27, 4q (4/27, 9p (4/27, 13q (4/27, 6p (3/27, 17p (3/27, 6q (2/27,11pterp13 (2/27 and 14q12q21.3 (2/27. Twenty one minimal critical regions (MCR, (range 0.04-71.36 Mb, were delineated in tumors and cell lines. Three MCRs were localized to 1q. The proximal one was mapped to 1q21.1q25.2 with a 6.3 Mb amplicon (1q21.1q21.3 harboring BCA2 and PIAS3. In the other 2 MCRs, 1q32.1 and 1q44, MDM4 and AKT3 appeared as possible drivers of these gains respectively. The 13q31.3q32.1 MCR contained an amplicon and ABCC4 might be the driver of this amplicon. The 40 Kb 2p16.1 MCR was the smallest gained MCR and specifically encompassed the REL oncogene which is already implicated in B cell lymphomas. The most frequently deleted MCR was 3p14.1 that removed the fifth exon of FHIT. Further investigations which combined gene expression and functional studies are essential to understand the lymphomagenesis mechanism and for the development of more effective, targeted therapeutic strategies.
PTSD: National Center for PTSD
Full Text Available ... MB) Close × Evidence-based Treatment: What Does It Mean? Right Click here to download "Evidence-based Treatment: What Does It Mean?" (22.7 MB) Close × Prolonged Exposure for PTSD ...
Uživatelské rozhraní systému Kramerius 4
Czech Academy of Sciences Publication Activity Database
Lhoták, Martin; Jansová, Linda
2011-01-01
Roč. 63, č. 6 (2011), s. 227-229 ISSN 0011-2321 Institutional research plan: CEZ:AV0Z70830501 Keywords : user interface * Kramerius 4 * digital libraries Subject RIV: AF - Documentation, Librarianship, Information Studies
PTSD: National Center for PTSD
Full Text Available ... 2 MB) Close × Evidence-based Treatment: What Does It Mean? Right Click here to download "Evidence-based Treatment: What Does It Mean?" (22.7 MB) Close × Prolonged Exposure for ...
Pramana – Journal of Physics | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Pramana – Journal of Physics; Volume 88; Issue 1 ... Universe with anisotropic dark energy, which isotropize for large time. ... Baba Banarasi Das National Institute of Technology & Management, Lucknow 227 105, India ...
Partial Molar Volumes of Air-Component Gases in Several Liquid n-Alkanes and 1-Alkanols at 313.15 K
Czech Academy of Sciences Publication Activity Database
Izák, Pavel; Cibulka, I.; Heintz, A.
1995-01-01
Roč. 109, č. 2 (1995), s. 227-234 ISSN 0378-3812 Keywords : data density * partial molar volume * gas -liquid mixture Subject RIV: CI - Industrial Chemistry, Chemical Engineering Impact factor: 1.024, year: 1995
Spatial and temporal changes in endogenous cytokinins in developing pea roots
Czech Academy of Sciences Publication Activity Database
Stirk, W.A.; Novák, Ondřej; Václavíková, Kateřina; Tarkowski, Petr; Strnad, Miroslav; van Staden, J.
2008-01-01
Roč. 227, č. 6 (2008), s. 1279-1289 ISSN 0032-0935 Institutional research plan: CEZ:AV0Z50380511 Keywords : cytokinins * germination * Pisum Subject RIV: CE - Biochemistry Impact factor: 3.088, year: 2008
Czech Academy of Sciences Publication Activity Database
Nováková, Alena; Kubátová, A.; Valinová, Š.; Hubka, Vít; Kolařík, Miroslav
2015-01-01
Roč. 67, č. 2 (2015), s. 227-231 ISSN 1805-1421 R&D Projects: GA MŠk(CZ) LD13039 Institutional support: RVO:61388971 Keywords : Ascomycota * Hypocreales * Trichoderma Subject RIV: EE - Microbiology, Virology
4 CFR 22.7 - Copies and Service Thereof [Rule 7].
2010-01-01
...)], shall be provided to the Board by e-mail at [email protected], with a courtesy copy of the submission provided... delivery, express or priority mail, or approved commercial carrier (e.g., UPS or FedEx) within 2 business...
49 CFR Appendix A to Part 227 - Noise Exposure Computation
2010-10-01
... + . . . + Cn/Tn), where Cn indicates the total time of exposure at a specific noise level, and Tn indicates the....054 127 0.047 128 0.041 129 0.036 130 0.031 140 0.078 1 Numbers above 115 dB(A) are italicized to indicate that they are noise levels that are not permitted. The italicized numbers are included only...
227 Rituals in Nollywood Films: A Discourse in Ideology Asiegbu ...
African Journals Online (AJOL)
USER
astronomical for the Nigerian filmmakers. In the bid to stay afloat and relevant to their chosen career, they found alternative in the video format. The video format is quite cheap when placed alongside celluloid film format. Whatever the position, the video format has come to stay and is popularly referred to as “Nollywood.
Erostratus Unbound: Norway’s 22/7 Converging Frames of War
DEFF Research Database (Denmark)
Meret, Susi; Hervik, Peter
2013-01-01
this lone wolf character and the acts of terrorist Anders Behring Breivik. It then situates Breivik firmly within an ideological landscape where communities of politicians, pundits and others distance themselves from Breivik’s terrorising acts, yet in the end share his basic criticism of “multiculturalism......” appearing synonymous with “cultural Marxism” as well as subscribing to what goes under the term of Eurabia conspiracy. In addition, through centring on other catch-all concept of political correctness, the clusters of different anti-migration, anti-feminism and Islamophobic opposition are united together...
48 CFR 227.7103-7 - Use and non-disclosure agreement.
2010-10-01
... recipient shall not, for example, enhance, decompile, disassemble, or reverse engineer the software; time... (b) of this subsection, technical data or computer software delivered to the Government with..., display, or disclose technical data subject to limited rights or computer software subject to restricted...
227 Rituals in Nollywood Films: A Discourse in Ideology Asiegbu ...
African Journals Online (AJOL)
USER
Introduction. Nollywood movies refer to the video films produced in Nigeria. The ... Consequently, the Nigerian video film industry is a highly placed commercial ..... video film industry: Technological fascination and the domestication game. In.
48 CFR 1852.227-85 - Invention reporting and rights-Foreign.
2010-10-01
... and complete technical information concerning the invention as is necessary to enable an understanding of the nature and operation thereof. (c) The Contractor hereby grants to the Government of the United... the State in which this contract is to be performed. As to such State, Contractor hereby grants to the...
25 CFR 227.4 - Sale of oil and gas leases.
2010-04-01
... the Joint Business Council of the Shoshone and Arapahoe Tribes or its authorized representative, the... first year's rental, and his share of the advertising costs, and shall file with the superintendent the... bidder or bidders will be required to pay his or their share of the advertising costs. Amounts received...
Fast electric dipole transitions in Ra-Ac nuclei
International Nuclear Information System (INIS)
Ahmad, I.
1985-01-01
Lifetime of levels in 225 Ra, 225 Ac, and 227 Ac have been measured by delayed coincidence techniques and these have been used to determine the E1 gamma-ray transition probabilities. The reduced E1 transition probabilities. The reduced E1 transition probabilities in 225 Ra and 225 Ac are about two orders of magnitude larger than the values in mid-actinide nuclei. On the other hand, the E1 rate in 227 Ac is similar to those measured in heavier actinides. Previous studies suggest the presence of octupole deformation in all the three nuclei. The present investigation indicates that fast E1 transitions occur for nuclei with octupole deformation. However, the studies also show that there is no one-to-one correspondence between E1 rate and octupole deformation. 13 refs., 4 figs
Ke stému ročníku Chemických Listů
Czech Academy of Sciences Publication Activity Database
Holý, Petr
2006-01-01
Roč. 100, č. 4 (2006), s. 227-232 ISSN 0009-2770 Keywords : history and significance of the journal * notable members of editorial board Subject RIV: CC - Organic Chemistry Impact factor: 0.431, year: 2006
Czech Academy of Sciences Publication Activity Database
Bláhová, Lucie; Babica, Pavel; Adamovský, Ondřej; Kohoutek, Jiří; Maršálek, Blahoslav
2008-01-01
Roč. 6, č. 4 (2008), s. 223-227 ISSN 1610-3653 Institutional research plan: CEZ:AV0Z60050516 Keywords : microcystins * cylindrospermopsin * health risks Subject RIV: EF - Botanics Impact factor: 1.366, year: 2008
African Journals Online (AJOL)
Items 51 - 100 of 227 ... ... on Soil Physical Properties in Enugu State South Eastern Nigeria, Abstract PDF ... on hydrocarbon reduction and growth of Abelmoschus esculentus ... volatile oils of Eucalyptus citrodora and lemon grass, Abstract PDF.
