22 CFR 224.21 - Discovery.

Science.gov (United States)

2010-04-01

... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Discovery. 224.21 Section 224.21 Foreign....21 Discovery. (a) The following types of discovery are authorized: (1) Requests for production of... parties, discovery is available only as ordered by the ALJ. The ALJ shall regulate the timing of discovery...

Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL

International Nuclear Information System (INIS)

Raeder, S.; Bastin, B.; Block, M.; Creemers, P.; Delahaye, P.; Ferrer, R.; Fléchard, X.; Franchoo, S.; Ghys, L.; Gaffney, L.P.; Granados, C.; Heinke, R.; Hijazi, L.

2016-01-01

To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.

Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL

Energy Technology Data Exchange (ETDEWEB)

Raeder, S., E-mail: s.raeder@gsi.de [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Bastin, B. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Block, M. [Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Institut für Kernchemie, Johannes Gutenberg Universität, 55128 Mainz (Germany); Creemers, P. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Delahaye, P. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Ferrer, R. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Fléchard, X. [LPC Caen, ENSICAEN, Université de Caen, CNRS/IN2P3, Caen (France); Franchoo, S. [Institute de Physique Nucléaire (IPN) d’Orsay, 91406 Orsay, Cedex (France); Ghys, L. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); SCK-CEN, Belgian Nuclear Research Center, Boeretang 200, 2400 Mol (Belgium); Gaffney, L.P.; Granados, C. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Heinke, R. [Institut für Physik, Johannes Gutenberg Universität, 55128 Mainz (Germany); Hijazi, L. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); and others

2016-06-01

To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.

49 CFR 224.109 - Inspection, repair, and replacement.

Science.gov (United States)

2010-10-01

... 49 Transportation 4 2010-10-01 2010-10-01 false Inspection, repair, and replacement. 224.109 Section 224.109 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD..., Inspection, and Maintenance of Retroreflective Material § 224.109 Inspection, repair, and replacement. (a...

49 CFR 224.13 - Preemptive effect.

Science.gov (United States)

2010-10-01

... 49 Transportation 4 2010-10-01 2010-10-01 false Preemptive effect. 224.13 Section 224.13 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... effect. Under 49 U.S.C. 20106, issuance of this part preempts any State law, rule, regulation, or order...

42 CFR 93.224 - Research record.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Research record. 93.224 Section 93.224 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON RESEARCH...

4 CFR 22.4 - Appeal File [Rule 4].

Science.gov (United States)

2010-01-01

... alternative organization of the appeal file is permitted, such as by document type or topic, documents within... 4 Accounts 1 2010-01-01 2010-01-01 false Appeal File [Rule 4]. 22.4 Section 22.4 Accounts... OFFICE CONTRACT APPEALS BOARD § 22.4 Appeal File [Rule 4]. (a) Duties of the Contracting Officer. (1...

48 CFR 352.224-70 - Privacy Act.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Privacy Act. 352.224-70... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and Clauses 352.224-70 Privacy Act. As prescribed in 324.103(b)(2), the Contracting Officer shall insert the following clause: Privacy Act (January...

48 CFR 52.224-2 - Privacy Act.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Privacy Act. 52.224-2... AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 52.224-2 Privacy... agency function: Privacy Act (APR 1984) (a) The Contractor agrees to— (1) Comply with the Privacy Act of...

Bone sarcoma induction by radium 224 in beagles: an interim report

International Nuclear Information System (INIS)

Mays, C.W.; Taylor, G.N.; Lloyd, R.D.; Bruenger, F.W.; Angus, W.

1989-01-01

Twenty beagles were given an injection of Ra 224 contaminated with 210 Pb and 228 Th. All have died, 8 with bone sarcoma. In a new study, 128 dogs were given purified Ra 224 in 1, 10 or 50 weekly injections from 1977-1979 (LD 50 for single injection ∼ 400 kBq 224 Ra/kg). As of 14 September 1987, at the highest skeletal dose of 3 Gy from 224 Ra, bone sarcomas had occurred in 5 of 6 dogs at an average of ± SD of 2069±302 days after the start of 50 injections (0 survivors), in 4 of 6 dogs at 2485±1110 days after the start of 10 injections (1 survivor), and in 1 of 8 dogs at 3066 days after a single injection (3 survivors). At 3 Gy, the toxicity of 224 Ra relative to 239 Pu, was 1.0 for 50 injections of 224 Ra, 0.7 for 10, and 0.4 for 1. The effectiveness per Gy of 224 Ra-equivalent dose from 1 injection of 224 Ra contaminated with 228 Th and 210 Pb was equal to that of 239 Pu. (UK)

14 CFR 417.224 - Probability of failure analysis.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Probability of failure analysis. 417.224..., DEPARTMENT OF TRANSPORTATION LICENSING LAUNCH SAFETY Flight Safety Analysis § 417.224 Probability of failure..., must account for launch vehicle failure probability in a consistent manner. A launch vehicle failure...

Bone sarcoma induction by 224Ra in Beagles: An interim report

International Nuclear Information System (INIS)

Mays, C.W.; Taylor, G.N.; Lloyd, R.D.; Bruenger, F.W.; Angus, W.

1988-01-01

During 1963-1968, 20 young adult Beagle dogs were given a single intravenous injection of 224 Ra that was unintentionally contaminated with 210 Pb and 228 Th. All of these dogs have died, eight with bone sarcomas. In addition, 128 Beagle dogs were given purified 224 Ra in one, ten or fifty weekly injections during 1977-1979. The acute lethal dosage (LD 50 ) for a single injection was about 400 kBq 224 Ra/kg (11 μCi 224 Ra/kg). As of September 14, 1987, at the highest skeletal dose of 3 Gy from purified 224 Ra, bone sarcomas occurred in 5 of 6 dogs at an average ± SD of 2069 ± 302 days after the start of injections (no survivors), in 4 of 6 dogs at 2485 ± 1,110 days after the start of 10 injections (healthy survivor) and in 1 of 8 dogs at 3066 days after a single injection (3 healthy survivors). At 3 Gy the toxicity of 224 Ra relative to 239 Pu, based on the ratio of skeletal doses at equal tumor appearance times, was 1.0 for 50 injections of 224 Ra, 0.7 for 10 injections, and 0.4 for one injection. In contrast, the effectiveness per Gy of a 224 Ra-equivalent dose from a single injection of 224 Ra contaminated with 228 Th and 210 Pb was equal to that from 239 Pu, assuming that the 224 Ra-equivalent dose equaled the 224 Ra dose plus the 228 Th dose pus 0.1 of the 210 Pb dose. A possible explanation is that protracted irradiation from the 1.91-yr half-life 228 Th and the 22.3-yr half-life 210 Pb may have 'activated' residual damage from the short-lived, 3.62 day half-life 224 Ra, possibly by stimulating the division of damaged stem cells to replace the bone cells killed by the protracted alpha particle irradiation. An important spin off from the study is experimental support for the assumption that the bone sarcoma effectiveness for 210 Pb is similar to that from long-lived, 1600 yr half-life 226 Ra. (author)

The biological effects of radium-224 injected into dogs

International Nuclear Information System (INIS)

Muggenburg, B.A.; Hahn, F.F.; Boecker, B.B.

1996-01-01

A life-span study was conducted in 128 beagle dogs to determine the biological effects of intravenously injected 224 Ra chloride. The 224 Ra chloride was prepared by the same method used for intravenous injections in humans who were treated for ankylosing spondylitis and tuberculosis. Thus the results obtained from dogs can be compared directly to the population of treated humans, both for the elucidation of the effect of exposure rate and for comparison with other radionuclides for which data for humans are unavailable. Using equal numbers of males and females, the dogs were injected with one of four levels of 224 Ra resulting in initial body burdens of approximately 13, 40, 120 or 350 kBq of 224 Ra kg -1 body mass. A control group of dogs was injected with diluent only. All dogs were divided further into three groups for which the amount of injected 224 Ra (half-life of 3.62 days) or diluent was given in a single injection or divided equally into 10 or 50 weekly injections. As a result of these three injection schedules, the accumulation of dose from the injected 224 Ra was distributed over approximately 1, 3 or 12 months. Each injection schedule included four different injection levels resulting in average absorbed α-particle doses to bone of 0.1, 0.3, 1 and 3 Gy, respectively. The primary early effect observed was a hematological dyscrasia in the dogs receiving either of the two highest injection levels. The effect was most severe in the dogs receiving a single injection of 224 Ra and resulted in the death of three dogs injected at the highest level. The late-occurring biological effects were tumors. Bone tumors were the most common followed by tumors in the nasal mucosa. 52 refs., 8 figs., 8 tabs

Growth retardation in children injected with 224Ra

International Nuclear Information System (INIS)

Spiess, H.; Mays, C.W.; Spiess-Paulus, E.

1986-01-01

We have obtained the adult heights of 133 patients formerly injected with 224 Ra as juveniles. 224 Ra induced growth retardation was greatest in children injected at young ages and increased with dose. The growth retardation was well represented as a 2% decrease in potential growth post irradiation per 100 rads of calculated average skeletal dose. (orig.)

22 CFR 224.40 - Stays ordered by the Department of Justice.

Science.gov (United States)

2010-04-01

... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Stays ordered by the Department of Justice. 224.40 Section 224.40 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT IMPLEMENTATION OF THE PROGRAM FRAUD CIVIL REMEDIES ACT § 224.40 Stays ordered by the Department of Justice. If at any time the...

MicroRNA-224 targets ERG2 and contributes to malignant progressions of meningioma

International Nuclear Information System (INIS)

Wang, Maomao; Deng, Xiaodong; Ying, Qi; Jin, Tingyan; Li, Ming; Liang, Chong

2015-01-01

MicroRNA-224 is overexpressed in various malignant tumors with poor prognosis, which plays a critical role in biological processes including cell proliferation, apoptosis and several developmental and physiological progressions. However, the potential association between miR-224 and clinical outcome in patients with meningiomas remains unknown. Here, we investigate miR-224 expression and biological functions in meningiomas. MiR-224 expression was measured by Northern blot analysis and quantitative reverse transcription-polymerase chain reaction (qRT-PCR) in meningioma and normal brain tissues. Kaplan–Meier analysis and Cox regression analysis were used to exam its correlation with clinicopathological features and prognostic value. The biological effects of miR-224 on the cell proliferation and apoptosis in meningioma cells were examined by MTT assay and apoptosis assay. We found the expression levels of miR-224 were significantly higher in meningioma tissues than that in normal brain, positively correlated with advanced pathological grade. Kaplan–Meier analysis indicated that meningioma patients with low miR-224 expression exhibited significantly prolonged overall and recurrence-free survival. Furthermore, we demonstrated that ERG2 was an identical candidate target gene of MiR-224 in vitro. Our results indicated that downregulation of miR-224 suppressed cell growth and resulted in the enhancement of cell apoptosis through activation of the ERG2-BAK-induced apoptosis pathway. Our findings imply the miR-224 expression could predict the overall survival and recurrence-free survival of patients with meningioma and it might be a promising therapeutic target for treating malignant meningiomas. - Highlights: • MiR-224 expression is correlates with prognosis in meningioma patients. • ERG2 is a novel downstream target of miR-224. • MiR-224 suppressed cell growth and enhanced apoptosis in IOMM-Lee and CH157 cells. • MiR-224 is an upstream regulator of the ERG2

Argonne-Utah studies of 224Ra endosteal surface dosimetry

International Nuclear Information System (INIS)

Schlenker, R.A.; Smith, J.M.

1985-01-01

The activities of 212 Pb relative to 224 Ra and of 222 Rn relative to 226 Ra were measured in bone surface deposits 24 h after injection of radium into beagles. The fractional retention of 220 Rn atoms was measured in vitro with hydrated and dehydrated bone samples to determine the effect of water content on the escape of radon from bone surfaces. The experimental data suggest that substantial 224 Ra daughter-product disequilibrium exists in bone surface deposits. Estimates for the lower and upper limits on the fractional retention of 220 Rn in vivo are 0.05 and 0.25, respectively. The average bone surface activity of 212 Pb relative to 224 Ra ranged from 0.34 to 0.71 for four dogs, with the majority of the values toward the lower end of the range. Only a small portion of the deposited 212 Pb came from lead in the injection solution despite near equilibrium between 224 Ra and its daughters at the time of injection. The retention data indicate that the endosteal tissue dose rate in the dogs at one day was actually one-third to about one-half that which would be calculated assuming equilibrium of 224 Ra daughter products in bone surface deposits. 11 references, 2 figures, 7 tables

Argonne-Utah studies of 224Ra endosteal surface dosimetry

International Nuclear Information System (INIS)

Schlenker, R.A.; Smith, J.M.

1984-01-01

The activities of 212 Pb relative to 224 Ra and of 222 Rn relative to 226 Ra were measured in bone surface deposits 24 h after radium injection into beagles. The fractional retention of 220 Rn atoms was measured in vitro with hydrated and dehydrated bone samples to determine the effect of water content on the escape of radon from bone surfaces. The experimental data suggest that substantial 224 Ra daughter product disequilibrium exists in bone surface deposits. Estimates for the lower and upper limits on the fractional retention of 220 Rn in vivo are 0.05 and 0.25, respectively. The average bone surface activity of 212 Pb relative to 224 Ra ranged from 0.34 to 0.71 for four dogs, with the majority of the values toward the low end of the range. Only a small portion of the deposited 212 Pb came from lead in the injection solution despite near equilibrium between 224 Ra and its daughters at the time of injection. The retention data indicate that the endosteal tissue dose rate in the dogs at one day was actually one-third to about one-half that which would be calculated assuming equilibrium of 224 Ra daughter products in bone surface deposits. 11 references, 2 figures, 7 tables

Argonne-Utah studies of 224Ra endosteal surface dosimetry

International Nuclear Information System (INIS)

Schlenker, R.A.; Smith, J.M.

1986-01-01

The activities of 212 Pb relative to 224 Ra and of 222 Rn relative to 226 Ra were measured in bone surface deposits 24 h after radium injection into beagles. The fractional retention of 220 Rn atoms was measured in vitro with hydrated and dehydrated bone samples to determine the effect of water content on the escape of radon from bone surfaces. The experimental data suggest that substantial 224 Ra daughter product disequilibrium exists in bone surface deposits. Estimates for the lower and upper limits on the fractional retention of 220 Rn in vivo are 0.05 and 0.25, respectively. The average bone surface activity of 212 Pb relative to 224 Ra ranged from 0.34 to 0.71 for four dogs, with the majority of the values toward the low end of the range. Only a small portion of the deposited 212 Pb came from lead in the injection solution despite near equilibrium between 224 Ra and its daughters at the time of injection. The retention data indicate that the endosteal tissue dose rate in the dogs at one day was actually one-third to about one-half that which would be calculated assuming equilibrium of 224 Ra daughter products in bone surface deposits. (orig.)

Brief history of /sup 224/Ra usage in radiotherapy and radiobiology

Energy Technology Data Exchange (ETDEWEB)

Schales, F [Gesellschaft fuer Strahlen- und Umweltforschung m.b.H., Neuherberg (Germany, F.R.)

1978-07-01

Attempts were made a short time after its discovery to introduce /sup 224/Ra in therapy. Besides its external application in dermatology the treatment of rheumatic diseases seemed to be promising. From 1944-1952 about 2000 patients, most of them with tuberculosis or ankylosing spondylitis were treated in a German hospital with repeated intravenous injections of Peteosthor, a combination containing /sup 224/Ra with traces of platinum and eosin, totalling about 4000 ..mu..Ci/sup 224/Ra. Different lesions were observed which were suspected to be due to irradiation. The treatment has nevertheless continued. A group of 1500 additional patients, exclusively adults, has received rather low amounts (250-300 ..mu..Ci) of /sup 224/Ra and are now under study. Based on linear hypothetical dose-effect relationships in this group an osteosarcoma incidence of 3-5 per 1000 patients could be expected during the first 20 years following average skeletal doses of 56 rad. In experiments started in 1965 in Neuherberg, Germany, the acute and late effects of /sup 224/Ra and /sup 227/Th in rats and mice are investigated. Similar experiments are under way in Czechoslovakia. In Salt Lake City, Utah, in connection with studies on boneseeking radioisotopes using dogs, a pilot study on /sup 224/Ra was started in 1963. Together with studies of Ra and Th toxicity a mock dial paint containing /sup 224/Ra and /sup 234/Th was developed. As /sup 224/Ra is a /sup 232/Th decay product, it might play a certain role in the Thorotrast problem.

Soft-tissue effects following /sup 224/Ra injections into humans

Energy Technology Data Exchange (ETDEWEB)

Spiess, H; Gerspach, A [Muenchen Univ. (Germany, F.R.). Kinderklinik; Mays, C W

1978-07-01

Following the Second World War, repeated intravenous injections of /sup 224/Ra were given to German children and adults for the intended treatment of tuberculosis, ankylosing spondylitis and a few other diseases. We have ascertained the health status of 204 juveniles and 612 adults for whom both dosage and injection span are known. /sup 224/Ra is known as a skeletal-seeker, and has induced malignant bone sarcomas, benign exostoses, tooth breakage, and growth retardation. But because of its short 3.62-day half-life, /sup 224/Ra also decays to an appreciable extent in soft tissues, as do the injected atoms of its decay products. Evidence is presented suggesting that some, but certainly not all, of the observed cases of soft-tissue neoplasms, kidney diseases, liver cirrhosis, and cataracts may be related to the /sup 224/Ra therapy. Of particular interest are the 8 cases of cataracts reported at 14-46 years of age (33 yr average) among the 204 patients injected with /sup 224/Ra as juveniles. Due to the rarity of naturally-occurring cataracts at young ages, perhaps all of these 8 cases can be regarded as induced.

Bone sarcoma induction by {sup 224}Ra in Beagles: An interim report

Energy Technology Data Exchange (ETDEWEB)

Mays, C W [Radiation Epidemiology Branch, National Cancer Institute, Bethesda, MD (United States); Taylor, G N; Lloyd, R D; Bruenger, F W; Angus, W [Radiobiology Division, University of Utah School of Medicine, Salt Lake City, UT (United States)

1988-12-01

During 1963-1968, 20 young adult Beagle dogs were given a single intravenous injection of {sup 224}Ra that was unintentionally contaminated with {sup 210}Pb and {sup 228}Th. All of these dogs have died, eight with bone sarcomas. In addition, 128 Beagle dogs were given purified {sup 224}Ra in one, ten or fifty weekly injections during 1977-1979. The acute lethal dosage (LD{sub 50}) for a single injection was about 400 kBq {sup 224}Ra/kg (11 {mu}Ci {sup 224}Ra/kg). As of September 14, 1987, at the highest skeletal dose of 3 Gy from purified {sup 224}Ra, bone sarcomas occurred in 5 of 6 dogs at an average {+-} SD of 2069 {+-} 302 days after the start of injections (no survivors), in 4 of 6 dogs at 2485 {+-} 1,110 days after the start of 10 injections (healthy survivor) and in 1 of 8 dogs at 3066 days after a single injection (3 healthy survivors). At 3 Gy the toxicity of {sup 224}Ra relative to {sup 239}Pu, based on the ratio of skeletal doses at equal tumor appearance times, was 1.0 for 50 injections of {sup 224}Ra, 0.7 for 10 injections, and 0.4 for one injection. In contrast, the effectiveness per Gy of a {sup 224}Ra-equivalent dose from a single injection of {sup 224}Ra contaminated with {sup 228}Th and {sup 210}Pb was equal to that from {sup 239}Pu, assuming that the {sup 224}Ra-equivalent dose equaled the {sup 224}Ra dose plus the {sup 228}Th dose pus 0.1 of the {sup 210}Pb dose. A possible explanation is that protracted irradiation from the 1.91-yr half-life {sup 228}Th and the 22.3-yr half-life {sup 210}Pb may have 'activated' residual damage from the short-lived, 3.62 day half-life {sup 224}Ra, possibly by stimulating the division of damaged stem cells to replace the bone cells killed by the protracted alpha particle irradiation. An important spin off from the study is experimental support for the assumption that the bone sarcoma effectiveness for {sup 210}Pb is similar to that from long-lived, 1600 yr half-life {sup 226}Ra. (author)

Expression and role of oncogenic miRNA-224 in esophageal squamous cell carcinoma

International Nuclear Information System (INIS)

He, Xiaoyan; Zhang, Zhimei; Li, Ming; Li, Shuo; Ren, Lihua; Zhu, Hong; Xiao, Bin; Shi, Ruihua

2015-01-01

Aberrant expression of miR-224 is associated with tumor development and progression. This study investigated the role of miR-224 in esophageal squamous cell carcinoma (ESCC) ex vivo and in vitro. A total of 103 esophageal intraepithelial neoplasia, ESCC tissue specimens, and their matched distant normal tissues were collected to test miR-224 expression using qRT-PCR analysis. Western blot was used to quantify the level of PH domain leucine-rich repeat protein phosphatase 1 (PHLPP1) and PHLPP2 in ESCC tissues. Cell viability, apoptosis, invasion, and colony formation assays were used to assess the altered phenotypes of esophageal cancer cell lines after miR-224 expression or inhibition. A luciferase reporter assay was used to confirm miR-224 binding to PHLPP1 and PHLPP2 mRNA. miR-224 was significantly overexpressed in esophageal intraepithelial neoplasia and ESCC tissues, while the expression of PHLPP1 and PHLPP2 proteins, the target genes of miR-224, was downregulated in ESCC tissues. miR-224 expression was associated with advanced clinical TNM stage, pathologic grade, and the level of PHLPP1 and PHLPP2 proteins in ESCC tissues. Ectopic overexpression of miR-224 promoted proliferation, migration, and invasion, but suppressed apoptosis of ESCC cells. miR-224 was able to bind to the 3′ untranslated region (3′-UTR) of PHLPP1 and PHLPP2 mRNA to suppress their expression. The current study demonstrated that miR-224 acts as an oncogenic miRNA in ESCC, possibly by targeting PHLPP1 and PHLPP2. The online version of this article (doi:10.1186/s12885-015-1581-6) contains supplementary material, which is available to authorized users

The biological effects of 224Ra injected into dogs

International Nuclear Information System (INIS)

Muggenburg, B.A.; Lloyd, R.D.; Hahn, F.F.; Griffith, W.C.; Boecker, B.B.

1994-01-01

The purpose of this study was to investigate the toxicity of injected 224 Ra in the dog. Radium-224 is a short-lived isotope of radium with a half-life of 3.62 d. When administered parenterally, it deposits on bone surfaces; because of its short half-life, most of its energy is deposited on bone surfaces, in a manner similar to plutonium. The experimental design included a comparison to the exposed human population. Instead of using a single injection of 224 Ra, groups were included in which dogs were injected once, 10 times, or 50 times. This design provided groups that could be compared to the multiple injections often used in people for the treatment of ankylosing spondylitis

Tooth breakage in patients injected with 224Ra

International Nuclear Information System (INIS)

Sonnabend, E.; Spiess, H.; Mays, C.W.

1986-01-01

Tooth breakage has been common among the 224 Ra patients, especially those injected as teenagers. The fracture of 1 or more teeth was reported by 26% (8/31) of boys and 23% (7/30) of girls injected with 224 Ra at 16-20 years of age. Combining results from all age groups, the incidence of tooth fractures increased significantly with dose (P=0.01). Unlike the normal loss of permanent teeth by periodontal disease, in which the entire tooth is lost, the tooth loss following 224 Ra injection was primarily from tooth resorption near the gum line causing the tooth crowns to break off easily. Eventually the tooth roots may either become incorporated into the jawbone or are resorbed and replaced with bone. These tooth fractures resembled those observed in the U.S. radium dial painters and in dogs injected with bone-seeking α-emitters. (orig.)

Structural integrity analysis of the 224U elevator mothballing

Energy Technology Data Exchange (ETDEWEB)

Boehnke, W.M.

1994-11-18

As part of the preparation of Building 224U for turnover to Decontamination and Decommissioning, it is necessary to place the elevator in a mothballed condition so that it can be reactivated for use after 10 to 25 years. This mothballing is going to be accomplished by landing the counterweight on wooden timbers and suspending the elevator cab with wire rope or chain slings. This will take the load off the cables and make it relatively easy to reactive. The objective of this Supporting Document is to verify the structural integrity of all of the load bearing components involved in mothballing the 224U Building elevator. Building 224U is part of the UO{sub 3} Plant where uranyl nitrates from the PUREX Plant was converted to UO{sub 3} powder.

22 CFR 224.30 - The hearing and burden of proof.

Science.gov (United States)

2010-04-01

... 22 Foreign Relations 1 2010-04-01 2010-04-01 false The hearing and burden of proof. 224.30 Section 224.30 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT IMPLEMENTATION OF THE PROGRAM FRAUD... mitigating factors by a preponderance of the evidence. (d) The hearing shall be open to the public unless...

Bone sarcoma induction by radium 224 in C57BL/Do mice

International Nuclear Information System (INIS)

Mays, C.W.; Lloyd, R.D.; Taylor, G.N.; Jones, C.W.

1989-01-01

Ninety-five C57BL/Do mice received radium 224 in ten weekly intraperitoneal injections. Doses ranged from 0.5 to 11.6 Gy. Twelve mice developed bone sarcoma. The risk coefficient ±SD was 2.8 ± 0.8%/Gy and the toxicity of shortlived radium 224 relative to longlived radium 226 was 5.4 ± 2.0. Concurrently, a single injection of 33 kBq/kg plutonium 239 was given to 47 similar mice which had a bone sarcoma risk coefficient of 8.4 ± 0.8%/Gy and toxicity relative to longlived radium 226 of 16 ± 4. Based on the studies of Mueller et al that established the increase in effectiveness with increased protraction of radium 224 dose, it is possible, if the radium 224 total dose had been spread continually over about 1 year, that the toxicity of the radium 224 might have been similar to that of plutonium 239. (author)

22 CFR 224.26 - Form, filing and service of papers.

Science.gov (United States)

2010-04-01

... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Form, filing and service of papers. 224.26... CIVIL REMEDIES ACT § 224.26 Form, filing and service of papers. (a) Form. (1) Documents filed with the ALJ shall include an original and two copies. (2) Every pleading and paper filed in the proceeding...

22 CFR 224.31 - Determining the amount of penalties and assessments.

Science.gov (United States)

2010-04-01

... assessments. 224.31 Section 224.31 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT IMPLEMENTATION OF... foreseeable consequential damages and the costs of investigation; (6) The relationship of the amount imposed... misconduct upon national defense, public health or safety, or public confidence in the management of...

MicroRNA-224 promotes the sensitivity of osteosarcoma cells to cisplatin by targeting Rac1.

Science.gov (United States)

Geng, Shuo; Gu, Lina; Ju, Fang; Zhang, Hepeng; Wang, Yiwen; Tang, Han; Bi, ZhengGang; Yang, Chenglin

2016-09-01

Osteosarcoma is the most common primary bone tumour in children and adolescents. Accumulating evidence has shown that microRNAs (miRNAs) participate in the development of almost all types of cancer. Here, we investigated the role of miR-224 in the development and progression of osteosarcoma. We demonstrated that miR-224 was down-regulated in osteosarcoma cell lines and tissues. Lower miR-224 levels were correlated with shorter survivalin osteosarcoma patients. Furthermore, overexpression of miR-224 suppressed osteosarcoma cell proliferation, migration and invasion and contributed to the increased sensitivity of MG-63 cells to cisplatin. We identified Rac1 as a direct target gene of miR-224 in osteosarcoma. Rac1 expression was up-regulated in the osteosarcoma cell lines and tissues, and there was an inverse correlation between Rac1 and miR-224 expression in osteosarcoma tissues. Furthermore, rescuing Rac1 expression decreased the sensitivity of miR-224-overexpressing MG-63 cells to cisplatin. We also demonstrated that ectopic expression of Rac1 promoted the proliferation, migration and invasion of miR-224-overexpressing MG-63 cells. These data suggest that miR-224 plays a tumour suppressor role in the development of osteosarcoma and is related to the sensitivity of osteosarcoma to cisplatin. © 2016 The Authors. Journal of Cellular and Molecular Medicine published by John Wiley & Sons Ltd and Foundation for Cellular and Molecular Medicine.

Radium-224, 226 and 228 activity in Brazil nuts

International Nuclear Information System (INIS)

Andrello, Avacir Casanova; Appoloni, Carlos Roberto; Martins, Maristela; Pacheco, Ariane Mendonca

2010-01-01

Full text: Recently, Brazil nuts have received a special attention because they contain large quantities of omega 6, antioxidant fat and selenium. Omega 6 and antioxidant fat prevent body cells inflammation and selenium combats cellular aging, guaranteeing a long and healthy life. One cashew per day is sufficient to assure the minimum amount of selenium necessary to the body. The aim of this work was to study radium (224, 226 and 228) concentration in Brazil nuts of the Amazon region. Thirty samples of different size (10 small, 10 medium and 10 large) exportation-type Brazil nuts, peeled and dehydrated, from the 2009 harvest, were analysed. Each sample, with 1.8 kg mass, was milled and then incinerated, resulting in 48 grams of ashes, that were placed in a 300 ml cylindrical recipient for gamma-ray spectrometry. Ra-224, Ra-226 and Ra-228 activities were determined using the gamma-rays of 234 keV following Pb-214 decay, 352 keV and 609 keV from Pb-212 and Bi-212, and the 911 keV from Ac-228, respectively. The incinerated samples average activities were 1100 Bq/kg for Ra-224, 4500 Bq/kg for Ra-226 and 3500 Bq/kg for Ra-228, corresponding to activities of 29.3 Bq/kg for Ra-224, 120 Bq/kg for Ra-226 and 93.9 Bq/kg for Ra-228 in raw Brazil nuts. (author)

Myeloid leukaemia/osteosarcoma ratio in CBA/H mice given radium 224

International Nuclear Information System (INIS)

Humphreys, E.R.; Stones, V.A.

1989-01-01

Four groups of 400 12-week-old CBA/H mice were injected intraperitoneally with mean amounts of 69, 139, 280 and 550 Bq/g -1 radium 224. A further group of 400 mice were injected intraperitoneally with diluting solution only. The mice were allowed unrestricted access to food and water until they died or were killed. To date (September 1988) about 40% of the mice are dead, and 28 cases of myeloid leukaemia and four cases of osteosarcoma have been diagnosed in the animals given radium 224. The relationship between the yield of myeloid leukaemia and the amount of radium 224 injected was found to be curvilinear. The determined value of the myeloid leukaemia:osteosarcoma ratio is discussed. (author)

78 FR 43963 - Twenty-Third Meeting: RTCA Special Committee 224, Airport Security Access Control Systems

Science.gov (United States)

2013-07-22

... Committee 224, Airport Security Access Control Systems AGENCY: Federal Aviation Administration (FAA), U.S. Department of Transportation (DOT). ACTION: Meeting Notice of RTCA Special Committee 224, Airport Security... meeting of the RTCA Special Committee 224, Airport Security Access Control Systems. DATES: The meeting...

30 CFR 285.224 - What happens if MMS accepts my bid?

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What happens if MMS accepts my bid? 285.224... Renewable Energy Leases Competitive Lease Award Process § 285.224 What happens if MMS accepts my bid? If we... withdraw an OCS area in which we have held a lease sale before you and MMS execute the lease in that area...

Model for the induction of bone cancer by 224Ra

International Nuclear Information System (INIS)

Groer, P.G.; Marshall, J.H.

1976-01-01

A mathematical model for the transformation of normal endosteal cells into malignant tumor cells by α irradiation is applied to 224 Ra. The model postulates that a normal endosteal cell near the bone surface is transformed into a malignant cell by three consecutive events. The first two events are the initiation events. The probability of their occurrence is proportional to the absorbed endosteal dose and they generate dormant tumor cells. These dormant tumor cells are promoted by the third event, the promotion event. The probability of this last event is proportional to the rate of bone remodeling but independent of the radiation dose. In competition with these transforming events is the killing of any endosteal cell by α irradiation. Killing is balanced by replacement of killed endosteal cells by normal stem cells. This model provides the following interesting predictions for the human 224 Ra cases: after the decay of 224 Ra the tumor rate decreases exponentially at a rate proportional to the bone turnover rate; for exposure to the same dose the model predicts an increased number of tumors for protracted exposure (i.e., exposure at a lower dose rate). Implications of this model for the therapy of ankylosing spondylitis are discussed. Statistical procedures are suggested for comparison of this theoretical model with the existing data on the induction of osteosarcomas by 224 Ra in man

Prognostic Value of microRNA-224 in Various Cancers: A Meta-analysis.

Science.gov (United States)

Zhang, Yue; Guo, Cong-Cong; Guan, Dong-Hui; Yang, Chuan-Hua; Jiang, Yue-Hua

2017-07-01

During previous studies, microRNA-224 (miR-224) was frequently investigated and discovered to be of vital significance to prognosis of patients with various cancers. However, its accurate prognostic value has not been estimated worldwide. Herein, we performed meta-analysis to assess its potential predictive value in a variety of human tumors. Qualified researches were identified up to March 1, 2017 through performing online searches in PubMed, EMBASE, Web of Science and Cochrane Database of Systematic Reviews. Overall survival (OS), disease-free survival (DFS) or progression-free survival (PFS) as a prognosis for various cancers were extracted and calculated, if available. Pooled hazard ratios (HR) and 95% confidence intervals (CI) were calculated using Stata version 13.0 (StataCorp, College Station, Texas, USA). 22 eligible studies with 3000 patients were ultimately brought into the current meta-analysis. It suggested that high miR-224 expression was significantly associated with poor OS in tissue (HR = 1.43, 95% CI = 1.00-2.03). During multivariate analysis, high miR-224 expression was more significantly associated with OS in tissue (HR = 2.81, 95% CI = 1.91-4.13). Likewise, there were significant associations between tissue miR-224 expression and colorectal cancer (CRC), diffuse large B-cell lymphoma (DLBCL) and gastric cancer (GC) patients (p present researches are concerned, tissue miR-224 has a significantly prognostic value in various cancers, especially in CRC, DLBCL and GC. Due to the complicated pathogenesis of cancers, more large-scale and standard researches are requisite. Copyright © 2017 IMSS. Published by Elsevier Inc. All rights reserved.

Incidence of tumours of the skeleton in 224Ra-treated ankylosing spondylitis patients

International Nuclear Information System (INIS)

Wick, R.R.; Goessner, W.

1983-01-01

We are following 1426 ankylosing spondylitis (a.sp.) patients treated with 224 Ra and 1556 control patients with a.sp. not treated with any form of ionizing radiation. The average follow-up time of the exposure group is 16 years and the average α-dose to the skeleton is 65 rad, resulting from intravenous injection of 4.8μCi/kg 224 Ra on average within a medium injection span of 12 weeks. Injections normally have been performed once a week, and in some cases also half-weekly with a correspondingly shorter injection span. Since 1970 three cases of malignant tumours in the skeleton have been observed in the exposure group in patients with skeletal α-doses below 90 rad compared with 0.6 expected. (No bone tumour has occurred in the control group.) Two of the three cases observed were tumours of the bone marrow. The incidence of leukaemias in both exposure and control groups is discussed with respect to phenylbutazone treatment and α-radiation from 224 Ra. An effect of 224 Ra on the bone marrow not yet detected in the Spiess series of patients treated with higher amounts of 224 Ra cannot be excluded. (author)

47 CFR 25.224 - Protection of receive-only earth stations in the 17/24 GHz BSS.

Science.gov (United States)

2010-10-01

... 47 Telecommunication 2 2010-10-01 2010-10-01 false Protection of receive-only earth stations in the 17/24 GHz BSS. 25.224 Section 25.224 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Technical Standards § 25.224 Protection of...

Risk and effect of radium-224 therapy of ankylosing spondylitis

International Nuclear Information System (INIS)

Schmitt, E.; Wick, R.R.

1983-01-01

A total of 1426 patients suffering from Bechterew's disease who had formerly been treated with 224-Ra (up to 30 years ago), were included in an epidemiological study. The mean skeletal alpha dose amounted to 65 rad, the mean observation period was 16 years. Among the 363 mortalities recorded 3 were due to tumours in the skeletal region; of these, 2 were observed in the haemopoietic system. The types of the tumours detected deserve to be given particular attention: whereas osteosarcomas were almost the only tumours observed in a group of patients studied by Spiess, who had been treated with higher doses, no such tumour was revealed in the study population investigated here. Among the 3 tumours seen in this study group 2 were detected in the haemopoietic system as compared to 1 out of 55 tumours observed by Spiess. In contrast to this finding there was a remarkably high incidence of tumours of haemopoietic organs among the victims of Hiroshima. These results show that the relative benefits and disadvantages of the drug 224-Ra once again must be carefully considered. None of the chemical agents used in the treatment of ankylosing spondylitis is free from side-effects. A comparison of the latter with the risks involved in the use of 224-Ra leads to the conclusion that - according to the experience gained so far - 224-Ra is very useful in the treatment of this disease, if there is an absolute indication. (orig./MG) [de

Long-term clinical investigation of patients with ankylosing spondylitis treated with /sup 224/Ra

Energy Technology Data Exchange (ETDEWEB)

Schmitt, E [Universitatsklinik Friedrichsheim, Frankfurt, West Germany; Ruckbeil, C; Wick, R R

1983-01-01

Between 1952 and 1980 about 250 patients with ankylosing spondylitis were treated with /sup 224/Ra at the Orthopaedic University Hospital of Frankfurt/M. In 1970, 119 of them were examined and X-rayed as was another group of 40 patients in 1980. The results of those examined could be compared with a group of 40 patients treated without /sup 224/Ra. Patients with /sup 224/Ra demonstrated a long-lasting period of subjective improvement after the treatment, with reduced consumption of antirheumatoid and analgesic drugs, on the average. Blood examinations show inflammatory activities. Nevertheless, the ankylosing spondylitis proceeded. In the final stages of the disease, neither the clinical aspects nor the X-rays showed any specific changes. We observed no case of malignant bone tumor. Of the 169 examined patients, 22 had a total of 32 children after the treatment with /sup 224/Ra. Among these was a set of twins with cerebral palsy and diabetes insipidus renalis. In conclusion, /sup 224/Ra in ankylosing spondylitis is a recommended treatment without higher risk compared to the common therapy with drugs.

224Ra and 226Ra experimentally induced dental changes in rats

International Nuclear Information System (INIS)

Reichart, P.A.; Althoff, J.; Eckhardt, W.; Rippel, W.

1979-01-01

Sprague-Dawley rats received intragastrically a single dose of 226 Ra or 224 Ra once weekly for 21 weeks. During this period the animals of both groups were thus exposed to comparable doses. After 12 weeks, a shortening of the maxillary incisors was observed, and this progressed during the course of the 55-week experiment. Radiologically, a loss of pulpal transparency and an apical irregular opacity in the maxillary incisors were demonstrable. Histologically, dysplastic changes of the maxillary incisors and multiple resorptions at the cemento-enamel junction of the molars were seen. The observed alterations were more pronounced in the 226 Ra group than in the 224 Ra treated group. The experimentally induced resorptions were comparable to those observed in patients who had incorporated 224 Ra or 226 Ra. Clinical, radiological, histological, γspecrometrical, and autoradiographical findings, as well as dose-estimations, are described. (author)

A model for the induction of bone cancer by 224Ra

International Nuclear Information System (INIS)

Groer, P.G.; Marshall, J.H.

1976-01-01

A mathematical model for the transformation of normal endosteal cells into malignant tumor cells by α-irradiation is applied to 224 Ra. The model postulates that a normal endosteal cell near the bone surface is transformed into a malignant cell by three consecutive events. The first two events are the initiation events. The probability of their occurrence is proportional to the absorbed endosteal dose and they generate dormant tumor cells. These dormant tumor cells are promoted by the third event, the promotion event. The probability of this last event is proportional to the rate of bone remodeling but independent of the radiation dose. In competition with these transformig events is the killing of any endosteal cell by α-irradiation. Killing is balanced by replacement of killed endosteal cells by normal stem cells. This model provides the following interesting predictions for the human 224 Ra cases. 1) After the decay of 224 Ra the tumor rate decreases exponentially at a rate proportional to the bone turnover rate. 2) For exposure to the same dose the model predicts an increased number of tumors for protacted exposure (i.e. exposure at a lower dose rate). Implications of this model for the therapy of ankylosing spondylitis are discussed. Statistical procedures are suggested for comparison of this theoretical model with the existing data on the induction of osteosarcomas by 224 Ra in man. (orig.) [de

25 CFR 1000.224 - How can a Tribe/Consortium expedite the review of a regulation waiver request?

Science.gov (United States)

2010-04-01

... regulation waiver request? 1000.224 Section 1000.224 Indians OFFICE OF THE ASSISTANT SECRETARY, INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ANNUAL FUNDING AGREEMENTS UNDER THE TRIBAL SELF-GOVERNMENT ACT AMENDMENTS TO THE INDIAN SELF-DETERMINATION AND EDUCATION ACT Waiver of Regulations § 1000.224 How can a...

224-T Transuranic Waste Storage and Assay Facility dangerous waste permit application

International Nuclear Information System (INIS)

1992-01-01

Westinghouse Hanford Company is a major contractor to the US Department of Energy Richland Field Office and serves as cooperator of the 224-T Transuranic Waste Storage and Assay Facility, the storage unit addressed in this permit application. At the time of submission of this portion of the Hanford Facility. Dangerous Waste Permit Application covering the 224-T Transuranic Waste Storage and Assay Facility, many issues identified in comments to the draft Hanford Facility Dangerous Waste Permit remain unresolved. This permit application reflects the positions taken by the US Department of Energy, Company on the draft Hanford Facility Dangerous Waste Permit and may not be read to conflict with those comments. The 224-T Transuranic Waste Storage and Assay Facility Dangerous Waste Permit Application (Revision 0) consists of both a Part A and Part B permit application. An explanation of the Part A revisions associated with this unit, including the Part A revision currently in effect, is provided at the beginning of the Part A section. The Part B consists of 15 chapters addressing the organization and content of the Part B Checklist prepared by the Washington State Department of Ecology (Ecology 1987). The 224-T Transuranic Waste Storage and Assay Facility Dangerous Waste Permit Application contains information current as of March 1, 1992

Skeletal 212Pb retention following 224Ra injection: extrapolation of animal data to adult humans

International Nuclear Information System (INIS)

Schlenker, R.A.