Taking notes as an interactive process
Hornig, Wolfgang
1984-01-01
Taking notes as an interactive process : how to improve students´ notes / Hornig W. ; Nowak, J. - In: Nowak, Johann: Textverstehen und Textrekonstruktion in Vorlesungen. - Augsburg : HDZ, 1984. - S. 227-253. - (Augsburger Studien zur Hochschuldidaktik ; 12)
Spatiotemporal variations of the incidence of the fleas (Siphonaptera ...
African Journals Online (AJOL)
SARAH
2014-08-31
Aug 31, 2014 ... Therefore, awareness of the authorities on the zoonotic risk of small ... Human Health in Benin must sensitize the populations at high risk of the rodent transmitted diseases. ..... Preventive. Veterinary Medicine 60: 227-235.
Formalizovaný model tranzitívnej ekonomiky - prípad SR
Czech Academy of Sciences Publication Activity Database
Luptáčik, M.; Páleník, V.; Kvetan, V.; Ďuraš, Ján; Hrivnáková, J.; Ondko, Peter
2006-01-01
Roč. 54, č. 2 (2006), s. 227-246 ISSN 0032-3233 Institutional research plan: CEZ:MSM0021620846 Keywords : economic transition * mathematical economics * small open economy Subject RIV: AH - Economics Impact factor: 0.363, year: 2006
Use of Chlorella as a carrier of organic-bound iodine in the nutrition of sows
Czech Academy of Sciences Publication Activity Database
Kotrbáček, V.; Doucha, Jiří; Offenbartl, T.
2004-01-01
Roč. 49, č. 1 (2004), s. 28-32 ISSN 1212-1819 Institutional research plan: CEZ:AV0Z5020903 Keywords : iodine intake * colostrum * milk Subject RIV: EE - Microbiology, Virology Impact factor: 0.227, year: 2004
Full Text Available ... will automatically play next. Up next What is PTSD? (Whiteboard Video) - Duration: 3:38. Veterans Health Administration 385,227 views 3:38 Veterans and PTSD: Challenging the Misconceptions - Duration: 2:14. Veterans Health ...
Czech Academy of Sciences Publication Activity Database
Haeba, M. H.; Hilscherová, Klára; Mazurová, E.; Bláha, Luděk
2008-01-01
Roč. 15, č. 3 (2008), s. 222-227 ISSN 0944-1344 Institutional research plan: CEZ:AV0Z60050516 Keywords : Daphnia magna * dicofol * endocrine disruption Subject RIV: EF - Botanics Impact factor: 2.492, year: 2008
Czech Academy of Sciences Publication Activity Database
Ruan, Z.; Giordano, Mario
2017-01-01
Roč. 40, č. 2 (2017), s. 227-236 ISSN 0140-7791 Institutional support: RVO:61388971 Keywords : carbon allocation * cyanobacteria * elemental stoichiometry Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 6.173, year: 2016
International Nuclear Information System (INIS)
Segre, Nadia; Fagundes, Rosane Correa
2013-01-01
In order to evaluate possible effects to the environment resulting from the implementation of the Centro Tecnologico da Marinha - Centro Experimental Aramar (CTMSP-CEA) at Ipero in Sao Paulo state, Brazil, which came into operation in 1989, an Environmental Monitoring Program (PMA) was established in October, 1987. One of the aims of this program is to monitor the soil and river sediments radionuclides levels at CEA and beyond its boundary. The utilization of statistical tools to evaluate the results of radiometric environmental monitoring is a procedure required by National Nuclear Energy Commission (CNEN). The box plot is a simple statistical tool for displaying data. The central tendency and dispersion of the results as well as the observation of unusual results (outliers) in the dataset are easily visualized. Control chart is a graph that maps data and provides a picture of how a process is performing over time. A control chart always has a central line for the mean, an upper line for the upper control limit and a lower line for the lower control limit. Box plots and control charts were used to visualize the annual amount of natural uranium, lead-214, actinium-228 and lead-212 in soil and river sediment detected between 1987 and 2011, considering the measurements of all monitored places each year. This historical observation shows that, in average, the results obtained are below than the 1987-1988 levels (CEA's pre-operational) or below than the backgrounds radionuclides values. (author)
Selective Decontamination Effect of Metal Ions in Soil Using Supercritical CO2 and TBP Complex
International Nuclear Information System (INIS)
Park, Jihye; Park, Kwangheon; Jung, Wonyoung
2014-01-01
Decontamination of soil pollution is difficult because the type of contamination largely depends on the characteristics of the pollutant and the area. Also, existing soil decontamination methods generate large quantities of secondary waste and additional process costs. For this reason, new decontamination methods are always under active investigation. A method involving the use of supercritical carbon dioxide with excellent permeability in place of chemical solvents is currently being studied. Unlike other heavy metals in fission products, uranium is used as fuel, and must be handled carefully. Therefore, in this paper, we studied a supercritical carbon dioxide method for decontaminating heavy metal ions in soil using tri-n-butyl phosphate(TBP), which is well known as a ligand for the extraction of metal ions of actinium. We investigated the decontamination effect of heavy metal ions in the soil using TBP-HNO 3 Complex and supercritical carbon dioxide. The study results showed that when heavy metals in soil are extracted using supercritical carbon dioxide, the extraction efficiency is different according to the type of pollutant metal ions in the soil. When TBP-HNO 3 Complex is used with an extractant, uranium extraction is very effective, but lithium, strontium, and cesium extraction is not effective. Therefore, in the case of a mixture of uranium and other metals such as lithium, strontium, cesium, and so on in soil contaminated by fission product leaks from nuclear power plants, we can selectively decontaminate uranium with supercritical carbon dioxide and TBP-HNO 3 Complex
Alpha-emitting nuclides in the marine environment
Pentreath, R. J.
1984-06-01
The occurrence of alpha-emitting nuclides and their daughter products in the marine environment continues to be a subject of study for many reasons. Those nuclides which occur naturally, in the uranium, thorium and actinium series, are of interest because of their value in determining the rates of geological and geochemical processes in the oceans. Studies of them address such problems as the determination of rates of transfer of particulate matter, deposition rates, bioturbation rates, and so on. Two of the natural alpha-series nuclides in which a different interest has been expressed are 210Po and 226Ra, because their concentrations in marine organisms are such that they contribute to a significant fraction of the background dose rates sustained both by the organisms themselves and by consumers of marine fish and shellfish. To this pool of naturally-occurring nuclides, human activities have added the transuranium nuclides, both from the atmospheric testing of nuclear devices and from the authorized discharges of radioactive wastes into coastal waters and the deep sea. Studies have therefore been made to understand the chemistry of these radionuclides in sea water, their association with sedimentary materials, and their accumulation by marine organisms, the last of these being of particular interest because the transuranics are essentially "novel" elements to the marine fauna and flora. The need to predict the long-term behaviour of these nuclides has, in turn, stimulated research on those naturally-occurring nuclides which may behave in a similar manner.
Determination of radium in water
International Nuclear Information System (INIS)
Hohorst, F.A.; Huntley, M.W.; Hartenstein, S.D.
1995-10-01
These detailed work instructions (DWIs) are tailored for the analysis of radium-226 and radium-228 in drinking water supplies from ground water and surface water sources and composites derived from them. The instructions have been adapted from several sources, including a draft EPA method. One objective was to minimize the generation of mixed wastes. Quantitative determinations of actinium-228 are made at 911 keV. The minimum detection level (MDL) for the gamma spectrometric measurements at this energy vary with matrix, volume, geometry, detector, background, and counting statistics. The range of MDL's for current detectors is 0.07 to 0.5 Bq/sample. Quantitative determinations of radium-226 are made by counting the high energy alpha particles which radium-226 progeny emit using liquid scintillation counting (LSC). The minimum detectable activity (MDA) is 3.8 E-3 Bq/sample. The maximum concentration which may be counted on available instruments without dilution is about 2 E + 5 Bq/sample. Typically, this determination of radium in a 2 L sample has a yield of 80%. If radium-228 is determined using a 16 h count after 50 h grow-in, the typical MDL is 1 E-9 to 8 E-9 μCi/mL (1 to 8 pCi/L). If radium-226 is determined using a 2.5 h count after 150 h grow-in, the typical MDA is about 1 E-10 μCi/mL (0. 1 pCi/L)
Energy Technology Data Exchange (ETDEWEB)
Segre, Nadia; Fagundes, Rosane Correa, E-mail: nadia.segre@ctmsp.mar.mil.br [Centro Tecnologico da Marinha (CTM-SP/CEA/LARE), Ipero, SP (Brazil). Centro Experimental Aramar. Lab. Radioecologico; Moraes, Marco Antonio P.V. [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)
2013-07-01
In order to evaluate possible effects to the environment resulting from the implementation of the Centro Tecnologico da Marinha - Centro Experimental Aramar (CTMSP-CEA) at Ipero in Sao Paulo state, Brazil, which came into operation in 1989, an Environmental Monitoring Program (PMA) was established in October, 1987. One of the aims of this program is to monitor the soil and river sediments radionuclides levels at CEA and beyond its boundary. The utilization of statistical tools to evaluate the results of radiometric environmental monitoring is a procedure required by National Nuclear Energy Commission (CNEN). The box plot is a simple statistical tool for displaying data. The central tendency and dispersion of the results as well as the observation of unusual results (outliers) in the dataset are easily visualized. Control chart is a graph that maps data and provides a picture of how a process is performing over time. A control chart always has a central line for the mean, an upper line for the upper control limit and a lower line for the lower control limit. Box plots and control charts were used to visualize the annual amount of natural uranium, lead-214, actinium-228 and lead-212 in soil and river sediment detected between 1987 and 2011, considering the measurements of all monitored places each year. This historical observation shows that, in average, the results obtained are below than the 1987-1988 levels (CEA's pre-operational) or below than the backgrounds radionuclides values. (author)
Mitigation of radiation nephropathy after internal α-particle irradiation of kidneys
International Nuclear Information System (INIS)
Jaggi, Jaspreet Singh; Seshan, Surya V.; McDevitt, Michael R.; Sgouros, George; Hyjek, Elizabeth; Scheinberg, David A.