1988-01-01

Two methods of interspecies extrapolation, one based on a correlation of skeletal 212 Pb/ 224 Ra with body weight, the other based on the mechanistic relationship between skeletal 212 Pb/ 224 Ra and reciprocal bone surface-to-volume ratio, lead to the conclusion that the retention of 212 Pb in the adult human skeleton is approximately complete a few days after injection. The correlation-based method gives most probable values for 212 Pb/ 224 Ra of 1.0 and 1.1 at 2 d and 7 d after injection, compared with values of 1.05 and 1.27 expected at these same times if the retention of 212 Pb were complete from the time of injection and if no 212 Pb were in the injection solution. The range of values corresponding to one geometric standard error on either side of the most probable value is 0.87 to 1.21 at 2 d post-injection. With the method based on the reciprocal bone surface-to-volume ratio, the best estimate of 212 Pb/ 224 Ra at 2 d after injection is 0.88, equal to the value observed in young adult beagles. An alternative interpretation of the results of this latter method leads to the conclusion that retention is complete, with 212 Pb/ 224 Ra equal to 1.0 for a 212 Pb-free injection solution and 1.1 for a solution containing 212 Pb in secular equilibrium with 224 Ra. This work, which uses 224 Ra daughter product retention data from mice, rats and dogs following 224Ra injection, provides a scientific foundation for retention assumptions made in the calculation of mean skeletal dose for adult humans. There now appear to be few uncertainties in these latter dose values, stemming from inaccurate retention assumptions; but substantial uncertainties remain in the mean skeletal dose values for juveniles and in the endosteal tissue doses regardless of age

Antipneumococcal activity of DW-224a, a new quinolone, compared to those of eight other agents.

Science.gov (United States)

Kosowska-Shick, Klaudia; Credito, Kim; Pankuch, Glenn A; Lin, Gengrong; Bozdogan, Bülent; McGhee, Pamela; Dewasse, Bonifacio; Choi, Dong-Rack; Ryu, Jei Man; Appelbaum, Peter C

2006-06-01

DW-224a is a new broad-spectrum quinolone with excellent antipneumococcal activity. Agar dilution MIC was used to test the activity of DW-224a compared to those of penicillin, ciprofloxacin, levofloxacin, gatifloxacin, moxifloxacin, gemifloxacin, amoxicillin-clavulanate, cefuroxime, and azithromycin against 353 quinolone-susceptible pneumococci. The MICs of 29 quinolone-resistant pneumococci with defined quinolone resistance mechanisms against seven quinolones and an efflux mechanism were also tested. DW-224a was the most potent quinolone against quinolone-susceptible pneumococci (MIC(50), 0.016 microg/ml; MIC(90), 0.03 microg/ml), followed by gemifloxacin, moxifloxacin, gatifloxacin, levofloxacin, and ciprofloxacin. beta-Lactam MICs rose with those of penicillin G, and azithromycin resistance was seen mainly in strains with raised penicillin G MICs. Against the 29 quinolone-resistant strains, DW-224a had the lowest MICs (0.06 to 1 microg/ml) compared to those of gemifloxacin, clinafloxacin, moxifloxacin, gatifloxacin, levofloxacin, and ciprofloxacin. DW-224a at 2x MIC was bactericidal after 24 h against eight of nine strains tested. Other quinolones gave similar kill kinetics relative to higher MICs. Serial passages of nine strains in the presence of sub-MIC concentrations of DW-224a, moxifloxacin, levofloxacin, ciprofloxacin, gatifloxacin, gemifloxacin, amoxicillin-clavulanate, cefuroxime, and azithromycin were performed. DW-224a yielded resistant clones similar to moxifloxacin and gemifloxacin but also yielded lower MICs. Azithromycin selected resistant clones in three of the five parents tested. Amoxicillin-clavulanate and cefuroxime did not yield resistant clones after 50 days.

Sun et al., Afr J Tradit Complement Altern Med. (2011) 8(3):224-229

African Journals Online (AJOL)

AJTCAM

Sun et al., Afr J Tradit Complement Altern Med. (2011) 8(3):224-229. 224. EFFECTS OF CHINESE MATERIA MEDICA-FUBAO DANGGUI JIAO ON EXPERIMENTAL. ENDOMETRIOSIS. Xing Sun*, Master; Lijue Chen, Master; Fanbo Zeng1,. Department of Pharmacy, Tongji Medical College, Huazhong. University of Science ...

Indication for the Ra-224 therapy in ankylosing spondylitis (Morbus Struempell-Bechterew-Marie)

International Nuclear Information System (INIS)

Koch, W.

1976-01-01

For a better understanding of the effects of corpuscular α- and β-rays of 224 Ra on growing and matured bone tissue the results of animal experiments are briefly introduced and compared with clinical observations made in humans. The therapeutic effect of 224 Ra-injection on Bechterew's disease is proved, but indication and eventual contra-indications should be observed with attention. (MG) [de

Age-related and 224Ra-induced abnormalities in the teeth of male mice

International Nuclear Information System (INIS)

Humphreys, E.R.; Stones, V.A.

1985-01-01

A high incidence of incisor abnormalities was found in aged control and aged 224 Ra-treated male CBA mice. Visual examination of the abnormalities in both controls and treated mice revealed extreme shortening of the upper incisors and hypoplastic, grooved or undulating enamel. The administration of 865 or 1730 nCi of 224 Ra hastened the onset of incisor abnormalities although no specific feature was attributable solely to radium toxicity. Radiography and histology revealed corrugated incisors, obliteration of the pulp cavity, extension and disorganized growth of incisors basally, secondary incisors, open pulp and fractures within the alveoli. There was a statistically-significant reduction in the number of molars present in animals given 432, 865 or 1730 nCi 224 Ra. (author)

224Ra: Risk to bone and haematopoietic tissue in ankylosing spondylitis patients

International Nuclear Information System (INIS)

Wick, R.R.; Goessner, W.; Chmelevsky, D.

1986-01-01

This follow-up study includes 1501 adult patients, who received repeated intraveneous injections of 224 Ra as a treatment for ankylosing spondylitis (a.sp), and a control group of 1557 a.sp. patients not treated with radioactive drugs or X-rays. The average total injected activity for the patients of the exposure group was 4.8 μCi of 224 Ra per kg body weight; the resulting average skeletal dose of α-rays has been 0.65 Gy. The mean duration of the 224 Ra treatment was 12 weeks with the mode at 10 weeks. At present, the mean follow-up time in the group of exposed patients is 16 years, and three cases of malignant skeletal tumours have been observed in patients with α-doses to the skeleton below 0.9 Gy (the lowest skeletal dose found to be associated with a bone tumour in the high dose group followed by Spiess and Mays). Based on general population statistics the expected number of bone tumours (ICD 170) was 0.4-0.7 . A recent risk estimate from data of Spiess and Mays suggests 5.8 radiation induced bone tumours for the present follow-up time. It is, furthermore, notable that 2 of the 3 observed skeletal tumours are tumours of the bone marrow; in the high dose group of Spiess and Mays there has been only 1 bone marrow tumour among 55 bone tumours. No malignant bone tumours have occurred, until now, in the control group. In the 224 Ra-group and the control group there have been 6 and 5 leukaemias, respectively,. Among the 6 leukaemias in the 224 R group 3 were chronic myeloid leukaemias while among the 5 leukaemias in the control group there was no chronic myeloid leukaemia. (orig.)

Rapid determination of radium-224/226 in seawater sample by alpha spectrometry.

Science.gov (United States)

Song, Lijuan; Yang, Yonggang; Luo, Maoyi; Ma, Yan; Dai, Xiongxin

2017-05-01

A new radiochemical separation method has been developed for rapid determination of alpha-emitting radium isotopes in seawater samples. This method can be applied for the measurement of 226 Ra in seawater samples when 224 Ra is used as tracer for chemical recovery correction. Likewise, 226 Ra can also be added as tracer for the determination of 224 Ra in seawater sample. In the method, radium is first pre-concentrated with hydrous titanium oxide (HTiO) and is purified by combined anion/cation exchange column chromatographic separation. The radium in the eluate is then co-precipitated with HTiO, dissolved in 9 M H 2 SO 4 , and followed through a BaSO 4 micro-precipitation step to prepare a thin-layer counting source to determine the activities of 224 Ra/ 226 Ra by alpha spectrometry. Replicate spike and blank samples were measured to evaluate the performance of the procedure. The minimum detectable activity concentration was determined to be 0.5 mBq·L -1 for 226 Ra and 0.4 mBq·L -1 for 224 Ra in 1 L of seawater sample with a counting time of 48 h. The method is a promising candidate for rapid measurement for alpha-emitting Ra isotopes in a large population of environment water samples. Copyright © 2017 Elsevier Ltd. All rights reserved.

50 CFR 224.104 - Special requirements for fishing activities to protect endangered sea turtles.

Science.gov (United States)

2010-10-01

... activities to protect endangered sea turtles. 224.104 Section 224.104 Wildlife and Fisheries NATIONAL MARINE... endangered sea turtles. (a) Shrimp fishermen in the southeastern United States and the Gulf of Mexico who comply with rules for threatened sea turtles specified in § 223.206 of this chapter will not be subject...

224Ra distribution in surface and deep water of Long Island Sound: sources and horizontal transport rates

International Nuclear Information System (INIS)

Torgersen, T.; O'Donnell, J.; DeAngelo, E.; Turekian, K.K.; Turekian, V.C.; Tanaka, N.

1997-01-01

Measurements of surface water and deep water 224 Ra(half-life 3.64 days) distributions in Long Island Sound (LIS) were conducted in July 1991. Because the pycnocline structure of LIS had been in place for about 50 days in July (long compared to the half-life of 224 Ra) in the surface water and the deep water operate as separate systems. In the surface water, the fine-grain sediments of nearshore and saltmarsh environments provide a strong source of 224 Ra, which is horizontally mixed away from the short to central LIS. A one-dimensional model of 224 Ra distribution suggests a cross-LIS horizontal eddy dispersivity of 5-50 m 2 s -1 . In the deep water, the mid-LIS sediment flux of 224 Ra is enhanced by ∼ 2x relative to the periphery, and the horizontal eddy flux is from central LIS to the periphery. A second one-dimensional model suggests a cross-LIS horizontal eddy dispersivity below the thermocline of 5-50 m 2 -1 . 224 Ra fluxes into the deep water of the central LIS are likely enhanced by (1) inhomogeneous sediment or (2) a reduced scavenging of 224 Ra in the sediments of central LIS brought about by low oxygen conditions (hypoxia) and the loss of the MnO 2 scavenging layer in the sediments. These rates of horizontal eddy dispersivity are significantly less than the estimate of 100-650 m 2 s -1 (Riley, 1967) but are consistent with the transport necessary to explain the dynamics of oxygen depletion in summer LIS. These results demonstrate the use of 224 Ra for quantifying the parameters needed to describe estuarine mixing and transport. (Author)

Estuarine geochemistry of 224Ra, 226Ra, and 222Rn

International Nuclear Information System (INIS)

Elsinger, R.J.

1982-01-01

Desorption from river borne sediments is the most likely source of the excess 226 Ra. Laboratory mixing experiments on Pee Dee River sediments show an increase in 226 Ra desorption with increasing salinities with maximum desorption occurring at or above 20 0 /oo salinity. Desorption and diffusion are the sources for 226 Ra in the estuarine systems. In Winyah Bay the 228 Ra/ 226 Ra activity ratio does not change significantly with salinity, averaging around 1.4, indicating desorption as the major source of 228 Ra. In the Yangtze River the 228 Ra/ 226 Ra activity ratio is constant (approx.1.90) until increasing linearly above 16 0 /oo. A diffusive flux from regeneration by 232 Th decay in shelf sediments is the source of the increase. In Delaware Bay 228 Ra increases faster than 226 Ra in the less than or equal to22 0 /oo water, indicating a source in addition to desorption. The increase can be balanced by a 0.33 dpm/cm 2 -year flux over the upper part of the Bay where fine grained sediments predominate. 224 Ra behavior is controlled by its 3.64 day half-life. In Winyah Bay a flux of around 0.4 dpm/cm 2 -day is necessary to support the standing crop of non-desorbed 224 Ra in the water column. In Delaware Bay the nearly constant 224 Ra in concentration over the 2.5 0 /oo to 12 0 /oo salinity range are maintained by regeneration from 228 Th in the turbidity maximum zones and diffusion from bottom sediments. Water leaving on ebb tide from a salt marsh on Delaware Bay had increases in all three radium isotopes ( 224 Ra > 228 Ra > 226 Ra) compared to water coming in on the flood tide. Excess 222 Rn concentrations in a fresh water section of the Pee Dee River show a decreasing downstream gradient. Using these gradients to determine evasion rates, stagnant film thicknesses range from 21μ to 62μ

Functionalized NaA nanozeolites labeled with 224,225Ra for targeted alpha therapy.

Science.gov (United States)

Piotrowska, Agata; Leszczuk, Edyta; Bruchertseifer, Frank; Morgenstern, Alfred; Bilewicz, Aleksander

2013-01-01

The 223 Ra, 224 Ra, and 225 Ra radioisotopes exhibit very attractive nuclear properties for application in radionuclide therapy. Unfortunately the lack of appropriate bifunctional ligand for radium is the reason why these radionuclides have not found application in receptor-targeted therapy. In the present work, the potential usefulness of the NaA nanozeolite as a carrier for radium radionuclides has been studied. 224 Ra and 225 Ra, α-particle emitting radionuclides, have been absorbed in the nanometer-sized NaA zeolite (30-70 nm) through simple ion exchange. 224,225 Ra-nanozeolites exhibited very high stability in solutions containing physiological salt, EDTA, amino acids, and human serum. To make NaA nanozeolite particles dispersed in water their surface was modified with a silane coupling agent containing poly(ethylene glycol) molecules. This functionalization approach let us covalently attach a biomolecule to the NaA nanozeolite surface.

EFSA Panel on Food Contact Materials , Enzymes, Flavourings and Processing Aids (CEF); Scientific Opinion on Flavouring Group Evaluation 224 (FGE.224): Consideration of genotoxic potential for two α,β - unsaturated thiophenes from subgroup 5.2 of FGE.19 by EFSA

DEFF Research Database (Denmark)

Beltoft, Vibe Meister; Binderup, Mona-Lise; Lund, Pia

The Panel on Food Contact Materials, Enzymes, Flavourings and Processing Aids of the European Food Safety Authority was requested to evaluate the genotoxic potential of two flavouring substances from subgroup 5.2 of FGE.19 in the Flavouring Group Evaluation 224 (FGE.224). The Flavour Industry has...... provided additional genotoxicity studies for one of the two substances in FGE.224, namely 5-methyl-2-thiophenecarbaldehyde [FL-no: 15.004]. The data requested by EFSA for the other substance, 3-acetyl-2,5-dimethylthiophene [FL-no: 15.024] of FGE.224 will be provided subsequently according to the Flavour...... are still pending and no conclusion could be drawn in the present FGE. © European Food Safety Authority, 2013...

Collective excitations in the transitional nuclei /sup 224,226,228,230 /Ra

CERN Document Server

Kurcewicz, W; Kaffrell, N; Nyman, G H; Ruchowska, E

1981-01-01

The gamma -rays following the beta -decay of /sup 224,226,228,230/Fr have been investigated by means of gamma -ray singles (including multispectrum analysis) and gamma gamma coincidence measurements using Ge(Li) spectrometers. The study of the excited levels in /sup 224,226,228,230/Ra is focused on the properties of collective states. The analysis of the results leads one to the conclusion that a ground- state octupole deformation is the most likely explanation for the special features of the collective excitations in Ra and some neighbouring nuclei in the N136 region. (15 refs).

The study of structure in 224–234 thorium nuclei within the framework IBM

Directory of Open Access Journals (Sweden)

Lee Su Youn

2017-01-01

Full Text Available An investigation has been made of the behaviour of nuclear structure as a function of an increase in neutron number from 224Th to 234Th. Thorium of mass number 234 is a typical rotor nucleus that can be explained by the SU(3 limit of the interacting boson model(IBM in the algebraic nuclear model. Furthermore, 224−232Th lie on the path of the symmetry-breaking phase transition. Moreover, the nuclear structure of 224Th can be explained using X(5 symmetry. However, as 226−230Th nuclei are not fully symmetrical nuclei, they can be represented by adding a perturbed term to express symmetry breaking. Through the following three calculation steps, we identified the tendency of change in nuclear structure. Firstly, the structure of 232Th is described using the matrix elements of the Hamiltonian and the electric quadrupole operator between basis states of the SU(3 limit in IBM. Secondly, the low-lying energy levels and E2 transition ratios corresponding to the observable physical values are calculated by adding a perturbed term with the first-order Casimir operator of the U(5 limit to the SU(3 Hamiltonian in IBM. We compared the results with experimental data of 224−234Th. Lastly, the potential of the Bohr Hamiltonian is represented by a harmonic oscillator, as a result of which the structure of 224−234Th could be expressed in closed form by an approximate separation of variables. The results of these theoretical predictions clarify nuclear structure changes in Thorium nuclei over mass numbers of practical significance.

Fine structures in 14C emission of 223Ra and 224Ra

International Nuclear Information System (INIS)

Hourani, E.; Rosier, L.; Berrier-Ronsin, G.; Elayi, A.; Mueller, A.C.; Rappenecker, G.; Rotbard, G.; Renou, G.; Liebe, A.; Stab, L.

1991-01-01

The measurement of the energy spectrum of 14 C nuclei emitted in the spontaneous radioactivity from 223 Ra and 224 Ra has been carried out, using thin and intense sources (480 MBq for 223 Ra and 3550 MBq for 224 Ra). The sources were obtained by implanting mass-separated beams from ISOLDE (CERN) into Al and vitreous C catchers. The measurement was performed with the supraconducting solenoidal spectrometer SOLENO installed at Orsay. The discovery, of a fine structure in the energy spectrum of 14 C emission from 223 Ra, which is analogous to the one known for α emission, is confirmed. Only 13% of the branching ratio in 14 C decay leads to the ground state of the residual nucleus, while 8l% to the first excited state. For 14 C emission of 224 Ra, a lower limit of 2 for the hindrance factor has been measured for the transition to the first excited state in the residual nucleus. Also, a precise identification in Z with a E·ΔE telescope has been performed for the radiation from the 223 Ra source. (author) 22 refs., 11 figs., 1 tab

[2-(2,4-dimethylphenylthio)phenyl] aniline and its amide derivatives ...

Indian Academy of Sciences (India)

YOGESH PATIL

2018-02-15

Feb 15, 2018 ... These derivatives could be considered as a precursor structure for further design of antituberculosis agent. Keywords. [2-(2,4-dimethylphenylthio)phenyl] aniline; antituberculosis activity; cytotoxicity. 1. Introduction. Tuberculosis (TB) is a contagious disease caused by the. Mycobacterium tuberculosis (MTB).

Long-term investigation of the risk of malignant diseases following intravenous radium-224 treatment for ankylosing spondylitis; Langzeituntersuchung zum Risiko maligner Erkrankungen nach intravenoeser Behandlung des Morbus Bechterew mit Radium-224

Energy Technology Data Exchange (ETDEWEB)

Schulte, Tobias L. [Klinik und Poliklinik fuer Allgemeine Orthopaedie und Tumororthopaedie, Universitaetsklinikum Muenster (Germany); Nekolla, Elke A. [Bundesamt fuer Strahlenschutz (BfS), Neuherberg (Germany); Wick, Roland R. [Inst. fuer Strahlenbiologie, Helmholtz-Zentrum Muenchen, Deutsches Forschungszentrum fuer Gesundheit und Umwelt, Neuherberg (Germany)

2009-09-15

Background and purpose: in German-speaking countries, the intravenous treatment of ankylosing spondylitis (AS) with radium-224 ({sup 224}Ra) was common between the late 1940s and 2005. In this long-term investigation, the risk of malignant diseases following intravenous {sup 224}Ra treatment for AS was assessed. Patients and methods: in a prospective long-term study, 1,471 patients with AS who were treated with {sup 224}Ra between 1948 and 1975 have been followed together with a control group of 1,324 AS patients treated neither with radioactive drugs nor with X-rays. Standardized questionnaires to evaluate the patients' health status were used. Observed numbers of malignant diseases were compared with those of the control group as well as with expected numbers for a normal population. Results: After 26 years of follow-up, causes of death have been certified for 1,006 patients of the exposure group (control group: 1,072 patients). Significantly increased rates of myeloid leukemia (12 cases observed vs. 2.9 expected; p < 0.001), kidney cancer (18 vs. 9.1; p < 0.01), thyroid cancer (4 vs. 1.2; p = 0.03) and borderline significantly increased rates of cancer of female genital organs (10 vs. 5.6; p = 0.06) were found in the exposure group in contrast to no significant increases of these diseases in the control group. Rates of pulmonary and gastrointestinal malignancies were not increased. Lymphatic leukemia (exposure group: 8 vs. 2.7; p < 0.01; control group: 7 vs. 3; p = 0.03) was significantly elevated due to a high rate of chronic lymphatic leukemia in both, the exposure as well as the control group. Conclusion: treatment of AS with {sup 224}Ra led to increased incidences of myeloid leukemia and malignancies of kidneys, thyroid and female genital organs. Although this kind of therapy is now abandoned, there is a need for close follow-up of patients who received it. (orig.)

Observation of unexpectedly small E1 moments in sup 224 Ra

Energy Technology Data Exchange (ETDEWEB)

Poynter, R.J.; Butler, P.A.; Clarkson, N.; Hoare, T.H.; Jones, G.D.; White, C.A. (Liverpool Univ. (UK). Oliver Lodge Lab.); Cline, D. (Rochester Univ., NY (USA). Nuclear Structure Research Lab.); Connell, K.A.; Cunningham, R.A.; Simpson, J. (Science and Engineering Research Council, Daresbury (UK). Daresbury Lab.); Goettig, L. (Warsaw Univ. (Poland). Inst. Fizyki Doswiadczalnej); Hughes, J.R.; Jarvis, N.S.; Mullins, S.M.; Wadsworth, R.; Watson, D.L. (York Univ. (UK). Dept. of Physics); Juutinen, S. (Jyvaeskylae Univ. (Finland). Dept. of Physics); Pass, C.N. (Oxford Univ. (UK). Dept. of Nuclear Physics)

1989-12-14

The {alpha}-decay of {sup 228}Th and the reaction {sup 226}Ra({sup 58}Ni, {sup 60}Ni){sup 224}Ra have been employed to populate states in {sup 224}Ra up to I{sup {pi}}=12{sup +}. Values of the intrinsic electric dipole moment vertical strokeQ{sub 1}vertical stroke have been deduced from the observed B(E1)/B(E2) branching ratios. These values are < or approx.0.1 e fm for spins up to I{sup {pi}}=9{sup -}, and are thus smaller than those in {sup 218,220}Ra or {sup 226}Ra. The behaviour of Q{sub 1} suggests that shell effects are important in this mass region, although theoretical calculations which include these effects do not reproduce the observed pattern. (orig.).

Epidemiological studies of German patients injected with Ra-224

International Nuclear Information System (INIS)

Mays, C.W.; Spiess, H.

1983-01-01

The health of 898 patients who received repeated injections of short-lived 224 Ra after World War II, mainly for the treatment of tuberculosis and ankylosing spondylitis has been followed. As of 1980, 53 of these patients had developed bone sarcoma vs only 0.2 cases expected naturally. Two patients with bone sarcoma subsequently developed an additional bone sarcoma. No new bone sarcomas have been reported since the end of 1974. For the patients in each category, the tumor rate at every year after 224 Ra injection was calculated by dividing the yearly number of bone sarcomas by the number of patients whose follow-up extended to that year. This corrected for the effects of death and incomplete follow-up. The yearly tumor rates were then summed to obtain the cumulative tumor rate. Dividing by the average skeletal dose in rads yielded the cumulative risk. The cumulative tumor risk was about 200 bone sarcomas/10 6 person rad of average skeletal dose and, with the dosimetric assumptions used, was not statistically different for (a) juveniles vs adults, (b) males vs females, or (c) TB patients vs spondylitic patients

A new determination method of 226Ra, 224Ra, and 228Th in water

International Nuclear Information System (INIS)

Horiuchi, Kimiko; Murakami, Yukio.

1981-01-01

A new method for the determination of 226 Ra, 224 Ra and 228 Th in water samples is described. It consists of extraction of 222 Rn and 220 Rn into a scintillator-toluene solution in equilibrium with 226 Ra and 224 Ra and the application of integral counting techniques with a liquid scintillation counter. One liter water sample, weakly acidified with hydrochloric acid, is transferred to a glass bottle, and vigorously bubbled with a stream of nitrogen to expel any radon or thoron in the water sample. Twenty five ml of the scintillator-toluene solution is added to the bottle (time is recorded). The bottle is stoppered with a Teflon stopper and kept at an upside-down position for a given period of time (usually 4 -- 16 days) to allow radon and thoron in partial equilibrium with their parent nuclides. Then, the sample system is vigorously shaken for 2 m and the organic layer is gently transferred to a counting vial through a specially devised transferring tube which is connected to the bottle. The initial counting time is set at 4 h after the separation of organic layer. The measurements are repeated 3 times each immediately and after 106 h from the initial counting time. From these results, the integral counting rates of radon and thoron at the initial counting time are easily obtained. The activities of 226 Ra, 224 Ra and 228 Th in the water sample are calculated from these integral counting rates by the proposed formulas. Some data on the 226 Ra and 224 Ra contents of mineral springs are presented. The lowest detection limits for 226 Ra and 224 Ra were 1.10 x 10 -12 and 1.47 x 10 -9 Ci, respectively. The present method is rapid, easy and accurate and eliminates a time-consuming sealing of the sample in Curie bottle and tedious procedure to transfer the sample gas through a vacuum system to the detector. (author)

5 CFR 591.224 - How does OPM adjust price indexes between surveys?

Science.gov (United States)

2010-01-01

... REGULATIONS ALLOWANCES AND DIFFERENTIALS Cost-of-Living Allowance and Post Differential-Nonforeign Areas Cost-Of-Living Allowances § 591.224 How does OPM adjust price indexes between surveys? (a) OPM adjusts...

Intravenous injection of Ra-224 as a treatment in Morbus Paget

International Nuclear Information System (INIS)

Koch, W.

1976-01-01

Between 1956 and 1973, 21 patients with histologically verified Morbus Paget were treated at the author's hospital with low dosage 224 Ra. In none of these patients an immediate or late impairment of the hematogenic or parenchymal organs was observed. (MG) [de

Biological effects of 224Ra. Benefit and risk of therapeutic application

International Nuclear Information System (INIS)

Mueller, W.A.; Ebert, H.G.

1978-01-01

The Second Symposium on the Biological effects of 224 Ra, held at Neuherberg, was focused on two topical aspects of radiation protection. One aspect was the long-term effects of high-LET ionizing radiations on man and the quantitative data involved in risk assessment at low doses. The evaluation of epidemiological studies and experimental research was discussed in order to provide facts and figures contributing to an objective assessment of the radiation hazard from incorporated radionuclides. The other aspect was that of radiation protection in medicine. In the case of 224 Ra treatment of ankylosing spondylitis the questions of benefit and risk of this therapeutic use of ionizing radiations were discussed, the aim being to achieve the therapeutic effect while reducing radiation exposure - and therefore the hazard - to a minimum. The proceedings contain the complete texts of 23 papers as well as the final round table discussions

10 CFR 431.224 - Uniform test method for the measurement of energy consumption for traffic signal modules and...

Science.gov (United States)

2010-01-01

... 10 Energy 3 2010-01-01 2010-01-01 false Uniform test method for the measurement of energy consumption for traffic signal modules and pedestrian modules. 431.224 Section 431.224 Energy DEPARTMENT OF... measurement of energy consumption for traffic signal modules and pedestrian modules. (a) Scope. This section...

Late effects of radium-224 injected in children and adults survey and comment of a paediatrician

Energy Technology Data Exchange (ETDEWEB)

Spiess, H. [Poliklinik Muenchen (Germany)

2005-07-01

Radium-224 (Ra-224) was already used as medicament before world war I; but because of serious side effects soon abandoned. It was revived as a remedy for tuberculosis and ankylosing spondylitis after world war II by a country doctor called Troch, supported by the Insurance Company ''Braunschweiger Landesversicherungsanstalt'' and over enthusiastic press reports. The 'new' medicine called 'Peteosthor' was a mixture of Ra-224 with traces of the red dye cosine and platinsol. The propaganda in favour of this therapy was so strong, that the government of Lower Saxony asked the University of Goettingen and others to examine this new 'wonderdrug'. Dr. Troch demanded that it should be used only under his personal supervision. As youngest assistent at the university childrens hospital of the University Goettingen I was sent in 1948 to this hospital in Hildesheim to examine 'Peteosthor'. (orig.)

Iron status markers in 224 indigenous Greenlanders

DEFF Research Database (Denmark)

Milman, N; Byg, K E; Mulvad, G

2001-01-01

OBJECTIVE: To evaluate iron status in indigenous Greenlanders and its relationship to gender, age and intake of traditional Greenlandic foods. Methods: Serum ferritin, serum transferrin saturation and haemoglobin were evaluated in a population survey in 1993-1994 comprising 224 Greenlandic...... of living. Consumption of traditional foods was assessed by questionnaire. RESULTS: Intake of traditional foods was more prevalent among elderly than among young individuals and more frequent in Uummannaq than in Ilulissat and Nuuk. Ferritin levels were higher in men than in women (p....06; women, r(s)=0.73, ptraditional foods was correlated with ferritin in men (r(s)=0.29, p=0.01) and women (r(s)=0.40, p

Closure Report for Corrective Action Unit 224: Decon Pad and Septic Systems, Nevada Test Site, Nevada

International Nuclear Information System (INIS)

NSTec Environmental Restoration

2007-01-01

Corrective Action Unit (CAU) 224 is located in Areas 02, 03, 05, 06, 11, and 23 of the Nevada Test Site, which is situated approximately 65 miles northwest of Las Vegas, Nevada. CAU 224 is listed in the Federal Facility Agreement and Consent Order (FFACO) of 1996 as Decon Pad and Septic Systems and is comprised of the following nine Corrective Action Sites (CASs): CAS 02-04-01, Septic Tank (Buried); CAS 03-05-01, Leachfield; CAS 05-04-01, Septic Tanks (4)/Discharge Area; CAS 06-03-01, Sewage Lagoons (3); CAS 06-05-01, Leachfield; CAS 06-17-04, Decon Pad and Wastewater Catch; CAS 06-23-01, Decon Pad Discharge Piping; CAS 11-04-01, Sewage Lagoon; and CAS 23-05-02, Leachfield. The Nevada Division of Environmental Protection (NDEP)-approved corrective action alternative for CASs 02-04-01, 03-05-01, 06-03-01, 11-04-01, and 23-05-02 is no further action. As a best management practice, the septic tanks and distribution box were removed from CASs 02-04-01 and 11-04-01 and disposed of as hydrocarbon waste. The NDEP-approved correction action alternative for CASs 05-04-01, 06-05-01, 06-17-04, and 06-23-01 is clean closure. Closure activities for these CASs included removing and disposing of radiologically and pesticide-impacted soil and debris. CAU 224 was closed in accordance with the NDEP-approved CAU 224 Corrective Action Plan (CAP). The closure activities specified in the CAP were based on the recommendations presented in the CAU 224 Corrective Action Decision Document (U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office, 2005). This Closure Report documents CAU 224 closure activities. During closure activities, approximately 60 cubic yards (yd3) of mixed waste in the form of soil and debris; approximately 70 yd 3 of sanitary waste in the form of soil, liquid from septic tanks, and concrete debris; approximately 10 yd 3 of hazardous waste in the form of pesticide-impacted soil; approximately 0.5 yd 3 of universal waste in the form of

Comparison of estimated energy intake from 224-hour recalls and a seven-day food record with objective measurements of energy expenditure in children

DEFF Research Database (Denmark)

Rothausen, Berit Worm; Matthiessen, Jeppe; Groth, Margit Velsing

2012-01-01

% limits of agreement were 438 and 3.52 MJ/d for the 224-HDRs, and 5.90 and 2.94 MJ/d for the 7-dFR. Pearson correlation coefficients between EI and EE were 0.51 for EI224-HDR and 0.29 for EI7-dFR, respectively. The proportion classified in the same or adjacent quartiles was 76% for EI224-HDR and 73...

MicroRNA-224 is Readily Detectable in Urine of Individuals with Diabetes Mellitus and is a Potential Indicator of Beta-Cell Demise

Directory of Open Access Journals (Sweden)

Siobhán Bacon

2015-06-01

Full Text Available MicroRNA (miRNA are a class of non-coding, 19–25 nucleotide RNA critical for network-level regulation of gene expression. miRNA serve as paracrine signaling molecules. Using an unbiased array approach, we previously identified elevated levels of miR-224 and miR-103 to be associated with a monogenic form of diabetes; HNF1A-MODY. miR-224 is a novel miRNA in the field of diabetes. We sought to explore the role of miR-224 as a potential biomarker in diabetes, and whether such diabetes-associated-miRNA can also be detected in the urine of patients. Absolute levels of miR-224 and miR-103 were determined in the urine of n = 144 individuals including carriers of a HNF1A mutation, participants with type 1 diabetes mellitus (T1DM, type 2 diabetes mellitus (T2DM and normal controls. Expression levels were correlated with clinical and biochemical parameters. miR-224 was significantly elevated in the urine of carriers of a HNF1A mutation and participants with T1DM. miR-103 was highly expressed in urine across all diabetes cohorts when compared to controls. For both miR-224 and-103, we found a significant correlation between serum and urine levels (p < 0.01. We demonstrate that miRNA can be readily detected in the urine independent of clinical indices of renal dysfunction. We surmise that the differential expression levels of miR-224 in both HNF1A-MODY mutation carriers and T1DM may be an attempt to compensate for beta-cell demise.

25 CFR 224.138 - What must the Director do if a tribe's noncompliance has caused imminent jeopardy to a physical...

Science.gov (United States)

2010-04-01

... noncompliance with the TERA or a Federal law has caused imminent jeopardy to a physical trust asset. ... caused imminent jeopardy to a physical trust asset? 224.138 Section 224.138 Indians BUREAU OF INDIAN... the Director do if a tribe's noncompliance has caused imminent jeopardy to a physical trust asset? If...

Inclusive neutral particle production in anti pp interactions at 22.4 GeV/c

International Nuclear Information System (INIS)

Boos, E.G.; Samojlov, V.V.; Takibaev, Zh.S.

1978-01-01

The differential distributions over longitudinal and transvers Feynman variables for inclusive γ, Ksub(s)sup(0), Λ production in anti pp interactions at 22.4 GeV/c are presented. The rapidity distributions in the c.m.s. for γ and K 0 /K 0 particles are well described by the quark-antiquark fusion model. In the central region there is some evidence for scaling behaviour of the invariant differential cross sections F for the anti pp → γ+all in the range from 22.4 GeV/c to 100 GeV/c while for the K 0 / K 0 tilde production Frises in this energy interval. A non-zero Λ polarization of -0.414+-0.206 was measured

Exostoses induced by 224Ra(ThX) in children

International Nuclear Information System (INIS)

Spiess, H.; Mays, C.W.

1979-01-01

Exostoses are benign cartilaginous tumors of bone. They can occur naturally or be induced by radiation therapy during the time of skeletal growth. We have observed exostoses in 28 of 218 children given repeated injections of radioactive bone-seeking 224 Ra. The younger the age at irradiation, the higher the incidence of exostoses. Boys are more susceptible than girls. To our knowledge, none of these radiation-induced exostoses have become malignant, although 36 of these children have developed bone sarcomas elsewhere in the skeleton. (orig.) [de

Measuring the radium quartet (228Ra, 226Ra, 224Ra, 223Ra) in seawater samples using gamma spectrometry

International Nuclear Information System (INIS)

Beek, P. van; Souhaut, M.; Reyss, J.-L.

2010-01-01

Radium isotopes are widely used in marine studies (eg. to trace water masses, to quantify mixing processes or to study submarine groundwater discharge). While 228 Ra and 226 Ra are usually measured using gamma spectrometry, short-lived Ra isotopes ( 224 Ra and 223 Ra) are usually measured using a Radium Delayed Coincidence Counter (RaDeCC). Here we show that the four radium isotopes can be analyzed using gamma spectrometry. We report 226 Ra, 228 Ra, 224 Ra, 223 Ra activities measured using low-background gamma spectrometry in standard samples, in water samples collected in the vicinity of our laboratory (La Palme and Vaccares lagoons, France) but also in seawater samples collected in the plume of the Amazon river, off French Guyana (AMANDES project). The 223 Ra and 224 Ra activities determined in these samples using gamma spectrometry were compared to the activities determined using RaDeCC. Activities determined using the two techniques are in good agreement. Uncertainties associated with the 224 Ra activities are similar for the two techniques. RaDeCC is more sensitive for the detection of low 223 Ra activities. Gamma spectrometry thus constitutes an alternate method for the determination of short-lived Ra isotopes.

Clinical, para-clinical and subjective quality of life modifications after[224Ra] radium-chloride-therapy (224 SpondylAT) in ankylosing spondylitis (Bechterew's disease)

International Nuclear Information System (INIS)

Straube, F.; Sagner, K.; Mende, T.; Tutar, K.

2002-01-01

Aim: The ankylosing spondylitis is a painful, chronically inflammatory illness which mainly manifests itself at the spine, and in addition at the peripheral joints with a pronounced inclination to reinforcement. Over the last years we again have been having the possibility to help the patients with a [ 224 Ra]radium treatment to reduce the pain and probably stop the progress of the disease. The purpose was to examine the analgetic effect in connection with the para-clinical inflammation parameters and subjective modifications of the quality of life. Material and Methods: In our clinic, 5 patients (1 woman, 4 men) (age median 43,4 years) were treated over a period of 10 weeks with one weekly injection of 1 MBq [ 224 Ra]radium chloride ( 224 SpondylAT). Before the therapy, at the last day of treatment, and 3 and 6 month after the therapy we documented the pain score (scale 1 to 10) of patients and the laboratory-chemical data (hemoglobin, leukocytes, neutrophile leukocytes, thrombocytes, CRP, blood sedimentation). Physical operability, psychological fortunes and the social role behavior was measured with the clinical test p rofile of quality of life chronically patients . The patients were asked retrospectively (approx. 5 to 15 months) to estimate their pre- and post-therapeutic situation. Results: Before the therapy, the inflammation parameters CRP (average 24.5) and BSR (average 47) of all patients were clearly increased. After 3 months, the CRP value showed a descending tendency, after 6 months however the starting value was almost reached again. The blood sedimentation rate was lowest 3 months after therapy; at a check after 6 months it was somewhat more higher, however still under the outgoing value. After 3 months, the pain score indicated by the patients was reduced from the first value of 7 significantly to 5,3, and after 6 months to 3,7. A significant modification of the blood cell parameters did not occur during the investigation period. 4 of 5 patients

Coronary heart disease-associated variation in TCF21 disrupts a miR-224 binding site and miRNA-mediated regulation.

Science.gov (United States)

Miller, Clint L; Haas, Ulrike; Diaz, Roxanne; Leeper, Nicholas J; Kundu, Ramendra K; Patlolla, Bhagat; Assimes, Themistocles L; Kaiser, Frank J; Perisic, Ljubica; Hedin, Ulf; Maegdefessel, Lars; Schunkert, Heribert; Erdmann, Jeanette; Quertermous, Thomas; Sczakiel, Georg

2014-03-01

Genome-wide association studies (GWAS) have identified chromosomal loci that affect risk of coronary heart disease (CHD) independent of classical risk factors. One such association signal has been identified at 6q23.2 in both Caucasians and East Asians. The lead CHD-associated polymorphism in this region, rs12190287, resides in the 3' untranslated region (3'-UTR) of TCF21, a basic-helix-loop-helix transcription factor, and is predicted to alter the seed binding sequence for miR-224. Allelic imbalance studies in circulating leukocytes and human coronary artery smooth muscle cells (HCASMC) showed significant imbalance of the TCF21 transcript that correlated with genotype at rs12190287, consistent with this variant contributing to allele-specific expression differences. 3' UTR reporter gene transfection studies in HCASMC showed that the disease-associated C allele has reduced expression compared to the protective G allele. Kinetic analyses in vitro revealed faster RNA-RNA complex formation and greater binding of miR-224 with the TCF21 C allelic transcript. In addition, in vitro probing with Pb2+ and RNase T1 revealed structural differences between the TCF21 variants in proximity of the rs12190287 variant, which are predicted to provide greater access to the C allele for miR-224 binding. miR-224 and TCF21 expression levels were anti-correlated in HCASMC, and miR-224 modulates the transcriptional response of TCF21 to transforming growth factor-β (TGF-β) and platelet derived growth factor (PDGF) signaling in an allele-specific manner. Lastly, miR-224 and TCF21 were localized in human coronary artery lesions and anti-correlated during atherosclerosis. Together, these data suggest that miR-224 interaction with the TCF21 transcript contributes to allelic imbalance of this gene, thus partly explaining the genetic risk for coronary heart disease associated at 6q23.2. These studies implicating rs12190287 in the miRNA-dependent regulation of TCF21, in conjunction with

ATN-224 enhances antitumor efficacy of oncolytic herpes virus against both local and metastatic head and neck squamous cell carcinoma

Directory of Open Access Journals (Sweden)

Ji Young Yoo

Full Text Available Head and neck squamous cell carcinoma (HNSCC is the sixth most frequent cancer worldwide, and the 5-year survival rates are among the worst of the major cancers. Oncolytic herpes simplex viruses (oHSV have the potential to make a significant impact in the targeted treatment of these patients. Here, we tested antitumor efficacy of RAMBO, an oHSV armed with the antiangiogenic Vstat120, alone and in conjunction with ATN-224, a copper chelator against HNSCC in vitro and in vivo animal models. We found that all tested HNSCC cells responded well to virus treatment and were sensitive to RAMBO-mediated oncolytic destruction. In vivo, RAMBO had a significant antiangiogenic and antitumorigenic effect. Physiologic levels of copper inhibited viral replication and HNSCC cell killing. Chelation of copper using ATN-224 treatment significantly improved serum stability of RAMBO and permitted systemic delivery in HNSCC tumor xenografts models. Furthermore, our results show that the combination of ATN-224 and RAMBO strongly inhibits lung metastases in a mouse model of HNSCC. These findings suggest that combining ATN-224 with RAMBO has potential for clinical trials in both early and advanced HNSCC patients.

Corrective Action Decision Document for Corrective Action Unit 224: Decon Pad and Septic Systems Nevada Test Site, Nevada, Rev. No.: 0

Energy Technology Data Exchange (ETDEWEB)

David A. Strand

2005-05-01

This Corrective Action Decision Document has been prepared for Corrective Action Unit (CAU) 224, Decon Pad and Septic Systems, in Areas 2, 3, 5, 6, 11, and 23 of the Nevada Test Site, Nevada, in accordance with the ''Federal Facility Agreement and Consent Order'' (1996). Corrective Action Unit 224 is comprised of the following corrective action sites (CASs): (1) 02-04-01, Septic Tank (Buried); (2) 03-05-01, Leachfield; (3) 05-04-01, Septic Tanks (4)/Discharge Area; (4) 06-03-01, Sewage Lagoons (3); (5) 06-05-01, Leachfield; (6) 06-17-04, Decon Pad and Wastewater Catch; (7) 06-23-01, Decon Pad Discharge Piping; (8) 11-04-01, Sewage Lagoon; and (9) 23-05-02, Leachfield. The purpose of this Corrective Action Decision Document is to identify and provide the rationale for the recommendation of a corrective action alternative for the nine CASs within CAU 224. Corrective action investigation activities were performed from August 10, 2004, through January 18, 2005, as set forth in the CAU 224 Corrective Action Investigation Plan.

25 CFR 224.137 - What must the Director do if a tribe's noncompliance has resulted in harm or the potential for...

Science.gov (United States)

2010-04-01

... potential for harm to a physical trust asset? If, because of the tribe's noncompliance with Federal law or... resulted in harm or the potential for harm to a physical trust asset? 224.137 Section 224.137 Indians... physical trust asset that does not rise to the level of imminent jeopardy to a physical trust asset, the...

Azimuthal correlations in anti pp interactions at 22.4 GeV/c

International Nuclear Information System (INIS)

Reimer, P.

Data are presented on azimuthal two particle correlations and the effect is estimated of resonance production on these correlations in anti pp interactions at 22.4 GeV/c. Attention is paid to correlations between two charged pions produced in the process anti p+p→ two charged pions + anything. The dependence is described of the azimuthal asymmetry parameter on rapidity difference. (Z.J.)

Early diagnostic evaluation of miR-122 and miR-224 as biomarkers for hepatocellular carcinoma

Directory of Open Access Journals (Sweden)

Khalda S. Amr

2017-12-01

Full Text Available Hepatocellular carcinoma (HCC is one of the common lethal types of tumor all over the world. The lethality of HCC accounts for many reasons. One of them, the lack of reliable diagnostic markers at the early stage, in this context, serum miRNAs became promising diagnostic biomarkers. Herein, we aimed to identify the predictive value of two miRNAs (miR-122 and miR-224 in plasma of patients with HCC preceded by chronic HCV infection. Taqman miRNA assays specific for hsa-miR-122 and hsa-miR-224 were used to assess the expression levels of the chosen miRNAs in plasma samples collected from three groups; 40 patients with HCC related to HCV, 40 with CHC patients and 20 healthy volunteers. This study revealed that the mean plasma values of miRNA-122 were significantly lower among HCC group when compared to CHC and control groups (P 1.2 (RQ and (AUC = 0.93, P < 0.001, while the accuracy of AFP to diagnose HCC was (AUC: 0.619; P = 0.06. In conclusion, the expression plasma of miR-122 and miR-224 could be used as noninvasive biomarkers for the early prediction of developing HCC at the early stage.

Alkali activated materials state-of-the-art report, RILEM TC 224-AAM

CERN Document Server

Deventer, Jannie

2014-01-01

This is a State of the Art Report resulting from the work of RILEM Technical Committee 224-AAM in the period 2007-2013. The Report summarises research to date in the area of alkali-activated binders and concretes, with a particular focus on the following areas: binder design and characterisation, durability testing, commercialisation, standardisation, and providing a historical context for this rapidly-growing research field.

Auditable safety analysis for the surveillance and maintenance of the 224-B building

International Nuclear Information System (INIS)

Cuneo, V.J.

1997-02-01

The Plutonium Concentration Facility (224-B Building) is an inactive, surplus facility that operated from 1945 until 1976. This document provides the auditable safety analysis (ASA) for the post-deactivation, long-term surveillance and maintenance phase of the abovegrade structures of the 224-B Building. In this ASA, the ability of the existing facilities to withstand the effects of natural phenomena hazard events is evaluated and the support systems used to maintain ventilation and/or prevent the spread of contamination are described. The purpose of the S ampersand M phase is as follows: Maintain confinement of residual inventories of radioactive materials and other contaminants until the facility is ultimately dispositioned; Prevent deterioration of confinement structures; Respond to potential accident conditions requiring response and mitigation; Provide for the safety of workers involved in the S ampersand M phase; and Provide the basis for evaluation and selection of ultimate disposal alternatives. In this ASA, the ability of the existing facilities to withstand the effects of natural phenomena hazard (NPH) events is evaluated and the support systems used to maintain ventilation and/or prevent the spread of contamination are described. This document also evaluates S ampersand M activities that are routinely required (i.e., the S ampersand M of facility barriers, equipment, structures, and postings [including repair and upgrade]; measures to identify, remove, or repair damaged asbestos; measures to identify, remove, or appropriately manage existing containers of hazardous substances; nondestructive assay, waste characterization and sampling; and the performance of spill response measures as needed). The type and nature of the hazards presented by the 224-B Building and specific controls that are required to maintain these hazards to acceptable levels are also identified

Behavioral, neuroendocrine and neurochemical effects of the imidazoline I2 receptor selective ligand BU224 in naive rats and rats exposed to the stress of the forced swim test.

Science.gov (United States)

Finn, David P; Martí, Octavi; Harbuz, Michael S; Vallès, Astrid; Belda, Xavier; Márquez, Cristina; Jessop, David S; Lalies, Margaret D; Armario, Antonio; Nutt, David J; Hudson, Alan L

2003-05-01

There is evidence for alterations in imidazoline(2) (I(2)) receptor density in depressed patients. Selective I(2) receptor ligands modulate central monoamine levels and activate the hypothalamo-pituitary-adrenal (HPA) axis and may have potential as antidepressants. To study the behavioral effects of the selective I(2) receptor ligand BU224 in the rat forced swim test (FST) and its effects on the HPA axis and central monoaminergic responses. Rats received saline or BU224 (10 mg/kg IP) 24, 18 and 1 h prior to 15 min exposure to the FST. Saline- and BU224-treated non-stressed groups were included. Time spent immobile, struggling and swimming calmly was measured. Plasma adrenocorticotrophic hormone (ACTH) and corticosterone levels 90 min post-BU224 were measured in addition to tissue levels of monoamines and metabolites in the frontal cortex, hippocampus and hypothalamus. Administration of BU224 significantly reduced immobility and increased mild swimming without affecting struggling. Exposure to the FST significantly increased plasma ACTH and corticosterone levels. BU224 administration also increased ACTH and potentiated the ACTH response to FST with no effect on corticosterone. BU224 administration significantly increased frontal cortex 5-hydroxytryptamine (5-HT) levels and decreased 5-HT turnover in the frontal cortex and hypothalamus of rats exposed to FST. In non-stressed rats, BU224 decreased 5-HT turnover in the hippocampus and hypothalamus and decreased norepinephrine turnover in the frontal cortex. The selective I(2) receptor ligand BU224 reduces immobility of rats in the FST, indicative of antidepressant-like activity. This effect is accompanied by alterations in HPA axis and central monoaminergic activity.

Risk of leukaemia following intravenous treatment with {sup 224}Ra - results of a long term follow-up study of ankylosing spondylitis patients; Leukaemierisiko nach intravenoeser {sup 224}Ra-Behandlung - Ergebnisse einer Langzeitstudie an Bechterew-Patienten

Energy Technology Data Exchange (ETDEWEB)

Wick, R.R. [GSF - Forschungszentrum fuer Umwelt und Gesundheit Neuherberg GmbH, Oberschleissheim (Germany). Inst. fuer Strahlenbiologie; Chmelevsky, D. [GSF - Forschungszentrum fuer Umwelt und Gesundheit Neuherberg GmbH, Oberschleissheim (Germany). Inst. fuer Strahlenschutz; Goessner, W. [GSF - Forschungszentrum fuer Umwelt und Gesundheit Neuherberg GmbH, Oberschleissheim (Germany). Inst. fuer Pathologie

1993-12-31

In an epidemiological study of the somatic late effects risk following incorporation of a short lived {alpha}-emitter, 1473 ankylosing spondylitis patients treated with repeated intravenous injections of {sup 224}Ra in the years 1948 - 75, have been observed in the GSF. The usual therapeutic plan consisted of a total of 10 - 12 injections of 1.036 MBq (28 {mu}Ci) of {sup 224}Ra each, given at weekly intervals; this would result in an cumulative {alpha}-dose of 0.56 - 0.67 Gy to the marrow-free skeleton of a 70-kg-man (standard man). These patients have been followed together with a control group of ankylosing spondylitis patients not treated with radioactive drugs and/or X-rays. Until May 1993 (mean follow-up time 19.9 yr), 595 patients of the exposure group and 722 patients of the control group have died, causes of death have been ascertained for 578, resp. 668 patients. Among others we observed in the exposure group 10 cases of leukaemia (vs. 2.7 - 2.8 cases expected, p < 0.001) and 6 cases of leukaemia in the control group (vs. 3.3 - 3.5 exp., p = 0.14). Subclassification of the leukaemias shows a clear preference for chronic myeloid leukaemia (CML) in the exposure group (4 cases obs. vs. 0.8 cases exp., p = 0.009), whereas in the control group the observed cases of CML are within the range of expectancy. Similar observations have not been made in another group of patients, now observed by Spiess and co-workers, who have been treated at a higher dose/dose rate range. This increased incidence of leukaemias in our exposure group is in one line with results from animal experiments with bone seeking {alpha}-emitters given at low dose rates. The induction of myeloid leukaemia has been demonstrated in mice down to dose rates of only a few mGy/day also for {sup 239}Pu, an {alpha}-emitter which like {sup 224}Ra deposits preferentially on the bone surface. (orig.) [Deutsch] Im Rahmen einer epidemiologischen Studie zum somatischen Strahlenspaetschadenrisiko nach

Long-range psu(2,2|4) Bethe ansatze for gauge theory and strings

International Nuclear Information System (INIS)

Beisert, Niklas; Staudacher, Matthias

2005-01-01

We generalize various existing higher-loop Bethe ansatze for simple sectors of the integrable long-range dynamic spin chain describing planar N=4 super-Yang-Mills theory to the full psu(2,2|4) symmetry and, asymptotically, to arbitrary loop order. We perform a large number of tests of our conjectured equations, such as internal consistency, comparison to direct three-loop diagonalization and expected thermodynamic behavior. In the special case of the su(1|2) subsector, corresponding to a long-range t-J model, we are able to derive, up to three loops, the S-matrix and the associated nested Bethe ansatz from the gauge theory dilatation operator. We conjecture novel all-order S-matrices for the su(1|2) and su(1,1|2) subsectors, and show that they satisfy the Yang-Baxter equation. Throughout the paper, we muse about the idea that quantum string theory on AdS 5 xS 5 is also described by a psu(2,2|4) spin chain. We propose asymptotic all-order Bethe equations for this putative ''string chain'', which differ in a systematic fashion from the gauge theory equations

Measuring the radium quartet ({sup 228}Ra, {sup 226}Ra, {sup 224}Ra, {sup 223}Ra) in seawater samples using gamma spectrometry

Energy Technology Data Exchange (ETDEWEB)

Beek, P. van, E-mail: vanbeek@legos.obs-mip.f [LEGOS, Laboratoire d' Etudes en Geophysique et Oceanographie Spatiales (CNRS/CNES/IRD/UPS), Observatoire Midi Pyrenees, 14 Avenue Edouard Belin, 31400 Toulouse (France); Souhaut, M. [LEGOS, Laboratoire d' Etudes en Geophysique et Oceanographie Spatiales (CNRS/CNES/IRD/UPS), Observatoire Midi Pyrenees, 14 Avenue Edouard Belin, 31400 Toulouse (France); Reyss, J.-L. [LSCE, Laboratoire des Sciences du Climat et de l' Environnement (CNRS/CEA/UVSQ), Avenue de la Terrasse, 91198 Gif-sur-Yvette (France)

2010-07-15

Radium isotopes are widely used in marine studies (eg. to trace water masses, to quantify mixing processes or to study submarine groundwater discharge). While {sup 228}Ra and {sup 226}Ra are usually measured using gamma spectrometry, short-lived Ra isotopes ({sup 224}Ra and {sup 223}Ra) are usually measured using a Radium Delayed Coincidence Counter (RaDeCC). Here we show that the four radium isotopes can be analyzed using gamma spectrometry. We report {sup 226}Ra, {sup 228}Ra, {sup 224}Ra, {sup 223}Ra activities measured using low-background gamma spectrometry in standard samples, in water samples collected in the vicinity of our laboratory (La Palme and Vaccares lagoons, France) but also in seawater samples collected in the plume of the Amazon river, off French Guyana (AMANDES project). The {sup 223}Ra and {sup 224}Ra activities determined in these samples using gamma spectrometry were compared to the activities determined using RaDeCC. Activities determined using the two techniques are in good agreement. Uncertainties associated with the {sup 224}Ra activities are similar for the two techniques. RaDeCC is more sensitive for the detection of low {sup 223}Ra activities. Gamma spectrometry thus constitutes an alternate method for the determination of short-lived Ra isotopes.

Analysis of pellet center temperatures measured in HALDEN IFA-224 using program FREG-3

International Nuclear Information System (INIS)

Harayama, Yasuo; Izumi, Fumio

1977-01-01

To verify the program FREG-3, we compared the calculations by FREG-3 with those by measurement in a HALDEN instrumented fuel assembly, IFA-224. FREG-3 generally gives higher pellet center temperatures than the measurement. The temperature distribution calculated by FREG-3 to estimate the stored energy in fuel rods results in safety side. (auth.)

Risk of somatic late effects in man following incorporation of /sup 224/Ra(thorium X). Risiko somatischer Strahlenspaetschaeden des Menschen nach Inkorporation von /sup 224/Ra(Thorium X)

Energy Technology Data Exchange (ETDEWEB)

Wick, R.R.; Chmelevsky, D.

1986-03-01

1568 ankylosing spondylitis patients, injected with repeated injections of /sup 224/Ra for treatment of their disease, have been observed in the GSF (study II). By the end of 1985 3 cases of malignant tumours in the skeleton had been observed, compared to 0 cases in a control group. According to the cancer mortality statistics for the FRG the age-corrected number of spontaneous bone tumours expected would be 0.4-0.7. In contrast, a recent risk estimate from the data of the patient group of study I (SPIESS/MAYS) who were treated with considerably higher doses, suggests an expected number of 5.8 radiation induced bone tumours for the present follow-up tine. Latest observations from that group show that bone tumours may occur up to 33 yr after treatment with /sup 224/Ra. Thus, the possibility of additional cases of bone tumours occurring in study II cannot be excluded. One striking observation was that 2 of the 3 skeletal tumours observed in study II were tumours of the bone marrow; there has been only 1 bone marrow tumour in the high dose group (study I) among 56 bone tumours. In addition there have been 6 and 5 leukaemias in the exposure and control group respectively. Of the 6 leukaemias in the exposure group 3 were chronic myeloid leukaemias (CML), whereas among the 5 leukaemias in the control group there was no CML.

Acute Inhalation of 2,2,4-Trimethylpentane Alters Visual Evoked Potentials and Signal Detection Behavior in Rats

Science.gov (United States)

The volatile organic compound 2,2,4-trimethylpentane (TMP, "isooctane") is a constituent of gasoline for which the current health effects data are insufficient to permit the US Environmental Protection Agency to conduct a risk assessment. The potential neurological impairment fro...

25 CFR 224.82 - What activities will the Department continue to perform after approval of a TERA?

Science.gov (United States)

2010-04-01

... assist the tribe in evaluating the physical, economic, financial, cultural, social, environmental, and... AND SELF DETERMINATION ACT Implementation of Tribal Energy Resource Agreements Applicable Authorities and Responsibilities § 224.82 What activities will the Department continue to perform after approval...

Acute inhalation of 2,2,4-trimethylpentane alters visual evoked potentials and signal detection behaviour of rats.

Science.gov (United States)

The volatile organic compound 2,2,4-trimethylpentane (TMP, “isooctane”) is a primary constituent of gasoline for which the current health effects data are insufficient to permit EPA to conduct a risk assessment. We evaluated potential neurological impairment from acute inhalati...

Growth of methyl 2-(2,4-dinitrophenyl)aminopropanoate single crystals

Science.gov (United States)

Perigaud, A.; Nicolau, Y. F.

1986-12-01

Methyl 2-(2,4-dinitrophenyl)aminopropanoate single crystals, 1 cm in diameter and 7 cm in length have been grown by a travelling-heater-Bridgman method in polyethylene tubes introduced into glass ampoules, at a growth rate of 1.5-6 mm/day. The starting material was synthesised and purified by recrystallization from methanol and by vacuum evaporation to a purity of 99.994%. The period of growth, and hence the length of the crystal, is limited due to melt decomposition and polycondensation. The b-axis of the crystals is always oriented at about 72° to the ampoule axis. Good quality single crystals have been obtained giving a FWHM of the Cu Kα (040) rocking curve of about 1'.

Effect of temperature and pressure on excess electron mobility in n-hexane, 2,2,4-trimethylpentane, and tetramethylsilane

International Nuclear Information System (INIS)

Munoz, R.C.; Holroyd, R.A.

1986-01-01

Measurements of excess electron mobility are reported for liquid n-hexane, 2,2,4-trimethylpentane, and tetramethylsilane for pressures from 1 to 2500 bar and for temperatures from 18 to 120 0 C. For tetramethylsilane, a liquid that exhibits a high electron mobility, the mobility at constant density is proportional to T/sup -0.9/ between 25 and 100 0 C. The results are compared with the Basak--Cohen deformation potential theory. For n-hexane, where the mobility is low, Arrhenius behavior is observed. The isochoric activation energy increases with density. The results in this case are consistent with both the two-state and hopping models. In 2,2,4-trimethylpentane the mobility increases with increasing pressure at room temperature and decreases at high temperature. At 2500 bar and at intermediate temperatures (70--80 0 C) the mobility is approximately constant

Nonlinear Equalization in 40/112/224 Gbit/s Mixed Line Rate 15-Channel DP-QPSK and DP-16QAM Contiguous Spectrum Based Networks

DEFF Research Database (Denmark)

Asif, Rameez

2014-01-01

We evaluated that in-line non-linear compensation schemes decrease the com- plexity of digital back-propagation and enhance the perfor mance of 40/112/224Gbit/s mixed line rate network. Both grouped and un-grouped spectral all ocation schemes are investigated.......We evaluated that in-line non-linear compensation schemes decrease the com- plexity of digital back-propagation and enhance the perfor mance of 40/112/224Gbit/s mixed line rate network. Both grouped and un-grouped spectral all ocation schemes are investigated....

Risk of leukaemia following intravenous treatment with 224Ra - results of a long term follow-up study of ankylosing spondylitis patients

International Nuclear Information System (INIS)

Wick, R.R.; Chmelevsky, D.; Goessner, W.

1993-01-01

In an epidemiological study of the somatic late effects risk following incorporation of a short lived α-emitter, 1473 ankylosing spondylitis patients treated with repeated intravenous injections of 224 Ra in the years 1948 - 75, have been observed in the GSF. The usual therapeutic plan consisted of a total of 10 - 12 injections of 1.036 MBq (28 μCi) of 224 Ra each, given at weekly intervals; this would result in an cumulative α-dose of 0.56 - 0.67 Gy to the marrow-free skeleton of a 70-kg-man (standard man). These patients have been followed together with a control group of ankylosing spondylitis patients not treated with radioactive drugs and/or X-rays. Until May 1993 (mean follow-up time 19.9 yr), 595 patients of the exposure group and 722 patients of the control group have died, causes of death have been ascertained for 578, resp. 668 patients. Among others we observed in the exposure group 10 cases of leukaemia (vs. 2.7 - 2.8 cases expected, p 239 Pu, an α-emitter which like 224 Ra deposits preferentially on the bone surface. (orig.) [de

25 CFR 224.40 - How does the Act or a TERA affect the Secretary's trust responsibility?

Science.gov (United States)

2010-04-01

... or other Federal law. (c) The Act and this part preserve the Secretary's trust responsibility to... 25 Indians 1 2010-04-01 2010-04-01 false How does the Act or a TERA affect the Secretary's trust... DETERMINATION ACT General Provisions § 224.40 How does the Act or a TERA affect the Secretary's trust...

Population of 224 realistic human subject-based computational breast phantoms

Energy Technology Data Exchange (ETDEWEB)

Erickson, David W. [Carl E. Ravin Advanced Imaging Laboratories, Duke University Medical Center, Durham, North Carolina 27705 and Medical Physics Graduate Program, Duke University, Durham, North Carolina 27705 (United States); Wells, Jered R., E-mail: jered.wells@duke.edu [Clinical Imaging Physics Group and Carl E. Ravin Advanced Imaging Laboratories, Duke University Medical Center, Durham, North Carolina 27705 and Medical Physics Graduate Program, Duke University, Durham, North Carolina 27705 (United States); Sturgeon, Gregory M. [Carl E. Ravin Advanced Imaging Laboratories, Duke University Medical Center, Durham, North Carolina 27705 (United States); Samei, Ehsan [Department of Radiology and Carl E. Ravin Advanced Imaging Laboratories, Duke University Medical Center, Durham, North Carolina 27705 and Departments of Physics, Electrical and Computer Engineering, and Biomedical Engineering, and Medical Physics Graduate Program, Duke University, Durham, North Carolina 27705 (United States); Dobbins, James T. [Department of Radiology and Carl E. Ravin Advanced Imaging Laboratories, Duke University Medical Center, Durham, North Carolina 27705 and Departments of Physics and Biomedical Engineering and Medical Physics Graduate Program, Duke University, Durham, North Carolina 27705 (United States); Segars, W. Paul [Department of Radiology and Carl E. Ravin Advanced Imaging Laboratories, Duke University Medical Center, Durham, North Carolina 27705 and Medical Physics Graduate Program, Duke University, Durham, North Carolina 27705 (United States); Lo, Joseph Y. [Department of Radiology and Carl E. Ravin Advanced Imaging Laboratories, Duke University Medical Center, Durham, North Carolina 27705 and Departments of Electrical and Computer Engineering and Biomedical Engineering and Medical Physics Graduate Program, Duke University, Durham, North Carolina 27705 (United States)

2016-01-15

Purpose: To create a database of highly realistic and anatomically variable 3D virtual breast phantoms based on dedicated breast computed tomography (bCT) data. Methods: A tissue classification and segmentation algorithm was used to create realistic and detailed 3D computational breast phantoms based on 230 + dedicated bCT datasets from normal human subjects. The breast volume was identified using a coarse three-class fuzzy C-means segmentation algorithm which accounted for and removed motion blur at the breast periphery. Noise in the bCT data was reduced through application of a postreconstruction 3D bilateral filter. A 3D adipose nonuniformity (bias field) correction was then applied followed by glandular segmentation using a 3D bias-corrected fuzzy C-means algorithm. Multiple tissue classes were defined including skin, adipose, and several fractional glandular densities. Following segmentation, a skin mask was produced which preserved the interdigitated skin, adipose, and glandular boundaries of the skin interior. Finally, surface modeling was used to produce digital phantoms with methods complementary to the XCAT suite of digital human phantoms. Results: After rejecting some datasets due to artifacts, 224 virtual breast phantoms were created which emulate the complex breast parenchyma of actual human subjects. The volume breast density (with skin) ranged from 5.5% to 66.3% with a mean value of 25.3% ± 13.2%. Breast volumes ranged from 25.0 to 2099.6 ml with a mean value of 716.3 ± 386.5 ml. Three breast phantoms were selected for imaging with digital compression (using finite element modeling) and simple ray-tracing, and the results show promise in their potential to produce realistic simulated mammograms. Conclusions: This work provides a new population of 224 breast phantoms based on in vivo bCT data for imaging research. Compared to previous studies based on only a few prototype cases, this dataset provides a rich source of new cases spanning a wide range

Analysis of elastic scattering in anti pp interactions at 22.4 Gev/c

International Nuclear Information System (INIS)

Batyunya, E.V.; Boguslavskij, I.V.; Bruntsko, D.

1985-01-01

Results are presented on measuring the anti pp elastic scattering differential cross section at 22.4 GeV/c over a region of 0.05 2 . The results have been obtained from pictures of the HBC ''Ludmila''. The total elastic cross section σsub(el)=9.0+-0.3 mb and the slope parameter b(s, t=0)=13.1+-0.8 GeVsup(-2) have been found from the data approximated by a quadratic exponential function. The results are compared with the data at similar energies

(Vapour + liquid) equilibria for binary and ternary mixtures of 2-propanol, tetrahydropyran, and 2,2,4-trimethylpentane at P = 101.3 kPa

International Nuclear Information System (INIS)

Lin, Dun-Yi; Tu, Chein-Hsiun

2012-01-01

Highlights: ► We report the VLE data at P = 101.3 kPa involving a cyclic ether. ► The activity coefficients of mixtures were obtained from modified Raoult’s law. ► The VLE data were correlated by four liquid activity coefficient models. ► The ternary VLE data were predicted from binary parameters of the four models. - Abstract: (Vapour + liquid) equilibrium (VLE) at P = 101.3 kPa have been determined for a ternary system (2-propanol + tetrahydropyran + 2,2,4-trimethylpentane) and its constituent binary systems (2-propanol + tetrahydropyran, 2-propanol + 2,2,4-trimethylpentane), and (tetrahydropyran + 2,2,4-trimethylpentane). Analysis of VLE data reveals that two binary systems (2-propanol + tetrahydropyran) and (2-propanol + 2,2,4-trimethylpentane) have a minimum boiling azeotrope. No azeotrope was found for the ternary system. The activity coefficients of liquid mixtures were obtained from the modified Raoult’s law and were used to calculate the reduced excess molar Gibbs free energy (g E /RT). Thermodynamic consistency tests were performed for all VLE data using the Van Ness direct test for the binary systems and the test of McDermott–Ellis as modified by Wisniak and Tamir for the ternary system. The VLE data of the binary mixtures were correlated using the three-suffix Margules, Wilson, NRTL, and UNIQUAC activity-coefficient models. The models with their best-fitted interaction parameters of the binary systems were used to predict the ternary (vapour + liquid) equilibrium.

Multiplicities and forward-backward correlations in anti pp interactions at 22.4 GeV/c

International Nuclear Information System (INIS)

Boos, E.G.; Samojlov, V.V.; Tashimov, M.A.

1977-01-01

Forward-backward multiplicity correlations in anti pp -interactions at 22.4 GeV/c and multiplicities in a simple icle multiplicity distribution is divided into even and odd components, the probability of producting an odd state is found to be higher than that of producing an even state, which may be interpreted to be due to diffraction forward-backward and to everall multiplicities is discussed

Purification, crystallization and preliminary crystallographic characterization of the α2,6-sialyltransferase from Photobacterium sp. JT-ISH-224

International Nuclear Information System (INIS)

Okino, Nozomu; Kakuta, Yoshimitsu; Kajiwara, Hitomi; Ichikawa, Masako; Takakura, Yoshimitsu; Ito, Makoto; Yamamoto, Takeshi

2007-01-01

Crystallization of the α2,6-sialyltransferase from Photobacterium. Sialyltransferases transfer sialic acid from cytidine-5-monophospho-N-acetylneuraminic acid (CMP-NeuAc) to the nonreducing termini of the oligosaccharyl structures of various glycoproteins and glycolipids. The newly cloned α2,6-sialyltransferase from Photobacterium sp. JT-ISH-224 (from the Vibrionaceae family) is composed of two domains: an unknown N-terminal domain and a catalytic C-terminal domain which shares significant homology with the Pasteurella multocida multifunctional sialyltransferase. The putative mature form of JT-ISH-224 α2,6-sialyltransferase was overproduced in Escherichia coli, purified and crystallized using the hanging-drop vapour-diffusion method at 293 K. The crystal belonged to space group P3 1 21 or P3 2 21, with unit-cell parameters a = b = 90.29, c = 204.33 Å. X-ray diffraction data were collected to 2.5 Å resolution

Early injuries on the tibia and vertebrae of the mouse after incorporation of thorium 227 and radium 224

Energy Technology Data Exchange (ETDEWEB)

Poemsl, H

1974-08-06

After incorporation of 5 and 50 ..mu..Ci/kg thorium 227 as well as 25 ..mu..Ci/kg radium 224, the tibia and lumbar vertebrae of the mouse were histologically and, using cell counting, morphometrically investigated within a period of 12 weeks. Osteoblasts and mesenchymal cells proved to be the most sensitive to radiation. They were temporarily decimated after 25 ..mu..Ci/kg radium 224 in the tibial metaphysis, but soon regenerated. After 5 ..mu..Ci/kg thorium 227, osteoblasts and mesenchymal cells were only slightly reduced, but more so in the lumbar vertebrae than in the tibia. The cells of osteogenic tissue were almost completely killed by 50 ..mu..Ci/kg thorium 227. In the subsequent regeneration phase, larger regions of atypical bone occured in the tibia metaphysis which was pushed off in the further course by newly formed compact substance of epiphysial cartilage.

Radium isotope (223Ra, 224Ra, 226Ra and 228Ra) distribution near Brazil's largest port, Paranaguá Bay, Brazil

International Nuclear Information System (INIS)

Dias, Thais H.; Oliveira, Joselene de; Sanders, Christian J.; Carvalho, Franciane; Sanders, Luciana M.; Machado, Eunice C.; Sá, Fabian

2016-01-01

This work investigates the 223 Ra, 224 Ra, 226 Ra and 228 Ra isotope distribution in river, estuarine waters and sediments of the Paranaguá Estuarine Complex (PEC). The stratification of the Ra isotopes along water columns indicate differing natural sources. In sediments, the radium isotope activities was inversely proportional to the particle size. The highest concentrations of 223 Ra, 224 Ra, 226 Ra and 228 Ra in the water column were found in the bottom more saline waters and towards the inner of the estuary. These relatively high concentrations towards the bottom of the estuary may be attributed to the influence of tidally driven groundwater source and desorption from particles at the maximum turbidity zone. The apparent river water ages from the radium isotope ratios, 223 Ra/ 224 Ra and 223 Ra/ 228 Ra, indicate that the principal rivers that flow into the estuary have residence times from between 6 and 11 days. - Highlights: • Radium isotope concentrations were evaluated along a large estuarine system. • The radioactivity level in river, estuary and sediments was within a normal range. • Spatial distributions of site specific radionuclides have differing activities and sources.

Use of nuclear recoil for separating 228Ra, 224Ra, and 233Pa from colloidal thorium

International Nuclear Information System (INIS)

Beydon, J.; Gratot, I.

1968-01-01

By using α-recoil it is possible to separate by dialysis the α disintegration products (224 Ra; 228 Ra) of thorium from colloidal thorium hydroxide.The use of n, γ recoil allows the separation of 233 Pa produced by the neutron irradiation of thorium, on condition that the colloidal thorium hydroxide is irradiated in the presence of a dispersing. (author) [fr

Dental extractions in relation to radiation therapy of 224 patients

International Nuclear Information System (INIS)

Makkonen, T.A.; Kiminki, A.; Makkonen, T.K.; Nordman, E.

1987-01-01

The case histories of 224 patients treated with radiation therapy for head and neck malignancies at the Radiotherapy Clinic of the Univesity Central Hospital in Turku during the years 1974-77 are reviewed. Of the 92 patients surviving for 5 years, 90 were available for re-examination. The median radiation dosage was 61 Gy in 6 to 8 weeks in patients with squamous cell carcinoma and othe solid tumours and 43 Gy in 5 weeks in patients with lymphoma. The oral status of the patients was examined clinically and radiographically. From these pationts 45 teeth had been extracted before irradiation and 94 after irradiation. In no case had this resulted in osteoradionecrosis of the jaws. It is evident that the repairing of patient's teeth before radiation treatment, coupled with continuous preventive care of caries, will prevent serious complications from arising. (author)

Determination of 226Ra and 224Ra in drinking waters by liquid scintillation counting

International Nuclear Information System (INIS)

Manjon, G.; Vioque, I.; Moreno, H.; Garcia-Tenorio, R.; Garcia-Leon, M.

1997-01-01

A method for the determination of Ra-isotopes in water samples has been developed. Ra is coprecipitated with Ba as sulphate. The precipitate is then dissolved with EDTA and counted with a liquid scintillation system after mixing with a scintillation cocktail. The study of the temporal evolution of the separated activity gives the isotopic composition of the sample, i.e. the 224 Ra and 226 Ra contribution to the total activity. The method has been applied to some Spanish drinking waters. (author)

48 CFR 1552.224-70 - Social security numbers of consultants and certain sole proprietors and Privacy Act statement.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Social security numbers of... CONTRACT CLAUSES Texts of Provisions and Clauses 1552.224-70 Social security numbers of consultants and... provision in all solicitations. Social Security Numbers of Consultants and Certain Sole Proprietors and...

Inelastic anti pp interactions at 22.4 GeV/c compared with e+e- annihilation into hadrons

International Nuclear Information System (INIS)

Boos, E.G.; Ermilova, D.I.; Samoilov, V.V.; Temiraliev, T.

1982-01-01

The 22.4 GeV/c anti pp interactions with the leading particle and the slow proton subtracted are used as data on soft processes. Considerable similarity between them and hard processes, such as e + e - annihilation into hardrons, is found by means of studying charged multiplicities. KNO scaling and longitudinal as well as transverse spectra. (orig.)

Tracing water movement in Mumbai harbor bay using naturally occurring "2"2"4Ra and "2"2"3Ra as tracer

International Nuclear Information System (INIS)

Yadav, V.B.; Sartandel, S.J.; Jha, S.K.; Tripathi, R.M.

2017-01-01

Measurement of short lived radium isotopes "2"2"4Ra and "2"2"3Ra in seawater samples collected from Mumbai Harbor Bay was carried out using MnO_2 based in-situ pre-concentration technique coupled with coincidence counting. Longitudinal variation of "2"2"4Ra and "2"2"3Ra was found in the range 17.74 - 98.66 dpm/100L and 0.56 - 2.26 dpm/100L respectively. Higher value of radium isotopes was found near shore sampling points where reused seawater and surface water from land intrudes in creek. A decreasing pattern was observed in the creek as we move to offshore locations. Lower activity ratio in offshore locations indicates the flow of water towards open sea. (author)

Oesteosarcomagenic doses of radium (224Ra) and infectious endogenous retroviruses enhance proliferation and osteogenic differentiation of skeletal tissue dofferentiating in vitro

International Nuclear Information System (INIS)

Schmidt, J.; Heermeier, K.; Linzner, U.; Luz, A.; Silbermann, M.; Livne, E.; Erfle, V.

1994-01-01

Cartilage tissue from embryonic mice which undergoes osteogenic differentiation during in vitro cultivation was used to study the effect of osteosarcomagenic doses of α-irradiation and bone-tumor-inducing retroviruses on proliferation and phenotypic differentiation of skeletal cells in a defined tissue culture model. Irradiated mandibular condyles showed dose-dependent enhancement of cell proliferation at day 7 of the culture and increased osteogenic differentiation at day 14. Maximal effects were found with 7.4 Bq/ml of 224 Ra-labeled medium. Doses of 740 and 7400 Bq/ml of 224 Ra-labeled medium induced increasing cell death. Retrovirus infection enhanced osteogenic differentiation and extended the viability of irradiated cells. After transplantation none of the treated tissues developed tumors in syngeneic mice. (orig.)

Inclusive rho0 production in anti pp interactions at 22.4 GeV/c

International Nuclear Information System (INIS)

Ermilova, D.I.; Filippova, V.V.; Samojlov, V.V.

1978-01-01

Inclusive rho 0 production has been investigated in anti pp reactions at 22.4 GeV/c. The total cross section for rho 0 production is 8.1+-2.0 mb. The average number of rhosup(0') s per event is 0.17+-0.03. The average transverse momentum, as obtained by extrapolation of a simple exponential to the psub(T)sup(2) distribution, is 0.52+-0.12 GeV. The Feynman x and center of mass rapidity distributions show rho 0 to be ''centrally'' produced

[Clinical characteristics and surgical treatment of idiopathic congenital nystagmus in 224 patients].

Science.gov (United States)

Ding, J; Zhao, K X; Li, Y P; Ma, H Z; Chen, X; Guo, X; Zhu, L N; Li, N D; Zhang, W

2016-08-01

To study clinical characteristics and surgical treatment of idiopathic congenital nystagmus (ICN). A retrospective study was conducted in 224 patients with ICN in Tianjin eye hospital from July 2007 to February 2013. There were 224 patients, 158 (70.54%) males and 66 (29.5%) females, mean age was (11.6±8.4) years and (11.4±6.4) years separately. Horizontal nystgamus happened in 215 cases, 3 cases were vertical type and 6 cases were mixed. 214 cases were with no history of operation and 10 patients had ever underwent surgeries before. Furthermore, 151 patients combined with strabismus and refractive error, anterior segment or retinal disorders, which accounting for 67.4% of all the patients. 48 patients were associated myopia, 30 patients with hyperopia, 43 patients with strabismus. Among them, 153 cases of compensatory head position direction were horizontal with face turn, 43 cases (43/153, 28.1%) showed face turning to the left, 110 cases (110/153, 71.9%) showed face turning to the right. Surgeries were designed according to the compensatory head position and head retroversion angle. For 15 patients with double intermediate zones, the position which was often used with good visual function was chosen for operation design. As for the patients with nystagmus and strabismus, the transfer null zone to primary position for the dominant eye and strabismus surgery for the other eye was chosen. And for complicated patients with compensative head position, the dominant head posture were designed for surgery. ICN is dominated by male with variable clinical manifestations. Surgical choice for ICN depends on the direction of head position and if there is strabismus accompanying it.The aim of ocular muscle surgery is to transfer null zone to primary position. (Chin J Ophthalmol, 2016, 52: 574-578).

Risk of somatic late effects in man following incorporation of 224Ra(thorium X)

International Nuclear Information System (INIS)

Wick, R.R.; Chmelevsky, D.

1986-03-01

1568 ankylosing spondylitis patients, injected with repeated injections of 224 Ra for treatment of their disease, have been observed in the GSF (study II). By the end of 1985 3 cases of malignant tumours in the skeleton had been observed, compared to 0 cases in a control group. According to the cancer mortality statistics for the FRG the age-corrected number of spontaneous bone tumours expected would be 0.4-0.7. In contrast, a recent risk estimate from the data of the patient group of study I (SPIESS/MAYS) who were treated with considerably higher doses, suggests an expected number of 5.8 radiation induced bone tumours for the present follow-up time. Latest observations from that group show that bone tumours may occur up to 33 yr after treatment with 224 Ra. Thus, the possibility of additional cases of bone tumours occurring in study II cannot be excluded. One striking observation was that 2 of the 3 skeletal tumours observed in study II were tumours of the bone marrow; there has been only 1 bone marrow tumour in the high dose group (study I) among 56 bone tumours. In addition there have been 6 and 5 leukaemias in the exposure and control group respectively. Of the 6 leukaemias in the exposure group 3 were chronic myeloid leukaemias (CML), whereas among the 5 leukaemias in the control group there was no CML. (orig./MG) [de

Investigation of the origin of elements of the uranium-235 family noticed in excess around the EL4 experimental nuclear reactor during its dismantling. Site of the Monts d'Arree - Brennilis (29) power plant. Years 2007-2008. Report and appendices with results

International Nuclear Information System (INIS)

2009-02-01

The presence of actinium-227 has been noticed in the Mont d'Arree region (Finistere district) and such a presence in the environment had never been reported before. Thus, a study has been performed to investigate the origin of this element: about 300 samples have been analysed. After an indication of the investigation chronology, the report outlines that there is no relationship between the excess of actinium-227 and land amendment or embankments, that there is no obvious relationship between this presence and radioactive liquid effluents or atmospheric effluents from the Brennilis nuclear site. It shows that there is an obvious relationship with the radiological quality. It states that this excess of actinium 227 is related to the management of rain waters about the Brennilis site. An appendix specifies the location, nature and agenda of samplings (bio-indicators, samplings in sludge, soils, food and tap water, aquatic foams and sediments, ponds, wet lands, and at the vicinity of the power plant channel), presents detailed results obtained by gamma spectrometry, and measurement equipment and methods

Epidemiological assessment of lens opacifications that impaired vision in patients injected with radium-224

International Nuclear Information System (INIS)

Chmelevsky, D.; Mays, C.W.; Spiess, H.; Stefani, F.H.; Kellerer, A.M.

1988-01-01

The incidence of lens opacifications that impaired vision (cataract) was analyzed among 831 patients who were injected with known dosages of 224 Ra in Germany shortly after World War II. The dependence of the incidence on dosage, i.e., injected activity per unit body weight, and on time after treatment was determined. The observations are equally consistent with proportionality of the incidence of cataract to the square of dosage or with a linear dependence beyond a threshold of 0.5 MBq/kg. The possibility of a linear dependence without threshold was strongly rejected (P less than 0.001). The analysis of temporal dependences yielded a component that was correlated with the injected amount of 224 Ra and a component that was uncorrelated. The former was inferred by a maximum likelihood analysis to increase approximately as the square of the time after treatment. The component unrelated to the treatment was found to increase steeply with age and to become dominant within the collective of patients between age 50 and 60. The relative magnitudes of the two components were such that a fraction of 55 to 60% of the total of 58 cataracts had to be ascribed to the dose-related incidence. Impaired vision due to cataract was diagnosed before age 54 in 25 cases. In terms of injected activity per unit body weight no dependence of the sensitivity on age was found; specifically there was no indication of a faster occurrence of the treatment-related cataracts in patients treated at older ages

Measurements of octupole collectivity in $^{220,222}$Rn and $^{222,224}$Ra using Coulomb excitation

CERN Multimedia

Kruecken, R; Larsen, A; Hurst, A M; Voulot, D; Grahn, T; Clement, E; Wadsworth, R; Gernhaeuser, R A; Siem, S; Huyse, M L; Iwanicki, J S

2008-01-01

We propose to exploit the unique capability of ISOLDE to provide post-accelerated $^{220,222}$Rn and $^{222,224}$Ra ion beams from the REX facility to enable the Coulomb excitation of the first 3$^{-}$ states in these nuclei. By measuring the $\\gamma$-ray yields of the E1 decays from the 3$^{-}$ state using the MINIBALL array we can obtain the transition matrix elements. This will give quantitative information about octupole correlations in these nuclei. We require 22 shifts to fulfil the aims of the experiment.

Inclusive neutral particle production in anti pp interactions at 22.4 GeV/c

International Nuclear Information System (INIS)

Boos, E.G.; Samojlov, V.V.; Takibaev, Zh.S.