2006-01-01
Purpose: Internal irradiation of kidneys as a consequence of radioimmunotherapy, radiation accidents, or nuclear terrorism can result in radiation nephropathy. We attempted to modify pharmacologically, the functional and morphologic changes in mouse kidneys after injection with the actinium ( 225 Ac) nanogenerator, an in vivo generator of α- and β-particle emitting elements. Methods and Materials: The animals were injected with 0.35 μCi of the 225 Ac nanogenerator, which delivers a dose of 27.6 Gy to the kidneys. Then, they were randomized to receive captopril (angiotensin-converting enzyme inhibitor), L-158,809 (angiotensin II receptor-1 blocker), spironolactone (aldosterone receptor antagonist), or a placebo. Results: Forty weeks after the 225 Ac injection, the placebo-control mice showed a significant increase in blood urea nitrogen (BUN) (87.6 ± 6.9 mg/dL), dilated Bowman spaces, and tubulolysis with basement membrane thickening. Captopril treatment accentuated the functional (BUN 119.0 ± 4.0 mg/dL; p <0.01 vs. placebo controls) and histopathologic damage. In contrast, L-158,809 offered moderate protection (BUN 66.6 ± 3.9 mg/dL; p = 0.02 vs. placebo controls). Spironolactone treatment, however, significantly prevented the development of histopathologic and functional changes (BUN 31.2 ± 2.5 mg/dL; p <0.001 vs. placebo controls). Conclusions: Low-dose spironolactone and, to a lesser extent, angiotensin receptor-1 blockade can offer renal protection in a mouse model of internal α-particle irradiation
Selective alpha-particle mediated depletion of tumor vasculature with vascular normalization.
Directory of Open Access Journals (Sweden)
Jaspreet Singh Jaggi
2007-03-01
Full Text Available Abnormal regulation of angiogenesis in tumors results in the formation of vessels that are necessary for tumor growth, but compromised in structure and function. Abnormal tumor vasculature impairs oxygen and drug delivery and results in radiotherapy and chemotherapy resistance, respectively. Alpha particles are extraordinarily potent, short-ranged radiations with geometry uniquely suitable for selectively killing neovasculature.Actinium-225 ((225Ac-E4G10, an alpha-emitting antibody construct reactive with the unengaged form of vascular endothelial cadherin, is capable of potent, selective killing of tumor neovascular endothelium and late endothelial progenitors in bone-marrow and blood. No specific normal-tissue uptake of E4G10 was seen by imaging or post-mortem biodistribution studies in mice. In a mouse-model of prostatic carcinoma, (225Ac-E4G10 treatment resulted in inhibition of tumor growth, lower serum prostate specific antigen level and markedly prolonged survival, which was further enhanced by subsequent administration of paclitaxel. Immunohistochemistry revealed lower vessel density and enhanced tumor cell apoptosis in (225Ac-E4G10 treated tumors. Additionally, the residual tumor vasculature appeared normalized as evident by enhanced pericyte coverage following (225Ac-E4G10 therapy. However, no toxicity was observed in vascularized normal organs following (225Ac-E4G10 therapy.The data suggest that alpha-particle immunotherapy to neovasculature, alone or in combination with sequential chemotherapy, is an effective approach to cancer therapy.
Determination of radium in water
Energy Technology Data Exchange (ETDEWEB)
Hohorst, F.A.; Huntley, M.W.; Hartenstein, S.D.
1995-10-01
These detailed work instructions (DWIs) are tailored for the analysis of radium-226 and radium-228 in drinking water supplies from ground water and surface water sources and composites derived from them. The instructions have been adapted from several sources, including a draft EPA method. One objective was to minimize the generation of mixed wastes. Quantitative determinations of actinium-228 are made at 911 keV. The minimum detection level (MDL) for the gamma spectrometric measurements at this energy vary with matrix, volume, geometry, detector, background, and counting statistics. The range of MDL`s for current detectors is 0.07 to 0.5 Bq/sample. Quantitative determinations of radium-226 are made by counting the high energy alpha particles which radium-226 progeny emit using liquid scintillation counting (LSC). The minimum detectable activity (MDA) is 3.8 E-3 Bq/sample. The maximum concentration which may be counted on available instruments without dilution is about 2 E + 5 Bq/sample. Typically, this determination of radium in a 2 L sample has a yield of 80%. If radium-228 is determined using a 16 h count after 50 h grow-in, the typical MDL is 1 E-9 to 8 E-9 {mu}Ci/mL (1 to 8 pCi/L). If radium-226 is determined using a 2.5 h count after 150 h grow-in, the typical MDA is about 1 E-10 {mu}Ci/mL (0. 1 pCi/L).
International Nuclear Information System (INIS)
Ferreira, F.S.; Lira, M.B.; Souza, E.M.; França, E.J.
2017-01-01
The natural radioactive isotopes come from the radioactive series of the 238 U (Uranium Series), the 235 U (Actinium Series) and the 232 Th (Thorium Series) series, or they can occur in isolation as is the case with the 40 K. Primordial radionuclides such as 40 K, 232 Th, 235 U and 238 U exist since the formation of the earth, being found in appreciable amounts in nature and in some cases may present a mass activity above the acceptable of environmental radiation. The objective of this work was to evaluate the mass activity of 40 K, 226 Ra and 228 Ra in the soils of a fragment of Atlantic Forest under ecological restoration process located in the Municipality of Paulista, PE, Brazil. Soil samples (0 - 15 cm) were collected under the projection of the treetops of the most abundant trees in the region. After drying and comminution, analytical portions of 40 g were transferred to polyethylene petri dishes, sealed and stored for 30 days to ensure secular equilibrium. Radioactivity was quantified by High Resolution Gamma Spectrometry - EGAR. The mean physical activities of 40 K, 226 Ra and 228 Ra were 12, 15 and 20 Bq kg -1 , respectively, for the surface soil of the Parque Natural Municipal Mata do Frio. The values found were lower than those found in mangroves in the state of Pernambuco and those considered normal for soils worldwide
Detection of Ancient DNA of Encephalitozoon intestinalis (Microsporidia) in Archaeological Material
Czech Academy of Sciences Publication Activity Database
Myšková, E.; Ditrich, O.; Sak, Bohumil; Kváč, Martin; Cymbalak, T.
2014-01-01
Roč. 100, č. 3 (2014), s. 356-359 ISSN 0022-3395 Institutional support: RVO:60077344 Keywords : parasites * Cryptosporidium * amplification * coprolites * Ascaris * Giardia * world * eggs Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.227, year: 2014
Czech Academy of Sciences Publication Activity Database
Trachtulec, Zdeněk; Forejt, Jiří
2001-01-01
Roč. 12, č. 3 (2001), s. 227-231 ISSN 0938-8990 Institutional research plan: CEZ:AV0Z5052915 Keywords : synteny of orthologous genes Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.318, year: 2001
Czech Academy of Sciences Publication Activity Database
Jurajda, Štěpán
2002-01-01
Roč. 108, č. 2 (2002), s. 227-252 ISSN 0304-4076 Institutional research plan: CEZ:AV0Z7085904 Keywords : employment durations * unemployment insurance * sample selection Subject RIV: AH - Economics Impact factor: 1.106, year: 2002
Full Text Available ... 2 minutes, 48 seconds. National Institute On Aging 12,023 views 5 years ago CC 2:27 ... seconds. National Institute On Aging 5 years ago 12,760 views Trainer Sandy shows Linda how to ...