1978-01-01

The results of an analysis of inclusive production of γ(πsup(0)), Ksub(s)ysup(0), Λ, anti Λ particles in anti pp interaction at 22.4 GeV/c are presented. The total and topological inclusive cross sections of neutral particles were obtained. The charged multiplicity dependences of the mean number of πsup(0), Ksup(0)/ anti Ksup(0), Λ/ anti Λ productions were studied. The mean number of Λ/ anti Λ particles decreases with increasing charged multiplicity. The KNO scaling hypothesis for πsup(0), Ksub(s)sup(0), Λ particles was confirmed

Design and manufacture of a three-counter channel system based on delayed coincidence principle using for 22'3Ra and 224Ra measurements

International Nuclear Information System (INIS)

Tuong Thi Thu Huong; Pham Ngoc Tuan; Dang Hong Ngoc Quy; Truong Van Dat; Tran Anh Khoi; Chau Thi Nhu Quynh

2016-01-01

The research group has designed and fabricated a radiation detection system for measuring low activities of 223 Ra and 224 Ra in natural waters based on a design of Giffin et al (1963). Samples are obtained by adsorbing 223 Ra and 224 Ra onto a column of MnO 2 coated fiber (Mn fiber). The short-lived Rn daughters of 223 Ra and 224 Ra which recoil from the Mn fiber are swept into a scintillation detector where alpha decays of Rn and Po occur. Signals from the detector are sent to a delayed coincidence circuit which discriminates decay of the 224 Ra daughters, 220 Ra and 216 Po, from decays of the 223 Ra daughters, 219 Ra and 215 Po. The main product of this project is a “Low Alpha counting system” based on digital technology. This system consists of some main electronic circuit such as amplifier, single channel analyzer, counters/timers, micro-processor, RS232 interfacing. Almost of mentioned-above components have been designed and fabricated using ISE 10.1 software toolkits from Xilinx. The application program for controlling and collecting data from the device is written in LabView. In comparison with conventional analog circuits, the design of this system is smaller and easy to use owing to being connected to personal computer through RS232 interface in order to data acquisition and processing. This is also a new trend in the field of development of nuclear equipment with the aim to simple design, cost-saving (Reuse of hardware components can further reduce the system development cost), flexible (arbitrarily adjust measurement parameters by setting parameters from software), user-Friendly Environment (program directly embedded into the FPGA). (author)

The properties of Hα emission-line galaxies at z = 2.24

International Nuclear Information System (INIS)

An, Fang Xia; Zheng, Xian Zhong; Wang, Wei-Hao; Huang, Jia-Sheng; Kong, Xu; Wang, Jun-Xian; Zhu, Feifan; Fang, Guan Wen; Gu, Qiu-Sheng; Wu, Hong; Hao, Lei; Xia, Xiao-Yang

2014-01-01

Using deep narrowband H 2 S1 and K s -band imaging data obtained with CFHT/WIRCam, we identify a sample of 56 Hα emission-line galaxies (ELGs) at z = 2.24 with the 5σ depths of H 2 S1 = 22.8 and K s = 24.8 (AB) over a 383 arcmin 2 area in the Extended Chandra Deep Field South. A detailed analysis is carried out with existing multi-wavelength data in this field. Three of the 56 Hα ELGs are detected in Chandra 4 Ms X-ray observations and two of them are classified as active galactic nuclei. The rest-frame UV and optical morphologies revealed by HST/ACS and WFC3 deep images show that nearly half of the Hα ELGs are either merging systems or have a close companion, indicating that the merging/interacting processes play a key role in regulating star formation at cosmic epoch z = 2-3. About 14% are too faint to be resolved in the rest-frame UV morphology due to high dust extinction. We estimate dust extinction from spectral energy distributions. We find that dust extinction is generally correlated with Hα luminosity and stellar mass. Our results suggest that Hα ELGs are representative of star-forming galaxies. Applying extinction corrections to individual objects, we examine the intrinsic Hα luminosity function (LF) at z = 2.24, obtaining a best-fit Schechter function characterized by a faint-end slope of α = – 1.3. This is shallower than the typical slope of α ≅ –1.6 in previous works based on constant extinction correction. We demonstrate that this difference is mainly due to the different extinction corrections. The proper extinction correction is thus the key to recovering the intrinsic LF as the extinction globally increases with Hα luminosity. Moreover, we find that our Hα LF mirrors the stellar mass function of star-forming galaxies at the same cosmic epoch. This finding indeed reflects the tight correlation between star formation rate and stellar mass for star-forming galaxies, i.e., the so-called main sequence.

Study on the risk of late damage in humans after incorporation of the short-lived alpha emitter Ra-224

International Nuclear Information System (INIS)

Wick, R.R.; Nekolla, E.A.; Kellerer, A.M.; Goessner, W.

2003-01-01

An epidemiological study has been carried out at the GSF - National Research Center for Environment and Health - between 1948 and 1975, on 1460 ankylosing spondylitis (AS) patients. The aim of the study was to ascertain the late health effects suffered by these patients who had received repeated intravenous injections of the short lived α-emitter 224 Ra. These patients have been followed together with a control group of 1323 ankylosing spondylitis patients not treated with radioactive drugs and/or X-rays. Causes of death have been ascertained for 842 exposed patients and 861 controls by the end of 2002. In the exposed group there has been a total of 219 malignant diseases and 206 cases among the controls. In particular, we observed 15 cases of leukaemia in the exposure group and 8 cases of leukaemia in the control group. Further subclassification of the leukaemias demonstrated a high increase of myeloid leukaemia in the exposure group (9 cases obs. vs. 2.5 cases exp.), and out of these especially the acute myeloid leukaemias (6 cases observed vs. 1.6 expected), whereas in the control group the observed cases are within the expected range (3 myeloid leukaemias vs. 2.6 cases). Out of these 6 cases of myeloid leukaemia, 3 cases have been observed at doses comparable to those of the currently applied 224 Ra treatment with the preparation SpondylAT registered , in one case the 224 Ra-dose was the 0.6fold, in another case 1.6fold, whereas in one case the total dose could not be verified exactly. The enhanced leukaemia incidence in our exposed group is in line with results from animal experiments in mice having been injected with bone seeking α-emitters given at low dose rates. (orig.) [de

Cervical spondylomyelopathy ('wobbler' syndrome) in the dog: a study based on 224 cases

International Nuclear Information System (INIS)

Lewis, D.G.

1989-01-01

Over the past 10 to 12 years, cervical spondylomyelopathy has been increasingly recognised in large breed dogs. The breeds mainly affected are dobermanns, great danes and basset hounds. Factors such as age, sex and location of the lesions are discussed in detail based on findings from 224 cases seen at the University of Liverpool Small Animal Hospital. The anatomical changes responsible for the signs show some striking similarities in young dogs of all the breeds affected. Where the condition is commoner later in life, such as in the dobermann, the changes and their effect on the spinal cord show considerable differences. These different findings are compared, and an attempt made to explain them

DEVELOPMENT OF A PHYSIOLOGICALLY-BASED PHARMACOKINETIC (PBPK) MODEL FOR THE INHALATION OF 2,2,4-TRIMETHYLPENTANE (TMP) IN LONG EVANS RATS.

Science.gov (United States)

TMP (2,2,4-trimethylpentane,“isooctane”) is a colorless liquid used primarily in the alkylation of isobutene and butylene reactions to derive high-octane fuels. TMP is released in the environment through the manufacture, use, and disposal of products associated with the gasoline ...

Review on transactinium isotope build-up and decay in reactor fuel and related sensitivities to cross section changes and results and main conclusions of the IAEA-Advisory Group Meeting on Transactinium Nuclear Data, held at Karlsruhe, November 1975

International Nuclear Information System (INIS)

Kuesters, H.; Lalovic, M.

1976-04-01

In this report a review is given on the actinium isotope build-up and decay in LWRs, LMFBRs and HTRs. The dependence of the corresponding physical aspects on reactor type, fuel cycle strategy, calculational methods and cross section uncertainties is discussed. Results from postirradiation analyses and from integral experiments in fast zero power assemblies are compared with theoretical predictions. Some sensitivity studies about the influence of actinium nuclear data uncertainties on the isotopic concentration, decay heat, and the radiation out-put in fuel and waste are presented. In a second part, the main results of the IAEA-Advisory Group Meeting on Transactinium Nuclear Data are summarized and discussed. (orig.) [de

Epidemiological statistics on late lesions in persons treated with radium-224

International Nuclear Information System (INIS)

Mueller, W.A.

1978-01-01

A brief survey of the so-called Schales study is given which is to be continued now after the death of its author. The main problem of these investigations consists in an exact radiation dosimetry. Exact data on Thorium-X-treatment are mostly not available. Therefore, in most cases, only an average skeleton dose can be indicated. The dose which had usually been applied earlier was meanwhile considerably reduced and lies now normally about 10 injections of 28μCi 224 Ra each, which brings a skeletal exposure of 56 rad for a medium weight. Out of 1850 Bechterew patients, more than 1100 could be directly asked in the investigation. A table of the skeletal doses of 1625 patients is introduced. Of the 418 deaths seen up to date, 14% were due to neoplasiae - a percentage lower than in the normal population; 4 osteosarcomas are among them. Genetical damage caused by radiation also seems to be very unlikely. A risk estimation for osteosarcoma is given. (MG) [de

VizieR Online Data Catalog: Spectrum of VY CMa in 220.65-224.25GHz range (Kaminski+, 2013)

Science.gov (United States)

Kaminski, T.; Gottlieb, C. A.; Menten, K. M.; Patel, N. A.; Young, K. H.; Brunken, S.; Muller, H. S. P.; McCarthy, M. C.; Winters, J. M.; Decin, L.

2013-02-01

A spectrum of VY Canis Majoris obtained with the Plateau de Bure Interferometer on 22 April and 13 October 2012 in the frequency range 220.65-224.25GHz. The interferometer was used in its D configuration with six antennas and the synthesized beam was 4.9x2.2-arcsec. The spectrum was extracted from the central pixel of the map obtained with the gridding of 0.65-arcsec. (2 data files).

Orthorhombic-orthorhombic phase transitions in Nd2NiO4+δ (0.067≤δ≤0.224)

International Nuclear Information System (INIS)

Ishikawa, Kenji; Metoki, Kenji; Miyamoto, Hiroshi

2009-01-01

Variation of the phases of Nd 2 NiO 4+δ with the excess oxygen concentration δ has been examined at room temperature in the range 0.067≤δ≤0.224 using the X-ray powder diffraction technique. The phases observed at room temperature are orthorhombic-I (0.21 2 NiO 4+δ with the excess oxygen concentration. O I : orthorhombic-I; O II : orthorhombic-II; O IV : orthorhombic-IV; T I : quasi-tetragonal-I.

Invariant cross sections for the inclusive reactions antipp→π++X and antipp→p+X at 22.4 GeV/c

International Nuclear Information System (INIS)

Boss, E.G.; Ermilova, D.I.; Samojlov, V.V.

1978-01-01

The invariant inclusive cross sections for π + mesons and protons from antipp reactions at 22.4 GeV/c are presented. The average multiplicity for π + meson and proton production is 1.92+-0.02 and 0.41+-0.02, respectively. The annihilation spectra have been approximated using the difference between antipp and pp data. The resulting distributions have similar features as the total antipp data

Cross sections, average multiplicities and energy fractions of neutral π- and k-mesons in p anti p-annihilations at 22.4 GeV/c

International Nuclear Information System (INIS)

Batyunya, B.V.; Boguslavsky, I.V.; Gramenitsky, I.M.

1982-01-01

To determine cross sections, average multiplicities and inelasticity coefficients π 0 and Ksub(n), formed in anti pp annihilation interaction at 22.4 GeV/c, data on the differences in the respective characteristics anti pp- and pp-interactions have been used. The average multiplicity of π 0 in anti pp annihilation interactions is equal to 3.2+-0.3 and exceeds analogous data for inelastic pp- and anti pp interactions. The inelasticity coefficient π + , π 0 and Ksub(n)/Ksup(0) or anti K 0 /of mesons formed in annihilation interactions: etasub(π)sup(+)=0.33+-0.22, etasub(πsup(0)=0.36+-0.05, etasub(Ksubn))=0.044+-0.008 is determined. The total multiplicity of charged and neutral particles formed in anti pp annihilation at 22.4 GeV/c equals 10.2+-0.4 and exceeds the corresponding values for inelastic anti pp and pp interactions

Differences between annihilation and nonannihilation characteristics of anti pp-interactions at 22.4 GeV/c

International Nuclear Information System (INIS)

Batyunya, B.V.; Boguslavsky, I.V.; Gramenitsky, I.M.; Lednicky, R.; Vrba, V.; Zlatanov, Z.; Fillipova, V.V.; Samoilov, V.V.; Temiraliev, T.; Levonian, S.V.; Villanen, P.; Walck, E.; Dementiev, R.K.; Korzhavina, I.A.; Leikin, E.M.; Puzyrnyi, A.G.; Rud, V.I.; Tikhonova, L.A.; Herynek, I.; Lokajicek, M.; Ridky, J.; Simak, V.; Leitner, R.; Suk, M.; Valkarova, A.; Kuratashvili, G.O.; Topuria, T.P.; Tsintsadze, V.D.

1985-01-01

All anti pp events at 22.4 GeV/c were separated into nonannihilation (N-group) and enriched annihilation (A-group) events. The mean sphericity value for the A-sample is in accordance with e + e - , K - p and π - p data. The experimental value of for events from the A-sample is larger than the value for N-events for all multiplicities. Mean charge transfer is found to be very sensitive to the dynamics of the process. The experimental value of mean charge transfer is = -0.25 if possible particle misidentification is taken into account. The experimental data are compared with the quark-parton model predictions. (orig.)

Electric dipole moments and polarizabilities of small Bi{sub n} (n = 2-24, 40, 80) clusters

Energy Technology Data Exchange (ETDEWEB)

Zhang, Song; Yuan, Hong Kuan; Chen, Hong; Wu, Bo [School of Physical Science and Technology, Southwest University, Chongqing 400715 (China); Kuang, An Long [School of Physical Science and Technology, Southwest University, Chongqing 400715 (China); School of Physical Science and Technology, Suzhou University, Suzhou 215006 (China)

2012-01-15

The electric dipole moments (EDMs) and polarizabilities of small Bi{sub n} (n = 2-24, 40, 80) clusters are investigated by the finite field method within density functional theory (DFT). The results show that both dipole moments and polarizabilities have even-odd oscillation behaviors, and they strongly depend on geometrical structures and electronic structures. High symmetry structure prohibits the occurrence of EDMs on Bi clusters. The increasing polarizabilities of Bi clusters are attributed to the inherent novel chain-like geometrical evolution, which is significantly different from the characters observed in metal clusters or semiconductor clusters. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

226Ra, 228Ra, 223Ra, and 224Ra in coastal waters with application to coastal dynamics and groundwater input

International Nuclear Information System (INIS)

Moore, W.S.

1997-01-01

Four radium isotopes offer promise in unraveling the complex dynamics of coastal ocean circulation and groundwater input. Each isotope is produced by decay of a thorium parent bound to sediment. The activities of these thorium isotopes and the sediment-water distribution coefficient for radium provide an estimate of the source function of each Ra isotope to the water. In salt marshes that receive little surface water input, Ra activities which exceed coastal ocean values must originate within the marsh. In North Inlet, South Carolina, the activities of 226 Ra exported from the marsh far exceed the activities generated within the marsh. To supply the exported activities, substantial groundwater input is required. In the coastal region itself, 226 Ra activities exceed the amount that can be supplied from rivers. Here also, substantial groundwater input is required. Within the coastal ocean, 223 Ra and 224 Ra may be used to determine mixing rates with offshore waters. Shore-perpendicular profiles of 223 Ra and 224 Ra show consistent trends which may be modeled as eddy diffusion coefficients of 350-540 m 2 s -1 . These coefficients allow an assessment of cross-shelf transport and provide further insight on the importance of groundwater to coastal regions. (author)

Invariant cross sections for inclusive reactions anti pp→π++X and anti pp→p+X at 22.4 GeV/c

International Nuclear Information System (INIS)

Boos, E.G.; Temiraliev, T.; Samojlov, V.V.

1977-01-01

Invariant inclusive cross sections for π + mesons and protons from antipp reactions at 22.4 GeV/c are presented. The average multiplicity for production of π + mesons is 1.92+-0.02 and for protons 0.41+-0.02. Annihilation spectra have been approximated by using the difference between antipp and pp data. The resulting distributions have similar gross features as the total antipp data. (author)

A Chemically Modified Curcumin (CMC 2.24) Inhibits Nuclear Factor κB Activation and Inflammatory Bone Loss in Murine Models of LPS-Induced Experimental Periodontitis and Diabetes-Associated Natural Periodontitis.

Science.gov (United States)

Elburki, Muna S; Rossa, Carlos; Guimarães-Stabili, Morgana R; Lee, Hsi-Ming; Curylofo-Zotti, Fabiana A; Johnson, Francis; Golub, Lorne M

2017-08-01

The purpose of this study was to assess the effect of a novel chemically modified curcumin (CMC 2.24) on NF-κB and MAPK signaling and inflammatory cytokine production in two experimental models of periodontal disease in rats. Experimental model I: Periodontitis was induced by repeated injections of LPS into the gingiva (3×/week, 3 weeks); control rats received vehicle injections. CMC 2.24, or the vehicle, was administered by daily oral gavage for 4 weeks. Experimental model II: Diabetes was induced in adult male rats by streptozotocin injection; periodontal breakdown then results as a complication of uncontrolled hyperglycemia. Non-diabetic rats served as controls. CMC 2.24, or the vehicle, was administered by oral gavage daily for 3 weeks to the diabetics. Hemimaxillae and gingival tissues were harvested, and bone loss was assessed radiographically. Gingival tissues were pooled according to the experimental conditions and processed for the analysis of matrix metalloproteinases (MMPs) and bone-resorptive cytokines. Activation of p38 MAPK and NF-κB signaling pathways was assessed by western blot. Both LPS and diabetes induced an inflammatory process in the gingival tissues associated with excessive alveolar bone resorption and increased activation of p65 (NF-κB) and p38 MAPK. In both models, the administration of CMC 2.24 produced a marked reduction of inflammatory cytokines and MMPs in the gingival tissues, decreased bone loss, and decreased activation of p65 (NF-κB) and p38 MAPK. Inhibition of these cell signaling pathways by this novel tri-ketonic curcuminoid (natural curcumin is di-ketonic) may play a role in its therapeutic efficacy in locally and systemically associated periodontitis.

Behaviour of uranium series radionuclides in surface water (Crouzille, Limousin). Geochemical implications

International Nuclear Information System (INIS)

Moulin, J.

2008-06-01

Understanding natural radionuclides behaviour in surface water is a required step to achieve uranium mine rehabilitation and preserve water quality. The first objective of this thesis is to determine which are the radionuclides sources in a drinking water reservoir. The second objective is to improve the knowledge about the behaviour of uranium series radionuclides, especially actinium. The investigated site is a brook (Sagnes, Limousin, France) which floods a peat bog contaminated by a former uranium mine and which empties into the Crouzille lake. It allows studying radionuclides transport in surface water and radionuclides retention through organic substance or water reservoir. Radionuclides distribution in particulate, colloidal and dissolved phases is determined thanks to ultra-filtrations. Gamma spectrometry allows measuring almost all natural radionuclides with only two counting stages. However, low activities of 235 U series radionuclides impose the use of very low background well-type Ge detectors, such as those of the Underground Laboratory of Modane (France). Firstly, this study shows that no or few radionuclides are released by the Sagnes peat bog, although its radioactivity is important. Secondly, it provides details on the behaviour of uranium series radionuclides in surface water. More specifically, it provides the first indications of actinium solubility in surface water. Actinium's behaviour is very close to uranium's even if it is a little less soluble. (author)

Clinical Study of 224 Patients with Hypertriglyceridemia Pancreatitis

Directory of Open Access Journals (Sweden)

Xiao-Li Zhang

2015-01-01

Full Text Available Background: Hypertriglyceridemia (HTG is the most common etiology of acute pancreatitis (AP after alcohol and gallstone-induced disease. Elevation of serum triglyceride (TG levels to ≥1000 mg/dl in a patient with AP strongly indicates HTG as the cause. The absolute risk of pancreatitis based on serum TG ≤1000 mg/dl has not been clearly defined. The aims of this study were to address the role of elevated TG levels between 500 and 1000 mg/dl in the clinical course of HTG pancreatitis (HTGP; and assess the relationship between the level of serum TG and disease severity. Methods: A total of 224 HTGP patients between 2007 and 2011 were divided into two subgroups. Totally, 122 patients in Group A had serum TG >1000 mg/dl; 102 patients in Group B had maximal TG levels between 500 and 1000 mg/dl accompanied by lactescent serum; 100 patients with biliary AP and 99 patients with alcoholic AP hospitalized during the study period were enrolled as controls. The clinical and biochemical data were analyzed. Results: The clinical presentation of HTG-induced pancreatitis was similar to other causes. Severe form of AP in Group A was higher than Group B (χ2 = 4.002, P = 0.045. The severity with HTGP was significantly higher as compared to biliary AP (χ2 = 33.533, P = 0.000 and alcoholic AP (χ2 = 7.179, P = 0.007. Systemic complications with HTGP were significantly higher than biliary AP (χ2 = 58.763, P = 0.000. Conclusions: The study demonstrated that TG level ≥500 mg/dl should raise a high degree of suspicion, especially if no other etiology of AP is apparent. The severity of HTGP seems to correlate directly with TG level. HTGP seems be more severe than other causes of AP.

Automated measurement of 224Ra and 226Ra in water

International Nuclear Information System (INIS)

Dimova, N.; Burnett, W.C.; Horwitz, E.P.; Lane-Smith, D.

2007-01-01

We present a new simple approach for automated, non-destructive measurement of the alpha-emitting radium isotopes ( 223 Ra, 224 Ra, and 226 Ra) in water based on the emanation of their respective radon daughters ( 219 Rn, 220 Rn, and 222 Rn). The method combines the high adsorption uptake of MnO 2 Resin for radium (K d =2.4x10 4 ml/g) over a wide pH range with the simplicity of the activity registration using a commercial radon-in-air analyzer (RAD7, DURRIDGE Company, Inc). Radium is first adsorbed onto the MnO 2 Resin by passing a water sample through the resin packed in a gas-tight glass cartridge. The same cartridge is then connected to the radon analyzer via a simple tubing system to circulate air through the resin and a drying system. The efficiency of the proposed system is determined by running standards prepared in the same manner. Our results indicate that the efficiency for 226 Ra is >22% if both 218 Po and 214 Po counts are collected. This is comparable with typical efficiencies for alpha spectrometry but with much less sample preparation. We estimate that an MDA of 0.8 pCi/L for 226 Ra may be obtained with this new approach using a 1 L water sample and less than 4 h of counting

Study of the origin of elements of the uranium-235 family observed in excess in the vicinity of the experimental nuclear EL4 reactor under dismantling. Lessons got at this day and conclusions

International Nuclear Information System (INIS)

2007-01-01

This study resumes the discovery of an excess of actinium 227 found around by EL4 nuclear reactor actually in dismantling. The search for the origin of this excess revealed a real inquiry of investigation during three years. Because a nuclear reactor existed in this area a particular attention will have concerned this region. The doubt became the line of conduct to find the answer to the human or natural origin of this excess. Finally and against any evidence, it appears that the origin of this phenomenon was natural, consequence of the particular local geology. The detail of the different investigations is given: search of a possible correlation with the composition of elevations constituent of lanes, search (and underlining) of new sites in the surroundings of the Rusquec pond and the Plouenez station, study of the atmospheric deposits under winds of the nuclear power plant and in the east direction, search of a possible relationship with the gaseous effluents of the nuclear power plant in the past, historical study of radioactive effluents releases in the fifty last years by the analysis of the sedimentary deposits in the Saint-Herbiot reservoir, search of a possible correlation between the excess of actinium 227 and the nuclear power plant activity; search of a possible correlation with a human activity without any relationship with the nuclear activities, search of a correlation with the underground waters, search of a correlation with the geological context, collect of information on the possible transfers in direction of the food chain, determination of the radiological composition of the underground waters ( not perturbed by human activity), search of the cause of an excess of actinium 227 in the old channel of liquid effluents release of the nuclear power plant. The results are given and discussed. And contrary to all expectations the origin of the excess of actinium 227 is completely natural. (N.C.)

Study of the origin of elements of the uranium-235 family observed in excess in the vicinity of the experimental nuclear EL4 reactor under dismantling. Lessons got at this day and conclusions; Etude de l'origine des elements de la famille de l'uranium-235 observes en exces dans les environs du reacteur nucleaire experimental EL4 en cours de demantelement. Enseignements retires a ce jour et conclusion

Energy Technology Data Exchange (ETDEWEB)

NONE

2007-07-01

This study resumes the discovery of an excess of actinium 227 found around by EL4 nuclear reactor actually in dismantling. The search for the origin of this excess revealed a real inquiry of investigation during three years. Because a nuclear reactor existed in this area a particular attention will have concerned this region. The doubt became the line of conduct to find the answer to the human or natural origin of this excess. Finally and against any evidence, it appears that the origin of this phenomenon was natural, consequence of the particular local geology. The detail of the different investigations is given: search of a possible correlation with the composition of elevations constituent of lanes, search (and underlining) of new sites in the surroundings of the Rusquec pond and the Plouenez station, study of the atmospheric deposits under winds of the nuclear power plant and in the east direction, search of a possible relationship with the gaseous effluents of the nuclear power plant in the past, historical study of radioactive effluents releases in the fifty last years by the analysis of the sedimentary deposits in the Saint-Herbiot reservoir, search of a possible correlation between the excess of actinium 227 and the nuclear power plant activity; search of a possible correlation with a human activity without any relationship with the nuclear activities, search of a correlation with the underground waters, search of a correlation with the geological context, collect of information on the possible transfers in direction of the food chain, determination of the radiological composition of the underground waters ( not perturbed by human activity), search of the cause of an excess of actinium 227 in the old channel of liquid effluents release of the nuclear power plant. The results are given and discussed. And contrary to all expectations the origin of the excess of actinium 227 is completely natural. (N.C.)

Sorption studies of radioelements on geological materials

International Nuclear Information System (INIS)

Berry, John A.; Yui, Mikazu; Kitamura, Akira

2007-11-01

Batch sorption experiments have been carried out to study the sorption of uranium, technetium, curium, neptunium, actinium, protactinium, polonium, americium and plutonium onto bentonite, granodiorite and tuff. Mathematical modelling using the HARPHRQ program and the HATCHES database was carried out to predict the speciation of uranium and technetium in the equilibrated seawater, and neptunium, americium and plutonium in the rock equilibrated water. Review of the literature for thermodynamic data for curium, actinium, protactinium and polonium was carried out. Where sufficient data were available, predictions of the speciation and solubility were made. This report is a summary report of the experimental work conducted by AEA Technology during April 1991-March 1998, and the main results have been presented at Material Research Society Symposium Proceedings and published as proceedings of them. (author)

Theoretical stusy of the reaction between 2,2',4' - trihydroxyazobenzene-5-sulfonic acid and zirconium

Science.gov (United States)

Fletcher, Mary H.

1960-01-01

Zirconium reacts with 2,2',4'-trihydroxyazobenzene-5-sulfonic acid in acid solutions to Form two complexes in which the ratios of dye to zirconium are 1 to 1 and 2 to 1. Both complexes are true chelates, with zirconium acting as a bridge between the two orthohydroxy dye groups. Apparent equilibrium constants for the reactions to form each of the complexes are determined. The reactions are used as a basis for the determination of the active component in the dye and a graphical method for the determination of reagent purity is described. Four absorption spectra covering the wave length region from 350 to 750 mu are given, which completely define the color system associated with the reactions in solutions where the hydrochloric acid concentration ranges from 0.0064N to about 7N.

On the singlet projector and the monodromy relation for psu(2,2|4) spin chains and reduction to subsectors

International Nuclear Information System (INIS)

Kazama, Yoichi; Komatsu, Shota; Nishimura, Takuya

2015-01-01

As a step toward uncovering the relation between the weak and the strong coupling regimes of the N=4 super Yang-Mills theory beyond the spectral level, we have developed in a previous paper [arXiv:1410.8533] a novel group theoretic interpretation of the Wick contraction of the fields, which allowed us to compute a much more general class of three-point functions in the SU(2) sector, as in the case of strong coupling [arXiv:1312.3727], directly in terms of the determinant representation of the partial domain wall partition function. Furthermore, we derived a non-trivial identity for the three point functions with monodromy operators inserted, being the discrete counterpart of the global monodromy condition which played such a crucial role in the computation at strong coupling. In this companion paper, we shall extend our study to the entire psu(2,2|4) sector and obtain several important generalizations. They include in particular (i) the manifestly conformally covariant construction, from the basic principle, of the singlet-projection operator for performing the Wick contraction and (ii) the derivation of the monodromy relation for the case of the so-called “harmonic R-matrix”, as well as for the usual fundamental R-matrtix. The former case, which is new and has features rather different from the latter, is expected to have important applications. We also describe how the form of the monodromy relation is modified as psu(2,2|4) is reduced to its subsectors.

[The influence of N-, S-containing chinasolone derivatives (NC-224) on the biochemical and physicochemical parameters of membrane endoplasmatic reticulum and nuclear chromatine fractions of rats liver cells in conditions of its injury by tetrachloromethane].

Science.gov (United States)

Gubs'kyî, Iu I; Goriushko, G G; Belenichev, I F; Kovalenko, S I; Litvinova, N V; Marchenko, O M; Kurapova, T M; Babenko, L P; Velychko, O M

2010-01-01

Using biochemical and physicochemical methods of investigation in vivo, the effect of the substance NC-224, N-, S-chinasolone-derivative, on the lipoperoxidation activity in rat liver endoplasmatic reticulum membranes and nuclear chromatin fractions under tetrachloromethane intoxication have been studied. It was shown that NC-224 has pronounced antioxidant activity which is the biochemical basis of the substance membrane- and genome-protective effects and its ability to restore physicochemical properties of the surface and hydrophobic zones of hepatocyte membranes and structural parameter nuclear chromatin fractions in the conditions of chemical liver injury.

Comparative study of chance coincidence correction in measuring 223Ra and 224Ra by delay coincidence method

International Nuclear Information System (INIS)

Yan Yongjun; Huang Derong; Zhou Jianliang; Qiu Shoukang

2013-01-01

The delay coincidence measurement of 220 Rn and 219 Rn has been proved to be a valid indirect method for measuring 224 Ra and 223 Ra extracted from natural water, which can provide valuable information on estuarine/ocean mixing, submarine groundwater discharge, and water/soil interactions. In practical operation chance coincidence correction must be considered, mostly Moore's correction method, but Moore's and Giffin's methods were incomplete in some ways. In this paper the modification (method 1) and a new chance coincidence correction formula (method 2) were provided. Experiments results are presented to demonstrate the conclusions. The results show that precision is improved while counting rate is less than 70 min- 1 . (authors)

Selenium nanoparticles prevents lead acetate-induced hypothyroidism and oxidative damage of thyroid tissues in male rats through modulation of selenoenzymes and suppression of miR-224.

Science.gov (United States)

Atteia, Hebatallah Husseini; Arafa, Manar Hamed; Prabahar, Kousalya

2018-03-01

Selenium nanoparticles (Se-NPs) are customizable drug delivery vehicles that show good bioavailability, higher efficacy and lower toxicity than ordinary Se. Pre-treatment of male rats with these NPs has been recently shown to exert a protective effect against chromium-induced thyroid dysfunction. This study, therefore, aimed to investigate and characterize the potential protective mechanism of Se-NPs against lead (Pb) acetate-induced thyrotoxicity. We found that prophylactic and concurrent treatment of Pb acetate-exposed rats with Nano-Se (0.5 mg/kg, i.p) for 15 wk significantly alleviated the decrease in free triiodothyronine (fT3) and free thyroxine (fT4) levels as well as fT3/fT4 ratio% and the increase in thyroid stimulating hormone (TSH) levels to approach control values. This was accompanied by a reduction in the accumulation of Pb in serum and thyroid tissues as well as maintenance of thyroidal pro-oxidant/antioxidant balance and iodothyronine deiodinase type 1 (ID1), an essential enzyme for metabolizing of T4 into active T3, gene expression. Surprisingly, miR-224, a direct complementary target of ID1 mRNA, expression in the thyroid tissues was significantly down-regulated in Nano-Se-pre- and co-treated Pb acetate intoxicated animals. Such changes in miR-224 expression were negatively correlated with the changes in ID1 gene expression and serum fT3 level. These results suggest that Se-NPs can rescue from Pb-induced impairment of thyroid function through the maintenance of selenoproteins and down-regulation of miR-224. Copyright © 2018 Elsevier Masson SAS. All rights reserved.

Local Control of Lung Derived Tumors by Diffusing Alpha-Emitting Atoms Released From Intratumoral Wires Loaded With Radium-224

International Nuclear Information System (INIS)

Cooks, Tomer; Schmidt, Michael; Bittan, Hadas; Lazarov, Elinor; Arazi, Lior; Kelson, Itzhak; Keisari, Yona

2009-01-01

Purpose: Diffusing alpha-emitters radiation therapy (DART) is a new form of brachytherapy enabling the treatment of solid tumors with alpha radiation. The present study examines the antitumoral effects resulting from the release of alpha emitting radioisotopes into solid lung carcinoma (LL2, A427, and NCI-H520). Methods and Materials: An in vitro setup tested the dose-dependent killing of tumor cells exposed to alpha particles. In in vivo studies, radioactive wires (0.3 mm diameter, 5 mm long) with 224 Ra activities in the range of 21-38 kBq were inserted into LL/2 tumors in C57BL/6 mice and into human-derived A427 or NCI-H520 tumors in athymic mice. The efficacy of the short-lived daughters of 224 Ra to produce tumor growth retardation and prolong life was assessed, and the spread of radioisotopes inside tumors was measured using autoradiography. Results: The insertion of a single DART wire into the center of 6- to 7-mm tumors had a pronounced retardation effect on tumor growth, leading to a significant inhibition of 49% (LL2) and 93% (A427) in tumor development and prolongations of 48% (LL2) in life expectancy. In the human model, more than 80% of the treated tumors disappeared or shrunk. Autoradiographic analysis of the treated sectioned tissue revealed the intratumoral distribution of the radioisotopes, and histological analysis showed corresponding areas of necrosis. In vitro experiments demonstrated a dose-dependent killing of tumors cells exposed to alpha particles. Conclusions: Short-lived diffusing alpha-emitters produced tumor growth retardation and increased survival in mice bearing lung tumor implants. These results justify further investigations with improved dose distributions.

Single-particle inclusive spectra of charged particles in anti- pp-interactions at 22.4 GeV/c

International Nuclear Information System (INIS)

Boos, E.G.; Samojlov, V.V.; Takibaev, Zh.S.

1976-01-01

The inclusive spectra for inelastic anti-pp-interactions are investigated. Distributions of the transverse momentum squared for negative and positive particles as well as for identified protons have been obtained. The missing mass-squared distributions to the identified protons have been determined for different topologies of the experiment. The rapidity and target fragmentation cross-sections distributions have been obtained for the anti-pp → π - (π + )+X reactions in the center-of-mass-system. Average characteristics of the transverse momentum distribution show similar features as well as those obtained at higher than 22.4 GeV/c elsewhere. The upper limit of the antiproton diffraction dissociation cross section is 3.68+-0.45 mb. In the central region a charge asymmetry has been observed, the asymmetry parameter being equal to 0.15+-0.01

Occurrence of Radium-224, Radium-226 and Radium-228 in Water from the Vincentown and Wenonah-Mount Laurel Aquifers, the Englishtown Aquifer System, and the Hornerstown and Red Bank Sands, Southwestern and South-Central New Jersey

Science.gov (United States)

dePaul, Vincent T.; Szabo, Zoltan

2007-01-01

This investigation is the first regionally focused study of the presence of natural radioactivity in water from the Vincentown and Wenonah-Mount Laurel aquifers, Englishtown aquifer system, and the Hornerstown and Red Bank Sands. Geologic materials composing the Vincentown and Wenonah-Mount Laurel aquifers and the Hornerstown and Red Bank Sands previously have been reported to contain radioactive (uranium-enriched) phosphatic strata, which is common in deposits from some moderate-depth coastal marine environments. The decay of uranium and thorium gives rise to natural radioactivity and numerous radioactive progeny, including isotopes of radium. Naturally occurring radioactive isotopes, especially those of radium, are of concern because radium is a known human carcinogen and ingestion (especially in water used for drinking) can present appreciable health risks. A regional network in southwestern and south-central New Jersey of 39 wells completed in the Vincentown and Wenonah-Mount Laurel aquifers, the Englishtown aquifer system, and the Hornerstown and Red Bank Sands was sampled for determination of gross alpha-particle activity; concentrations of radium radionuclides, major ions, and selected trace elements; and physical properties. Concentrations of radium-224, radium-226, and radium-228 were determined for water from 28 of the 39 wells, whereas gross alpha-particle activity was determined for all 39. The alpha spectroscopic technique was used to determine concentrations of radium-224, which ranged from less than 0.5 to 2.7 pCi/L with a median concentration of less than 0.5pCi/L, and of radium-226, which ranged from less than 0.5 to 3.2 pCi/L with a median concentration of less than 0.5 pCi/L. The beta-counting technique was used to determine concentrations of radium-228. The concentration of radium-228 ranged from less than 0.5 to 4.3 pCi/L with a median of less than 0.5. Radium-228, when quantifiable, had the greatest concentration of the three radium

High vacuum test of the dynamic components of the cyclotron dee chamber at the 224 cm variable energy cyclotron

International Nuclear Information System (INIS)

Chintalapudi, S.N.; Bandopadhyay, D.K.; Ghosh, D.K.; Gowariker, S.R.

1979-01-01

The 224 cm Variable Energy Cyclotron constructed and commissioned at Calcutta comprises a number of dynamic components in the high vacuum Dee Chamber. The static and dynamic conditions of these components have to be tested for high vacuum worthiness prior to their installation in the Dee Tank. A special set up was fabricated and used for simulating the Dee Chamber conditions and testing the components. A high vacuum of the order of 1 x 10 -5 torr was achieved under both dynamic and static conditions with and without coolant hydraulic pressures. The details of the set up, methods employed for the various tests carried out and the results obtained are described. (auth.)

Formation and evolution of ultrafine particles produced by radiolysis and photolysis

International Nuclear Information System (INIS)

Madelaine, G.J.; Perrin, M.L.; Renoux, A.

1980-01-01

Results are presented, concerning the formation, the size distribution, and the behavior of ultrafine particles produced by alpha disintegration of actinium and uv irradiation in filtered and natural atmospheric air. The characterization of these particles is obtained by electrical aerosol analyzer and diffusion battery method. Measurements are made in the range between 0.003 and 0.5 micrometer. Some qualitative indications are obtained on the different mechanisms which govern the evolution of ultrafine particles in the atmosphere (nucleation, coagulation, and condensation). It is now well established that the photo-oxydation of SO 2 in the atmosphere leads to the production of sulphuric acid and of sulphate, which are usually found in the form of submicronic particles. This paper concerns the evolution of ultrafine particles generated in the presence of a preexisting aerosol. They are either instantaneously produced by the alpha disintegrations of actinium 219 or continuously produced by the transformation of SO 2 under uv irradiation

Actinide metals

Energy Technology Data Exchange (ETDEWEB)

Brown, Paul L. [Geochem Australia, Kiama, NSW (Australia); Ekberg, Christian [Chalmers Univ. of Technology, Goeteborg (Sweden). Nuclear Chemistry/Industrial Materials Recycling

2016-07-01

All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO{sub 2}OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH{sup 2+} for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.

Status of liquid metal reactor development in the United States of America

International Nuclear Information System (INIS)

Griffith, J.D.; Horton, K.E.

1991-01-01

An existing network of government and industry research facilities and engineering test centers in the United States is currently providing test capabilities and the technical expertise required to conduct an aggressive advanced reactor development program. Subsequent to the directive to shut down the Fast Flux Test Facility in early 1990, a variety of activities were undertaken to provide support for continued operation. The United States has made substantial progress in achieving ALMR program objectives. The metal fuel cycle is designed to recycle and burn its own actiniums, and has the potential to be a very effective burner of actiniums generated in the LWRs. The current emphasis in the IFR Program is on the comprehensive development of the IFR (Integral Fast Reactor) technology, to be followed by a period of technology demonstration which would verify the economic feasibility of the concept. The United States has been active in international cooperative activities in the fast reactor sector since 1969. (author). 11 figs, 1 tab

Actinide metals

International Nuclear Information System (INIS)

Brown, Paul L.; Ekberg, Christian

2016-01-01

All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO 2 OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH 2+ for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.

Determination of 226Ra and 224Ra in sediments samples by liquid scintillation counting

International Nuclear Information System (INIS)

Villa, M.; Moreno, H.P.; Manjon, G.

2005-01-01

An experimental procedure has been developed for a rapid determination of the activity concentration of 226 Ra and 224 Ra in sediments by liquid scintillation counting. The importance of the method lies in its application to the measurement of sediments where the Ra-isotopes activity concentration has been increased due to an anthropomorphic enhancement based on releases of naturally occurring radioactive material (NORM). A sample pre-treatment, including a digestion with aqua regia and a precipitation of hydroxides, was applied to samples before the radium extraction, which was made by co-precipitation with barium. Measurements were done in a low background scintillation spectrometer Quantulus 1220, which can separate and detect simultaneously α and β particles. Additionally, some improvements are suggested for a better α and β interference correction of the results. The obtaining of radiochemical yields is also improved using 133 Ba as tracer, which decays by emission of conversion electrons and γ-rays; the wide range of radiochemical yields obtained confirms the need of this analyses. The procedure has been applied to the measurement of riverbed sediments from an estuary in the south-west of Spain, affected in the past by direct and indirect phosphogypsum discharges

Mutagenic activity of 2-(2',4'-diaminophenoxy)ethanol in strains TA1538 and TA98 of Salmonella typhimurium.

Science.gov (United States)

Mohn, G; Bouter, S; de Knijff, P

1982-12-01

The mutagenicity of 2-(2',4'-diaminophenoxy)ethanol (2,4-DAPE) was compared with that of 2,4-diaminoanisole (2,4-DAA), a chemically related compound previously used in hair-dye formulations. Both chemicals were tested in standard procedures with the Salmonella/microsome mutagenicity test as described by Ames and colleagues. In several experiments, which extended over a total period of 2 years, 2,4-DAA exhibited definite, but variable mutagenicity toward strain TA1538 when S9 preparations of rat liver induced with Aroclor 1254 were present in the incubation mixtures. The compound 2,4-DAPE did not exhibit detectable mutagenic activity when tested concomitantly under the same experimental conditions. We conclude that 2,4-DAPE is not mutagenic for Salmonella under conditions of the standard mammalian microsome assay with strain TA1538 and TA98 as indicators.

DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS

Energy Technology Data Exchange (ETDEWEB)

P. Bernot

2005-07-13

The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this activity is to predict dissolved concentrations or solubility limits for elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) relevant to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are provided in the form of tabulated functions with pH and log fCO{sub 2} as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. Even though selection of an appropriate set of radionuclides documented in Radionuclide Screening (BSC 2002 [DIRS 160059]) includes actinium, transport of Ac is not modeled in the total system performance assessment for the license application (TSPA-LA) model because of its extremely short half-life. Actinium dose is calculated in the TSPA-LA by assuming secular equilibrium with {sup 231}Pa (Section 6.10); therefore, Ac is not analyzed in this report. The output data from this report are fundamental inputs for TSPA-LA used to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for the actinides discussed in this report. These models cover broad ranges of environmental conditions so they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or

DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS

International Nuclear Information System (INIS)

P. Bernot

2005-01-01

The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this activity is to predict dissolved concentrations or solubility limits for elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) relevant to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are provided in the form of tabulated functions with pH and log fCO 2 as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. Even though selection of an appropriate set of radionuclides documented in Radionuclide Screening (BSC 2002 [DIRS 160059]) includes actinium, transport of Ac is not modeled in the total system performance assessment for the license application (TSPA-LA) model because of its extremely short half-life. Actinium dose is calculated in the TSPA-LA by assuming secular equilibrium with 231 Pa (Section 6.10); therefore, Ac is not analyzed in this report. The output data from this report are fundamental inputs for TSPA-LA used to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for the actinides discussed in this report. These models cover broad ranges of environmental conditions so they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or otherwise

Kinetics of radioisotope exchange between brine and rock in a geothermal system

International Nuclear Information System (INIS)

Hammond, D.E.; Zukin, J.G.; Teh-Lung Ku

1988-01-01

A wide range of isotopes in the /sup 238/U, /sup 235/U, and /sup 232/Th decay chains was measured in geothermal brines collected from two production zones at 1898 and 3220 m in the Salton Sea Scientific Drilling Project well. High concentrations of radium, radon, and lead isotopes are generated and maintained by the input of these isotopes from solid phases into brine by both recoil and leaching processes, by the high chloride content of the brine which complexes radium and lead, and by the apparent absence of suitable unoccupied adsorption sites. In contrast, uranium, thorium, actinium, bismuth, and polonium isotopes all have low concentrations due to their efficient sorption from brine to rock. Measurements of short-lived isotopes in these decay series yield insights regarding the mechanisms controlling radioisotope exchange, and they permit estimation of rates of brine-rock interaction. For example, the /sup 228/Ac//sup 228/Ra activity ratio of 0.2 in brines indicates that the mean residence time of actinium in solution before sorption onto solid surfaces is less than 2.5 hours

Performance of 22.4-kW nonlaminated-frame dc series motor with chopper controller. [a dc to dc voltage converter

Science.gov (United States)

Schwab, J. R.