Production of paclitaxel by Fusarium solani isolated from Taxus ...
Indian Academy of Sciences (India)
SEARCH U
The mobile phase ... 0.1% trifluoroacetic acid (TFA) at a flow rate of 1 ml/min and absorbance was monitored at 227 nm. ... Institute of Microbial Technology, Chandigarh, India. ... engineering may improve paclitaxel production by F. solani.
Indian Academy of Sciences (India)
Unknown
Effect of silica sol of different routes on the properties of low cement castables. 227 .... Optical absorption and fluorescent behaviour of titanium ions in silicate glasses. 335 .... catalytic activity of titania based catalysts. 667. Sawarkar S B.
Full Text Available ... 2 minutes, 48 seconds. National Institute On Aging 12,220 views 6 years ago CC 2:27 ... seconds. National Institute On Aging 6 years ago 12,952 views Trainer Sandy shows Linda how to ...
Full Text Available ... Administration 385,227 views 3:38 Coping With Depression - Duration: 4:50. Veterans Health Administration 7,915 ... Health Administration 1,219 views 1:16 Connected Care 2017 - Duration: 7:19. Veterans Health Administration 1, ...
Planktic Cyanobacteria from Sao Paulo State, Brazil: Chroococcales
Czech Academy of Sciences Publication Activity Database
Sant'Anna, C. L.; Azevedo, M. T. P.; Senna, P. A. C.; Komárek, Jiří; Komárková, Jaroslava
2004-01-01
Roč. 27, č. 2 (2004), s. 213-227 ISSN 0100-8404 R&D Projects: GA AV ČR KSK6005114 Institutional research plan: CEZ:AV0Z6005908 Keywords : taxonomy * Brazil * Chroococcales Subject RIV: EF - Botanics
Czech Academy of Sciences Publication Activity Database
Pärtel, M.; Öpik, M.; Moora, M.; Tedersoo, L.; Szava-Kovats, R.; Rosendahl, S.; Rillig, M. C.; Lekberg, Y.; Kreft, H.; Helgason, T.; Eriksson, O.; Davison, J.; de Bello, Francesco; Caruso, T.; Zobel, M.
2017-01-01
Roč. 216, č 1 (2017), s. 227-238 ISSN 0028-646X Institutional support: RVO:67985939 Keywords : biodiversity * dark diversity * Ice Age Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 7.330, year: 2016
Mitochondria in Cancer: Why Mitochondria Are a Good Target for Cancer Therapy
Czech Academy of Sciences Publication Activity Database
Dong, L.F.; Neužil, Jiří
2014-01-01
Roč. 2014, č. 127 (2014), s. 211-227 ISSN 1877-1173 Institutional support: RVO:86652036 Keywords : ALPHA -TOCOPHERYL SUCCINATE * RESPIRATORY COMPLEX-II * DNA MUTATIONS Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.488, year: 2014
Stakeholders' Views on Ethical Issues in the Practice of In-Vitro ...
African Journals Online (AJOL)
Erah
wrong answers when considering the ethics and morality of IVF as these are principally dependent on choice and circumstances. .... media as an interest group as well as couples who ..... Biomedical Communications Group. 11: 225 – 227. 6.
Jak a proč sociologizovat pohled na jazykovou kulturu
Czech Academy of Sciences Publication Activity Database
Beneš, Martin
2016-01-01
Roč. 99, č. 3 (2016), s. 227-242 ISSN 0027-8203 Institutional support: RVO:68378092 Keywords : language cultivation * ontological socialism * intersubjectivity * common knowledge * language correctness * linguistic rule * usage * norm * codification * language change Subject RIV: AI - Linguistics
Czech Academy of Sciences Publication Activity Database
Hubálek, Zdeněk
2017-01-01
Roč. 66, č. 4 (2017), s. 227-230 ISSN 0139-7893 Institutional support: RVO:68081766 Keywords : animal behaviour * chronobiology * circadian rhythms * environmental variables Subject RIV: EG - Zoology OBOR OECD: Ornithology Impact factor: 0.739, year: 2016
Czech Academy of Sciences Publication Activity Database
Ribas, Alexis; Molina-Vacas, G.; Boadella, M.; Rodríguez-Teijeiro, J. D.; Fernández-Cardo, R.; Arrizabalaga, A.
2012-01-01
Roč. 86, č. 2 (2012), s. 222-227 ISSN 0022-149X Institutional research plan: CEZ:AV0Z60930519 Keywords : Eurasian badger * parasites * Iberian Peninsula Subject RIV: EG - Zoology Impact factor: 1.157, year: 2012
A recombinant E1-deleted porcine adenovirus-3 as an expression vector
International Nuclear Information System (INIS)
Zakhartchouk, Alexander; Zhou Yan; Tikoo, Suresh Kumar
2003-01-01
Replication-defective E1-deleted porcine adenoviruses (PAVs) are attractive vectors for vaccination. As a prerequisite for generating PAV-3 vectors containing complete deletion of E1, we transfected VIDO R1 cells (fetal porcine retina cells transformed with E1 region of human adenovirus 5) with a construct containing PAV-3 E1B large coding sequences under the control of HCMV promoter. A cell line named VR1BL could be isolated that expressed E1B large of PAV-3 and also complemented PAV214 (E1A+E1B small deleted). The VR1BL cells could be efficiently transfected with DNA and allowed the rescue and propagation of recombinant PAV507 containing a triple stop codon inserted in the E1B large coding sequence. In addition, recombinant PAV227 containing complete deletion of E1 (E1A+E1B small + E1B large ) could be successfully rescued using VR1BL cell line. Recombinant PAV227 replicated as efficiently as wild-type in VR1BL cells but not in VIDO R1 cells, suggesting that E1B large was essential for replication of PAV-3. Next, we constructed recombinant PAV219 by inserting green fluorescent (GFP) protein gene flanked by a promoter and a poly(A) in the E1 region of the PAV227 genome. We demonstrated that PAV219 was able to transduce and direct expression of GFP in some human cell lines
Kidney cancer in Lebanon: a specific histological distribution?
Khafaja, Sarah; Kourie, Hampig Raphael; Matar, Dany; Sader-Ghorra, Claude; Kattan, Joseph
2015-01-01
Kidney cancer is the third most frequent urologic cancer in Lebanon after prostate and bladder cancer, accounting for 1.5% of all diagnosed cancers. In this paper, we report the histologic characteristics and distribution of kidney cancer, never described in Lebanon or the Middle East. Pathology results of operated kidney cancer were collected during a two year period (2010-2011) from two different Lebanese hospitals (Hotel-Dieu de France University Hospital and Saint Joseph Hospital). A total of 124 reports were reviewed and analyzed according to WHO classification of 2009. The 124 patients diagnosed with kidney cancer had a median age of 62.4 [18-86], 75% being men and 25% women. Some 71 % of the lesions were renal cell carcinoma (RCC), 25.8% had a urothelial histology, 1.6% were lymphomas and 1.6% were metastases to the kidney. Patients having RCC had a median age of 60.3 [18-85], 77.3% were men and 22.7% women. Of the RCCs, 59.1% were clear cell carcinoma, 22.7% papillary, 11.4% chromophobic, 3.4% rom the collecting ducts of Bellini and 3.4% were not otherwise classified. Histological distribution of Lebanese kidney cancer seems unusual when compared to the literature. The percentage of urothelial renal pelvis tumors is strikingly high. Moreover, clear cell carcinoma accounts for only 59.1% of RCCS in contrast to the 75% described elsewhere, while papillary carcinoma represents more than 22.7% compared to 10%.
Hagemann, H; Marcillat, O; Buchet, R; Vial, C
2000-08-08
Two distinct methods were used to investigate the role of Trp residues during Mg-ADP binding to cytosolic creatine kinase (CK) from rabbit muscle: (1) Raman spectroscopy, which is very sensitive to the environment of aromatic side-chain residues, and (2) reaction-induced infrared difference spectroscopy (RIDS) and photolabile substrate (ADP[Et(PhNO(2))]), combined with site-directed mutagenesis on the four Trp residues of CK. Our Raman results indicated that the environment of Trp and of Tyr were not affected during Mg-ADP binding to CK. Analysis of RIDS of wild-type CK, inactive W227Y, and active W210,217,272Y mutants suggested that Trp227 was not involved in the stacking interactions. Results are consistent with Trp227 being essential to prevent water molecules from entering in the active site [as suggested by Gross, M., Furter-Graves, E. M., Wallimann, T., Eppenberger, H. M., and Furter, R. (1994) Protein Sci. 3, 1058-1068] and that another Trp could in addition help to steer the nucleotide in the binding site, although it is not essential for the activity of CK. Raman and infrared spectra indicated that Mg-ADP binding does not involve large secondary structure changes. Only 3-4 residues absorbing in the amide I region are directly implicated in the Mg-ADP binding (corresponding to secondary structure changes less than 1%), suggesting that movement of protein domains due to Mg-nucleotide binding do not promote large secondary structure changes.