1979-01-01

Performance data obtained through experimental testing of a 22.4 kW traction motor using two types of excitation are presented. Ripple free dc from a motor-generator set for baseline data and pulse width modulated dc as supplied by a battery pack and chopper controller were used for excitation. For the same average values of input voltage and current, the motor power output was independent of the type of excitation. However, at the same speeds, the motor efficiency at low power output (corresponding to low duty cycle of the controller) was 5 to 10 percentage points lower on chopped dc than on ripple free dc. The chopped dc locked-rotor torque was approximately 1 to 3 percent greater than the ripple free dc torque for the same average current.

Cataracts in patients injected with a solution of radium 224, colloidal platinum, and the red dye eosin (Peteosthor)

International Nuclear Information System (INIS)

Stefani, F.H.; Spiess, H.

1989-01-01

Among 218 patients in the Spiess series injected with 224 Ra as juveniles from 1943 to about 1952, 91 have died leaving 127 alive. Of these, 47 have been examined in detail with a slitlamp by an ophthalmologist and 25 were found to have some kind of lens opacity. In 14 out of the 25 the cataracts appeared morphologically similar to age-related cataracts. In 11 patients there was a bilateral posterior subcapsular cataract. In eight this was a bilateral dense round plaque with a clear subcapsular zone of about 0.5-0.6 mm. This clear zone corresponds to newly deposited lens fibres during the period of about 40 years from treatment to examination. By June 1984, 12 of the 218 were reported to have had cataract as cause of decreased visual acuity. The present study found 32 patients (25 examined recently and seven others) with cataract confirmed with a slitlamp by August 1988. Three additionally reported cataracts could not be updated. (author)

Cataracts in patients injected with a solution of radium 224, colloidal platinum, and the red dye eosin (Peteosthor)

International Nuclear Information System (INIS)

Stefani, F.H.; Spiess, H.; Mays, C.W.

1989-01-01

Among 218 patients in the Spiess series injected with 224 Ra as juveniles from 1943 to about 1952, 91 have died. Of the 127 survivors, 47 have been examined in detail with a slitlamp and 25 were found to have some kind of lens opacity. In 14 out of the 25 the cataracts appeared morphologically similar to age-related cataracts. In 11 patients there was a bilateral posterior subcapsular cataract. In eight this was a bilateral dense round plaque with a clear subcapsular zone of about 0.5-0.6 mm, corresponding to newly deposited lens fibres during the period of about 40 years from treatment to examination. By June 1984, 12 of the 218 patients were reported to have had cataract as cause of decreased visual acuity. The present study found 32 patients (25 examined recently and seven others) with cataract confirmed with a slitlamp by August 1988. Three additionally reported cataracts could not be updated. (author)

LASL experience in decontamination of the environment

International Nuclear Information System (INIS)

Ahlquist, A.J.

1981-01-01

This discussion represents one part of a major effort in soil decontamination at the Los Alamos site. A contaminated industrial waste line in the Los Alamos townsite was removed, and a plutonium incineration facility, and a filter building contaminated with actinium-227 were dismantled. The former plutonium handling facility has been decontaminated, and canyons and an old firing site contaminated with strontium-90 have been surveyed

Determination of radionuclides in discharged water from gold ...

African Journals Online (AJOL)

Long-lived radionuclides from the Uranium-, Thorium- and Actinium-decay chains in the discharged water into the environment were radiochemically separated and the activity concentrations determined for 238U-series ranged from 3.8 ± 1.5 to 178 ± 19 mBqL-1, 232Th-series ranged from < 2.0 to 47.8 ± 7.3 mBqL-1 and ...

The reverse protraction factor in the induction of bone sarcomas in radium-224 patients

International Nuclear Information System (INIS)

Chmelevsky, D.; Spiess, H.; Mays, C.W.; Kellerer, A.M.

1990-01-01

More than 50 bone sarcomas have occurred among a collective of about 800 patients who had been injected in Germany after World War II with large activities of radium-224 for the intended treatment of bone tuberculosis and ankylosing spondylitis. In an earlier analysis it was concluded that, at equal mean absorbed doses in the skeleton, patients with longer exposure time had a higher incidence of bone sarcomas. The previous analysis was based on approximations; in particular, it did not account for the varying times at risk of the individual patients. In view of the implications of a reverse protraction factor for basic considerations in radiation protection, the need was therefore felt to reevaluate the data from the continued follow-up by more rigorous statistical methods. A first step of the analysis demonstrates the existence of the reverse dose-rate effect in terms of a suitably constructed rank-order test. In a second step of the analysis it is concluded that the data are consistent with a linear no-threshold dose dependence under the condition of constant exposure time, while there is a steeper than linear dependence on dose when the exposure times increase proportionally to dose. A maximum likelihood fit of the data is then performed in terms of a proportional hazards model that includes the individual parameters, dose, treatment duration, and age at treatment. The fit indicates proportionality of the tumor rates to mean skeletal dose with an added factor (1 + 0.18.tau), where tau is the treatment time in months. This indicates that a protraction of the injections over 15 months instead of 5 months doubles the risk of bone sarcoma

An aerial radiological survey of the Sandia National Laboratories and surrounding area

International Nuclear Information System (INIS)

Riedhauser, S.R.

1994-06-01

A team from the Remote Sensing Laboratory conducted an aerial radiological survey of the area surrounding the Sandia National Laboratories and Kirtland Air Force Base in Albuquerque, New Mexico, during March and April 1993. The survey team measured the terrestrial gamma radiation at the site to determine the levels of natural and man-made radiation. This survey includes the areas covered by a previous survey in 1981. The results of the aerial survey show a background exposure rate which varies between 5 and 18 μR/h plus an approximate 6 μR/h contribution from cosmic rays. The major radioactive isotopes found in this survey were: potassium-40, thallium-208, bismuth-214, and actinium-228, which are all naturally-occurring isotopes, and cobalt-60, cesium-137, and excess amounts of thallium-208 and actinium-228, which are due to human actions in the survey area. In regions away from man-made activity, the exposure rates inferred from this survey's gamma ray measurements agree almost exactly with the exposure rates inferred from the 1981 survey. In addition to the aerial measurements, another survey team conducted in situ and soil sample radiation measurements at three sites within the survey perimeter. These ground-based measurements agree with the aerial measurements within ± 5%

Optically active antifungal azoles. XII. Synthesis and antifungal activity of the water-soluble prodrugs of 1-[(1R,2R)-2-(2,4-difluorophenyl)-2-hydroxy-1-methyl-3-(1H-1,2,4-triazol-1-yl)propyl]-3-[4-(1H-1-tetrazolyl)phenyl]-2-imidazolidinone.

Science.gov (United States)

Ichikawa, T; Kitazaki, T; Matsushita, Y; Yamada, M; Hayashi, R; Yamaguchi, M; Kiyota, Y; Okonogi, K; Itoh, K

2001-09-01

1-[(1R,2R)-2-(2,4-Difluorophenyl)-2-hydroxy-1-methyl-3-(1H-1,2,4-triazol-1-yl)propyl]-3-[4-(1H-1-tetrazolyl)phenyl]-2-imidazolidinone (1: TAK-456) was selected as a candidate for clinical trials, but since its water-solubility was insufficient for an injectable formulation, the quaternary triazolium salts 2 were designed as water-soluble prodrugs. Among the prodrugs prepared, 4-acetoxymethyl-1-[(2R,3R)-2-(2,4-difluorophenyl)-2-hydroxy-3-[2-oxo-3-[4-(1H-1-terazolyl)phenyl]-1-imidazolidinyl]butyl]-1H-1,2,4-triazolium chloride (2a: TAK-457) was selected as an injectable candidate for clinical trials based on the results of evaluations on solubility, stability, hemolytic effect and in vivo antifungal activities.

Growth and characterization of an organic single crystal: 2-[2-(4-Diethylamino-phenyl)-vinyl]-1-methyl-pyridinium iodide

Science.gov (United States)

Senthil, K.; Kalainathan, S.; Ruban Kumar, A.

Optically transparent crystal of the organic salt DEASI (2-[2-(4-Diethylamino-phenyl)-vinyl]-1-methyl-pyridinium iodide) has been synthesized by using knoevenagel condensation reaction method. The synthesized material has been purified by successfully recrystallization process. Single crystals of DEASI have been grown by slow evaporation technique at room temperature. The solubility of the title material has been determined at different temperature in acetonitrile/methanol mixture. The cell parameters and crystallinity of the title crystal were determined by single crystal XRD. The powder diffraction was carried out to study the reflection plane of the grown crystal and diffraction peaks were indexed. The presence of different functional groups in the crystal was confirmed by Fourier transform infrared (FTIR) analysis. 1H NMR spectrum was recorded to confirm the presence of hydrogen nuclei in the synthesized material. The optical property of the title crystal was studied by UV-Vis-NIR spectroscopic analysis. The melting point and thermal property of DEASI were studied using TGA/DSC technique. The Vicker’s hardness (Hv) was carried out to know the category. The dielectric constant and dielectric loss of the compound decreases with an increase in frequencies. Chemical etching studies showed that the DEASI grows in the two dimensional growth mechanisms. The Kurtz-Perry powder second harmonic generation (SHG) test has done for title crystal.

Growth and characterization of an organic single crystal: 2-[2-(4-diethylamino-phenyl)-vinyl]-1-methyl-pyridinium iodide.

Science.gov (United States)

Senthil, K; Kalainathan, S; Ruban Kumar, A

2014-05-05

Optically transparent crystal of the organic salt DEASI (2-[2-(4-Diethylamino-phenyl)-vinyl]-1-methyl-pyridinium iodide) has been synthesized by using knoevenagel condensation reaction method. The synthesized material has been purified by successfully recrystallization process. Single crystals of DEASI have been grown by slow evaporation technique at room temperature. The solubility of the title material has been determined at different temperature in acetonitrile/methanol mixture. The cell parameters and crystallinity of the title crystal were determined by single crystal XRD. The powder diffraction was carried out to study the reflection plane of the grown crystal and diffraction peaks were indexed. The presence of different functional groups in the crystal was confirmed by Fourier transform infrared (FTIR) analysis. (1)H NMR spectrum was recorded to confirm the presence of hydrogen nuclei in the synthesized material. The optical property of the title crystal was studied by UV-Vis-NIR spectroscopic analysis. The melting point and thermal property of DEASI were studied using TGA/DSC technique. The Vicker's hardness (Hv) was carried out to know the category. The dielectric constant and dielectric loss of the compound decreases with an increase in frequencies. Chemical etching studies showed that the DEASI grows in the two dimensional growth mechanisms. The Kurtz-Perry powder second harmonic generation (SHG) test has done for title crystal. Copyright © 2014 Elsevier B.V. All rights reserved.

Alpha-emitting isotopes and chromium in a coastal California aquifer

Science.gov (United States)

Densmore, Jill N.; Izbicki, John A.; Murtaugh, Joseph M.; Swarzenski, Peter W.; Bullen, Thomas D.

2014-01-01

The unadjusted 72-h gross alpha activities in water from two wells completed in marine and alluvial deposits in a coastal southern California aquifer 40 km north of San Diego were 15 and 25 picoCuries per liter (pCi/L). Although activities were below the Maximum Contaminant Level (MCL) of 15 pCi/L, when adjusted for uranium activity; there is concern that new wells in the area may exceed MCLs, or that future regulations may limit water use from the wells. Coupled well-bore flow and depth-dependent water-quality data collected from the wells in 2011 (with analyses for isotopes within the uranium, actinium, and thorium decay-chains) show gross alpha activity in marine deposits is associated with decay of naturally-occurring 238U and its daughter 234U. Radon activities in marine deposits were as high as 2230 pCi/L. In contrast, gross alpha activities in overlying alluvium within the Piedra de Lumbre watershed, eroded from the nearby San Onofre Hills, were associated with decay of 232Th, including its daughter 224Ra. Radon activities in alluvium from Piedra de Lumbre of 450 pCi/L were lower than in marine deposits. Chromium VI concentrations in marine deposits were less than the California MCL of 10 μg/L (effective July 1, 2014) but δ53Cr compositions were near zero and within reported ranges for anthropogenic chromium. Alluvial deposits from the nearby Las Flores watershed, which drains a larger area having diverse geology, has low alpha activities and chromium as a result of geologic and geochemical conditions and may be more promising for future water-supply development.

Hallucinogen-like effects of 2-([2-(4-cyano-2,5-dimethoxyphenyl) ethylamino]methyl)phenol (25CN-NBOH), a novel N-benzylphenethylamine with 100-fold selectivity for 5-HT2A receptors, in mice

DEFF Research Database (Denmark)

Fantegrossi, William E; Gray, Bradley W; Bailey, Jessica M

2015-01-01

RATIONALE: 2-([2-(4-cyano-2,5-dimethoxyphenyl)ethylamino]methyl)phenol (25CN-NBOH) is structurally similar to N-benzyl substituted phenethylamine hallucinogens currently emerging as drugs of abuse. 25CN-NBOH exhibits dramatic selectivity for 5-HT2A receptors in vitro, but has not been behaviorally...... an intermediate degree of generalization (55 %) for the DOI training dose, and these interoceptive effects were attenuated by M100907. Finally, 25CN-NBOH did not generalize to M100907 at any dose, but ketanserin fully substituted in these animals. CONCLUSIONS: 25CN-NBOH was behaviorally active, but less effective...

Radiometric determination of {sup 226}, {sup 228}Ac and {sup 40}K in fly ashes and building materials

Energy Technology Data Exchange (ETDEWEB)

Harangozo, M; Toelgyessy, J; Lesny, J; Cik, G [Slovak Technical Univ., Bratislava (Slovakia). Fac. of Chemical Technology, Dept. of Environmental Science

1996-12-31

In this paper the activities of radium-226, actinium-228 and potassium-40 in fly ashes and building materials of Slovakia were determined. Different origin of coals combusted results in significant differences in specific activities of radium-226 and activities-228 of measured fly-ashes and building materials. The knowledge of the specific activity of selected nuclides contained in fly-ashes is, therefore, very important and in specific cases can indicate the possibilities of their further technological use. (J.K.) 1 tab., 3 refs.

A Radium-223 microgenerator from cyclotron-produced trace Actinium-227

International Nuclear Information System (INIS)

Abou, Diane S.; Pickett, Juile; Mattson, John E.; Thorek, Daniel L.J.

2017-01-01

The alpha particle emitter Radium-223 dichloride ("2"2"3RaCl_2) has recently been approved for treatment of late-stage bone metastatic prostate cancer. There is considerable interest in studying this new agent outside of the clinical setting, however the supply of "2"2"3Ra is limited and expensive. We have engineered a "2"2"3Ra microgenerator using traces of "2"2"7Ac previously generated from cyclotron-produced "2"2"5Ac. Radiochemically pure "2"2"3RaCl_2 was made, characterized, evaluated in vivo, and the source was recovered in high yield for regeneration of the microgenerator. - Highlights: • A "2"2"3Ra microgenerator was built using residual "2"2"7Ac from cyclotron-produced "2"2"5Ac. • Following "2"2"5Ac decay, the residual "2"2"7Ac was processed into pure "2"2"3Ra. • "2"2"7Ac and "2"2"7Th were recovered in high yield for a permanent supply of "2"2"3Ra. • Clinically supplied and generator-produced "2"2"3Ra have equivalent in vivo distribution. • Microdose column provides sufficient material for research use.

Evaluation of Mir-224, Mir-215 and Mir-143 as Serum Biomarkers for HCV Associated Hepatocellular Carcinoma

Science.gov (United States)

Mamdouh, Samah; Khorshed, Fatma; Aboushousha, Tarek; Hamdy, Hussam; Diab, Ayman; Seleem, Mohamed; Saber, Mohamed

2017-11-26

HCV induced hepatitis and hepatocellular carcinoma as its sequel are major health problems world-wide and especially in Egypt. For diagnosis and during treatment of liver diseases, liver functions are monitored through determination of serum levels of liver enzymes and α-fetoprotein although the obtained information is generally not sufficient for either early detection of hepatic insult or effective follow up of therapeutic effects. More sensitive biomarkers may help to achieve these goals. MiRNAs are small non-coding RNAs that have an important role in gene expression and regulation. Many, such as miR-224, miR-215, miR-143 are correlated with tumor appearance and with the degree of fibrosis in lung, breast and colon cancer. This study was performed to estimate the level of these miRNAs in serum of patients with HCV-associated hepatitis and HCC in relation to grade of hepatitis, stage of fibrosis and differentiation of tumor tissue. In addition, correlations between serological and tissue levels were assessed. A total of 80 patients were examined, out of which 50 were included in the study. Blood samples and tissue specimens from malignant tumor and corresponding non-tumor tissue of HCV hepatitis patients were collected. Blood samples from 20 healthy volunteers were also obtained as controls. It was found that miRNAs profiles differed in HCC patients compared to controls and HCV-associated hepatitis cases. Distinction of tumor grade and fibrosis stage of patients as well as between different grades of tumor differentiation proved possible, making miRNAs promising biomarkers for diagnosis and assessment of treatment response of HCC patients. Creative Commons Attribution License

Purification of cerium, neodymium and gadolinium for low background experiments

Directory of Open Access Journals (Sweden)

Boiko R.S.

2014-01-01

Full Text Available Cerium, neodymium and gadolinium contain double beta active isotopes. The most interesting are 150Nd and 160Gd (promising for 0ν2β search, 136Ce (2β+ candidate with one of the highest Q2β. The main problem of compounds containing lanthanide elements is their high radioactive contamination by uranium, radium, actinium and thorium. The new generation 2β experiments require development of methods for a deep purification of lanthanides from the radioactive elements. A combination of physical and chemical methods was applied to purify cerium, neodymium and gadolinium. Liquid-liquid extraction technique was used to remove traces of Th and U from neodymium, gadolinium and for purification of cerium from Th, U, Ra and K. Co-precipitation and recrystallization methods were utilized for further reduction of the impurities. The radioactive contamination of the samples before and after the purification was tested by using ultra-low-background HPGe gamma spectrometry. As a result of the purification procedure the radioactive contamination of gadolinium oxide (a similar purification efficiency was reached also with cerium and neodymium oxides was decreased from 0.12 Bq/kg to 0.007 Bq/kg in 228Th, from 0.04 Bq/kg to <0.006 Bq/kg in 226Ra, and from 0.9 Bq/kg to 0.04 Bq/kg in 40K. The purification methods are much less efficient for chemically very similar radioactive elements like actinium, lanthanum and lutetium.

'Masurium' and the 'early transuranium elements' or how discovery of nuclear fission was not clearly seen

International Nuclear Information System (INIS)

Keller, C.

1988-01-01

Fifty years after the discovery of fission, the scientific community is aware that this type of nuclear reaction could have been discovered more than a decade earlier. Noddack, Tacke and Berg announced in 1925 the discovery of elements Z = 43 (masurium) and rhenium (Z = 75), the first one could be detected only in U-bearing minerals. A recent re-examination by P.H.M. von Assche of the published data clearly showed that the original claim for element Z = 43 of the authors in 1925 was correct and, therefore, they detected not only element Z = 43 but also the first fission product. Because this discovery of element Z = 43 could not be repeated by other authors as that time, the scientific credibility of Noddack-Tacke was very low in order to give credit to her proposal that the 'early' transuranium elements by Enrico Fermi might also be fragments of known (lighter) elements. Enrico Fermi in 1934 obtained these 'early' (and as we today know: wrong) transuranium isotopes by irradiation of uranium with neutrons. A 'wrong' periodic system in the thirties which placed Th, Pa and U as 6d-elements and not as 5f-actinides chemically helped to consider these fission products as transuranium elements Z = 93/94. In 1937/38 I. Curie and P. Savitch discovered an 'actinium-nuclide' with 3,5 h half-life which, however, had properties similar to lanthanium and not to actinium, as they stated. (orig.) [de

Shape of intrinsic alpha pulse height spectra in lanthanide halide scintillators

Science.gov (United States)

Wolszczak, W.; Dorenbos, P.

2017-06-01

Internal contamination with actinium-227 and its daughters is a serious drawback in low-background applications of lanthanide-based scintillators. In this work we showed the important role of nuclear γ de-excitations on the shape of the internal alpha spectrum measured in scintillators. We calculated with Bateman equations the activities of contamination isotopes and the time evolution of actinium-227 and its progenies. Next, we measured the intrinsic background spectra of LaBr3(Ce), LaBr3(Ce,Sr) and CeBr3 with a digital spectroscopy technique, and we analyzed them with a pulse shape discrimination method (PSD) and a time-amplitude analysis. Finally, we simulated the α background spectrum with Geant4 tool-kit, consequently taking into account complex α-γ-electron events, the α / β ratio dependence on the α energy, and the electron/γ nonproportionality. We found that α-γ mixed events have higher light yield than expected for alpha particles alone, which leads to overestimation of the α / β ratio when it is measured with internal 227Th and 223Ra isotopes. The time-amplitude analysis showed that the α peaks of 219Rn and 215Po in LaBr3(Ce) and LaBr3(Ce,Sr) are not symmetric. We compared the simulation results with the measured data and provided further evidence of the important role of mixed α-γ-electron events for understanding the shape of the internal α spectrum in scintillators.

Actinides

International Nuclear Information System (INIS)

Martinot, L.; Fuger, J.

1985-01-01

The oxidation behavior of the actinides is explained on the basis of their electronic structure. The actinide elements, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium, curium, berkelium, californium, einsteinium, fermium, mendelevium, nobelium, and laurencium are included. For all except the last three elements, the points of discussion are oxidation states, Gibbs energies and potentials, and potential diagram for the element in acid solution; and thermodynamic properties of these same elements are tabulated. References are cited following discussion of each element with a total of 97 references being cited. 13 tables

Calculation of entropy of liquid metals using acoustic measurements in the framework of the rigid sphere model

International Nuclear Information System (INIS)

Tekuchev, V.V.; Barashkov, B.I.; Rygalov, L.N.; Dolzhikov, Yu.S.

2001-01-01

For the first time one obtained the polytherms of ultrasound velocity for liquid high-melting metals within wide temperature range. In terms of the rigid sphere model on the basis of the acoustic data one calculated the entropy values for 34 liquid metals at the melting point. The average discrepancy of the calculated values of entropy with the published one constitutes 8.2%. With increase of metal valency the error increases from 2.8 up to 13%. In case of francium, radium, promethium, actinium, hafnium, polonium, rhenium one obtained data for the first time [ru

Status of the lanthanides and actinides in the periodic table

International Nuclear Information System (INIS)

Holden, N.E.

1985-01-01

In extended discussions and correspondence with Ekkehard Fluck, the author was made aware of a problem with the Periodic Table, i.e., which element should be shown in the main table as the representative of the lanthanide series and the actinide series. In earlier discussion, he came to the conclusion that lanthanum and actinium are not the elements which should appear, but rather lutetium and lawrencium are more appropriate for inclusion in their place. This paper will attempt to justify the reasons for the above conclusions. 4 refs

49 CFR 571.224 - Standard No. 224; Rear impact protection.

Science.gov (United States)

2010-10-01

... supporting frame structure of a motor vehicle. Horizontal member means the structural member of the guard... vehicle's cargo doors, tailgate, or other permanent structures are positioned as they normally are when... equipment that, while the vehicle is in transit, resides in or moves through any portion of the space...

A study of uranium and thorium migration at the Koongarra uranium deposit with application to actinide transport from nuclear waste repositories

International Nuclear Information System (INIS)

Payne, T.E.

1991-01-01

One way to gain confidence in modelling possible radionuclide releases is to study natural systems which are similar to components of the multibarrier waste repository. Several such analogues are currently under study and these provide useful data about radionuclide behaviour in the natural environment. One such system is the Koongarra uranium deposit in the Northern Territory. In this dissertation, the migration of actinides, primarily uranium and thorium, has been studied as an analogue for the behaviour of transuranics in the far-field of a waste repository. The major findings of this study are: 1. the main process retarding uranium migration in the dispersion fan at Koongarra is sorption, which suppresses dissolved uranium concentrations well below solubility limits, with ferrihydrite being a major sorbing phase; 2. thorium is extremely immobile, with very low dissolved concentrations and corresponding high distribution ratios for 230 Th. Overall, it is estimated that colloids are relatively unimportant in Koongarra groundwater. Uranium migrates mostly as dissolved species, whereas thorium and actinium are mostly adsorbed to larger, relatively immobile particles and the stationary phase. However, of the small amount of 230 Th that passes through a 1μm filter, a significant proportion is associated with colloidal particles. Actinium appears to be slightly more mobile than thorium and is associated with colloids to a greater extent, although generally present in low concentrations. These results support the possibility of colloidal transport of trivalent and tetravalent actinides in the vicinity of a nuclear waste repository. 112 refs., 23 tabs., 32 figs

Participant and spectator scaling of spectator fragments in Au + Au and Cu + Cu collisions at √{sN N}=19.6 and 22.4 GeV

Science.gov (United States)

Alver, B.; Back, B. B.; Baker, M. D.; Ballintijn, M.; Barton, D. S.; Betts, R. R.; Bickley, A. A.; Bindel, R.; Budzanowski, A.; Busza, W.; Carroll, A.; Chai, Z.; Chetluru, V.; Decowski, M. P.; García, E.; Gburek, T.; George, N.; Gulbrandsen, K.; Gushue, S.; Halliwell, C.; Hamblen, J.; Harnarine, I.; Heintzelman, G. A.; Henderson, C.; Hofman, D. J.; Hollis, R. S.; Hołyński, R.; Holzman, B.; Iordanova, A.; Johnson, E.; Kane, J. L.; Katzy, J.; Khan, N.; Kucewicz, W.; Kulinich, P.; Kuo, C. M.; Li, W.; Lin, W. T.; Loizides, C.; Manly, S.; McLeod, D.; Mignerey, A. C.; Nouicer, R.; Olszewski, A.; Pak, R.; Park, I. C.; Pernegger, H.; Reed, C.; Remsberg, L. P.; Reuter, M.; Richardson, E.; Roland, C.; Roland, G.; Rosenberg, L.; Sagerer, J.; Sarin, P.; Sawicki, P.; Sedykh, I.; Skulski, W.; Smith, C. E.; Stankiewicz, M. A.; Steinberg, P.; Stephans, G. S. F.; Sukhanov, A.; Szostak, A.; Tang, J.-L.; Tonjes, M. B.; Trzupek, A.; Vale, C.; van Nieuwenhuizen, G. J.; Vaurynovich, S. S.; Verdier, R.; Veres, G. I.; Walters, P.; Wenger, E.; Willhelm, D.; Wolfs, F. L. H.; Wosiek, B.; Woźniak, K.; Wuosmaa, A. H.; Wyngaardt, S.; Wysłouch, B.; Phobos Collaboration

2016-08-01

Spectator fragments resulting from relativistic heavy ion collisions, consisting of single protons and neutrons along with groups of stable nuclear fragments up to nitrogen (Z =7 ), are measured in PHOBOS. These fragments are observed in Au+Au (√{sNN}=19.6 GeV ) and Cu+Cu (22.4 GeV) collisions at high pseudorapidity (η ). The dominant multiply-charged fragment is the tightly bound helium (α ), with lithium, beryllium, and boron all clearly seen as a function of collision centrality and pseudorapidity. We observe that in Cu+Cu collisions, it becomes much more favorable for the α fragments to be released than lithium. The yields of fragments approximately scale with the number of spectator nucleons, independent of the colliding ion. The shapes of the pseudorapidity distributions of fragments indicate that the average deflection of the fragments away from the beam direction increases for more central collisions. A detailed comparison of the shapes for α and lithium fragments indicates that the centrality dependence of the deflections favors a scaling with the number of participants in the collision.

An eighteen-membered macrocyclic ligand for actinium-225 targeted alpha therapy

International Nuclear Information System (INIS)

Thiele, Nikki A.; MacMillan, Samantha N.; Wilson, Justin J.; Rodriguez-Rodriguez, Cristina

2017-01-01

The 18-membered macrocycle H 2 macropa was investigated for 225 Ac chelation in targeted alpha therapy (TAT). Radiolabeling studies showed that macropa, at submicromolar concentration, complexed all 225 Ac (26 kBq) in 5 min at RT. [ 225 Ac(macropa)] + remained intact over 7 to 8 days when challenged with either excess La 3+ ions or human serum, and did not accumulate in any organ after 5 h in healthy mice. A bifunctional analogue, macropa-NCS, was conjugated to trastuzumab as well as to the prostate-specific membrane antigen-targeting compound RPS-070. Both constructs rapidly radiolabeled 225 Ac in just minutes at RT, and macropa-Tmab retained >99 % of its 225 Ac in human serum after 7 days. In LNCaP xenograft mice, 225 Ac-macropa-RPS-070 was selectively targeted to tumors and did not release free 225 Ac over 96 h. These findings establish macropa to be a highly promising ligand for 225 Ac chelation that will facilitate the clinical development of 225 Ac TAT for the treatment of soft-tissue metastases. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

An eighteen-membered macrocyclic ligand for actinium-225 targeted alpha therapy

Energy Technology Data Exchange (ETDEWEB)

Thiele, Nikki A.; MacMillan, Samantha N.; Wilson, Justin J. [Cornell Univ., Ithaca, NY (United States). Chemistry and Chemical Biology; Brown, Victoria; Jermilova, Una; Ramogida, Caterina F.; Robertson, Andrew K.H.; Schaffer, Paul; Radchenko, Valery [TRIUMF, Vancouver, BC (Canada). Life Science Div.; Kelly, James M.; Amor-Coarasa, Alejandro; Nikolopoulou, Anastasia; Ponnala, Shashikanth; Williams, Clarence Jr.; Babich, John W. [Radiology, Weill Cornell Medicine, New York, NY (United States); Rodriguez-Rodriguez, Cristina [British Columbia Univ., Vancouver, BC (Canada). Dept. of Physics and Astronomy and Centre for Comparative Medicine

2017-11-13

The 18-membered macrocycle H{sub 2}macropa was investigated for {sup 225}Ac chelation in targeted alpha therapy (TAT). Radiolabeling studies showed that macropa, at submicromolar concentration, complexed all {sup 225}Ac (26 kBq) in 5 min at RT. [{sup 225}Ac(macropa)]{sup +} remained intact over 7 to 8 days when challenged with either excess La{sup 3+} ions or human serum, and did not accumulate in any organ after 5 h in healthy mice. A bifunctional analogue, macropa-NCS, was conjugated to trastuzumab as well as to the prostate-specific membrane antigen-targeting compound RPS-070. Both constructs rapidly radiolabeled {sup 225}Ac in just minutes at RT, and macropa-Tmab retained >99 % of its {sup 225}Ac in human serum after 7 days. In LNCaP xenograft mice, {sup 225}Ac-macropa-RPS-070 was selectively targeted to tumors and did not release free {sup 225}Ac over 96 h. These findings establish macropa to be a highly promising ligand for {sup 225}Ac chelation that will facilitate the clinical development of {sup 225}Ac TAT for the treatment of soft-tissue metastases. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

Journal of Naval Science. Volume 2. Number 3. July 1976

Science.gov (United States)

1976-07-01

supplementary food to the beakers containing stage VI nauplii: cyprids do not feed. The larvae in each beaker were con- fined within a close-fitting plastic...99-274% of Natural U) Uranium-234 (234U) (0-006% of Natural U) 2-48 X 10"’yrs Thorium-230 (230Th) Polonium -218(2I8Po) /through short lived...Natural U) Actinium-227 (--7Ac) FIG. 1. Nuclide chart. 4-51 X 10’Yrs 7 hours P 8 X 10’ Yrs 4 days Lead- 210 (210Pb) (22 yrs,/3"). 1-39 X 10

Cessation of dangerousness status: an analysis of 224 reports from the Instituto de Perícias Heitor Carrilho, Rio de Janeiro, Brazil

Directory of Open Access Journals (Sweden)

Gustavo C. Oliveira

Full Text Available Objectives: To evaluate factors related to dangerousness cessation at the end of involuntary commitment based on an analysis of expert reports. In light of the current legal requirement of dangerousness cessation as a pre-requisite for prison or internment release of individuals subjected to the safety measure, we sought elements to reflect on the practice of expert examiners in charge of making this decision. Methods: The authors revised 224 expert psychiatric dangerousness cessation reports released 2011 through 2014 and collected data for a statistical analysis. Results: The following variables were associated with positive risk cessation assessments: no inadequate behavior (according to the assistant professionals, no productive psychotic symptoms, no negative symptoms, presence of insight, presence of a support network, and no psychoactive substance abuse. The following variables were associated with negative dangerousness cessation decisions: early onset of malfunction, lack of insight, negative attitudes, active signs of major mental illness, presence of impulsiveness, poor response to treatment, presence of plans lacking feasibility, exposure to destabilizing factors, lack of personal support, and presence of stress. Conclusions: In this study we were able to identify factors associated with dangerousness in a sample of expert reports. The knowledge of factors linked to a higher risk of recidivism in illegal activities or violent behavior is crucial for decision-making regarding the release of offenders after their legally established period of involuntary commitment.

The hair-dye reagent 2-(2',4'-diaminophenoxy)ethanol is mutagenic to Salmonella typhimurium.

Science.gov (United States)

Venitt, S; Crofton-Sleigh, C; Osborne, M R

1984-01-01

A new hair-dye ingredient, 2-(2',4'-diaminophenoxy)ethanol (2,4-DAPE), was described as being devoid of any genotoxic activity on the basis of a multi-laboratory study. Since 2,4-DAPE is a close analogue of 2,4-diaminoanisole (2,4-DAA), which is mutagenic and carcinogenic, we tested this claim by assaying 2,4-DAPE for bacterial mutagenicity. Two samples of 2,4-DAPE X 2HCl were synthesized by reduction of the corresponding dinitrophenoxyethanol and identity and purity were established by elemental analysis, NMR spectrometry, mass-spectrometry, UV-spectrophotometry, TLC and HPLC. Fresh aqueous solutions of 2,4-DAPE X 2HCl were assayed in several separate plate tests using S. typhimurium TA1538, TA97, TA98 and TA100, and E. coli WP2uvrA (pKM101), 3 plates per dose and 0%, 4%, 10% and 30% Aroclor 1254-induced rat-liver S9 in S9 mixes. We obtained negative results in TA100 and E. coli. Reproducible, statistically significant dose-related increases in revertants (up to 14 times the background) were obtained in frame-shift mutants of S. typhimurium in the dose range 10-80 micrograms per plate. Mutagenicity was S9-dependent, significant increases in revertants being obtained only with 50 microliter per plate or more of S9. 2,4-DAPE induced significant mutagenic effects at doses of less than 1 micrograms per ml in TA1538 and TA98 in fluctuation tests using 2% S9 in the S9 mix. In plate tests, 2,4-DAPE was less mutagenic (by a factor of about 8) than 2,4-DAA, which gave the highest mutant yields with 20 microliter S9 per plate (4% S9 in the S9 mix). 2,4-DAPE obtained commercially was about 8 times more mutagenic than our sample of 2,4-DAPE. After purification, the commercial product, now chromatographically identical with our own sample, gave plate-test results close to those obtained for our samples of 2,4-DAPE. A review of the published reports (in which 2,4-DAPE was claimed to be inactive in a variety of short-term tests) revealed: (a) the use of protocols for bacterial

New insights into the environmental photochemistry of 5-chloro-2-(2,4-dichlorophenoxy)phenol (triclosan): reconsidering the importance of indirect photoreactions.

Science.gov (United States)

Bianco, Angelica; Fabbri, Debora; Minella, Marco; Brigante, Marcello; Mailhot, Gilles; Maurino, Valter; Minero, Claudio; Vione, Davide

2015-04-01

Triclosan (5-chloro-2-(2,4-dichlorophenoxy)phenol) is a widely used antimicrobial agent that undergoes fairly slow biodegradation. It is often found in surface waters in both the acidic (HTric) and basic (Tric(-)) forms (pKa ∼8), and it can undergo direct photodegradation to produce several intermediates including a dioxin congener (2,8-dichlorodibenzodioxin, hereafter 28DCDD). The latter is formed from Tric(-) and causes non-negligible environmental concern. Differently from current literature reports, in this paper we show that the direct photolysis would not be the only important transformation pathway of triclosan in surface waters. This is particularly true for HTric, which could undergo very significant reactions with (•)OH and, if the laser-derived quenching rate constants of this work are comparable to the actual reaction rate constants, with the triplet states of chromophoric dissolved organic matter ((3)CDOM*). Model calculations suggest that reaction with (3)CDOM* could be the main HTric phototransformation pathway in deep waters with high dissolved organic carbon (DOC), while reaction with (•)OH could prevail in low-DOC waters. In the case of Tric(-) the direct photolysis is much more important than for HTric, but triplet-sensitised transformation could produce 28DCDD + 27DCDD with higher yield compared to the direct photolysis, and it could play some role as dioxin source in deep waters with elevated DOC. Copyright © 2014 Elsevier Ltd. All rights reserved.

Independent verification survey report for exposure units Z2-24, Z2-31, Z2-32, AND Z2-36 in zone 2 of the East Tennessee technology park Oak Ridge, Tennessee

Energy Technology Data Exchange (ETDEWEB)

King, David A. [Oak Ridge Inst. for Science and Education (ORISE), Oak Ridge, TN (United States)

2013-10-01

The U.S. Department of Energy (DOE) Oak Ridge Office of Environmental Management selected Oak Ridge Associated Universities (ORAU), through the Oak Ridge Institute for Science and Education (ORISE) contract, to perform independent verification (IV) at Zone 2 of the East Tennessee Technology Park (ETTP) in Oak Ridge, Tennessee. ORAU has concluded IV surveys, per the project-specific plan (PSP) (ORAU 2013a) covering exposure units (EUs) Z2-24, -31, -32, and -36. The objective of this effort was to verify the target EUs comply with requirements in the Zone 2 Record of Decision (ROD) (DOE 2005), as implemented by using the dynamic verification strategy presented in the dynamic work plan (DWP) (BJC 2007); and confirm commitments in the DWP were adequately implemented, as verified via IV surveys and soil sampling.

Phenotype-gene: 31 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 31 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u1030i decreased density of chloroph...iNetS_ria224i/cria224u4ria224u15659096i decreased density of chlorophyll http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u617i AT5G35220

Phenotype-gene: 580 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 580 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u1577i non-functional stomatal movement...db/SciNetS_ria224i/cria224u4ria224u16990135i non-functional stomatal movement http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u956i AT1G52400

Phenotype-gene: 30 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 30 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u1029i decreased density of chloroph...b.riken.jp/db/SciNetS_ria224i/cria224u4ria224u15525647i decreased density of chlorophyll http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u617i AT3G19040

Phenotype-gene: 32 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 32 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u1031i decreased density of chloroph...b/SciNetS_ria224i/cria224u4ria224u16262716i decreased density of chlorophyll http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u617i AT5G56860

Phenotype-gene: 29 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 29 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u1028i decreased density of chloroph...db.riken.jp/db/SciNetS_ria224i/cria224u4ria224u18182030i decreased density of chlorophyll http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u617i AT1G78600

Phenotype-gene: 553 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 553 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u1550i non-functional obsolete microgametoph...adb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u11251103i non-functional obsolete microgametophyte http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u940i AT4G17730

Phenotype-gene: 562 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 562 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u1559i non-functional response to gravity...ken.jp/db/SciNetS_ria224i/cria224u4ria224u16690816i non-functional response to gravity http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u947i AT1G54990

Alpha-emitting isotopes and chromium in a coastal California aquifer

International Nuclear Information System (INIS)

Densmore, Jill N.; Izbicki, John A.; Murtaugh, Joseph M.; Swarzenski, Peter W.; Bullen, Thomas D.

2014-01-01

Highlights: • Alluvium in Piedra de Lumbre basin higher radionuclides likely from natural Th. • Natural uranium decay-chain isotopes, including Ra, present in marine deposits. • Marine deposits also contain low concentrations of chromium. • Radionuclides and chromium concentrations lower in alluvium in the Las Flores basin. - Abstract: The unadjusted 72-h gross alpha activities in water from two wells completed in marine and alluvial deposits in a coastal southern California aquifer 40 km north of San Diego were 15 and 25 picoCuries per liter (pCi/L). Although activities were below the Maximum Contaminant Level (MCL) of 15 pCi/L, when adjusted for uranium activity; there is concern that new wells in the area may exceed MCLs, or that future regulations may limit water use from the wells. Coupled well-bore flow and depth-dependent water-quality data collected from the wells in 2011 (with analyses for isotopes within the uranium, actinium, and thorium decay-chains) show gross alpha activity in marine deposits is associated with decay of naturally-occurring 238 U and its daughter 234 U. Radon activities in marine deposits were as high as 2230 pCi/L. In contrast, gross alpha activities in overlying alluvium within the Piedra de Lumbre watershed, eroded from the nearby San Onofre Hills, were associated with decay of 232 Th, including its daughter 224 Ra. Radon activities in alluvium from Piedra de Lumbre of 450 pCi/L were lower than in marine deposits. Chromium VI concentrations in marine deposits were less than the California MCL of 10 μg/L (effective July 1, 2014) but δ 53 Cr compositions were near zero and within reported ranges for anthropogenic chromium. Alluvial deposits from the nearby Las Flores watershed, which drains a larger area having diverse geology, has low alpha activities and chromium as a result of geologic and geochemical conditions and may be more promising for future water-supply development

Phenotype-gene: 533 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 533 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u1530i low sensitivity toward under influence...nsitivity toward under influence of 1-chloro-2,4-dinitrobenzene http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u921i AT2G34660 ...Plant Cell Physiol. 49(4):557-69. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u18325934i low se

Phenotype-gene: 743 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 743 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u919i abnormal for trait of behavior...a224i/cria224u4ria224u17376810i abnormal for trait of behavioral quality in organ

Phenotype-gene: 754 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 754 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u930i abnormal for trait of behavior..._ria224i/cria224u4ria224u17139246i abnormal for trait of behavioral quality in or

Phenotype-gene: 424 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 424 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u1421i increased number of axillary inflore...scence bud in organ named inflorescence for AT5G15230 Roxrud Ingrid et al. 2007 Mar. P...ed number of axillary inflorescence bud in organ named inflorescence http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u839i AT5G15230 ...lant Cell Physiol. 48(3):471-83. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u17284469i increas

Phenotype-gene: 774 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available ology in organ named obsolete microgametophyte for AT5G11110 Suzuki Toshiya et al. 2008 Oct. Plant Cell Ph... 774 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u950i abnormal for trait of morph...ysiol. 49(10):1465-77. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u18779216i abnormal for trait of morph...ology in organ named obsolete microgametophyte http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u567i AT5G11110

Phenotype-gene: 529 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available onment of soil environment for AT3G62910 Motohashi Reiko et al. 2007 Jul. Plant Mol...nt of soil environment http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u919i AT3G62910 .... Biol. 64(5):481-97. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u17450416i lethal in organ named seedling in environme... 529 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u1526i lethal in organ named seedling in envir

Phenotype-gene: 494 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 494 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u1491i inpaired stomatal movement... http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u12773379i inpaired stomatal movement in presence

Phenotype-gene: 753 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 753 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u929i abnormal for trait of behavior...tadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u12694594i abnormal for trait of behavior

Phenotype-gene: 475 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 475 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u1472i increased sensitivity under influence...//metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u17355438i increased sensitivity under influence of lead

Phenotype-gene: 461 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 461 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u1458i increased responsivity under influence...-66. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u14729919i increased responsivity under influence

Phenotype-gene: 196 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 196 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u1194i decreased sensitivity under influence... http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u17347412i decreased sensitivity under influence o

Phenotype-gene: 456 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 456 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u1453i increased resistance under influence...80. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u16540482i increased resistance under influence

Phenotype-gene: 457 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 457 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u1454i increased resistance under influence...http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u15181201i increased resistance under influence of

Phenotype-gene: 190 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 190 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u1188i decreased responsivity under influence...:471-81. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u18263776i decreased responsivity under influence

Phenotype-gene: 455 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 455 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u1452i increased resistance under influence...1853-60. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u17293438i increased resistance under influence

Phenotype-gene: 33 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 33 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u1032i decreased density of chloroph...041-52. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u17335513i decreased density of chlorophyll

Phenotype-gene: 558 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 558 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u1555i non-functional ph...73-85. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u16024589i non-functional phloem or xylem hi

Phenotype-gene: 788 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 788 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u964i abnormal for trait of morph...9. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u15316111i abnormal for trait of morphology in o

Phenotype-gene: 775 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 775 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u951i abnormal for trait of morph...-22. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u19081078i abnormal for trait of morphology in

Phenotype-gene: 509 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 509 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u1506i lethal (sensu gen...ant J. 42(5):720-30. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u15918885i lethal (sensu genet

Phenotype-gene: 525 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 525 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u1522i lethal (sensu gen...Sci. U.S.A. 101(20):7821-6. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u15136745i lethal (sensu gen

Phenotype-gene: 789 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 789 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u965i abnormal for trait of morph...-24. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u15659634i abnormal for trait of morphology in

Phenotype-gene: 776 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 776 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u952i abnormal for trait of morph...-22. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u19081078i abnormal for trait of morphology in

Phenotype-gene: 767 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 767 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u943i abnormal for trait of morph...):627-37. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u12699618i abnormal for trait of morpholo

Phenotype-gene: 797 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 797 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u973i abnormal for trait of morph...):591-603. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u16792691i abnormal for trait of morphol

Phenotype-gene: 779 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 779 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u955i abnormal for trait of morph...2-93. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u18591352i abnormal for trait of morphology i

Phenotype-gene: 791 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 791 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u967i abnormal for trait of morph...):272-84. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u16112663i abnormal for trait of morpholo

Phenotype-gene: 798 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 798 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u974i abnormal for trait of morph...-66. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u16531491i abnormal for trait of morphology in

Phenotype-gene: 505 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 505 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u1502i kinked for trait of morph...66. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u16531491i kinked for trait of morphology in or

Phenotype-gene: 768 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 768 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u944i abnormal for trait of morph...p://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u12750345i abnormal for trait of morphology in organ n

Phenotype-gene: 499 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 499 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u1496i insufficient for quantity of chloroph... 16(12):3400-12. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u15539473i insufficient for quantity of chloroph

Phenotype-gene: 790 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 790 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u966i abnormal for trait of morph...93. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u18591352i abnormal for trait of morphology in

Phenotype-gene: 795 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 795 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u971i abnormal for trait of morph...:353-66. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u14729919i abnormal for trait of morpholog

Phenotype-gene: 792 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 792 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u968i abnormal for trait of morph...2):3548-63. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u17189341i abnormal for trait of morpho

Phenotype-gene: 778 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 778 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u954i abnormal for trait of morph...:282-4. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u16015335i abnormal for trait of morphology

Phenotype-gene: 762 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 762 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u938i abnormal for trait of morph...:1467-81. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u15829606i abnormal for trait of morpholo

Phenotype-gene: 773 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 773 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u949i abnormal for trait of morph...-80. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u16510519i abnormal for trait of morphology in

Phenotype abnormality: 270 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 270 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u775i elongated hypocotyl in environment... of light regimen in environment of light regimen http://metadb.riken.jp/db/SciNetS_ria224i/cria224u2ria224u34i hypocotyl ... elongated ...

Phenotype-gene: 736 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 736 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u912i abnormal for trait of behavior...eb. Science 307(5712):1111-3. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u15618487i abnormal for trait of behavior

Phenotype-gene: 737 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 737 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u913i abnormal for trait of behavior...c. EMBO J. 25(24):5907-18. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u17139246i abnormal for trait of behavior

Phenotype-gene: 735 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 735 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u911i abnormal for trait of behavior...t Physiol. 142(2):564-73. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u16891550i abnormal for trait of behavior

Phenotype-gene: 786 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 786 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u962i abnormal for trait of morph...03 Jul. Plant Cell 15(7):1632-45. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u12837952i abnormal for trait of morph

Phenotype-gene: 785 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 785 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u961i abnormal for trait of morph...U.S.A. 103(17):6759-64. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u16617119i abnormal for trait of morph

Phenotype-gene: 766 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 766 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u942i abnormal for trait of morph...i. U.S.A. 104(47):18836-41. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u18000056i abnormal for trait of morph

Phenotype-gene: 787 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 787 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u963i abnormal for trait of morph...03 Jul. Plant Cell 15(7):1632-45. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u12837952i abnormal for trait of morph

Phenotype-gene: 763 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 763 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u939i abnormal for trait of morph.... U.S.A. 103(17):6759-64. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u16617119i abnormal for trait of morph

Phenotype abnormality: 403 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 403 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u907i involute hypocotyl in environment... of far red light regimen in environment of far red light regimen http://metadb.riken.jp/db/SciNetS_ria224i/cria224u2ria224u32i hypocotyl ... involute ...

Phenotype abnormality: 404 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 404 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u908i involute hypocotyl in environment... of red light regimen in environment of red light regimen http://metadb.riken.jp/db/SciNetS_ria224i/cria224u2ria224u39i hypocotyl ... involute ...

Purification of radium-226 for the manufacturing of actinium-225 in a cyclotron for alpha-immunotherapy; Radium-Aufreinigung zur Herstellung von Actinium-225 am Zyklotron fuer die Alpha-Immuntherapie

Energy Technology Data Exchange (ETDEWEB)

Marx, Sebastian Markus

2014-09-23

The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.

Phenotype abnormality: 46 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 46 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u552i abnormal for trait of behavior.../cria224u2ria224u38i stomatal complex ... abnormal ... response to light stimulus ... behavioral quality

Phenotype-gene: 741 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 741 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u917i abnormal for trait of behavior...ria224u4ria224u15986216i abnormal for trait of behavioral quality in organ named

Phenotype-gene: 755 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 755 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u931i abnormal for trait of behavior...ria224u4ria224u17148695i abnormal for trait of behavioral quality in organ named

Phenotype-gene: 747 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 747 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u923i abnormal for trait of behavior...4i/cria224u4ria224u12837954i abnormal for trait of behavioral quality in organ na

Origin of elements of the Uranium-235 family observed in the Ellez river near the EL-4 experimental nuclear reactor in dismantling (Monts d'Arree- Finistere department); Origine des elements de la famille de l'uranium-235 observes dans la riviere Ellez a proximite du reacteur nucleaire experimental EL4 en cours de demantelement (Mont d'Arree - departement du Finistere). Resultats et premiers constats annee 2006

Energy Technology Data Exchange (ETDEWEB)

NONE

2006-07-01

In a previous study which concerned the catchment basin of the harbour of Brest, the A.C.R.O. put in evidence a marking by artificial radioelements around the power plant of Brennilis which can be imputed without ambiguities to the nuclear installation. It also put in evidence abnormalities concerning the natural radioactivity which justifies this new study. In the area of the Monts d'Arree, actinium 227 ({sup 227}Ac), non born by its ascendents which are {sup 235}U and {sup 231}Pa is observed. This phenomenon is characterized by mass activities superior to these ones of {sup 235}U and able to reach these ones of {sup 238}U. Its presence corresponds with the drainage of the Ellez river since the former channel of radioactive effluents releases from the nuclear power plant EL-4 up to the reservoir Saint-Herblot situated 6 km downstream. The strongest values of radioactivity are registered near the disused power plant, at this place a relationship exists between the level of actinium 227 and this one of the artificial radioactivity as it exists a relationship with the decay products of radon exhaled from the subsoil ({sup 210}Pb). But its presence is not limited to a part of the Ellez river, it is equally observed in terrestrial medium, in places in priori not influenced by the direct liquid effluents of the power plant. This place is situated at more than 4 km and without any connection with the Ellez waters. At this stage of the study, it is not possible to answer with certainty the question of the origin of this phenomenon. A new reorientation is considered indispensable to clarify definitively the origin of this unknown phenomenon in the scientific publications and the environmental monitoring. (N.C.)

origin of elements of the Uranium-235 family observed in the Ellez river near the EL-4 experimental nuclear reactor in dismantling (Monts d'Arree- Finistere department)

International Nuclear Information System (INIS)

2006-01-01

In a previous study which concerned the catchment basin of the harbour of Brest, the A.C.R.O. put in evidence a marking by artificial radioelements around the power plant of Brennilis which can be imputed without ambiguities to the nuclear installation. It also put in evidence abnormalities concerning the natural radioactivity which justifies this new study. In the area of the Monts d'Arree, actinium 227 ( 227 Ac), non born by its ascendents which are 235 U and 231 Pa is observed. This phenomenon is characterized by mass activities superior to these ones of 235 U and able to reach these ones of 238 U. Its presence corresponds with the drainage of the Ellez river since the former channel of radioactive effluents releases from the nuclear power plant EL-4 up to the reservoir Saint-Herblot situated 6 km downstream. The strongest values of radioactivity are registered near the disused power plant, at this place a relationship exists between the level of actinium 227 and this one of the artificial radioactivity as it exists a relationship with the decay products of radon exhaled from the subsoil ( 210 Pb). But its presence is not limited to a part of the Ellez river, it is equally observed in terrestrial medium, in places in priori not influenced by the direct liquid effluents of the power plant. This place is situated at more than 4 km and without any connection with the Ellez waters. At this stage of the study, it is not possible to answer with certainty the question of the origin of this phenomenon. A new reorientation is considered indispensable to clarify definitively the origin of this unknown phenomenon in the scientific publications and the environmental monitoring. (N.C.)

Phenotype-gene: 746 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 746 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u922i abnormal for trait of behavior...t al. 2005 Feb. Plant J. 41(3):364-75. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u15659096i abnormal for trait of beha...vioral quality in organ named hypocotyl during process n

Phenotype-gene: 777 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 777 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u953i abnormal for trait of morph...ology in organ named root for AT5G60920 ... abnormal for trait of morphology in organ named root http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u568i AT5G60920

JB_224_ESM.docx

Indian Academy of Sciences (India)

121

(A) Subcellular localization of CFP-AtMBD6 along with YFP protein was performed in onion epidermal cells. YFP was present in both cytoplasm and nucleus. It did not show a pattern of localization in the nucleus, which was similar to that of the interacting partners. The energy transfer between CFP-AtMBD6 and YFP was ...

Comment: 224 [Taxonomy Icon

Lifescience Database Archive (English)

Full Text Available ty of Tokyo) licensed under CC Attribution2.1 Japan ヨコヅナクマムシ 光学顕微鏡写真 撮影:國枝武和（東京大学） bando 2010/02/15 14:55:40 2010/02/16 10:42:46 ...

Phenotype-gene: 796 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 796 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u972i abnormal for trait of morph...ology in organ named vascular leaf for AT5G18410 Li Yunhai et al. 2004 Nov. Plant Physiol. 136(3...):3616-27. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u15516496i abnormal for trait of morphol

Phenotype-gene: 780 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 780 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u956i abnormal for trait of morph...ology in organ named seed for AT2G35110 Li Yunhai et al. 2004 Nov. Plant Physiol. 136(3):3616-27.... http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u15516496i abnormal for trait of morphology in or

Phenotype-gene: 793 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 793 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u969i abnormal for trait of morph...ology in organ named vascular leaf for AT2G35110 Li Yunhai et al. 2004 Nov. Plant Physiol. 136(3...):3616-27. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u15516496i abnormal for trait of morphol

Phenotype-gene: 781 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 781 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u957i abnormal for trait of morph...ology in organ named seed for AT5G18410 Li Yunhai et al. 2004 Nov. Plant Physiol. 136(3):3616-27.... http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u15516496i abnormal for trait of morphology in or

Phenotype-gene: 765 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 765 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u941i abnormal for trait of morph...ology in organ named chloroplast for AT5G55280 Yoder David W et al. 2007 Jun. Plant Cell Physiol.... 48(6):775-91. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u17468127i abnormal for trait of morph

Phenotype-gene: 764 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 764 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u940i abnormal for trait of morph...ology in organ named chloroplast for AT1G22700 St旦ckel Jana et al. 2006 Jul. Plant Physiol. 141(...3):870-8. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u16679416i abnormal for trait of morpholo

Phenotype-gene: 794 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 794 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u970i abnormal for trait of morph...ology in organ named vascular leaf for AT2G44950 Fleury Delphine et al. 2007 Feb. Plant Cell 19(...2):417-32. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u17329565i abnormal for trait of morphol

Phenotype-gene: 769 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 769 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u945i abnormal for trait of morph...ology in organ named inflorescence for AT2G35110 Li Yunhai et al. 2004 Nov. Plant Physiol. 136(3...):3616-27. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u15516496i abnormal for trait of morphol

Phenotype-gene: 770 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 770 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u946i abnormal for trait of morph...ology in organ named inflorescence for AT5G18410 Li Yunhai et al. 2004 Nov. Plant Physiol. 136(3...):3616-27. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u15516496i abnormal for trait of morphol

Phenotype-gene: 771 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 771 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u947i abnormal for trait of morph...ology in organ named leaf lamina for AT1G55250 Fleury Delphine et al. 2007 Feb. Plant Cell 19(2)...:417-32. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u17329565i abnormal for trait of morpholog

Phenotype-gene: 772 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 772 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u948i abnormal for trait of morph...ology in organ named leaf lamina for AT1G55255 Fleury Delphine et al. 2007 Feb. Plant Cell 19(2)...:417-32. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u17329565i abnormal for trait of morpholog

Phenotype-gene: 57 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available iency during process named polyploidization for AT5G08550 Yoshizumi Takeshi et al. 2006 Oct. Plant Cell 18(1...0):2452-68. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u17012601i decreased efficiency during process named polyploidiz...ation http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u639i AT5G08550

Phenotype-gene: 496 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available ward in organ named root under influence of ethene for AT1G25220 Stepanova Anna N et al. 2005 Aug. Plant Cel...luence of ethene http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u903i AT1G25220 ...l 17(8):2230-42. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u15980261i insensitive toward in organ named root under inf

Phenotype-gene: 498 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available ward in organ named root under influence of ethene for AT5G05730 Stepanova Anna N et al. 2005 Aug. Plant Cel...luence of ethene http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u903i AT5G05730 ...l 17(8):2230-42. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u15980261i insensitive toward in organ named root under inf

Synthesis, docking and acetylcholinesterase inhibitory assessment of 2-(2-(4-Benzylpiperazin-1-yl)ethyl)isoindoline-1,3-dione derivatives with potential anti-Alzheimer effects

Science.gov (United States)

2013-01-01

Background Alzheimer’s disease (AD) as neurodegenerative disorder, is the most common form of dementia accounting for about 50-60% of the overall cases of dementia among persons over 65 years of age. Low acetylcholine (ACh) concentration in hippocampus and cortex areas of the brain is one of the main reasons for this disease. In recent years, acetylcholinesterase (AChE) inhibitors like donepezil with prevention of acetylcholine hydrolysis can enhance the duration of action of acetylcholine in synaptic cleft and improve the dementia associated with Alzheimer’s disease. Results Design, synthesis and assessment of anticholinesterase activity of 2-(2-(4-Benzylpiperazin-1-yl)ethyl)isoindoline-1,3-dione derivatives showed prepared compounds can function as potential acetylcholinesterase inhibitor. Among 12 synthesized derivatives, compound 4a with ortho chlorine moiety as electron withdrawing group exhibited the highest potency in these series (IC50 = 0.91 ± 0.045 μM) compared to donepezil (IC50 = 0.14 ± 0.03 μM). The results of the enzyme inhibition test (Ellman test) showed that electron withdrawing groups like Cl, F and NO2 can render the best effect at position ortho and para of the phenyl ring. But compound 4g with methoxy group at position 3(meta) afforded a favorable potency (IC50 = 5.5 ± 0.7 μM). Furthermore, docking study confirmed a same binding mode like donepezil for compound 4a. Conclusions Synthesized compounds 4a-4l could be proposed as potential anticholinesterase agents. PMID:23758724

Synthesis, Docking and Acetylcholinesterase Inhibitory Assessment of 2-(2-(4-Benzylpiperazin-1-YlEthylIsoindoline-1,3-Dione Derivatives with Potential Anti-Alzheimer Effects

Directory of Open Access Journals (Sweden)

Ahmad Mohammadi-Farani

2013-06-01

Full Text Available Background:Alzheimer’s disease (AD as neurodegenerative disorder, is the most common form of dementia accounting for about 50-60% of the overall cases of dementia among persons over 65 years of age. Low acetylcholine (ACh concentration in hippocampus and cortex areas of the brain is one of the main reasons for this disease. In recent years, acetylcholinesterase (AChE inhibitors like donepezil with prevention of acetylcholine hydrolysis can enhance the duration of action of acetylcholine in synaptic cleft and improve the dementia associated with Alzheimer’s disease.Results:Design, synthesis and assessment of anticholinesterase activity of 2-(2-(4-Benzylpiperazin-1-ylethylisoindoline-1,3-dione derivatives showed prepared compounds can function as potential acetylcholinesterase inhibitor. Among 12 synthesized derivatives, compound 4a with ortho chlorine moiety as electron withdrawing group exhibited the highest potency in these series (IC50 = 0.91 ± 0.045 μM compared to donepezil (IC50 = 0.14 ± 0.03 μM. The results of the enzyme inhibition test (Ellman test showed that electron withdrawing groups like Cl, F and NO2 can render the best effect at position ortho and para of the phenyl ring. But compound 4g with methoxy group at position 3(meta afforded a favorable potency (IC50 = 5.5 ± 0.7 μM. Furthermore, docking study confirmed a same binding mode like donepezil for compound 4a.Conclusions:Synthesized compounds 4a-4l could be proposed as potential anticholinesterase agents.

Study of the specific concentrations of 40K, 224Ra, 226Ra and 228Ra in some seasonings marketed in Rio de Janeiro City

International Nuclear Information System (INIS)

Garcêz, Ricardo W.D.; Lopes, José M.; Silva, Leandro B.; Silva, Ademir X. da; Lima, Marco A.F.

2017-01-01

The seasoning are vegetables substances used in foods to enhance their flavor, aroma and color. This work presents an investigation of the activity concentration of Naturally Occurring Radioactive Materials (NORMs) in 28 samples of seasoning utilized by brazilian population. The seasoning samples were measured using gamma spectroscopy technique with a high-purity germanium (HPGe) detector, a non-destructive nuclear method and with the LabSOCS software for the calculation of the efficiency curve. The analysis shows that the activity concentration of 40 K was measured in all samples and ranges from 21.0 Bq/kg to 1288 Bq/kg. The highest concentration activity of 40 K was measured to 'cheiro verde', a local seasoning made of chives (Allium Schoenoprasum) and parsley (Petroselinum Crispum), while annatto, made with the fruit of Bixa Orelhana, had the lowest activity concentration. Brazil nut (Bertholletia Excelsa) presented the highest concentrations for 226 Ra and 228 Ra with 24 Bq/kg and 25.7 Bq/kg, respectively and black pepper (Piper Nigrum) presented the highest concentration for 224 Ra with 33.9 Bq/kg. The highest effective dose for members of the public due to ingestion was 23.5 μSv/y due to Brazil nut and the lowest effective dose was found for annatto: 0.13 μSv/y. The syrian seasoning sample present specific concentration of 6.1±1.1 Bq/kg for 137 Cs and 0.08 μSv/y of effective dose. The values found in this work do not represent a risk to human health. (author)

Phenotype-gene: 752 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 752 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u928i abnormal for trait of behavior...a224u16055636i abnormal for trait of behavioral quality in organ named stamen dur

Phenotype-gene: 742 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 742 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u918i abnormal for trait of behavior...ia224u16299182i abnormal for trait of behavioral quality in organ named cotyledon

Phenotype-gene: 744 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 744 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u920i abnormal for trait of behavior...a224u16055636i abnormal for trait of behavioral quality in organ named flower dur

Radionuclide interactions with marine sediments

International Nuclear Information System (INIS)

Higgo, J.J.W.

1987-09-01

A critical review of the literature on the subject of the interactions of radionuclides with marine sediments has been carried out. On the basis of the information available, an attempt has been made to give ranges and 'best estimates' for the distribution ratios between seawater and sediments. These estimates have been based on an understanding of the sediment seawater system and the porewater chemistry and mineralogy. Field measurements, laboratory measurements and estimates based on stable-element geochemical data are all taken into account. Laboratory measurements include distribution-ratio and diffusion-coefficient determinations. The elements reviewed are carbon, chlorine, calcium, nickel, selenium, strontium, zirconium, niobium, technetium, tin, iodine, caesium, lead, radium, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium and curium. (author)

Calculation technique of free and impurity ion electronic structures

International Nuclear Information System (INIS)

Kulagin, N.A.; Sviridov, D.T.

1986-01-01

The monograph deals with calculation technique of free and impurity ion spectra with completed nl N -shell. The principles of the theory of irreducible tensor operators, genealogical coefficients, calculation technique of angular and radial parts of matrix elements operators are stated. The correlation accounting methods in free ions are considered in detail. The principles of the theory of crystal field and ligand field, the method of self-consistent field for impurity ions are reported. The technique efficiency based on example of lanthanum and actinium group ions is shown. Experimental data by nf N -ion spectra are given. The tables of angular coefficients, energy values of X-ray lines of rare earth ions and genealogical coefficients are given in the appendix

JAEA thermodynamic database for performance assessment of geological disposal of high-level and TRU wastes. Refinement of thermodynamic data for trivalent actinoids and samarium

International Nuclear Information System (INIS)

Kitamura, Akira; Fujiwara, Kenso; Yui, Mikazu

2010-01-01

Within the scope of the JAEA thermodynamic database project for performance assessment of geological disposal of high-level radioactive and TRU wastes, the refinement of the thermodynamic data for the inorganic compounds and complexes of trivalent actinoids (actinium(III), plutonium(III), americium(III) and curium(III)) and samarium(III) was carried out. Refinement of thermodynamic data for these elements was based on the thermodynamic database for americium published by the Nuclear Energy Agency in the Organisation for Economic Co-operation and Development (OECD/NEA). Based on the similarity of chemical properties among trivalent actinoids and samarium, complementary thermodynamic data for their species expected under the geological disposal conditions were selected to complete the thermodynamic data set for the performance assessment of geological disposal of radioactive wastes. (author)

Formerly utilized MED/AEC sites Remedial Action Program. Radiological survey of the St. Louis Airport Storage Site, St. Louis, Missouri. Final report. [U, Ra-bearing wastes stored in 1940-60's

Energy Technology Data Exchange (ETDEWEB)

None

1979-09-01

Results of two radiological surveys of the St. Louis-Lambert Airport property, formerly known as the Airport Storage Site, St. Louis, Missouri, are presented. Uranium- and radium-bearing waste materials were stored from the 1940's to the late 1960's in this area. The surveys included direct measurements of beta-gamma radiation; determination of uranium, actinium, and radium concentrations in soil samples and from bore holes; determination of radionuclide concentrations in groundwater and surface water; measurement of radon flux from the ground surface; and measurements of /sup 222/Rn in air near the site. Results indicate that some offsite drainage pathways are becoming contaminated, probably by runoff from the site; no migration of /sup 222/Rn from the site was observed.

Volumetric behaviour of the (2,2,4-trimethylpentane + methylbenzene + butan-1-ol) ternary system and its binary sub-systems within the temperature range (298.15–328.15) K

International Nuclear Information System (INIS)

Morávková, Lenka; Troncoso, Jacobo; Machanová, Karolina; Sedláková, Zuzana

2013-01-01

Highlights: • Density measurements. • Excess molar volume at atmospheric pressure. • Redlich–Kister equation. • ERAS model. • Comparison of our data with literature data. -- Abstract: Densities and speeds of sound of the (2,2,4-trimethylpentane + methylbenzene + butan-1-ol) ternary system as well as all its binary sub-systems were measured at four temperatures, namely 298.15 K, 308.15 K, 318.15 K, and 328.15 K at atmospheric pressure by a vibrating-tube densimeter DSA 5000. The binary (isooctane + toluene) system was studied previously. Excess quantities (molar volume, adiabatic compressibility, and isobaric thermal expansivity) of the mixtures studied were calculated from the experimental densities and speed of sounds. The excess molar volume data were correlated using the Redlich–Kister equation. Both the positive and S-shaped excess molar volume curves were found for the systems studied. The excess molar volumes versus concentration of binary systems differed in the shape and temperature dependence. The experimental binary data were compared with literature data. The experimental excess molar volumes were analyzed by means of the Extended Real Associated Solution (ERAS) model. The experimental data and the ERAS model can help to estimate real behaviour of the systems studied

Discovery of (1R,2S)-2-{[(2,4-Dimethylpyrimidin-5-yl)oxy]methyl}-2-(3-fluorophenyl)-N-(5-fluoropyridin-2-yl)cyclopropanecarboxamide (E2006): A Potent and Efficacious Oral Orexin Receptor Antagonist.

Science.gov (United States)

Yoshida, Yu; Naoe, Yoshimitsu; Terauchi, Taro; Ozaki, Fumihiro; Doko, Takashi; Takemura, Ayumi; Tanaka, Toshiaki; Sorimachi, Keiichi; Beuckmann, Carsten T; Suzuki, Michiyuki; Ueno, Takashi; Ozaki, Shunsuke; Yonaga, Masahiro

2015-06-11

The orexin/hypocretin receptors are a family of G protein-coupled receptors and consist of orexin-1 (OX1) and orexin-2 (OX2) receptor subtypes. Orexin receptors are expressed throughout the central nervous system and are involved in the regulation of the sleep/wake cycle. Because modulation of these receptors constitutes a promising target for novel treatments of disorders associated with the control of sleep and wakefulness, such as insomnia, the development of orexin receptor antagonists has emerged as an important focus in drug discovery research. Here, we report the design, synthesis, characterization, and structure-activity relationships (SARs) of novel orexin receptor antagonists. Various modifications made to the core structure of a previously developed compound (-)-5, the lead molecule, resulted in compounds with improved chemical and pharmacological profiles. The investigation afforded a potential therapeutic agent, (1R,2S)-2-{[(2,4-dimethylpyrimidin-5-yl)oxy]methyl}-2-(3-fluorophenyl)-N-(5-fluoropyridin-2-yl)cyclopropanecarboxamide (E2006), an orally active, potent orexin antagonist. The efficacy was demonstrated in mice in an in vivo study by using sleep parameter measurements.

CopperCore 2.2.4

NARCIS (Netherlands)

Vogten, Hubert; Martens, Harrie; Koper, Rob

2005-01-01

Changed in this release: -fixed bug with the id of the Monitor object and other services, fixed bugs with regard to the visibility of items. Please go to SourceForge for the original sources and website (this is only a backup archive): http://coppercore.sourceforge.net/ Available under the GNU GPL

22 CFR 224.29 - Sanctions.

Science.gov (United States)

2010-04-01

...), (d), and (e) of this section, shall reasonably relate to the severity and nature of the failure or... upon, testimony relating to the information sought; and (4) Strike any part of the pleadings or other...

12 CFR 22.4 - Exemptions.

Science.gov (United States)

2010-01-01

... State-owned property covered under a policy of self-insurance satisfactory to the Director of FEMA, who publishes and periodically revises the list of States falling within this exemption; or (b) Property...

Dissolved Concentration Limits of Radioactive Elements

Energy Technology Data Exchange (ETDEWEB)

Y. Chen; E.R. Thomas; F.J. Pearson; P.L. Cloke; T.L. Steinborn; P.V. Brady

2003-06-20

The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of radioactive elements under possible repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, and measurements made in laboratory experiments and field work. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 radioactive elements (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium), which are important to calculated dose. Model outputs are mainly in the form of look-up tables plus one or more uncertainty terms. The rest are either in the form of distributions or single values. The results of this analysis are fundamental inputs for total system performance assessment to constrain the release of these elements from waste packages and the engineered barrier system. Solubilities of plutonium, neptunium, uranium, americium, actinium, thorium, protactinium, lead, and radium have been re-evaluated using the newly updated thermodynamic database (Data0.ymp.R2). For all of the actinides, identical modeling approaches and consistent environmental conditions were used to develop solubility models in this revision. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, activity coefficients, and selection of solubility controlling phase have been quantified or otherwise addressed. Moreover, a new blended plutonium solubility model has been developed in this revision, which gives a mean solubility that is three orders of magnitude lower than the plutonium solubility model used for the Total System Performance Assessment for the Site Recommendation. Two alternative neptunium solubility models have also been

Dissolved Concentration Limits of Radioactive Elements

International Nuclear Information System (INIS)

Y. Chen; E.R. Thomas; F.J. Pearson; P.L. Cloke; T.L. Steinborn; P.V. Brady

2003-01-01

The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of radioactive elements under possible repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, and measurements made in laboratory experiments and field work. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 radioactive elements (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium), which are important to calculated dose. Model outputs are mainly in the form of look-up tables plus one or more uncertainty terms. The rest are either in the form of distributions or single values. The results of this analysis are fundamental inputs for total system performance assessment to constrain the release of these elements from waste packages and the engineered barrier system. Solubilities of plutonium, neptunium, uranium, americium, actinium, thorium, protactinium, lead, and radium have been re-evaluated using the newly updated thermodynamic database (Data0.ymp.R2). For all of the actinides, identical modeling approaches and consistent environmental conditions were used to develop solubility models in this revision. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, activity coefficients, and selection of solubility controlling phase have been quantified or otherwise addressed. Moreover, a new blended plutonium solubility model has been developed in this revision, which gives a mean solubility that is three orders of magnitude lower than the plutonium solubility model used for the Total System Performance Assessment for the Site Recommendation. Two alternative neptunium solubility models have also been

Phenotype abnormality: 236 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 236 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u742i decreased susceptibility... in response to organism Agrobacterium ... Agrobacterium ... decreased susceptibility toward ...

Phenotype abnormality: 213 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 213 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u719i decreased sensitivity toward under influ...ence of brassinosteroid ... decreased sensitivity toward ... brassinosteroid ...

Phenotype abnormality: 311 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 311 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u816i increased efficiency during process... named seed dormancy process ... increased efficiency ... seed dormancy process ...

Phenotype abnormality: 135 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 135 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u641i decreased efficiency during process... named seed dormancy process ... decreased efficiency ... seed dormancy process ...

How fission was discovered

International Nuclear Information System (INIS)

Fluegge, S.

1989-01-01

After the great survey of neutron induced radioactivity by Fermi and co-workers, the laboratories in Paris and Berlin-Dahlen tried to disentangle the complex results found in uranium. At that time neutron sources were small, activities low, and equipment very simple. Chemistry beyond uranium still was unknown. Hahn and Meitner believed to have observed three transuranic isomeric chains, a doubtful result even then. Early in 1938, Curie and Savic in Paris found an activity interpreted to be actinium, and Hahn and Meitner another to be radium. Both interpretations seemed impossible from energy considerations. Hahn and Strassmann, therefore, continued this work and succeeded to separate the new activity from radium. There remained no doubt that a barium isotope had been produced, the uranium nucleus splitting in the yet-unknown process we now call fission

Phenotype abnormality: 86 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 86 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u592i alternation in organ named inflore...scence during process named organ development ... inflorescence ... alternation ... organ development ...

Phenotype abnormality: 283 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 283 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u788i impaired in org...an named whole plant during process named vernalization response ... whole plant ... impaired ...

Reference: 691 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 691 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u18024555i Watanabe Mutsu...ogy Fukushima Atsushi|Kusano Miyako|Noji Masaaki|Oikawa Akira|Saito Kazuki|Watanabe Mutsumi

Phenotype abnormality: 407 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 407 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u911i lethal (sensu genetics...) during process named seedling development stage ... lethal (sensu genetics) ... seedling development stage ...

Phenotype abnormality: 411 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 411 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u915i lethal (sensu genetics...) in period of stem elongation stage ... stem elongation stage ... lethal (sensu genetics) ...

Phenotype abnormality: 35 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 35 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u541i abnormal for trait of behavioral quality... during process named response to gravity ... abnormal ... behavioral quality

New method for large scale production of medically applicable Actinium-225 and Radium-223

International Nuclear Information System (INIS)

Aliev, R.A.; Vasilyev, A.N.; Ostapenko, V.; Kalmykov, S.N.; Zhuikov, B.L.; Ermolaev, S.V.; Lapshina, E.V.

2014-01-01

Alpha-emitters ( 211 At, 212 Bi, 213 Bi, 223 Ra, 225 Ac) are promising for targeted radiotherapy of cancer. Only two alpha decays near a cell membrane result in 50% death of cancer cell and only a single decay inside the cell is required for this. 225 Ac may be used either directly or as a mother radionuclide in 213 Bi isotope generator. Production of 225 Ac is provided by three main suppliers - Institute for Transuranium Elements in Germany, Oak Ridge National Laboratory in USA and Institute of Physics and Power Engineering in Obninsk, Russia. The current worldwide production of 225 Ac is approximately 1.7 Ci per year that corresponds to only 100-200 patients that could be treated annually. The common approach for 225 Ac production is separation from mother 229 Th or irradiation of 226 Ra with protons in a cyclotron. Both the methods have some practical limitations to be applied routinely. 225 Ac can be also produced by irradiation of natural thorium with medium energy protons . Cumulative cross sections of 225 Ac, 227 Ac, 227 Th, 228 Th formations have been obtained recently. Thorium targets (1-9 g) were irradiated by 114-91 MeV proton beam (1-50 μA) at INR linear accelerator. After dissolution in 8 M HNO 3 + 0.004 M HF thorium was removed by double LLX by HDEHP in toluene (1:1). Ac and REE were pre-concentrated and separated from Ra and most fission products by DGA-Resin (Triskem). After washing out by 0.01 M HNO 3 Ac was separated from REE by TRU Resin (Triskem) in 3 M HNO 3 media. About 6 mCi 225 Ac were separated in hot cell with chemical yield 85%. The method may be upscaled for production of Ci amounts of the radionuclide. The main impurity is 227 Ac (0.1% at the EOB) but it does not hinder 225 Ac from being used for medical 225 Ac/ 213 Bi generators. (author)

The marine geochemistry of actinium-227: Evidence for its migration through sediment pore water

International Nuclear Information System (INIS)

Nozaki, Yoshiyuki; Yamada, Masatoshi; Nikaido, Hirofumi

1990-01-01

227 Ac with a half life of 21.8 years has a potential utility as a tracer of deep water circulation and mixing studies on time scales less than 100 years. Here the authors present the first measurement of 227 Ac profile in the pore water of Northwest Pacific deep-sea sediment and in the ∼10,000 m long water column of Izu-Ogasawara Trench. The results clearly show that 227 Ac is supplied from the sediment to the overlying water through migration in the pore water. The model calculation indicates that the molecular diffusion alone through sediment porewater can support only a half of the standing crop of excess 227 Ac in the water column and the enhanced supply of 227 Ac by particle mixing is necessary to account for the remainder. Thus, bioturbation in the deep sea plays an important role in controlling the flux of some short-lived radionuclides such as 227 Ac and 228 Ra across the sediment-water interface

Phenotype abnormality: 31 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 31 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u537i abnormal for trait of behavior...al quality during process named localization of cell ... abnormal ... behavioral quality

Phenotype abnormality: 33 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 33 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u539i abnormal for trait of behavior...al quality during process named response to auxin stimulus ... abnormal ... behavioral quality

Phenotype abnormality: 372 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available ent of high light intensity regimen in situation of photoinhibition in environment ... 372 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u877i increased sensitivity toward in environm

Phenotype abnormality: 32 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 32 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u538i abnormal for trait of behavioral quality... during process named organ development ... abnormal ... organ development ... behavioral quality

Phenotype abnormality: 34 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 34 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u540i abnormal for trait of behavioral quality... during process named response to cytokinin stimulus ... abnormal ... behavioral quality

Phenotype-gene: 748 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 748 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u924i abnormal for trait of behavior...7472i abnormal for trait of behavioral quality in organ named root during process

Phenotype-gene: 745 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 745 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u921i abnormal for trait of behavior...u18047472i abnormal for trait of behavioral quality in organ named hypocotyl duri

Phenotype-gene: 756 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 756 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u932i abnormal for trait of behavior...73454i abnormal for trait of behavioral quality in organ named whole plant during

Phenotype abnormality: 42 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 42 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u548i abnormal for trait of behavior...al quality in organ named root during process named gravitropism ... root ... abnormal ... behavioral quality

Phenotype-gene: 194 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available uence of brassinosteroid for AT1G12840 ... decreased sensitivity toward under influence... 194 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u1192i decreased sensitivity toward under infl

Phenotype-gene: 195 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available uence of brassinosteroid for AT4G33430 ... decreased sensitivity toward under influence... 195 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u1193i decreased sensitivity toward under infl

Phenotype abnormality: 339 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 339 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u844i increased number of inflore...scence in organ named whole plant ... whole plant ... present in greater numbers in organism ... inflorescence ...

Phenotype abnormality: 351 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 351 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u856i increased number of trichome... branch in organ named trichome ... trichome ... present in greater numbers in organism ... trichome branch ...

Phenotype abnormality: 383 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available of stomatal complex in environment of continuous dark (no light) regimen in environment of continuous dark (... 383 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u888i increased size

Phenotype abnormality: 90 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 90 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u596i arrhythmic in environment... of continuous dark (no light) regimen in environment of continuous dark (no light) regimen http://

Reference: 183 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 183 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u15737939i Booker Jon...noid-derived branch-inhibiting hormone. 3 443-9 15737939 2005 Mar Developmental cell Booker Jonathan|Goddard

Phenotype abnormality: 40 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 40 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u546i abnormal for trait of behavioral quality... in organ named hypocotyl during process named gravitropism ... hypocotyl ... abnormal ... behavioral quality

Phenotype abnormality: 43 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 43 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u549i abnormal for trait of behavioral quality... in organ named root during process named growth ... root ... abnormal ... growth ... behavioral quality

Phenotype-gene: 757 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available ait of behavioral quality in organ named whole plant during process named photomorphogenesis for AT2G36910 L...in Rongcheng et al. 2005 Jun. Plant Physiol. 138(2):949-64. http://metadb.riken.jp/db/SciNetS_ria224i/cria22... plant during process named photomorphogenesis http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u556i AT2G36910

Phenotype-gene: 758 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available ait of behavioral quality in organ named whole plant during process named photomorphogenesis for AT3G28860 L...in Rongcheng et al. 2005 Jun. Plant Physiol. 138(2):949-64. http://metadb.riken.jp/db/SciNetS_ria224i/cria22... plant during process named photomorphogenesis http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u556i AT3G28860

Excess enthalpies of ternary mixtures of oxygenated additives + hydrocarbon mixtures in fuels and bio-fuels: Dibutyl ether (DBE) and 1-butanol and 1-hexene or cyclohexane or 2,2,4 trimethylpentane at 298.15 K and 313.15 K

International Nuclear Information System (INIS)

Aguilar, Fernando; Alaoui, Fatima E.M.; Segovia, José J.; Montero, Eduardo A.

2013-01-01

Highlights: ► New excess enthalpy data for ternary mixtures of dibutyl ether + hydrocarbon + 1-butanol are reported. ► Four ternary systems at 298.15 K and 313.15 K were measured by means of an isothermal flow calorimeter. ► 420 Data were fitted to a Redlich–Kister rational equation. ► Intermolecular and association effects involved in these systems have been discussed. - Abstract: New experimental excess molar enthalpy data (420 points) of the ternary systems dibutyl ether (DBE) and 1-butanol and 1-hexene at 298.15 K and 313.15 K, and DBE and 1-butanol and cyclohexane or 2,2,4-trimethylpentane (TMP) at 313.15 K at atmospheric pressure are reported. A quasi-isothermal flow calorimeter has been used to make the measurements. All the ternary systems show endothermic character. The experimental data for the ternary systems have been fitted using the Redlich–Kister rational equation. Considerations with respect the intermolecular interactions amongst ether, alcohol and hydrocarbon compounds are presented.

Phenotype abnormality: 265 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 265 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u770i disrupted in or...gan named seedling during process named growth after radicle emergence stage ... seedling ... disrupted radicle emergence stage ... growth ...

Phenotype-gene: 751 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 751 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u927i abnormal for trait of behavior...4u15908594i abnormal for trait of behavioral quality in organ named root during p

Phenotype abnormality: 47 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 47 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u553i abnormal for trait of behavior...al quality in organ named thylakoid membrane during process named thylakoid membrane organization ... abnormal ... behavioral quality

Phenotype-gene: 750 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 750 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u926i abnormal for trait of behavior...4u15908594i abnormal for trait of behavioral quality in organ named root during p

Phenotype abnormality: 334 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 334 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u839i increased number of axillary inflore...scence bud in organ named inflorescence ... inflorescence ... present in greater numbers in organism ... axillary inflorescence bud ...