Journal of Chemical Sciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Hydrothermal synthesis and structure of framework cobalt phosphates · Amitava Choudhury ... Volume 113 Issue 3 June 2001 pp 227-234 Physical and Theoretical. Synthesis and .... x H2O ( ∼ 12), possessing a layered structure · Srinivasan ...
Kirjad vallutatud Hiinast / Karl Rumor
Rumor, Karl, pseud., 1886-1971
2008-01-01
1937. a. alanud Hiina-Jaapani sõjast, poliitlistest oludest ja revolutsioonist Hiinas, hiinlastest ja Hiina suhetest teiste riikidega. Varem ilmunud: Uus Eesti 19.-20. aug, 1938, nr. 226-227; 12.-13., 16. sept. 1938, nr. 250-251, 254
EST Table: FS918359 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available FS918359 E_FL_fufe_44C07_F_0 10/09/28 37 %/227 aa ref|XP_001842174.1| sensitized chromosome inheritance... modifier 19 [Culex quinquefasciatus] gb|EDS39679.1| sensitized chromosome inheritance m
Nadpozemský rozměr lásky mladého Karla Hynka aneb O romantické mentalitě
Czech Academy of Sciences Publication Activity Database
Pokorný, Martin Z.
2012-01-01
Roč. 30, č. 93 (2012), s. 215-227 ISSN 0862-7045 Institutional support: RVO:67985955 Keywords : romanticism * historical mentality * romantic love * the position of man in the world * the crisis in faith Subject RIV: AA - Philosophy ; Religion
Conferences in historical geography – traditional interdisciplinary meetings
Czech Academy of Sciences Publication Activity Database
Semotanová, Eva; Chodějovská, Eva; Šimůnek, Robert
2012-01-01
Roč. 38, č. 1 (2012), s. 222-227 ISSN 0323-0988 R&D Projects: GA ČR(CZ) GBP410/12/G113 Institutional support: RVO:67985963 Keywords : history * historical geography * interdisciplinary meetings Subject RIV: AB - History
Testing fundamental symmetries using radioactive ion beams at ...
Indian Academy of Sciences (India)
. In this paper we ... gravitational fields, dark matter, and dark energy, and makes many phenomeno- ..... pothesis, the vector coupling constant is a conserved quantity (just like the electric charge) ..... J. Special Topics 150, 227 (2007). [26] J A ...
Why Are Drugs So Hard to Quit?
... views 2:01 The Swiss Cheese Model of Drug Addiction - Duration: 1:46. National Institute on Drug Abuse ( ... 14,227 views 3:39 Teen discussion on drug abuse and addiction with Dr. Volkow NIDA - Duration: 9:44. National ...
On Defining "Imaginary" Beings and Attributes: How do ...
African Journals Online (AJOL)
R.B. Ruthven
default world view of lexicographic descriptions changes and how cultural biases operate in the treatment of ..... ions) the creator and ruler of the universe and source of all moral au- thority ..... As Niiniluoto (1999: 227-228) indicates, relativism.
Thermogravimetric analysis of co-combustion between microalgae and textile dyeing sludge.
Peng, Xiaowei; Ma, Xiaoqian; Xu, Zhibin
2015-03-01
The synergistic interaction and kinetics of microalgae, textile dyeing sludge and their blends were investigated under combustion condition by thermogravimetric analysis. The textile dyeing sludge was blended with microalgae in the range of 10-90wt.% to investigate their co-combustion behavior. Results showed that the synergistic interaction between microalgae and textile dyeing sludge improved the char catalytic effect and alkali metals melt-induced effect on the decomposition of textile dyeing sludge residue at high temperature of 530-800°C. As the heating rate increasing, the entire combustion process was delayed but the combustion intensity was enhanced. The lowest average activation energy was obtained when the percentage of microalgae was 60%, which was 227.1kJ/mol by OFW and 227.4kJ/mol by KAS, respectively. Copyright © 2015 Elsevier Ltd. All rights reserved.
Undetected common mental disorders in long-term sickness absence
DEFF Research Database (Denmark)
Søgaard, Hans Jørgen
2012-01-01
Background. Undetected Common Mental Disorders (CMDs) amongst people on sick leave complicate rehabilitation and return to work because appropriate treatments are not initiated. Aims. The aim of this study is to estimate (1) the frequencies of CMD, (2) the predictors of undetected CMD, and (3...... individuals registered on LSA who were sick-listed without a psychiatric sick leave diagnosis. In this respect, Phase 1 included 831 individuals, who were screened for mental disorders. In Phase 2, following the screening of Phase 1, 227 individuals were thoroughly examined by a psychiatrist applying Present...... State Examination. The analyses of the study were carried out based on the 227 individuals from Phase 2 and, subsequently, weighted to be representative of the 831 individuals in Phase 1. Results. The frequencies of undetected mental disorders among all sick-listed individuals were for any psychiatric...
African Journals Online (AJOL)
Items 151 - 200 of 227 ... Vol 33 (2017), Optimization of biodiesel production from castor oil by ... Rice Husk and Cassava Peel as Carriers for Bio-fertilizer Production, Abstract PDF ... Vol 29 (2015), Potentials of Microalgae Biodiesel Production in ...
Quality of Care for PTSD and Depression in the Military Health System: Phase 1 Report
2016-01-01
psychological testing, while other testing and assessment methods, including neuropsychological testing and health and behavior assessment, were uti - lized with...Resident/Intern Without License 750 Pharmacist , General Practice 227 Physician/Pathology/Hematology 117 Plastic Surgery Resident/Intern Without License
Historie výzkumu supergenních minerálů uranu v českých zemích
Czech Academy of Sciences Publication Activity Database
Plášil, Jakub
2017-01-01
Roč. 25, č. 3 (2017), s. 227-233 ISSN 1213-0710 R&D Projects: GA MŠk LO1603 Institutional support: RVO:68378271 Keywords : materials research * uranium minerals * Czech republic Subject RIV: DB - Geology ; Mineralogy OBOR OECD: Geology
Rice genetic marker database: An identification of single nucleotide ...
African Journals Online (AJOL)
based genetic marker system to provide information about SNP and QTL markers in rice. The SNP marker database provides 7,227 SNP markers including location information on chromosomes by using genetic map. It allows users to access a ...
Czech Academy of Sciences Publication Activity Database
Illnerová, Helena; Sumová, Alena
2008-01-01
Roč. 9, č. 5 (2008), s. 224-227 ISSN 1213-0508 R&D Projects: GA MŠk(CZ) LC554 Institutional research plan: CEZ:AV0Z50110509 Keywords : circadian system * biological clock * melatonin Subject RIV: ED - Physiology
Czech Academy of Sciences Publication Activity Database
Červinka, C.; Fulem, Michal; Růžička, K.
2012-01-01
Roč. 57, č. 1 (2012), s. 227-232 ISSN 0021-9568 Institutional support: RVO:68378271 Keywords : chemical thermodynamic properties * harmonic vibrational frequencies * vapor-pressure * scale Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.004, year: 2012
Czech Academy of Sciences Publication Activity Database
Campos, R. S.; Mendonca, A. L.; Cabral Jr, C. R.; Vaníčková, Lucie; do Nascimento, R. R.
2016-01-01
Roč. 86, Mar (2016), s. 25-31 ISSN 0022-1910 Institutional support: RVO:61388963 Keywords : venom gland * trail pheromone * two-dimensional gas chromatography * leaf-cutting ants Atta sp. Subject RIV: ED - Physiology Impact factor: 2.227, year: 2016
COMMUNITY MEDICINE & PRIMARY HEALTH CARE
African Journals Online (AJOL)
ajiboro
Result: Majority of the mothers (89.2%) had primary/secondary education and 69.4% were traders. Most ... regards immunization, 22.7% of the children were not fully immunized. A total of 69 ..... Nigeria: Perception and Attitudes of the. 17.
Antibiotic susceptibility profiles for group B streptococci isolated from neonates, 1995-1998
Lin, FYC; Azimi, PH; Weisman, LE; Philips, JB; Regan, J; Clark, P; Rhoads, GG; Clemens, J; Troendle, J; Pratt, E; Brenner, RA; Gill, [No Value
Antibiotic susceptibility profiles were analyzed for 119 invasive and 227 colonizing strains of group B streptococci isolated from neonates at 6 US academic centers, All strains were susceptible to penicillin, vancomycin, chloramphenicol, and cefotaxime, The rate of resistance to erythromycin was
V tesnote i v obide / Jekaterina Rodina
Rodina, Jekaterina
2005-01-01
EA Reng arhitekti Ilmar Jalase koostatud detailplaneering näeb ette Tallinna Õismäe elamurajoonis Paldiski mnt. 227 / Järveotsa tee 2 vahele 24, 14- ja 9-korruseliste hoonete ehitamist. Elanike protest peatas 24-korruselise elumaja planeeringu kinnitamise
Towards a genetic architecture of cryptic genetic variation and ...