Reference: 612 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 612 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u17513484i Feng Haizh...1531-45 17513484 2007 Jul Plant physiology Chen Qingguo|Feng Haizhong|Feng Jian|Yang Xiaohui|Zhang Jian|Zuo Jianru

Reference: 359 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 359 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u16531491i Cnops Gerda...leaf development in Arabidopsis thaliana. 4 852-66 16531491 2006 Apr The Plant cell Azmi Abdelkrim|Cnops Gerda

Phenotype abnormality: 460 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 460 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u964i pale green whole plant in environment... of low light intensity regimen in environment of low light intensity regimen http://m

Phenotype abnormality: 251 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available lant flowering stage in environment of long day length regimen in environment of long day length regimen htt... 251 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u757i delayed whole p

Phenotype abnormality: 384 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available of stomatal complex in environment of light regimen in environment of light regimen http://metadb.riken.jp/d... 384 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u889i increased size

Phenotype abnormality: 415 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available nment of soil environment in environment of soil environment http://metadb.riken.jp... 415 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u919i lethal in organ named seedling in enviro

Phenotype abnormality: 252 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available lant flowering stage in environment of short day length regimen in environment of short day length regimen h... 252 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u758i delayed whole p

Phenotype abnormality: 340 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 340 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u845i increased number of lateral root... in organ named primary root ... primary root ... present in greater numbers in organism ... lateral root ...

Phenotype abnormality: 50 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 50 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u556i abnormal for trait of behavioral quality... in organ named whole plant during process named photomorphogenesis ... whole plant ... abnormal ... behavioral quality

Reference: 693 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 693 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u18036201i Garcia Mar...nzyme MurE has an essential role in chloroplast development. 6 924-34 18036201 2008 Mar The Plant journal Garcia

Reference: 751 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 751 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u18390806i Sitaraman ...unctions during Arabidopsis embryo and floral development. 2 672-81 18390806 2008 Jun Plant physiology Bui Minh|Liu Zhongchi|Sitaraman Jayashree

Phenotype abnormality: 44 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 44 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u550i abnormal for trait of behavior...al quality in organ named root during process named organ development ... root ... abnormal ... organ development ... behavioral quality

Phenotype abnormality: 45 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 45 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u551i abnormal for trait of behavior...al quality in organ named stamen during process named organ development ... stamen ... abnormal ... organ development ... behavioral quality

Phenotype abnormality: 37 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 37 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u543i abnormal for trait of behavior...al quality in organ named cotyledon during process named organ development ... cotyledon ... abnormal ... organ development ... behavioral quality

Phenotype abnormality: 39 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 39 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u545i abnormal for trait of behavior...al quality in organ named flower during process named organ development ... flower ... abnormal ... organ development ... behavioral quality

Phenotype-gene: 373 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 373 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u1370i increased dens...ity for quantity of tocopherol in organ named vascular leaf for AT1G64970 ... increased density for quantity of tocoph

Reference: 414 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 414 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u16832621i Jayasekaran Kandakumar... 11 1255-62 16832621 2006 Nov Plant cell reports Jayasekaran Kandakumar|Kim Kyung-Nam|Ok Sung Han|Shin Jeong Sheop|Vivekanandan Munusamy

Phenotype-gene: 739 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 739 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u915i abnormal for trait of behavior...al quality during process named response to cytokinin stimulus for AT4G16420 ... abnormal for trait of behavior

Phenotype-gene: 738 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 738 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u914i abnormal for trait of behavior...al quality during process named response to auxin stimulus for AT4G16420 ... abnormal for trait of behavior

Phenotype abnormality: 49 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 49 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u555i abnormal for trait of behavior...al quality in organ named whole plant during process named cell growth ... whole plant ... abnormal ... cell growth ... behavioral quality

Phenotype-gene: 749 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 749 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u925i abnormal for trait of behavior...al quality in organ named root during process named growth for AT5G60920 ... abnormal for trait of behavior

Phenotype abnormality: 48 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 48 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u554i abnormal for trait of behavior...al quality in organ named vascular leaf during process named organ development ... vascular leaf ... abnormal ... organ development ... behavioral quality

Reference: 378 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 378 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u16640597i Guo Yongfeng... family transcription factor, has an important role in leaf senescence. 4 601-12 16640597 2006 May The Plant journal Gan Susheng|Guo Yongfeng

Phenotype-gene: 782 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 782 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u958i abnormal for trait of morph...ology in organ named seedling for AT2G19760 ... abnormal for trait of morphology in organ named se

Phenotype-gene: 783 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 783 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u3ria224u959i abnormal for trait of morph...ology in organ named seedling for AT5G49720 ... abnormal for trait of morphology in organ named se

Reference: 696 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 696 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u18047472i Harrison B...gravity signal transduction pathway in root statocytes. 2 380-92 18047472 2008 Jan The Plant journal Harrison Benjamin R|Masson Patrick H

Reference: 610 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 610 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u17496122i Anand Ajit...7 May The Plant cell Anand Ajith|Citovsky Vitaly|Krichevsky Alexander|Lahaye Thomas|Mysore Kirankumar S|Schornack Sebastian|Tang Yuhong|Tzfira Tzvi

Reference: 163 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 163 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u15660207i Kanter Ulr...saccharides. 2 243-54 15660207 2005 May Planta Guerineau Fran巽ois|Kanter Ulrike|Li Yong|Pauly Markus|Tenhaken Raimund|Usadel Bj旦rn

Reference: 236 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 236 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u15992545i Dharmasiri...5 Jul Developmental cell Dharmasiri Nihal|Dharmasiri Sunethra|Ehrismann Jasmin S|Estelle Mark|Hobbie Lawrence|J端rgens Gerd|Lechner Esther|Weijers Dolf|Yamada Masashi

Distribution characteristics of radium isotopes and their influence factors in the water of Jiaozhou Bay area

International Nuclear Information System (INIS)

Wang Bo; Guo Zhanrong; Yuan Xiaojie; Zhang Bin; Ma Zhiyong; Liu Jie

2014-01-01

Background: The interaction between continental and oceanic process is much intense in coastal region. The terrestrial freshwater mixes with seawater here which leads to the chemical constituents in water undergo rapid change. Purpose: The aim is to analyze and study the distribution characteristics of 224 Ra and 226 Ra and their influence factors in the water of Jiaozhou Bay area. Methods: The water samples of 224 Ra and 226 Ra were collected from groundwater, river water and seawater around the Jiaozhou Bay from April to May, 2012. In the laboratory, the activities of 224 Ra absorbed on the Mn-fiber were measured through the continuous emanation method. Finally, the Mn-fiber was sealed for more than 7 days, and the activities of 226 Ra absorbed on the Mn-fiber were measured through the direct emanation method. Results: The results show that the activities of 224 Ra and 226 Ra in groundwater and river water are much higher in the granitic area which has higher concentration of 232 Th and 238 U. Because of mixing with seawater, the salinity of groundwater and river water in coastal region rises which leads to the increasing amounts of 224 Ra and 226 Ra desorbed from the particles, resulting in higher activities of 224 Ra and 226 Ra in coastal region. Affected by the input of river (dissolved and desorbed from suspended particles) and submarine groundwater discharge (SGD), the activities of 224 Ra and 226 Ra are relatively higher in nearshore seawater, then with the decay of 224 Ra and mixing dilution effect of the offshore seawater, the activities of 224 Ra gradually decrease from nearshore region to the open ocean. The activities of 226 Ra in the seawater of Jiaozhou Bay remain high-level values, and there are only a few zones of low 226 Ra activities. The main reasons are that the activities of 226 Ra from terrestrial freshwater are close to those from offshore seawater and the half-life of 226 Ra is very long. Conclusion: The activities of 224 Ra and 226 Ra in

Reference: 248 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 248 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u16045474i Singh Sunil Kumar... the animal exostosins. 3 384-97 16045474 2005 Aug The Plant journal Eland Cathlene|Harholt Jesper|Marchant Alan|Scheller Henrik Vibe|Singh Sunil Kumar

Reference: 590 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 590 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u17450124i Caro Elena et al. 2007 May. Nature... to root epidermis patterning in Arabidopsis. 7141 213-7 17450124 2007 May Nature Caro Elena|Castellano M Mar|Gutierrez Crisanto

Reference: 282 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 282 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u16214903i Kasahara Ryushiro...abidopsis. 11 2981-92 16214903 2005 Nov The Plant cell Drews Gary N|Kasahara Ryushiro D|Portereiko Michael F|Rabiger David S|Sandaklie-Nikolova Linda

Process for radioisotope recovery and system for implementing same

Science.gov (United States)

Meikrantz, David H [Idaho Falls, ID; Todd, Terry A [Aberdeen, ID; Tranter, Troy J [Idaho Falls, ID; Horwitz, E Philip [Naperville, IL

2009-10-06

A method of recovering daughter isotopes from a radioisotope mixture. The method comprises providing a radioisotope mixture solution comprising at least one parent isotope. The at least one parent isotope is extracted into an organic phase, which comprises an extractant and a solvent. The organic phase is substantially continuously contacted with an aqueous phase to extract at least one daughter isotope into the aqueous phase. The aqueous phase is separated from the organic phase, such as by using an annular centrifugal contactor. The at least one daughter isotope is purified from the aqueous phase, such as by ion exchange chromatography or extraction chromatography. The at least one daughter isotope may include actinium-225, radium-225, bismuth-213, or mixtures thereof. A liquid-liquid extraction system for recovering at least one daughter isotope from a source material is also disclosed.

Phenotype-gene: 400 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available rescence for quantity of chlorophyll for AT5G52110 Lyska Dagmar et al. 2007 Dec. Plant Cell Physiol. 48(12):...1737-46. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u17971335i increased fluorescence for quantity of chloroph

Reference: 759 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 759 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u18434608i Guan Yue-Feng...s. 2 852-63 18434608 2008 Jun Plant physiology Gao Ju-Fang|Guan Yue-Feng|Huang Xue-Yong|Yang Zhong-Nan|Zhang Hong-Xia|Zhu Jun

Phenotype-gene: 188 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available stance in response to organism Plectosphaerella cucumerina for AT1G59870 Stein M坦nica et al. 2006 Mar. Plant... in response to organism Plectosphaerella cucumerina http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u713i AT1G59870

Phenotype-gene: 399 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available rescence for quantity of chlorophyll for AT5G51545 Ma Jinfang et al. 2007 Jun. Plant Cell 19(6):1980-93. htt...p://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u17601825i increased fluorescence for quantity of chloroph

Reference: 322 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 322 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u16407439i Konishi Mi...gene, ROOT PRIMORDIUM DEFECTIVE 1, is required for the maintenance of active cell proliferation. 2 591-602 16407439 2006 Feb Plant physiology Konishi Mineko|Sugiyama Munetaka

Phenotype-gene: 376 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available ciency during process named UV protection for AT2G31660 Zhao Jinfeng et al. 2007 Nov. Plant Cell 19(11):3805...-18. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u17993626i increased efficiency during process named UV protection

Reference: 223 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 223 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u15923347i Dohmann Es... cause the cop/det/fus mutant phenotype in Arabidopsis. 7 1967-78 15923347 2005 Jul The Plant cell Dohmann Esther M N|Kuhnle Carola|Schwechheimer Claus

Reference: 291 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 291 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u16244906i Chai Mao-Feng...d chloroplast protection. 4 553-64 16244906 2005 Nov Plant molecular biology An Rui|Chai Mao-Feng|Chen Jia|Chen Qi-Jun|Chen Ye-Miao|Wang Xue-Chen

Phenotype-gene: 345 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available an named peduncle during process named trichome morphogenesis for AT2G30432 Wang Shucai et al. 2007 Nov. Dev...an named peduncle during process named trichome morphogenesis http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u774i AT2G30432

Phenotype-gene: 344 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available an named pedicel during process named trichome morphogenesis for AT2G30432 Wang Shucai et al. 2007 Nov. Deve...n named pedicel during process named trichome morphogenesis http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u773i AT2G30432

Phenotype-gene: 454 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available stance in response to organism biotroph for AT5G60600 Gil M Jos辿 et al. 2005 Oct. Plant J. 44(1):155-66. htt...p://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u16167903i increased resistance in response to organism biotroph

Phenotype-gene: 547 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available growth in environment of fertilized soil for AT5G40780 Hirner Axel et al. 2006 Aug. Plant Cell 18(8):1931-4...6. http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u16816136i non-functional growth in environment of fertilized soil

Reference: 385 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 385 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u16690816i Dharmasiri...y Science (New York, N.Y.) Bennett M J|Dharmasiri N|Dharmasiri S|Estelle M|Kowalchyk M|Marchant A|Mills S|Mockaitis K|Sandberg G|Singh S K|Swarup R

Reference: 239 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 239 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u16015335i Bundock Paul et al. 2005 Jul. Natur...functions. An Arabidopsis hAT-like transposase is essential for plant development. 7048 282-4 16015335 2005 Jul Nature Bundock Paul|Hooykaas Paul

Reference: 736 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 736 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u18305482i Negi Juntaro et al. 2008 Mar. Natur...l. CO2 regulator SLAC1 and its homologues are essential for anion homeostasis in plant cells. 7186 483-6 18305482 2008 Mar Nature

Phenotype-gene: 740 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available ait of behavioral quality during process named response to gravity for AT5G06140 Jaillais Yvon et al. 2006 S... trait of behavioral quality during process named response to gravity http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u541i AT5G06140

Reference: 556 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 556 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u17337534i Padmanaban Senthilkumar...+ exchanger AtCHX20 in osmoregulation of guard cells. 1 82-93 17337534 2007 May Plant physiology Chanroj Salil|Kwak June M|Li Xiyan|Padmanaban Senthilkumar|Sze Heven|Ward John M

Phenotype-gene: 460 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available onsivity in organ named whole plant under influence of ethene for AT5G40770 Christians Matthew J et al. 2007...responsivity in organ named whole plant under influence of ethene http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u870i AT5G40770

Phenotype-gene: 497 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available ward in organ named root under influence of ethene for AT1G54490 Olmedo Gabriela et al. 2006 Sep. Proc. Natl...sensitive toward in organ named root under influence of ethene http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u903i AT1G54490

Phenotype-gene: 472 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available itivity toward in organ named seedling during process named growth under influence of abscisic acid for AT5G...g during process named growth under influence of abscisic acid http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u879i AT5G13680

Reference: 241 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 241 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u16024589i Calderon-V...development of Arabidopsis thaliana. 9 2473-85 16024589 2005 Sep The Plant cell Bevan Mike|Calderon-Villalobos Luz I A|Dohmann Esther M N|Kuhnle Carola|Li Hanbing|Schwechheimer Claus

Reference: 418 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 418 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u16856986i Chai Mao-Feng...cid responses in Arabidopsis. 5 665-74 16856986 2006 Sep The Plant journal An Rui|Chai Mao-Feng|Chen Jia|Chen Qi-Jun|Wang Xue-Chen|Wei Peng-Cheng|Yang Shuhua

Reference: 295 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 295 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u16284313i Fujita Yas...ng that enhances drought stress tolerance in Arabidopsis. 12 3470-88 16284313 200...5 Dec The Plant cell Fujita Miki|Fujita Yasunari|Hiratsu Keiichiro|Maruyama Kyonoshin|Ohme-Takagi Masaru|Par

Reference: 177 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 177 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u15722472i Al-Daoude ...lator of the plant disease resistance protein RPM1. 3 1016-28 15722472 2005 Mar The Plant cell Al-Daoude Antonious|Grant Murray|Ko Jong-Hyun|de Torres Zabala Marta

Reference: 32 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 32 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u12753583i Friesner Jo...0- and DNA ligase IV-deficient plants are sensitive to ionizing radiation and defective in T-DNA integration. 4 427-40 12753583 2003 May The Plant journal Britt Anne B|Friesner Joanna

Study of the specific concentrations of {sup 40}K, {sup 224}Ra, {sup 226}Ra and {sup 228}Ra in some seasonings marketed in Rio de Janeiro City

Energy Technology Data Exchange (ETDEWEB)

Garcêz, Ricardo W.D.; Lopes, José M.; Silva, Leandro B.; Silva, Ademir X. da [Coordenacao de Pos-Graduacao e Pesquisa de Engenharia (PEN/COPPE/UFRJ), Rio de Janeiro, RJ (Brazil). Programa de Engenharia Nuclear; Lima, Marco A.F., E-mail: rgarcez@nuclear.ufrj.br [Universidade Federal Fluminense (UFF), Niterói, RJ (Brazil). Instituto de Biologia

2017-07-01

The seasoning are vegetables substances used in foods to enhance their flavor, aroma and color. This work presents an investigation of the activity concentration of Naturally Occurring Radioactive Materials (NORMs) in 28 samples of seasoning utilized by brazilian population. The seasoning samples were measured using gamma spectroscopy technique with a high-purity germanium (HPGe) detector, a non-destructive nuclear method and with the LabSOCS software for the calculation of the efficiency curve. The analysis shows that the activity concentration of {sup 40}K was measured in all samples and ranges from 21.0 Bq/kg to 1288 Bq/kg. The highest concentration activity of {sup 40}K was measured to 'cheiro verde', a local seasoning made of chives (Allium Schoenoprasum) and parsley (Petroselinum Crispum), while annatto, made with the fruit of Bixa Orelhana, had the lowest activity concentration. Brazil nut (Bertholletia Excelsa) presented the highest concentrations for {sup 226}Ra and {sup 228}Ra with 24 Bq/kg and 25.7 Bq/kg, respectively and black pepper (Piper Nigrum) presented the highest concentration for {sup 224}Ra with 33.9 Bq/kg. The highest effective dose for members of the public due to ingestion was 23.5 μSv/y due to Brazil nut and the lowest effective dose was found for annatto: 0.13 μSv/y. The syrian seasoning sample present specific concentration of 6.1±1.1 Bq/kg for {sup 137}Cs and 0.08 μSv/y of effective dose. The values found in this work do not represent a risk to human health. (author)

Phenotype-gene: 486 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available d in organ named stomatal complex during process named stomatal movement for AT1G20090 Jeon Byeong Wook et a...reased speed in organ named stomatal complex during process named stomatal movement http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u893i AT1G20090

Phenotype-gene: 471 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available itivity toward in organ named guard cell under influence of abscisic acid for AT1G30270 Cheong Yong Hwa et a...eased sensitivity toward in organ named guard cell under influence of abscisic acid http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u878i AT1G30270

Phenotype-gene: 473 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available itivity toward in organ named whole plant under influence of ethene for AT5G40770 Christians Matthew J et al...eased sensitivity toward in organ named whole plant under influence of ethene http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u880i AT5G40770

Phenotype-gene: 495 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available ward in organ named hypocotyl under influence of ethene for AT1G54490 Olmedo Gabriela et al. 2006 Sep. Proc....7i insensitive toward in organ named hypocotyl under influence of ethene http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u902i AT1G54490

Phenotype-gene: 203 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available in organ named epidermal pavement cell in organ named vascular leaf for AT5G24630 Kirik Viktor et al. 2007 ...d size in organ named epidermal pavement cell in organ named vascular leaf http://metadb.riken.jp/db/SciNetS_ria224i/cria224u1ria224u724i AT5G24630

Reference: 193 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available 193 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u15772667i Peiter Edgar et al. 2005 Mar. Natur...ation and stomatal movement. 7031 404-8 15772667 2005 Mar Nature Hetherington Alistair M|Knight Heather|Maathuis Frans J M|Mills Lewis N|Peiter Edgar|Pelloux J辿r担me|Sanders Dale

Publications | Page 224 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Simulation study of inter-firm network knowledge transfer moderated by the proximity [Chinese language] (restricted access). In order to explore the influence of inter-firm network attributes on knowledge transfer performance, a multi-agent simulation model was established. Results of the computerized simulation were ...

Publications | Page 224 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

IDRC works with developing-country researchers and institutions to build local ... Promoting Decent Work for Women in the Banking and Domestic Sectors in ... by the Institute for Social and Environmental Transition (ISET) in collaboration with ... geographical disparities faced by different Indonesian provinces and districts.

Publications | Page 224 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

IDRC works with developing-country researchers and institutions to build local capacity ... In most countries fiscal and social reforms are subject to political swings, which are reflected in the ... Policy brief : revising Thailand's financing innovation policies (restricted access) ... Malaysia, Singapore, Taiwan and Thailand were.

Reference: 584 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available ing in Arabidopsis thaliana shoot and root stem cell organizers. 7137 811-4 17429400 2007 Apr Nature Hashimo...nda K et al. 2007 Apr. Nature 446(7137):811-4. Throughout the lifespan of a plant, which in some cases can l... 584 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u17429400i Sarkar Ana

Reference: 435 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available Arabidopsis. 7107 106-9 16936718 2006 Sep Nature Fobis-Loisy Isabelle|Gaude Thierry|Jaillais Yvon|Miège Christine|Rollin Claire ... 435 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u16936718i Jaillais Yvon et al. 2006 Sep. Natu...re 443(7107):106-9. Polarized cellular distribution of the phytohormone auxin and i

The chemistry of the actinide elements. Volume I

International Nuclear Information System (INIS)

Katz, J.J.; Seaborg, G.T.; Morss, L.R.

1986-01-01

The Chemistry of the Actinide Elements is a comprehensive, contemporary and authoritative exposition of the chemistry and related properties of the 5f series of elements: actinium, thorium, protactinium, uranium and the first eleven. This second edition has been completely restructured and rewritten to incorporate current research in all areas of actinide chemistry and chemical physics. The descriptions of each element include accounts of their history, separation, metallurgy, solid-state chemistry, solution chemistry, thermo-dynamics and kinetics. Additionally, separate chapters on spectroscopy, magnetochemistry, thermodynamics, solids, the metallic state, complex ions and organometallic compounds emphasize the comparative chemistry and unique properties of the actinide series of elements. Comprehensive lists of properties of all actinide compounds and ions in solution are given, and there are special sections on such topics as biochemistry, superconductivity, radioisotope safety, and waste management, as well as discussion of the transactinides and future elements

A neutron source of variable fluence

International Nuclear Information System (INIS)

Brachet, Guy; Demichel, Pascal; Prigent, Yvon; Riche, J.C.

1975-01-01

The invention concerns a variable fluence neutron source, like those that use in the known way a reaction between a radioactive emitter and a target, particularly of type (α,n). The emitter being in powder form lies in a carrier fluid forming the target, inside a closed containment. Facilities are provided to cause the fluidisation of the emitter by the carrier fluid in the containment. The fluidisation of the emitting powder is carried out by a booster with blades, actuated from outside by a magnetic coupling. The powder emitter is a α emitter selected in the group of curium, plutonium, thorium, actinium and americium oxides and the target fluid is formed of compounds of light elements selected from the group of beryllium, boron, fluorine and oxygen 18. The target fluid is a gas used under pressure or H 2 O water highly enriched in oxygen 18 [fr

Phenotype-gene: 93 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available iency in organ named root during process named phototropism in environment of blue light regimen for AT2G029...50 Boccalandro Hern叩n E et al. 2008 Jan. Plant Physiol. 146(1):108-15. http://metadb.riken.jp/db/SciNetS_ria...224i/cria224u4ria224u18024556i decreased efficiency in organ named root during process named ph

Reference: 678 [Arabidopsis Phenome Database[Archive

Lifescience Database Archive (English)

Full Text Available velopment. 7165 1053-7 17960244 2007 Oct Nature Blilou Ikram|Galinha Carla|Heidstra Renze|Hofhuis Hugo|Luijten Marijn|Scheres Ben|Willemsen Viola ... 678 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u17960244i Galinha Carla et al. 2007 Oct. Natu...re 449(7165):1053-7. Factors with a graded distribution can program fields of cells

肿瘤患者机体组成及肌肉减少症的调查%Observational research on body composition and sarcopenia in patients with tumor

Institute of Scientific and Technical Information of China (English)

吴焱; 凌轶群; 丁慧萍; 钱泳; 汪琼

2016-01-01

Objective:To observe body composition and the occurrence of sarcopenia in tumor patients so as to provide evidence for the early monitoring of their nutritional status .Methods:Bioelectrical impedance analysis(BIA) was adopted to analyze the body composition and appendicular skeletal muscle mass index (ASMI) was used to observe the occurrence of sarcopenia to explore the relationship between BMI and sarcopenia in 224 patients with tumor .The body composition of 224 cases of tumor patients was analyzed by bioelectrical impedance analysis(BIA) .The occurrence of sarcopenia was observed with appendicular skeletal mass index (ASMI) ,and the relationship between body mass index (BMI) and sarcopenia was also explored .Results:In 224 tumor patients ,13 .4% (30/224) were underweight ,60 .7% (136/224) were normal weight and 25 .9% (58/224) were overweight or obese .The incidence of sarcopenia was 58 .04% (130/224) ,and 77 .7% (101/130) of the patients with sarcopenia were normal ,overweight or obese .Conclusions:The change of the muscle and its function in cancer patients is as noteworthy as weight loss .Body composition of cancer patients should be timely monitored in order to optimize nutritional risk screening , establish individualized nutritional support , and develop the treatment plan with best tolerance .%目的：观察肿瘤患者的机体组成和肌肉减少症（sarcopenia）的发生情况，为尽早监测肿瘤患者的营养状况提供依据。方法：采用生物电阻抗法（bioelectrical impedance analysis ，BIA ）分析224例肿瘤患者的机体组成，利用四肢骨骼肌指数（appendicular skeletal mass index ，ASMI）观察肌肉减少症的发生情况，并探究肿瘤患者体质指数（BMI）与肌肉减少症的关系。结果：224例肿瘤患者中13．4％（30／224）为消瘦，60．7％（136／224）为正常体质量，25．9％（58／224）为超重或肥胖。肌肉减少症发生率为58．04％（130／224） ，77．7�

Purification of radium-226 for the manufacturing of actinium-225 in a cyclotron for alpha-immunotherapy

International Nuclear Information System (INIS)

Marx, Sebastian Markus

2014-01-01

The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.

Linear free energy relationship applied to trivalent cations with lanthanum and actinium oxide and hydroxide structure

International Nuclear Information System (INIS)

Ragavan, Anpalaki J.

2006-01-01

Linear free energy relationships for trivalent cations with crystalline M 2 O 3 and, M(OH) 3 phases of lanthanides and actinides were developed from known thermodynamic properties of the aqueous trivalent cations, modifying the Sverjensky and Molling equation. The linear free energy relationship for trivalent cations is as ΔG f,MvX 0 =a MvX ΔG n,M 3+ 0 +b MvX +β MvX r M 3+ , where the coefficients a MvX , b MvX , and β MvX characterize a particular structural family of MvX, r M 3+ is the ionic radius of M 3+ cation, ΔG f,MvX 0 is the standard Gibbs free energy of formation of MvX and ΔG n,M 3+ 0 is the standard non-solvation free energy of the cation. The coefficients for the oxide family are: a MvX =0.2705, b MvX =-1984.75 (kJ/mol), and β MvX =197.24 (kJ/molnm). The coefficients for the hydroxide family are: a MvX =0.1587, b MvX =-1474.09 (kJ/mol), and β MvX =791.70 (kJ/molnm).

Development of ion beam sputtering techniques for actinide target preparation

International Nuclear Information System (INIS)

Aaron, W.S.; Zevenbergen, L.A.; Adair, H.L.

1985-01-01

Ion beam sputtering is a routine method for the preparation of thin films used as targets because it allows the use of minimum quantity of starting material, and losses are much lower than most other vacuum deposition techniques. Work is underway in the Isotope Research Materials Laboratory (IRML) at ORNL to develop the techniques that will make the preparation of actinide targets up to 100 μg/cm 2 by ion beam sputtering a routinely available service from IRML. The preparation of the actinide material in a form suitable for sputtering is a key to this technique, as is designing a sputtering system that allows the flexibility required for custom-ordered target production. At present, development work is being conducted on low-activity in a bench-top system. The system will then be installed in a hood or glove box approved for radioactive materials handling where processing of radium, actinium, and plutonium isotopes among others will be performed. (orig.)

Development of ion beam sputtering techniques for actinide target preparation

Science.gov (United States)

Aaron, W. S.; Zevenbergen, L. A.; Adair, H. L.

1985-06-01

Ion beam sputtering is a routine method for the preparation of thin films used as targets because it allows the use of a minimum quantity of starting material, and losses are much lower than most other vacuum deposition techniques. Work is underway in the Isotope Research Materials Laboratory (IRML) at ORNL to develop the techniques that will make the preparation of actinide targets up to 100 μg/cm 2 by ion beam sputtering a routinely available service from IRML. The preparation of the actinide material in a form suitable for sputtering is a key to this technique, as is designing a sputtering system that allows the flexibility required for custom-ordered target production. At present, development work is being conducted on low-activity actinides in a bench-top system. The system will then be installed in a hood or glove box approved for radioactive materials handling where processing of radium, actinium, and plutonium isotopes among others will be performed.

Proposed training program for construction personnel involved in remedial action work at sites contaminated by naturally occurring radionuclides

International Nuclear Information System (INIS)

Berven, B.A.; Goldsmith, W.A.; Haywood, F.F.; Schiager, K.J.

1979-01-01

Many sites used during the early days of the US atomic energy program are contaminated with radionuclides of the primordial decay chains (uranium, thorium, and actinium series). This contamination consists of residues resulting from refining and processing uranium and thorium. Preparation of these sites for release to unrestricted private use will involve the assistance of construction workers, many of whom have limited knowledge of the hazards associated with radioactive materials. Therefore, there is a need to educate these workers in the fundamentals of radioactive material handling to minimize exposures and possible spread of contamination. This training should disseminate relevant information at an appropriate educational level and should instill a cautious, common-sense attitude toward the handling of radioactive materials. The training should emphasize basic information concerning environmental radiation within a context of relative risk. A multi-media format, including colorful visual aids, demonstration, and discussion, should be used to maximize motivation and retention. A detailed, proposed training program design is presented

Multiple approaches towards decolorization and reuse of a textile dye (VB-B) by a marine bacterium Shewanella decolorationis

Digital Repository Service at National Institute of Oceanography (India)

SatheeshBabu, S.; Mohandass, C.; VijayRaj, A.S.; Rajasabapathy, R.; Dhale, M.A.

stream_size 41279 stream_content_type text/plain stream_name Water_Air_Soil_Pollut_224_1500a.pdf.txt stream_source_info Water_Air_Soil_Pollut_224_1500a.pdf.txt Content-Encoding UTF-8 Content-Type text/plain; charset=UTF-8...     1    Author version: Water Air Soil Pollut., vol.224(4); 2013; 1500 Multiple approaches towards decolorization and reuse of a textile dye (VB-B) by a marine bacterium Shewanella decolorationis S. Satheesh Babu, C.Mohandass*, A.S.Vijay Raj, R...

Table_S6.xls

Indian Academy of Sciences (India)

Vit4

369, 6, 406, -0.01, 0.0057, 0.0108. 370, 7, 334, -0.048, 0.0081, 0.0264. 371. 372, 48, 1vzwA, 1, 224, 0.005, 0.005, 0. 373, 2, 224, 0.005, 0.005, 0. 374, 3, 224, 0.005, 0.005, 0. 375, 4, 222, 0.004, 0.0053, 0.0061. 376, 5, 221, -0.001, 0.0043, 0.0079. 377, 6, 213, 0.01, 0.0049, 0.0153. 378. 379, 49, 1xagA, 1, 353, 0.001, 0.0008 ...

Gender | Page 224 | IDRC - International Development Research ...

International Development Research Centre (IDRC) Digital Library (Canada)

Our planet's ability to sustain human life has long been a subject of study and concern by economists, demographers, and environmentalists. Yet most experts no longer consider overpopulation a major threat to humanity. Of greater concern to social scientists is the emerging trend of population aging — the topic of a recent ...

7 CFR 1951.224 - Third party agreements.

Science.gov (United States)

2010-01-01

... in changes to the borrower's legal organizational structure which would result in its loss of control... Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS...) PROGRAM REGULATIONS (CONTINUED) SERVICING AND COLLECTIONS Servicing of Community and Direct Business...

Editorial [Malta Medical Journal, Vol.22(4)

OpenAIRE

Vassallo, Josanne

2010-01-01

Another publication year has come to an end and I note with pleasure the diversity of papers that have been submitted over the course of the past year. The papers are of particular interest to the medical community in the Maltese islands. A survey dealing with the aetiology of infectious intestinal disease provides information of relevance to practitioners in Malta.

Does bank failure affect client firms? Micro evidence from Estonia

Czech Academy of Sciences Publication Activity Database

Joeveer, Karin

-, č. 224 (2004), s. 1-29 ISSN 1211-3298 Institutional research plan: CEZ:AV0Z7085904 Keywords : bank failure * client firm performance * firm bank ruptcy Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp224.pdf

Browse Title Index

African Journals Online (AJOL)

Items 201 - 224 of 224 ... Vol 13, No 2 (2010), Spatial Analysis of Particle Size Distribution of Soils Formed on ... swelling index and moisture content of white and yellow garri in ... and Composition of Milk of West African Dwarf (Wad) Sheep Fed ...

Dicty_cDB: Contig-U16011-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available J669288 |pid:none) Crassostrea gigas isolate I_8 acti... 224 1e-59 EU128481_1( EU128481 |pid:none) Tanichthys albonube... 224 1e-59 EU128482_1( EU128482 |pid:none) Tanichthys albonubes beta-actin ge...

Analysis of ancestral and functionally relevant CD5 variants in systemic lupus erythematosus patients.

Directory of Open Access Journals (Sweden)

Maria Carmen Cenit

Full Text Available CD5 plays a crucial role in autoimmunity and is a well-established genetic risk factor of developing RA. Recently, evidence of positive selection has been provided for the CD5 Pro224-Val471 haplotype in East Asian populations. The aim of the present work was to further analyze the functional relevance of non-synonymous CD5 polymorphisms conforming the ancestral and the newly derived haplotypes (Pro224-Ala471 and Pro224-Val471, respectively as well as to investigate the potential role of CD5 on the development of SLE and/or SLE nephritis.The CD5 SNPs rs2241002 (C/T; Pro224Leu and rs2229177 (C/T; Ala471Val were genotyped using TaqMan allelic discrimination assays in a total of 1,324 controls and 681 SLE patients of Spanish origin. In vitro analysis of CD3-mediated T cell proliferative and cytokine response profiles of healthy volunteers homozygous for the above mentioned CD5 haplotypes were also analyzed.T-cell proliferation and cytokine release were significantly increased showing a bias towards to a Th2 profile after CD3 cross-linking of peripheral mononuclear cells from healthy individuals homozygous for the ancestral Pro224-Ala471 (CC haplotype, compared to the more recently derived Pro224-Val471 (CT. The same allelic combination was statistically associated with Lupus nephritis.The ancestral Ala471 CD5 allele confers lymphocyte hyper-responsiveness to TCR/CD3 cross-linking and is associated with nephritis in SLE patients.

Paranjape, Dr Kapil Hari

Indian Academy of Sciences (India)

Date of birth: 19 March 1960. Specialization: Algebraic Geometry, Topology and Differential Geometry Address: Professor, Indian Institute of Science Education and Research, Knowledge City, Sector 81, Manauli P.O., Mohali, SAS Nagar 140 306, Panjab Contact: Office: (0172) 224 3110. Residence: (0172) 224 0019

In vivo characterization of the novel imidazopyridine BYK191023 [2-[2-(4-methoxy-pyridin-2-yl)-ethyl]-3H-imidazo[4,5-b]pyridine], a potent and highly selective inhibitor of inducible nitric-oxide synthase.

Science.gov (United States)

Lehner, Martin D; Marx, Degenhard; Boer, Rainer; Strub, Andreas; Hesslinger, Christian; Eltze, Manfrid; Ulrich, Wolf-Rüdiger; Schwoebel, Frank; Schermuly, Ralph Theo; Barsig, Johannes

2006-04-01

Excessive release of nitric oxide from inducible nitric-oxide synthase (iNOS) has been postulated to contribute to pathology in a number of inflammatory diseases. We recently identified imidazopyridine derivatives as a novel class of potent nitricoxide synthase inhibitors with high selectivity for the inducible isoform. In the present study, we tested the in vivo potency of BYK191023 [2-[2-(4-methoxy-pyridin-2-yl)-ethyl]-3H-imidazo-[4,5-b]pyridine], a selected member of this inhibitor class, in three different rat models of lipopolysaccharide-induced systemic inflammation. Delayed administration of BYK191023 dose-dependently suppressed the lipopolysaccharide-induced increase in plasma nitrate/nitrite (NO(x)) levels with an ED(50) of 14.9 micromol/kg/h. In a model of systemic hypotension following high-dose lipopolysaccharide challenge, curative administration of BYK191023 at a dose that inhibited 83% of the NO(x) increase completely prevented the gradual decrease in mean arterial blood pressure observed in vehicle-treated control animals. The vasopressor effect was specific for endotoxemic animals since BYK191023 did not affect blood pressure in saline-challenged controls. In addition, in a model of lipopolysaccharide-induced vascular hyporesponsiveness, BYK191023 infusion partially restored normal blood pressure responses to norepinephrine and sodium nitroprusside via an l-arginine competitive mechanism. Taken together, BYK191023 is a member of a novel class of highly isoform-selective iNOS inhibitors with promising in vivo activity suitable for mechanistic studies on the role of selective iNOS inhibition as well as clinical development.

Sequential phosphorylation of GRASP65 during mitotic Golgi disassembly

Directory of Open Access Journals (Sweden)

Danming Tang

2012-09-01

GRASP65 phosphorylation during mitosis and dephosphorylation after mitosis are required for Golgi disassembly and reassembly during the cell cycle. At least eight phosphorylation sites on GRASP65 have been identified, but whether they are modified in a coordinated fashion during mitosis is so far unknown. In this study, we raised phospho-specific antibodies that recognize phosphorylated T220/T224, S277 and S376 residues of GRASP65, respectively. Biochemical analysis showed that cdc2 phosphorylates all three sites, while plk1 enhances the phosphorylation. Microscopic studies using these antibodies for double and triple labeling demonstrate sequential phosphorylation and dephosphorylation during the cell cycle. S277 and S376 are phosphorylated from late G2 phase through metaphase until telophase when the new Golgi is reassembled. T220/224 is not modified until prophase, but is highly modified from prometaphase to anaphase. In metaphase, phospho-T220/224 signal localizes on both Golgi haze and mitotic Golgi clusters that represent dispersed Golgi vesicles and Golgi remnants, respectively, while phospho-S277 and S376 labeling is more concentrated on mitotic Golgi clusters. Expression of a phosphorylation-resistant GRASP65 mutant T220A/T224A inhibited mitotic Golgi fragmentation to a much larger extent than the expression of the S277A and S376A mutants. In cytokinesis, T220/224 dephosphorylation occurs prior to that of S277, but after S376. This study provides evidence that GRASP65 is sequentially phosphorylated and dephosphorylated during mitosis at different sites to orchestrate Golgi disassembly and reassembly during cell division, with phosphorylation of the T220/224 site being most critical in the process.

Using Radon and Radium isotopes to trace submarine groundwater discharge in Yilan Plain, Taiwan

Science.gov (United States)

Huang, Chun-Kai; Su, Chih-Chieh

2015-04-01

The Yilan Plain which located in the northeast Taiwan was selected for submarine groundwater discharge (SGD) study. The geomorphic and climatic conditions induce lush rain drenched mountains and create abundant groundwater resource in the Yilan Plain. The annual precipitation in 2014 is 2025 mm with most of the precipitation concentrated on autumn (from September to November). In this study, radon and radium isotopes are used as tracers for SGD survey. The 224Ra (t1/2 =3.6 days) was measured by a delayed coincidence counter (RaDeCC). The 222Rn (t1/2 =3.8 days) was measured by RAD-7 equipped with RAD H2O and RAD AQUA system. The river-water samples were collected from the main stream of Lanyang River and its tributaries from upstream to river mouth. The spring-water samples were collected at 8 sites in April, July and October 2014. Ten surface seawater samples along the coastline of the Yilan Plain were collected in August 2014. Our results show the activities of 222Rn and 224Ra in springs ranging from 3400 to 30850 Bq/m3 and 0.02 to 0.29 Bq/m3, and there are no significant differences between wet and dry seasons. Unexpectedly, the springs are characterized with high 222Rn and low 224Ra activities. For river samples, the activities of 224Ra in downstream and river mouth (0.18 to 1.48 Bq/m3) are higher than upstream (0 to 0.3 Bq/m3). The average activity of 224Ra in downstream samples which collected in April (0.98 Bq/m3) has the highest value than other seasons (0.41-0.51 Bq/m3). In coastal seawater, the activities of 222Rn and 224Ra ranged from 0 to 366 Bq/m3 and 0.10 to 1.14 Bq/m3 in August 2014. In summary, this study points out in some coastal regions of the Yilan Plain, where without riverine input, have high 222Rn and 224Ra activities in seawater. We suggest the SGD plays an important role on land-sea exchange along the coastline of the Yilan Plain. Compare with the spring water samples, the 224Ra activities in coastal seawater are 3-4 times higher than

Browse Title Index

African Journals Online (AJOL)

Items 201 - 224 of 224 ... Annotated Extracts from Samuel Cronwright's Diaries (Sept. 1921-Nov. 1923). Abstract. P Walters, J Fogg. Vol 38, No 3 (2011), Thomas Pringle's “The Emigrant's Cabin” and the Invention of Settler Colonialism, Abstract. M Shum. Vol 39, No 2 (2012), Three Tales of Theal: Biography, History and ...

Geological disposal: security and R and D. Security of 'second draft for R and D of geological disposal'

International Nuclear Information System (INIS)

Shiotsuki, Masao; Miyahara, Kaname

2003-01-01

The second draft for R and D of geological disposal (second draft) was arranged in 1999. The idea of security of geological disposal in the second draft is explained. The evaluation results of the uncertainty analysis and an example of evaluation of the effect of separation nuclear transmutation on the geological disposal are shown. The construction of strong engineered barrier is a basic idea of geological disposal system. Three processes such as isolation, engineering countermeasures and safety evaluation are carried out for the security of geological disposal. The security of geological environment for a long time of 12 sites in Japan was studied by data. Provability of production and enforcement of engineered barrier were confirmed by trial of over pack, tests and the present and future technologies developed. By using the conditions of reference case in the second draft, the evaluation results of dose effects in the two cases: 1) 90 to 99% Cs and Sr removed from HLW (High Level radioactive Waste) and 2) high stripping ratio of actinium series are explained. (S.Y.)

Ac, La, and Ce radioimpurities in {sup 225}Ac produced in 40-200 MeV proton irradiations of thorium

Energy Technology Data Exchange (ETDEWEB)

Engle, Jonathan W.; Ballard, Beau D. [Los Alamos National Laboratory, NM (United States); Weidner, John W. [Air Force Institute of Technology, Wright Patterson Air Force Base, OH (United States); and others

2014-10-01

Accelerator production of {sup 225}Ac addresses the global supply deficiency currently inhibiting clinical trials from establishing {sup 225}Ac's therapeutic utility, provided that the accelerator product is of sufficient radionuclidic purity for patient use. Two proton activation experiments utilizing the stacked foil technique between 40 and 200 MeV were employed to study the likely co-formation of radionuclides expected to be especially challenging to separate from {sup 225}Ac. Foils were assayed by nondestructive γ-spectroscopy and by α-spectroscopy of chemically processed target material. Nuclear formation cross sections for the radionuclides {sup 226}Ac and {sup 227}Ac as well as lower lanthanide radioisotopes {sup 139}Ce, {sup 141}Ce, {sup 143}Ce, and {sup 140}La whose elemental ionic radii closely match that of actinium were measured and are reported. The predictions of the latest MCNP6 event generators are compared with measured data, as they permit estimation of the formation rates of other radionuclides whose decay emissions are not clearly discerned in the complex spectra collected from {sup 232}Th(p,x) fission product mixtures. (orig.)