Indian Academy of Sciences (India)
Unknown
reprinted in this issue as a J. Genet. classic, pages 227–257). IAN DWORKIN* ... In this commentary, I will discuss the context of this work examining the genetic ... mental buffering where development was channelled in one of several ...
Episodic memory for human-like agents and human-like agents for episodic memory
Czech Academy of Sciences Publication Activity Database
Brom, C.; Lukavský, Jiří; Kadlec, R.
2010-01-01
Roč. 2, č. 2 (2010), s. 227-244 ISSN 1793-8473 Institutional research plan: CEZ:AV0Z70250504 Keywords : episodic memory * virtual agent * modelling Subject RIV: AN - Psychology http://www.worldscinet.com/ijmc/02/0202/S1793843010000461.html
XIII. mezinárodní sjezd slavistů - Lublaň 2003. Sociolingvistika
Czech Academy of Sciences Publication Activity Database
Gladkova, Hana
2004-01-01
Roč. 73, č. 2 (2004), s. 227-230 ISSN 0037-6736. [Mezinárodní kongres slavistů /13./. Ljubljana, 15.08.2003-21.08.2003] Institutional research plan: CEZ:AV0Z9092920 Keywords : sociolinguistics Subject RIV: AI - Linguistics
The Integral Equation Method and the Neumann Problem for the Poisson Equation on NTA Domains
Czech Academy of Sciences Publication Activity Database
Medková, Dagmar
2009-01-01
Roč. 63, č. 21 (2009), s. 227-247 ISSN 0378-620X Institutional research plan: CEZ:AV0Z10190503 Keywords : Poisson equation * Neumann problem * integral equation method Subject RIV: BA - General Mathematics Impact factor: 0.477, year: 2009
NATIVE AND INTRODUCED LARVAL FISHES IN SUISAN MARSH, CALIFORNIA,: THE EFFECTS OF FRESHWATER FLOW
We sampled ichthyoplankton weekly in Suisun Marsh in the San Francisco Estuary from February to June each year from 1994 to 1999. We collected approximately 227,900 fish, predominantly shimofuri goby Tridentiger bifasciatus (60%) and prickly sculpin Cottus asper (33%). Principal ...
Thermal analysis of sulfide Ge-Ga glasses doped by praseodymium
Czech Academy of Sciences Publication Activity Database
Drabik, M.; Kozak, T.; Ležal, Dimitrij; Poulain, M.; Kalužný, J.
2002-01-01
Roč. 67, č. 1 (2002), s. 223-227 ISSN 1418-2874 Institutional research plan: CEZ:AV0Z4032918 Keywords : glass transition * Pr dopand * sulfide Ge-Ga glasses Subject RIV: CA - Inorganic Chemistry Impact factor: 0.598, year: 2002
African Journals Online (AJOL)
2018-01-02
Jan 2, 2018 ... providing 44% of meat in the world market. (FAO, 2001). ... turbinate deformation in growing pigs. (Kumar et al. ... size was calculated to be 227 pigs. The animals ... laboratory as soon as possible using cold pack and sera ...
Czech Academy of Sciences Publication Activity Database
Růžicová, M.; Petrželková, Klára Judita; Kalousová, B.; Modrý, D.; Pomajbíková, K.
2014-01-01
Roč. 100, č. 5 (2014), s. 662-670 ISSN 0022-3395 R&D Projects: GA ČR GA206/09/0927 Institutional support: RVO:68081766 Keywords : ciliates * chimpanzees * pigs Subject RIV: EG - Zoology Impact factor: 1.227, year: 2014
Lifescience Database Archive (English)
Full Text Available QT64352 Cucumis sativus Cucurbitaceae ldr6.4 Mean length:diameter ratio over three... harvests little-leaf (ll) trait (ldr1.3) 1,6 ... LG_06 ... 22.7 7.3 ... 10.1007/s00122-003-1277-1 12827247
Lifescience Database Archive (English)
Full Text Available QT64351 Cucumis sativus Cucurbitaceae ldr6.3 Mean length:diameter ratio over three... harvests little-leaf (ll) trait (ldr1.3) 1,6 ... LG_06 ... 22.7 4.2 ... 10.1007/s00122-003-1277-1 12827247
77 FR 64837 - Federal Aviation Administration
2012-10-23
... DEPARTMENT OF TRANSPORTATION Federal Aviation Administration Fourth Meeting: RTCA Special Committee 227, Standards of Navigation Performance AGENCY: Federal Aviation Administration (FAA), U.S... Operations Group, Federal Aviation Administration. [FR Doc. 2012-26034 Filed 10-22-12; 8:45 am] BILLING CODE...
Antigravity - its manifestations and origin
Czech Academy of Sciences Publication Activity Database
Křížek, Michal; Somer, L.
2013-01-01
Roč. 3, č. 3 (2013), s. 227-235 ISSN 2161-4717 Institutional support: RVO:67985840 Keywords : Hubble parameter * dark energy * antigravity Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics http://www.scirp.org/journal/PaperInformation.aspx?paperID=36509
Thoolen, B.J.
2007-01-01
This prospective randomized controlled trial evaluated a theory-driven group-based self-management course for patients with screen-detected type 2 diabetes. 227 patients receiving either intensive pharmacological or usual-care treatment since diagnosis (3-33 months previously) agreed to participate
Radiochemical studies on nuclear fission at Trombay
Indian Academy of Sciences (India)
227Ac to 245Cm were determined by radiochemical methods which involved ... foil, followed by direct γ counting using high resolution Ge(Li) detector was also ... the stiffness to mass asymmetric distortion decreases on either side of lead.Also ...
Why Are Drugs So Hard to Quit?
Full Text Available ... views 2:01 The Swiss Cheese Model of Drug Addiction - Duration: 1:46. National Institute on Drug Abuse ( ... 14,227 views 3:39 Teen discussion on drug abuse and addiction with Dr. Volkow NIDA - Duration: 9:44. National ...
Nigerian Journal of Basic and Applied Sciences - Vol 20, No 3 (2012)
African Journals Online (AJOL)
Screening for Total Carotenoids and β-Carotene in Some Widely Consumed Vegetables in Nigeria · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. DM Sahabi, RA Shehu, Y Saidu, AS Abdullahi, 225-227 ...
2013-12-12
... design feature associated with the architecture and connectivity capabilities of the airplanes' computer... the comment for an association, business, labor union, etc.). DOT's complete Privacy Act Statement can...; facsimile 425-227-1149. SUPPLEMENTARY INFORMATION: The proposed network architecture includes the following...
2013-12-12
... the comment for an association, business, labor union, etc.). DOT's complete Privacy Act Statement can...; facsimile 425-227-1149. SUPPLEMENTARY INFORMATION: The network architecture is composed of several connected... business and administrative support, and 3. Passenger entertainment. The applicable airworthiness...
Indian Academy of Sciences (India)
Specialization: Quantum Information Theory, Quantum Computing, Foundations of Quantum Theory Address: QIC Group, Physics Division, Harish Chandra Research Institute, Chhatnag Road, Jhusi, Allahabad 211 019, U.P.. Contact: Office: (0532) 227 4391. Mobile: 87566 12314. Fax: (0532) 256 9576, (0532) 256 7444
Czech Academy of Sciences Publication Activity Database
Gacheva, G. V.; Gigova, L. G.; Ivanova, N. Y.; Pilarski, P. S.; Lukavský, Jaromír
2013-01-01
Roč. 61, č. 3 (2013), s. 217-227 ISSN 1322-0829 R&D Projects: GA TA ČR TE01020080 Institutional support: RVO:67985939 Keywords : antioxidant enzymes * Gloeocapsa * temperature, light Subject RIV: EI - Biotechnology ; Bionics Impact factor: 0.955, year: 2013
Competitive adsorption and photodegradation of salicylate and oxalate on goethite
Czech Academy of Sciences Publication Activity Database
Krýsa, J.; Jirkovský, Jaromír; Bajt, O.; Mailhot, G.
2011-01-01
Roč. 161, č. 1 (2011), s. 221-227 ISSN 0920-5861 R&D Projects: GA MŠk 1M0577 Institutional research plan: CEZ:AV0Z40400503 Keywords : goethite * oxalate * salicylate Subject RIV: CG - Electrochemistry Impact factor: 3.407, year: 2011
30 CFR 210.10 - What are the OMB-approved information collections?
2010-07-01
... information. 1010-0087, 30 CFR Parts 227, 228, and 229, Delegation to States and Cooperative Activities with... auditing and investigative activities. • Request for cooperative agreement and subsequent requirements...-4410, Accounting for Comparison [Dual Accounting]. Form MMS-4393, Request to Exceed Regulatory...
Czech Academy of Sciences Publication Activity Database
Moyo, M.; Amoo, S.O.; Aremu, A.O.; Grúz, Jiří; Šubrtová, Michaela; Doležal, Karel; van Staden, J.
2014-01-01
Roč. 227, OCT 2014 (2014), s. 157-164 ISSN 0168-9452 R&D Projects: GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : Antioxidants * Hydroxybenzoic acids * Hydroxycinnamic acids Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.607, year: 2014
Mitochondrial Dysfunction in Gliomas
Czech Academy of Sciences Publication Activity Database
Katsetos, C.D.; Anni, H.; Dráber, Pavel
2013-01-01
Roč. 20, č. 3 (2013), s. 216-227 ISSN 1071-9091 R&D Projects: GA MŠk LH12050 Institutional support: RVO:68378050 Keywords : gliomas * mitochondrial dysfunction * microtubule proteins Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.883, year: 2013
Ženské psaní jako inscenace limit textu
Czech Academy of Sciences Publication Activity Database
Matonoha, Jan
2008-01-01
Roč. 56, č. 2 (2008), s. 201-227 ISSN 0009-0468 R&D Projects: GA ČR GA405/03/0416 Institutional research plan: CEZ:AV0Z90560517 Keywords : Theory of Literature * Gender Studies Subject RIV: AJ - Letters, Mass-media, Audiovision
Research Article Special Issue
African Journals Online (AJOL)
2017-10-05
Oct 5, 2017 ... Journal of Fundamental and Applied Scienc. ISSN 1112-9867 ..... In 227th American Astronomical. Society, 2016, pp ... [28] Zabidi A, Tahir N M, Yassin I M, Rizman Z I. The performance of binary artificial bee colony (BABC) in ...
International Nuclear Information System (INIS)
Delincee, H.; Ehlermann, D.; Gruenewald, T.; Harmuth-Hoene, A.E.; Muenzner, R.
1978-01-01
The present issue of the bibliographic series contains 227 items. The main headings of the content are basics of food irradiation, applications at low dose levels, applications at higher dose levels, effects on foods and on components of foods, and microbiology. (MG) [de
Epidemiology of subtypes of hyperthyroidism in Denmark: a population-based study
DEFF Research Database (Denmark)
Carle, Allan; Pedersen, Inge Bulow; Knudsen, Nils
2011-01-01
Z227 632).Methods: A laboratory monitoring system identified subjects with thyroid function tests suggesting overt hyperthyroidism (low s-TSH combined with high s-thyroxine or s-triiodothyronine). For all subjects, we collected information on medical history, thyroid scintigraphy and thyroid hormone...
Jména studánek na Moravě a ve Slezsku
Czech Academy of Sciences Publication Activity Database
Komárková, Zina
2010-01-01
Roč. 51, č. 1 (2010), s. 227-246 ISSN 1211-4413 R&D Projects: GA ČR GA405/08/0703 Institutional research plan: CEZ:AV0Z90610518 Keywords : small water sources * hydronyms * word-formation * motivation Subject RIV: AI - Linguistics
Identification of bacteria using mass spectrometry techniques
Czech Academy of Sciences Publication Activity Database
Krásný, Lukáš; Hynek, R.; Hochel, I.
2013-01-01
Roč. 353, NOV 2013 (2013), s. 67-79 ISSN 1387-3806 R&D Projects: GA ČR GAP503/10/0664 Institutional support: RVO:61388971 Keywords : Mass spectrometry * Bacteria * Identification Subject RIV: EE - Microbiology, Virology Impact factor: 2.227, year: 2013
Czech Academy of Sciences Publication Activity Database
Posch, T.; Jezbera, Jan; Vrba, Jaroslav; Šimek, Karel; Pernthaler, J.; Andreatta, S.; Sonntag, B.
2001-01-01
Roč. 42, - (2001), s. 217-227 ISSN 0095-3628 Grant - others:ANB(AT) OENB6513; AKTION(AT) projects23p5; AKTION(AT) 2000/22 Keywords : protozoa * bacteria * predator-prey relation Subject RIV: EE - Microbiology, Virology Impact factor: 2.891, year: 2001
2015-05-16
and S. Shaun Murphree Journal of Chemical Education 2009 86 (2), 227 19. Microwave-Assisted Synthesis of a Natural Insecticide on Basic...NMR Spectroscopy and Molecular Modeling Roosevelt Shaw, Ashika Severin, Miguel Balfour, and Columbus Nettles Journal of Chemical Education 2005 82
Electric vehicle test report Cutler-Hammer Corvette
1981-01-01
Vehicles were characterized for the state of the art assessment of electric vehicles. The vehicle evaluated was a Chevrolet Corvette converted to electric operation. The original internal combustion engine was replaced by an electric traction motor. Eighteen batteries supplied the electrical energy. A controller, an onboard battery charger, and several dashboard instruments completed the conversion. The emphasis was on the electrical portion of the drive train, although some analysis and discussion of the mechanical elements are included. Tests were conducted both on the road (actually a mile long runway) and in a chassis dynamometer equipped laboratory. The majority of the tests performed were according to SAE Procedure J227a and included maximum effort accelerations, constant speed range, and cyclic range. Some tests that are not a part of the SAE Procedure J227a are described and the analysis of the data from all tests is discussed.
Evaluation of rice mutant lines for resistance to brown planthopper, nilaparvata lugens stall
International Nuclear Information System (INIS)
Mugiono
1985-01-01
The most important and common insect in rice cultivation in South East Asia is brown planthopper, nilaparvata lugens stall. Seven rice mutant lines produced by the National Atomic Energy Agency, Indonesia, were tested at IRRI, the Philippines for resistance to brown planthopper. Those mutant lines were Atomita 1, 627/10-3/PsJ, Atomita 2 and 627/4-E/PsJ originated from Pelita 1/1 which was irradiated with 0.2 kGy of gamma rays and A227/2/PsJ, A227/3/PsJ and A227/5/PsJ, originated from early maturing mutant A23/PsJ/72K from irradiated Pelita 1/1 which was irradiated with 0.1 kGy of gamma rays. Evaluation of resistance was carried out by seedling bulk screening, honeydew excretion, survival and population build up tests by using brown planthopper biotype 1, 2 and 3. Results of these tests showed that the seven tested mutant lines were resistant to biotype 1 but susceptible to biotype 2. Reaction to biotype 3 showed that six mutant lines tested were moderately resistant and only one mutant of 627/4-E/PsJ was susceptible. Reactions of the mutant lines to biotype 1, 2 and 3 were different from the resistant varieties, Mudgo or ASD-7. This indicated that mutant lines might have gene(s) for resistance which differed from those of resistant varieties. The results showed that resistance to brown planthopper is possible to be introduced in Indonesian rice varieties by means of mutations. (author)
: tous les projets | Page 227 | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
Sujet: RESEARCH FELLOWSHIPS, ORGANIZED CRIME, NARCOTICS, DRUGS OF ABUSE, DRUG TRAFFIC, DRUG CONTROL. Région: North and Central America, South America. Programme: Gouvernance et justice. Financement total : CA$ 402,800.00. Criminalité et violence dans les zones urbaines d'Amérique latine ...
75 FR 227 - Drawbridge Operation Regulations; Harlem River, New York, NY
2010-01-05
..., and require all the moveable bridges across the Harlem River, except the Spuyten Duyvil Bridge, to... eleven moveable bridges across the Harlem River provide the following vertical clearances in the closed... bridges across the Harlem River at New York City, New York. This final rule revises the drawbridge...
48 CFR 52.227-11 - Patent Rights-Ownership by the Contractor.
2010-10-01
... variety has been reproduced with recognized characteristics. Nonprofit organization means a university or...) Communications. [Complete according to agency instructions.] (k) Subcontracts. (1) The Contractor shall include... international agreements entered into by the Government before or after the effective date of the contract and...
48 CFR 952.227-13 - Patent rights-acquisition by the Government.
2010-10-01
... revocation or modification of the license, DOE will furnish the Contractor a written notice of its intention..., have the right to examine any books (including laboratory notebooks), records, and documents of the...
Sud du Sahara | Page 227 | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
Langue French. Read more about Rôle de la propriété intellectuelle dans le développement ouvert en Afrique. Langue French. Read more about Agenda panafricain de recherche sur l'intégration pédagogique des TIC (PanAf) - phase III. Langue French. Read more about Panafrican Research Agenda on the Pedagogical ...
48 CFR 252.227-7013 - Rights in technical data-Noncommercial items.
2010-10-01
... management information. (15) Unlimited rights means rights to use, modify, reproduce, perform, display...) In no event shall the Contractor use its obligation to recognize and protect subcontractor or... designs. For a vessel design (including a vessel design embodied in a useful article) that is developed or...
2,2,7-Trichloro-3,4-dihydronaphthalen-1(2H-one
Directory of Open Access Journals (Sweden)
Ben Capuano
2009-09-01
Full Text Available The title compound, C10H7Cl3O, obtained as a major byproduct from a classical Schmidt reaction. The cyclohexyl ring is distorted from a classical chair conformation, as observed for monocyclic analogues, presumably due to conjugation of the planar annulated benzo ring and the ketone group (r.m.s. deviation 0.024 Å. There are no significant intermolecular interactions.
Language for Profit: Spanish-English Bilingualism in Lowe's Home Improvement
Hepford, Elizabeth A.
2017-01-01
The USA is commonly portrayed as a country dominated by the ideology of monolingualism [Dick, Hilary Parsons. 2011. "Language and Migration to the United States." "Annual Review of Anthropology" 40: 227-240; Silverstein, Michael. 1996. "Monoglot 'Standard' in America: Standardization and Metaphors of Linguistic…
Aldol condensation of furfural and acetone on zeolites
Czech Academy of Sciences Publication Activity Database
Kikhtyanin, O.; Kelbichová, V.; Vitvarová, Dana; Kubů, Martin; Kubička, D.
2014-01-01
Roč. 227, MAY 2014 (2014), s. 154-162 ISSN 0920-5861 R&D Projects: GA ČR GBP106/12/G015 Institutional support: RVO:61388955 Keywords : aldol condensation * oligomerization * zeolites Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.893, year: 2014
Czech Academy of Sciences Publication Activity Database
Campos-Herrera, R.; Půža, Vladimír; Jaffuel, G.; Blanco-Pérez, R.; Čepulyté-Rakauskiené, R.; Turlings, T. C. J.
2015-01-01
Roč. 132, NOV 01 (2015), s. 216-227 ISSN 0022-2011 Institutional support: RVO:60077344 Keywords : Oscheius * quantitative real-time PCR * intraguild competition Subject RIV: EH - Ecology, Behaviour Impact factor: 2.198, year: 2015 http://www.sciencedirect.com/science/article/pii/S0022201115300276
Army Cyber Mission Force - Ambitions and Realities
2015-05-21
London: A & C Black, 2006), 219. 3 Ibid., 227. 4 Susan Pines, Veda Dickerson, and Lori Cates, eds., O*NET Dictionary of Occupational Titles, 2nd ed...Pines, Susan, Veda Dickerson, and Lori Cates. "Experience." In O*NET Dictionary of Occupational Titles
Andrei, Federica; Smith, Martin M.; Surcinelli, Paola; Baldaro, Bruno; Saklofske, Donald H.
2016-01-01
This study investigated the structure and validity of the Italian translation of the Trait Emotional Intelligence Questionnaire. Data were self-reported from 227 participants. Confirmatory factor analysis supported the four-factor structure of the scale. Hierarchical regressions also demonstrated its incremental validity beyond demographics, the…
The effects of a 28-Hz vibration on arm muscle activity during isometric exercise
Mischi, M.; Cardinale, M. (Marco)
2009-01-01
The aim of this study was to evaluate activation and coactivation of biceps and triceps muscles during isometric exercise performed with and without superimposing a vibration stimulation. Methods: Twelve healthy volunteers (age = 22.7 +/- 2.6 yr) participated in this study. The subjects performed
Czech Academy of Sciences Publication Activity Database
Řasová, K.; Havrdová, E.; Brandejský, P.; Zálišová, M.; Foubíková, B.; Martinková, Patrícia
2006-01-01
Roč. 12, č. 2 (2006), s. 227-234 ISSN 1352-4585 Source of funding: V - iné verejné zdroje Keywords : aerobic training * fatigue * multiple sclerosis * neurorehabilitation * spirometric and spiroergometric parameters Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 2.773, year: 2006
78 FR 30197 - Oral Dosage Form New Animal Drugs; Clindamycin; Enrofloxacin
2013-05-22
...-0002] Oral Dosage Form New Animal Drugs; Clindamycin; Enrofloxacin AGENCY: Food and Drug Administration...- Tallaght, Dublin Oral Drops. 940. 24, Ireland. 200-551........ Putney, Inc., 400 Enrofloxacin Original....812 Enrofloxacin. (a) Specifications. Each tablet contains 22.7, 68.0, or 136.0 milligrams (mg) of...
The way toward theoretical description of state-selected reactions of O+ with methane
Czech Academy of Sciences Publication Activity Database
Hrušák, Jan; Paidarová, Ivana
354-355, SI (2013), s. 372-377 ISSN 1387-3806 R&D Projects: GA ČR GAP208/11/0446 Institutional support: RVO:61388955 Keywords : methane oxidation * excited state * ab initio MCSCF calculations Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.227, year: 2013
PARASITES OF FRESHWATER FISHES IN NORTH AMERICA: WHY SO NEGLECTED?
Czech Academy of Sciences Publication Activity Database
Scholz, Tomáš; Choudhury, A.
2014-01-01
Roč. 100, č. 1 (2014), s. 26-45 ISSN 0022-3395 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:60077344 Keywords : Trematode * North America * Cestoda * Acanthocephala * Digenea Subject RIV: EG - Zoology Impact factor: 1.227, year: 2014
Sequencing of 15622 gene-bearing BACs clarifies the gene-dense regions of the barley genome
Czech Academy of Sciences Publication Activity Database
Munoz-Amatriain, M.; Lonardi, S.; Luo, M.C.; Madishetty, K.; Svensson, J.T.; Moscou, M. J.; Wanamaker, S.; Kudrna, D.; Zheng, J.; Šimková, Hana; Doležel, Jaroslav; Grimwood, J.; Mammadov, J.; Close, T.J.
2015-01-01
Roč. 84, č. 1 (2015), s. 216-227 ISSN 0960-7412 R&D Projects: GA MŠk(CZ) LO1204 Institutional support: RVO:61389030 Keywords : Barley * Hordeum vulgare L * BAC sequencing Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 5.468, year: 2015
Resistance to first line platinum paclitaxel chemotherapy in serous epithelial ovarian cancer
DEFF Research Database (Denmark)
Steffensen, Karina Dahl; Smoter, Marta; Waldstrøm, Marianne
2014-01-01
of sensitivity to platinum/paclitaxel treatment. The primary aim of the study was to investigate whether ERCC1 and Tau protein expression correlates with patient outcome in newly diagnosed epithelial ovarian cancer (EOC) patients. Formalin-fixed, paraffin-embedded tissue sections from 227 newly diagnosed EOC...
Growth of muscle cells on plasma-treated and gold nanoparticles-grafted polytetrafluoroethylene
Czech Academy of Sciences Publication Activity Database
Řezníčková, A.; Makajová, Z.; Kasálková-Slepičková, N.; Kolská, Z.; Bačáková, Lucie; Švorčík, V.
2014-01-01
Roč. 23, č. 3 (2014), s. 227-236 ISSN 1026-1265 R&D Projects: GA ČR(CZ) GBP108/12/G108 Institutional support: RVO:67985823 Keywords : polytetrafluoroethylene ( PTFE ) * nanoparticles * biocompatibility Subject RIV: EI - Biotechnology ; Bionics Impact factor: 1.806, year: 2014
Outcome of status epilepticus in immature rats varies according to the paraldehyde treatment
Czech Academy of Sciences Publication Activity Database
Kubová, Hana; Rejchrtová, Jana; Redkozubova, Olga; Mareš, Pavel
2005-01-01
Roč. 46, Suppl. 5 (2005), s. 38-42 ISSN 0013-9580 R&D Projects: GA MZd(CZ) NF6474 Institutional research plan: CEZ:AV0Z5011922 Keywords : status epilepticus * paraldehyde * long-term consequences Subject RIV: ED - Physiology Impact factor: 3.227, year: 2005
Sociolingvistické sympozium v Berlíně
Czech Academy of Sciences Publication Activity Database
Kaderka, Petr; Sloboda, M.; Sherman, T.; Mrázková, Kamila; Dovalil, V.; Havlík, Martin
2013-01-01
Roč. 74, č. 3 (2013), s. 227-236 ISSN 0037-7031 R&D Projects: GA ČR GAP406/12/1829 Institutional support: RVO:68378092 Keywords : sociolinguistics * language and the city * super-diversity Subject RIV: AI - Linguistics Impact factor: 0.133, year: 2013