Background radiation and individual dosimetry in the coastal area of Tamil Nadu (India)

International Nuclear Information System (INIS)

Matsuda, N.; Brahmanandhan, G. M.; Yoshida, M.; Takamura, N.; Suyama, A.; Koguchi, Y.; Juto, N.; Raj, Y. L.; Winsley, G.; Selvasekarapandian, S.

2011-01-01

South coast of India is known as the high-level background radiation area (HBRA) mainly due to beach sands that contain natural radionuclides as components of the mineral monazite. The rich deposit of monazite is unevenly distributed along the coastal belt of Tamil Nadu and Kerala. An HBRA site that laid in 2x7 m along the sea was found in the beach of Chinnavillai, Tamil Nadu, where the maximum ambient dose equivalent reached as high as 162.7 mSv y -1 . From the sands collected at the HBRA spot, the high-purity germanium semi-conductor detector identified six nuclides of thorium series, four nuclides of uranium series and two nuclides belonging to actinium series. The highest radioactivity observed was 43.7 Bq g -1 of Th-228. The individual dose of five inhabitants in Chinnavillai, as measured by the radiophotoluminescence glass dosimetry system, demonstrated the average dose of 7.17 mSv y -1 ranging from 2.79 to 14.17 mSv y -1 . (authors)

Soil nuclide distribution coefficients and their statistical distributions

International Nuclear Information System (INIS)

Sheppard, M.I.; Beals, D.I.; Thibault, D.H.; O'Connor, P.

1984-12-01

Environmental assessments of the disposal of nuclear fuel waste in plutonic rock formations require analysis of the migration of nuclides from the disposal vault to the biosphere. Analyses of nuclide migration via groundwater through the disposal vault, the buffer and backfill, the plutonic rock, and the consolidated and unconsolidated overburden use models requiring distribution coefficients (Ksub(d)) to describe the interaction of the nuclides with the geological and man-made materials. This report presents element-specific soil distribution coefficients and their statistical distributions, based on a detailed survey of the literature. Radioactive elements considered were actinium, americium, bismuth, calcium, carbon, cerium, cesium, iodine, lead, molybdenum, neptunium, nickel, niobium, palladium, plutonium, polonium, protactinium, radium, samarium, selenium, silver, strontium, technetium, terbium, thorium, tin, uranium and zirconium. Stable elements considered were antimony, boron, cadmium, tellurium and zinc. Where sufficient data were available, distribution coefficients and their distributions are given for sand, silt, clay and organic soils. Our values are recommended for use in assessments for the Canadian Nuclear Fuel Waste Management Program

Identification of groundwater discharge in Cuddalore Coast, Tamil Nadu using radium isotopes

International Nuclear Information System (INIS)

Diksha; Jacob, Noble; Mohokar, H.V.

2013-01-01

For the optimal exploitation and management of coastal aquifers of Tamil Nadu, it is essential to evaluate the groundwater outflow into the sea. In this study, radium isotopes ( 223,224 Ra) were employed to understand the groundwater discharge in coastal areas of Cuddalore district, Tamil Nadu. Sea water samples (100 L) were collected from various locations of Cuddalore coast in October 2011 and passed through Mn-impregnated acrylic fiber columns. These acrylic columns were analyzed for 223,224 Ra activities using Radium Delayed Coincidence Counter (RaDeCC). The observed higher activities of 223,224 Ra (0-0.18 and 3.84-22.77 dpm/L respectively) indicate that groundwater discharge occurs in this coastal region. (author)

The novel imidazopyridine 2-[2-(4-methoxy-pyridin-2-yl)-ethyl]-3H-imidazo[4,5-b]pyridine (BYK191023) is a highly selective inhibitor of the inducible nitric-oxide synthase.

Science.gov (United States)

Strub, Andreas; Ulrich, Wolf-Rüdiger; Hesslinger, Christian; Eltze, Manfrid; Fuchss, Thomas; Strassner, Jochen; Strand, Susanne; Lehner, Martin D; Boer, Rainer

2006-01-01

We have identified imidazopyridine derivatives as a novel class of NO synthase inhibitors with high selectivity for the inducible isoform. 2-[2-(4-Methoxy-pyridin-2-yl)-ethyl]-3H-imidazo[4,5-b]pyridine (BYK191023) showed half-maximal inhibition of crudely purified human inducible (iNOS), neuronal (nNOS), and endothelial (eNOS) NO synthases at 86 nM, 17 microM, and 162 microM, respectively. Inhibition of inducible NO synthase was competitive with l-arginine, pointing to an interaction of BYK191023 with the catalytic center of the enzyme. In radioligand and surface plasmon resonance experiments, BYK191023 exhibited an affinity for iNOS, nNOS, and eNOS of 450 nM, 30 microM, and >500 microM, respectively. Inhibition of cellular nitrate/nitrite synthesis in RAW, rat mesangium, and human embryonic kidney 293 cells after iNOS induction showed 40- to 100-fold higher IC(50) values than at the isolated enzyme, in agreement with the much higher l-arginine concentrations in cell culture media and inside intact cells. BYK191023 did not show any toxicity in various rodent and human cell lines up to high micromolar concentrations. The inhibitory potency of BYK191023 was tested in isolated organ models of iNOS (lipopolysaccharide-treated and phenylephrine-precontracted rat aorta; IC(50) = 7 microM), eNOS (arecaidine propargyl ester-induced relaxation of phenylephrine-precontracted rat aorta; IC(50) > 100 microM), and nNOS (field-stimulated relaxation of phenylephrine-precontracted rabbit corpus cavernosum; IC(50) > 100 microM). These data confirm the high selectivity of BYK191023 for iNOS over eNOS and nNOS found at isolated enzymes. In summary, we have identified a new highly selective iNOS inhibitor structurally unrelated to known compounds and l-arginine. BYK191023 is a valuable tool for the investigation of iNOS-mediated effects in vitro and in vivo.

Book Review: Commemoration as Conflict: Space, Memory and Identity in Peace Processes

DEFF Research Database (Denmark)

McQuaid, Sara Dybris

2016-01-01

Book rewiew: Commemoration as Conflict: Space, Memory and Identity in Peace Processes / Sara McDowell and Maire Braniff Palgrave Macmillan, 2014, 224pp., ISBN 978-0-230-27375-7......Book rewiew: Commemoration as Conflict: Space, Memory and Identity in Peace Processes / Sara McDowell and Maire Braniff Palgrave Macmillan, 2014, 224pp., ISBN 978-0-230-27375-7...

7 CFR 2.24 - Assistant Secretary for Administration.

Science.gov (United States)

2010-01-01

... with policies, regulations, and procedures with respect to purchases, contracts, leases, and other...] (13) Related to ethics. The Ethics function in the U.S. Department of Agriculture is under the... Agency Ethics Official under the Office of Government Ethics regulations at 5 CFR part 2638. (14...

Dicty_cDB: VSI224 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available yk mek*e*iy*w*ntsc*ifkkemgkrg*i*tn*rvvdissw***ncrqici*merfkw*lv *iiwk*klgiq*iwsngsktcink*sln**itkiislamr*kt*...*iy*w*ntsc*ifkkemgkrg*i*tn*rvvdissw***ncrqici*me rfkw*lv*iiwk*klgiq*iwsngsktcink*sln**itkiislamr*kt**sskfirf

Dicty_cDB: AFO224 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ksck*ey snr*slrftrketllqsw*t*cscp*t*lcrpir*syrkrsfithllwyskw*fcnfthc wcsswyrn*thr*w*nyn*rccwssns*ilftnfrei...ki*ni Frame B: fkknhlgnlkifnikk*kksflttfvyaeekkrnekyiiirfwlcckast*lplkkrrlf cnnc*fi

47 CFR 36.224 - Extraordinary items-Account 7600.

Science.gov (United States)

2010-10-01

..., REVENUES, EXPENSES, TAXES AND RESERVES FOR TELECOMMUNICATIONS COMPANIES 1 Operating Revenues and Certain... account of an operating nature are apportioned on a basis consistent with the nature of these items. ...

29 CFR 778.224 - “Other similar payments”.

Science.gov (United States)

2010-07-01

... exclusion from the regular rate is specifically provided under section 7(e)(2) because they are not made as compensation for hours of work. Section 7(e) (2) also authorizes exclusion from the regular rate of “other... the payments specifically described in section 7(e)(2). It is clear that the clause was not intended...

10 CFR 600.224 - Matching or cost sharing.

Science.gov (United States)

2010-01-01

... fringe benefits may be included in the valuation. (2) Employees of other organizations. When an employer... of pay exclusive of the employee's fringe benefits and overhead costs. If the services are in a... paragraph (e)(2)(i) of this section, no amount may be counted for donated land, and only depreciation or use...

Characterization of associate spaces of weighted Lorentz spaces with applications

Czech Academy of Sciences Publication Activity Database

Gogatishvili, Amiran; Pick, L.; Soudský, F.

2014-01-01

Roč. 224, č. 1 (2014), s. 1-23 ISSN 0039-3223 R&D Projects: GA ČR GA13-14743S Institutional support: RVO:67985840 Keywords : weighted Lorentz spaces * weighted inequalities * non-increasing rearragement * Banach function space Subject RIV: BA - General Mathematics Impact factor: 0.610, year: 2014 http://journals.impan.gov.pl/sm/Inf/224-1-1.html

TRASH TO TREASURE: CONVERTING COLD WAR LEGACY WASTE INTO WEAPONS AGAINST CANCER

International Nuclear Information System (INIS)

Nicholas, R.G.; Lacy, N.H.; Butz, T.R.; Brandon, N.E.

2004-01-01

As part of its commitment to clean up Cold War legacy sites, the U.S. Department of Energy (DOE) has initiated an exciting and unique project to dispose of its inventory of uranium-233 (233U) stored at Oak Ridge National Laboratory (ORNL), and extract isotopes that show great promise in the treatment of deadly cancers. In addition to increasing the supply of potentially useful medical isotopes, the project will rid DOE of a nuclear concern and cut surveillance and security costs. For more than 30 years, DOE's ORNL has stored over 1,200 containers of fissile 233U, originally produced for several defense-related projects, including a pilot study that looked at using 233U as a commercial reactor fuel. This uranium, designated as special nuclear material, requires expensive security, safety, and environmental controls. It has been stored at an ORNL facility, Building 3019A, that dates back to the Manhattan Project. Down-blending the material to a safer form, rather than continuing to store it, will eliminate a $15 million a year financial liability for the DOE and increase the supply of medical isotopes by 5,700 percent. During the down-blending process, thorium-229 (229Th) will be extracted. The thorium will then be used to extract actinium-225 (225Ac), which will ultimately supply its progeny, bismuth-213 (213Bi), for on-going cancer research. The research includes Phase II clinical trials for the treatment of acute myelogenous leukemia at Sloan-Kettering Memorial Cancer Center in New York, as well as other serious cancers of the lungs, pancreas, and kidneys using a technique known as alpha-particle radioimmunotherapy. Alpha-particle radioimmunotherapy is based on the emission of alpha particles by radionuclides. 213Bi is attached to a monoclonal antibody that targets specific cells. The bismuth then delivers a high-powered but short-range radiation dose, effectively killing the cancerous cells but sparing the surrounding tissue. Production of the actinium and

National culture and business model change: a framework for successful expansions

DEFF Research Database (Denmark)

Dalby, J.; Nielsen, L.S.; Lueg, Rainer

2014-01-01

Dalby, J., Nielsen, Lueg, R., L. S., Pedersen, L., Tomoni, A. C. 2014. National culture and business model change: a framework for successful expansions. Journal of Enterprising Culture, 22(4): 379-498.......Dalby, J., Nielsen, Lueg, R., L. S., Pedersen, L., Tomoni, A. C. 2014. National culture and business model change: a framework for successful expansions. Journal of Enterprising Culture, 22(4): 379-498....

Identification of groundwater discharge in Cuddalore coast, Tamil Nadu using radium isotopes

International Nuclear Information System (INIS)

Diksha Chawla; Noble Jacob; Mohokar, H.V.

2014-01-01

For the optimal exploitation and management of coastal aquifers of Tamil Nadu, it is essential to evaluate the groundwater outflow into the sea also called as submarine groundwater discharge. In this study, radium isotopes ( 223,224 Ra) were employed to understand the groundwater discharge in coastal areas of Cuddalore district, Tamil Nadu. Sea water samples (100 L) were collected from various locations of Cuddalore coast in October 2011 and passed through Mn-impregnated acrylic fiber columns. These acrylic columns were analyzed for 223,224 Ra activities using radium delayed coincidence counter. The observed higher activities of 223,224 Ra excess (0.02 ± 0.001-3.28 ± 0.16 and 64 ± 3-380 ± 19 mBq/100 L respectively) indicate that groundwater discharge occurs in this coastal region. (author)

Radiochemical determination and separation or total radium, 226Ra and 224Ra; Analisis Radioquimico de Radio total, Radio-226 y Radio-224

Energy Technology Data Exchange (ETDEWEB)

Suarez, J A; Gonzalez, J A; Pablo, M A. de

1987-07-01

Radiochemical purification and separation of radium has been carried out and the determination of total radium solubilized in aqueous samples has been studied assuming that all the alpha emitters of the sample have their origin in the 226Ra and elements of its desintegration chain. Also, the activities of 22Ra and 226 Ra have been evaluated separately doing a measurement after the chemical separation of the radium and another one 10 days after. (Author) 9 refs.

Minor Actinide Burning in Thermal Reactors. A Report by the Working Party on Scientific Issues of Reactor Systems

International Nuclear Information System (INIS)

Hesketh, K.; Porsch, D.; Rimpault, G.; Taiwo, T.; Worrall, A.

2013-01-01

The actinides (or actinoids) are those elements in the periodic table from actinium upwards. Uranium (U) and plutonium (Pu) are two of the principal elements in nuclear fuel that could be classed as major actinides. The minor actinides are normally taken to be the triad of neptunium (Np), americium (Am) and curium (Cm). The combined masses of the remaining actinides (i.e. actinium, thorium, protactinium, berkelium, californium, einsteinium and fermium) are small enough to be regarded as very minor trace contaminants in nuclear fuel. Those elements above uranium in the periodic table are known collectively as the transuranics (TRUs). The operation of a nuclear reactor produces large quantities of irradiated fuel (sometimes referred to as spent fuel), which is either stored prior to eventual deep geological disposal or reprocessed to enable actinide recycling. A modern light water reactor (LWR) of 1 GWe capacity will typically discharge about 20-25 tonnes of irradiated fuel per year of operation. About 93-94% of the mass of uranium oxide irradiated fuel is comprised of uranium (mostly 238 U), with about 4-5% fission products and ∼1% plutonium. About 0.1-0.2% of the mass is comprised of neptunium, americium and curium. These latter elements accumulate in nuclear fuel because of neutron captures, and they contribute significantly to decay heat loading and neutron output, as well as to the overall radio-toxic hazard of spent fuel. Although the total minor actinide mass is relatively small - approximately 20-25 kg per year from a 1 GWe LWR - it has a disproportionate impact on spent fuel disposal, and thus the longstanding interest in transmuting these actinides either by fission (to fission products) or neutron capture in order to reduce their impact on the back end of the fuel cycle. The combined masses of the trace actinides actinium, thorium, protactinium, berkelium and californium in irradiated LWR fuel are only about 2 parts per billion, which is far too low for

Potentiation of oxycodone antinociception in mice by agmatine and BMS182874 via an imidazoline I2 receptor-mediated mechanism.

Science.gov (United States)

Bhalla, Shaifali; Ali, Izna; Lee, Hyaera; Andurkar, Shridhar V; Gulati, Anil

2013-01-01

The potentiation of oxycodone antinociception by BMS182874 (endothelin-A (ET(A)) receptor antagonist) and agmatine (imidazoline receptor/α(2)-adrenoceptor agonist) is well-documented. It is also known that imidazoline receptors but not α(2)-adrenoceptors are involved in potentiation of oxycodone antinociception by agmatine and BMS182874 in mice. However, the involvement of specific imidazoline receptor subtypes (I(1), I(2), or both) in this interaction is not clearly understood. The present study was conducted to determine the involvement of imidazoline I(1) and I(2) receptors in agmatine- and BMS182874-induced potentiation of oxycodone antinociception in mice. Antinociceptive (tail flick and hot-plate) latencies were determined in male Swiss Webster mice treated with oxycodone, agmatine, BMS182874, and combined administration of oxycodone with agmatine or BMS182874. Efaroxan (imidazoline I(1) receptor antagonist) and BU224 (imidazoline I(2) receptor antagonist) were used to determine the involvement of I(1) and I(2) imidazoline receptors, respectively. Oxycodone produced significant antinociceptive response in mice which was not affected by efaroxan but was blocked by BU224. Agmatine-induced potentiation of oxycodone antinociception was blocked by BU224 but not by efaroxan. Similarly, BMS182874-induced potentiation of oxycodone antinociception was blocked by BU224 but not by efaroxan. This is the first report demonstrating that BMS182874- or agmatine-induced enhancement of oxycodone antinociception is blocked by BU224 but not by efaroxan. We conclude that imidazoline I(2) receptors but not imidazoline I(1) receptors are involved in BMS182874- and agmatine-induced potentiation of oxycodone antinociception in mice. Copyright © 2012 Elsevier Inc. All rights reserved.

The Incidence of Helminth Parasites in Donkeys

Directory of Open Access Journals (Sweden)

G.B. Shrikhande

2009-12-01

Full Text Available The faeces of 82 donkeys irrespective of sex and age were collected and examined for any parasitic ova. The faecal sample of68 donkeys were infected with: Strongylus sp. (54.87%, Parascaris sp. (29.26%, Strongyloides sp. (24.39%, Trichonema sp. (15.85%,Oxyuris sp. (8.53%, Gastrodiscus sp. (8.53%, Entamoeba sp. (8.53%, Dictyocaulus sp. (3.65%, and Triodontophorus sp. (2.43%. [Vet World 2009; 2(6.000: 224-224

The Incidence of Helminth Parasites in Donkeys

OpenAIRE

G.B. Shrikhande; S.G. Rewatkar; S.S. Deshmukh; D.K. Maske and Y.M. Raghorte

2009-01-01

The faeces of 82 donkeys irrespective of sex and age were collected and examined for any parasitic ova. The faecal sample of68 donkeys were infected with: Strongylus sp. (54.87%), Parascaris sp. (29.26%), Strongyloides sp. (24.39%), Trichonema sp. (15.85%),Oxyuris sp. (8.53%), Gastrodiscus sp. (8.53%), Entamoeba sp. (8.53%), Dictyocaulus sp. (3.65%), and Triodontophorus sp. (2.43%). [Vet World 2009; 2(6.000): 224-224

Electronic structure and dynamics of ordered clusters with ME or RE ions on oxide surface

Energy Technology Data Exchange (ETDEWEB)

Kulagin, N.A., E-mail: nkulagin@bestnet.kharkov.u [Kharkiv National University for Radio Electronics, Avenue Shakespeare 6-48, 61045 Kharkiv (Ukraine)

2011-03-15

Selected data of ab initio simulation of the electronic structure and spectral properties of either cluster with ions of iron, rare earth or actinium group elements have been presented here. Appearance of doped Cr{sup +4} ions in oxides, Cu{sup +2} in HTSC, Nd{sup +2} in solids has been discussed. Analysis of experimental data for plasma created ordered structures of crystallites with size of about 10{sup -9} m on surface of separate oxides are given, too. Change in the spectroscopic properties of clusters and nano-structures on surface of strontium titanate crystals discussed shortly using the X-ray line spectroscopy experimental results. - Research highlights: External influence and variation of technology induce changes in valence of nl ions in compounds. Wave function of cluster presented as anti-symmetrical set of ions wave functions. The main equation describes the self-consistent field depending on state of all electrons of cluster. Level scheme of Cr{sup 4+} ions in octo- and tetra-site corresponds to doped oxides spectra after treatment. Plasma treatment effects in appearance of systems of unit crystallites with size of about 10{sup -6}-10{sup -9} m.

Electronic structure and dynamics of ordered clusters with ME or RE ions on oxide surface

International Nuclear Information System (INIS)

Kulagin, N.A.

2011-01-01

Selected data of ab initio simulation of the electronic structure and spectral properties of either cluster with ions of iron, rare earth or actinium group elements have been presented here. Appearance of doped Cr +4 ions in oxides, Cu +2 in HTSC, Nd +2 in solids has been discussed. Analysis of experimental data for plasma created ordered structures of crystallites with size of about 10 -9 m on surface of separate oxides are given, too. Change in the spectroscopic properties of clusters and nano-structures on surface of strontium titanate crystals discussed shortly using the X-ray line spectroscopy experimental results. - Research highlights: → External influence and variation of technology induce changes in valence of nl ions in compounds. → Wave function of cluster presented as anti-symmetrical set of ions wave functions. → The main equation describes the self-consistent field depending on state of all electrons of cluster. → Level scheme of Cr 4+ ions in octo- and tetra-site corresponds to doped oxides spectra after treatment. → Plasma treatment effects in appearance of systems of unit crystallites with size of about 10 -6 -10 -9 m.

Review of radionuclide source terms used for performance-assessment analyses

International Nuclear Information System (INIS)

Barnard, R.W.

1993-06-01

Two aspects of the radionuclide source terms used for total-system performance assessment (TSPA) analyses have been reviewed. First, a detailed radionuclide inventory (i.e., one in which the reactor type, decay, and burnup are specified) is compared with the standard source-term inventory used in prior analyses. The latter assumes a fixed ratio of pressurized-water reactor (PWR) to boiling-water reactor (BWR) spent fuel, at specific amounts of burnup and at 10-year decay. TSPA analyses have been used to compare the simplified source term with the detailed one. The TSPA-91 analyses did not show a significant difference between the source terms. Second, the radionuclides used in source terms for TSPA aqueous-transport analyses have been reviewed to select ones that are representative of the entire inventory. It is recommended that two actinide decay chains be included (the 4n+2 ''uranium'' and 4n+3 ''actinium'' decay series), since these include several radionuclides that have potentially important release and dose characteristics. In addition, several fission products are recommended for the same reason. The choice of radionuclides should be influenced by other parameter assumptions, such as the solubility and retardation of the radionuclides

The immigration model and its implications of natural radionuclides of coastal groundwater in Xiamen

International Nuclear Information System (INIS)

Cai Minggang; Huang Yipu; Chen Min; Liu Guangshan

2004-01-01

The natural radionuclides in groundwater systems are considered to reside in three pools: dissolved, sorbed (on rock surface), and solid. Transfer of radionuclides between the dissolved and solid pools is accomplished chiefly by dissolution, (co-)precipitation and/or a-recoil. The mass balance equations model of the natural radionuclides of dissolved and adsorbed phase reservoir in groundwater is established by setting certain conditions and parameters. The modeling equations form the basic of our assessment of the effects of sorption-desorption, dissolution-precipitation, and advection-diffusion in radionuclide transport in the groundwater. The interaction between groundwater and rock in Xiamen coastal aquifers were studied quantitatively using this model, which gave us reasonable explanation for the spatial distribution of natural radium, radon isotopes activities and their activities ratio. α-recoil supply rates of 222 Rn (P r,Rn-222 ) and 224 Ra (P α,Ra-224 ) range from 0.09 x 10 3 to 3.44 x 10 3 atoms·m -3 ·s -1 and from 0.13 x l0 3 to 4.91 x 10 3 atoms·m -3 ·s -1 , respectively. P α,Ra-224 is also found to be larger than P r,Rn-222 in every station, revealing that aquifer solids contain more thorium than uranium in studied area. Both of P r,Rn-222 and P α,Ra-224 of coastal groundwater decreased seaward, revealing a-recoil supplying rates of 222 Rn and 224 Ra by aquifers rock decreased gradually, which gave good explanation of the spatial distribution characters of above two nuclides. P r,Rn-222 /A Rn-222 increase seaward from 0.3 to 0.9 along the major paths, with the average value of 0.6. Such results reveal that the primary source of groundwater 222 Rn in these areas is α-recoil of 226 Ra decay in solid pool, and its relative increase along the paths. Another source of 222 Rn is 226 Ra decay in tile sorbed pool (R f,Ra-226 ·A Ra-226 ), which attributes about 40 percent of total source of coastal groundwater 222 Rn. P α,Ra-224 /A Ra-224 ranges

The immigration model and its implications of natural radionuclides of coastal groundwater in Xiamen

International Nuclear Information System (INIS)

Cai Minggang; Huang Yipu; Chen Min; Liu Guangshan

2005-01-01

The natural radionuclides in groundwater systems are considered to reside in three pools: dissolved, sorbed (on rock surface), and solid. Transfer of radionuclides between the dissolved and solid pools is accomplished chiefly by dissolution. (co-)precipitation and/or α-recoil. The mass balance equations model of the natural radionuclides of dissolved and adsorbed phase reservoir in groundwater is established by setting certain conditions and parameters. The modeling equations form the basic of our assessment of the effects of sorption-desorption, dissolution-precipitation, and advection-diffusion in radionuclide transport in the groundwater. The interaction between groundwater and rock in Xiamen coastal aquifers were studied quantitatively using this model, which gave us reasonable explanation for the spatial distribution of natural radium, radon isotopes activities and their activities ratio. α-recoil supply rates of 222 Rn (P r,Rn-22 -2) and 224 Ra (P a,Ra-224 ) range from 0.09 x l0 3 to 3.44 x 10 3 atoms·m -3 ·s -1 and from 0.13 x 10 3 to 4.91 x 10 3 x 10 3 atoms·m -3 ·s -1 , respectively. P a,Ra-224 is also found to be larger than P r,Rn-222 in every station, revealing that aquifer solids contain more thorium than uranium in studied area. Both of P r,Rn-222 and P a,Ra-224 of coastal groundwater decreased seaward, revealing α-recoil supplying rates of 222 Rn and 224 Ra by aquifers rock decreased gradually, which gave good explanation of the spatial distribution characters of above two nuclides. P r,Rn-222 /A Rn-222 increase seaward from 0.3 to 0.9 along the major paths, with the average value of 0.6, Such results reveal that the primary source of groundwater 222 Rn in these areas is α-recoil of 226 Ra decay in solid pool, and its relative increase along the paths. Another source of 222 Rn is 226 Ra decay in the sorbed pool (R f,Ra-226 ·A Ra-226 ), which attributes about 40 per cent of total source of coastal groundwater 222 Rn. P α,Ra-224 /A Ra-224

Renal uptake of bismuth-213 and its contribution to kidney radiation dose following administration of actinium-225-labeled antibody

Energy Technology Data Exchange (ETDEWEB)

Schwartz, J; O' Donoghue, J A; Humm, J L [Department of Medical Physics, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); Jaggi, J S [Bristol-Myers Squibb, Plainsboro, NJ (United States); Ruan, S; Larson, S M [Nuclear Medicine Service Department of Radiology, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); McDevitt, M; Scheinberg, D A, E-mail: schwarj1@mskcc.org [Molecular Pharmacology and Chemistry, Sloan-Kettering Institute, 1275 York Avenue, New York, NY 10065 (United States)

2011-02-07

Clinical therapeutic studies using {sup 225}Ac-labeled antibodies have begun. Of major concern is renal toxicity that may result from the three alpha-emitting progeny generated following the decay of {sup 225}Ac. The purpose of this study was to determine the amount of {sup 225}Ac and non-equilibrium progeny in the mouse kidney after the injection of {sup 225}Ac-huM195 antibody and examine the dosimetric consequences. Groups of mice were sacrificed at 24, 96 and 144 h after injection with {sup 225}Ac-huM195 antibody and kidneys excised. One kidney was used for gamma ray spectroscopic measurements by a high-purity germanium (HPGe) detector. The second kidney was used to generate frozen tissue sections which were examined by digital autoradiography (DAR). Two measurements were performed on each kidney specimen: (1) immediately post-resection and (2) after sufficient time for any non-equilibrium excess {sup 213}Bi to decay completely. Comparison of these measurements enabled estimation of the amount of excess {sup 213}Bi reaching the kidney ({gamma}-ray spectroscopy) and its sub-regional distribution (DAR). The average absorbed dose to whole kidney, determined by spectroscopy, was 0.77 (SD 0.21) Gy kBq{sup -1}, of which 0.46 (SD 0.16) Gy kBq{sup -1} (i.e. 60%) was due to non-equilibrium excess {sup 213}Bi. The relative contributions to renal cortex and medulla were determined by DAR. The estimated dose to the cortex from non-equilibrium excess {sup 213}Bi (0.31 (SD 0.11) Gy kBq{sup -1}) represented {approx}46% of the total. For the medulla the dose contribution from excess {sup 213}Bi (0.81 (SD 0.28) Gy kBq{sup -1}) was {approx}80% of the total. Based on these estimates, for human patients we project a kidney-absorbed dose of 0.28 Gy MBq{sup -1} following administration of {sup 225}Ac-huM195 with non-equilibrium excess {sup 213}Bi responsible for approximately 60% of the total. Methods to reduce renal accumulation of radioactive progeny appear to be necessary for the success of {sup 225}Ac radioimmunotherapy.

Distribution of trace elements in land plants and botanical taxonomy with special reference to rare earth elements and actinium

International Nuclear Information System (INIS)

Koyama, Mutsuo

1989-01-01

Distribution profiles of trace elements in land plants were studied by neutron activation analysis and radioactivity measurements without activation. Number of botanical samples analyzed were more than three thousand in which more than three hundred botanical species were included. New accumulator plants of Co, Cr, Zn, Cd, rare earth elements, Ac, U, etc., were found. Capabilities of accumulating trace elements can be related to the botanical taxonomy. Discussions are given from view points of inorganic chemistry as well as from botanical physiology

Kelder. Gerda Taljaard. Kaapstad: Tafelberg, 2012. 224 pp. ISBN ...

African Journals Online (AJOL)

There are. Benjamin's girlfriends—Elzette, the evil blonde skinny lawyer, and Martine, the goth with porcelain skin who plays jazz saxophone in her soundproof bathroom whilst standing on the toilet seat. One of Esmeralda's boyfriends is a butcher with massive sideburns. Another boyfriend is a professional big game hunter,.

Quantitative analysis of intermolecular interactions in 2,2'-((4 ...

Indian Academy of Sciences (India)

SUBBIAH THAMOTHARAN

2018-02-07

Feb 7, 2018 ... in good agreement with the crystal structure of the title compound. The structures of title ... was isolated from the reaction medium by simple filtra- tion. Thus, a green protocol ... In this situation, a study to understand how other ...

All projects related to | Page 224 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

2012-03-01

. Infectious diseases are especially problematic in sub-Saharan Africa, where livestock production accounts for up to 25% of national income. Start Date: March 1, 2012. End Date: October 31, 2014. Topic: BIOTECHNOLOGY, AGRICULTURAL ...

29 CFR 779.224 - Common control in other cases.

Science.gov (United States)

2010-07-01

... discussed in §§ 779.225 through 779.235. Leased Departments, Franchise and Other Business Arrangements ... business activities with other persons or corporations. In such a case, the activities may be performed... arrangement between the parties so as to vest the control of the activities of one business in the hands of...

Practical Pseudo-collisions for Hash Functions ARIRANG-224/384

DEFF Research Database (Denmark)

Guo, Jian; Matusiewicz, Krystian; Knudsen, Lars Ramkilde

2009-01-01

In this paper we analyse the security of the SHA-3 candidate ARIRANG. We show that bitwise complementation of whole registers turns out to be very useful for constructing high-probability differential characteristics in the function. We use this approach to find near-collisions with Hamming weigh...

22 CFR 224.6 - Prerequisites for issuing a complaint.

Science.gov (United States)

2010-04-01

... paragraph (b) of this section), the amount of money or the value of property or services demanded or... single request, demand, or submission. (c) Nothing in this section shall be construed to limit the... were not submitted simultaneously, regardless of the amount of money, or the value of property or...

Pæren er faldet langt fra stammen

DEFF Research Database (Denmark)

Haarder, Jon Helt

2013-01-01

Roman: Hassan Preislers vellykkede debutroman udleverer ikke bare multikulti-industrien. Den er også en rablende diagnosticering af det moderne menneskes livsvilkår HASSAN PREISLER BRUN MANDS BYRDE 224 sider, 249,95 Lindhardt og Ringhof Er udkommet 4......Roman: Hassan Preislers vellykkede debutroman udleverer ikke bare multikulti-industrien. Den er også en rablende diagnosticering af det moderne menneskes livsvilkår HASSAN PREISLER BRUN MANDS BYRDE 224 sider, 249,95 Lindhardt og Ringhof Er udkommet 4...

Effect of electrostatic interactions on phase stability of cubic phases of biomembranes.

Science.gov (United States)

Li, Shu Jie; Masum, Shah Md; Yamashita, Yuko; Tamba, Yukihiro; Yamazaki, Masahito

2002-06-01

We investigated effect of electrostatic interactions due to surfacecharges on structures and stability of cubic phases of monoolein (MO)membrane using the small-angle X-ray scattering method. Firstly, wechanged the surface charge density of the membrane by usingdioleoylphosphatidic acid (DOPA). As increasing DOPA concentration in themembrane at 30 wt % lipid concentration, a Q(224) to Q(229) phasetransition occurred at 0.6 mol % DOPA, and at and above 25 mol %, DOPA/MOmembranes were in the L(α) phase. NaCl in the bulk phase reduced theeffect of DOPA. These results indicate that as the electrostaticinteractions increase, the most stable phase changes as follows: Q(224)⇒ Q(229) ⇒ L(α). The increase in DOPAconcentration reduced the absolute value of spontaneous curvature of themembrane, | H(0) |. Secondly, we changed the surface charge of themembrane by adding a de novo designed peptide, which has netpositive charges and a binding site on the electrically neutral membraneinterface. The peptide-1 (WLFLLKKK) induced a Q(224) to Q(229)phase transition in the MO membrane at low peptide concentration. As NaClconcentration increases, the MO/peptide-1 membrane changed from Q(229)to Q(224) phase. The increase in peptide-1 concentration reduced |H(0) |. Based on these results, the stability of the cubic phases and themechanism of phase transition between cubic phase and L(α) phase arediscussed.

Occurrence of Cryptosporidium spp. and Giardia spp. in a public water-treatment system, Paraná, Southern Brazil

Directory of Open Access Journals (Sweden)

Jonatas Campos Almeida

Full Text Available The purpose of this study was to investigate the occurrence of Cryptosporidium spp. and Giardia spp. in a public water-treatment system. Samples of raw and treated water were collected and concentrated using the membrane filtration technique. Direct Immunofluorescence Test was performed on the samples. DNA extraction using a commercial kit was performed and the DNA extracted was submitted to a nested-PCR reaction (n-PCR and sequencing. In the immunofluorescence, 2/24 (8.33% samples of raw water were positive for Giardia spp.. In n-PCR and sequencing, 2/24 (8.33% samples of raw water were positive for Giardia spp., and 2/24 (8.33% samples were positive for Cryptosporidium spp.. The sequencing showed Cryptosporidium parvum and Giardia duodenalis DNA. In raw water, there was moderate correlation among turbidity, color and Cryptosporidium spp. and between turbidity and Giardia spp.. The presence of these protozoans in the water indicates the need for monitoring for water-treatment companies.

Characterization of decontamination and decommissioning wastes expected from the major processing facilities in the 200 Areas

International Nuclear Information System (INIS)

Amato, L.C.; Franklin, J.D.; Hyre, R.A.; Lowy, R.M.; Millar, J.S.; Pottmeyer, J.A.; Duncan, D.R.

1994-08-01

This study was intended to characterize and estimate the amounts of equipment and other materials that are candidates for removal and subsequent processing in a solid waste facility when the major processing and handling facilities in the 200 Areas of the Hanford Site are decontaminated and decommissioned. The facilities in this study were selected based on processing history and on the magnitude of the estimated decommissioning cost cited in the Surplus Facilities Program Plan; Fiscal Year 1993 (Winship and Hughes 1992). The facilities chosen for this study include B Plant (221-B), T Plant (221-T), U Plant (221-U), the Uranium Trioxide (UO 3 ) Plant (224-U and 224-UA), the Reduction Oxidation (REDOX) or S Plant (202-S), the Plutonium Concentration Facility for B Plant (224-B), and the Concentration Facility for the Plutonium Finishing Plant (PFP) and REDOX (233-S). This information is required to support planning activities for current and future solid waste treatment, storage, and disposal operations and facilities

Thin film electronic devices with conductive and transparent gas and moisture permeation barriers

Science.gov (United States)

Simpson, Lin Jay

2013-12-17

A thin film stack (100, 200) is provided for use in electronic devices such as photovoltaic devices. The stack (100, 200) may be integrated with a substrate (110) such as a light transmitting/transmissive layer. A electrical conductor layer (120, 220) is formed on a surface of the substrate (110) or device layer such as a transparent conducting (TC) material layer (120,220) with pin holes or defects (224) caused by manufacturing. The stack (100) includes a thin film (130, 230) of metal that acts as a barrier for environmental contaminants (226, 228). The metal thin film (130,230) is deposited on the conductor layer (120, 220) and formed from a self-healing metal such as a metal that forms self-terminating oxides. A permeation plug or block (236) is formed in or adjacent to the thin film (130, 230) of metal at or proximate to the pin holes (224) to block further permeation of contaminants through the pin holes (224).

Characterization of decontamination and decommissioning wastes expected from the major processing facilities in the 200 Areas

Energy Technology Data Exchange (ETDEWEB)

Amato, L.C.; Franklin, J.D.; Hyre, R.A.; Lowy, R.M.; Millar, J.S.; Pottmeyer, J.A. [Los Alamos Technical Associates, Kennewick, WA (United States); Duncan, D.R. [Westinghouse Hanford Co., Richland, WA (United States)

1994-08-01

This study was intended to characterize and estimate the amounts of equipment and other materials that are candidates for removal and subsequent processing in a solid waste facility when the major processing and handling facilities in the 200 Areas of the Hanford Site are decontaminated and decommissioned. The facilities in this study were selected based on processing history and on the magnitude of the estimated decommissioning cost cited in the Surplus Facilities Program Plan; Fiscal Year 1993 (Winship and Hughes 1992). The facilities chosen for this study include B Plant (221-B), T Plant (221-T), U Plant (221-U), the Uranium Trioxide (UO{sub 3}) Plant (224-U and 224-UA), the Reduction Oxidation (REDOX) or S Plant (202-S), the Plutonium Concentration Facility for B Plant (224-B), and the Concentration Facility for the Plutonium Finishing Plant (PFP) and REDOX (233-S). This information is required to support planning activities for current and future solid waste treatment, storage, and disposal operations and facilities.

Plasma and erythrocyte phospholipid fatty acid profile in professional basketball and football players.

Science.gov (United States)

Tepsic, Jasna; Vucic, Vesna; Arsic, Aleksandra; Blazencic-Mladenovic, Vera; Mazic, Sanja; Glibetic, Marija

2009-10-01

The effect of intensive long-term physical activity on phospholipid fatty acid (FA) composition has not been studied thoroughly. We determined plasma and erythrocyte phospholipid FA status of professional basketball and football players. Our results showed differences in plasma FA profile not only between sportsmen and sedentary subjects, but also between two groups of sportsmen. Plasma FA profile in basketball players showed significantly higher proportion of n-6 FA (20:3, 20:4, and 22:4) and total polyunsaturated FA (PUFA) than controls, while football players had higher palmitoleic acid (16:1) than basketball players and controls. Total PUFA and 22:4 were also higher in basketball than in football players. Erythrocyte FA profile showed no differences between football players and controls. However, basketball players had higher proportion of 18:0 than controls, higher saturated FA and lower 18:2 than two other groups, and higher 22:4 than football players. These findings suggest that long-term intensive exercise and type of sport influence FA profile.

A novel chemically modified curcumin reduces inflammation-mediated connective tissue breakdown in a rat model of diabetes: periodontal and systemic effects.

Science.gov (United States)

Elburki, M S; Moore, D D; Terezakis, N G; Zhang, Y; Lee, H-M; Johnson, F; Golub, L M

2017-04-01

Periodontal disease is the most common chronic inflammatory disease known to mankind (and the major cause of tooth loss in the adult population) and has also been linked to various systemic diseases, particularly diabetes mellitus. Based on the literature linking periodontal disease with diabetes in a "bidirectional manner", the objectives of the current study were to determine: (i) the effect of a model of periodontitis, complicated by diabetes, on mechanisms of tissue breakdown including bone loss; and (ii) the response of the combination of this local and systemic phenotype to a novel pleiotropic matrix metalloproteinase inhibitor, chemically modified curcumin (CMC) 2.24. Diabetes was induced in adult male rats by intravenous injection of streptozotocin (nondiabetic rats served as controls), and Escherichia coli endotoxin (lipopolysaccharide) was repeatedly injected into the gingiva to induce periodontitis. CMC 2.24 was administered by oral gavage (30 mg/kg) daily; untreated diabetic rats received vehicle alone. After 3 wk of treatment, the rats were killed, and gingiva, jaws, tibia and skin were collected. The maxillary jaws and tibia were dissected and radiographed. The gingival tissues of each experimental group (n = 6 rats/group) were pooled, extracted, partially purified and, together with individual skin samples, analyzed for matrix metalloproteinase (MMP)-2 and MMP-9 by gelatin zymography; MMP-8 was analyzed in gingival and skin tissue extracts, and in serum, by western blotting. The levels of three bone-resorptive cytokines [interleukin (IL)-1β, IL-6 and tumor necrosis factor-α], were measured in gingival tissue extracts and serum by ELISA. Systemic administration of CMC 2.24 to diabetic rats with endotoxin-induced periodontitis significantly inhibited alveolar bone loss and attenuated the severity of local and systemic inflammation. Moreover, this novel tri-ketonic phenylaminocarbonyl curcumin (CMC 2.24) appeared to reduce the pathologically excessive

Evaluation of Antitrypanosomal Dihydroquinolines for Hepatotoxicity, Mutagenicity, and Methemoglobin Formation In Vitro.

Science.gov (United States)

Werbovetz, Karl A; Riccio, Edward S; Furimsky, Anna; Richard, Julian V; He, Shanshan; Iyer, Lalitha; Mirsalis, Jon

2014-07-01

N1-Benzylated dihydroquinolin-6-ols and their corresponding esters display exceptional activity against African trypanosomes in vitro, and administration of members of this class of compounds to trypanosome-infected mice results in cures in a first-stage African trypanosomiasis model. Since a quinone imine intermediate has been implicated in the antiparasitic mechanism of action of these compounds, evaluation of the hepatotoxic, mutagenic, and methemoglobin-promoting effects of these agents was performed. 1-Benzyl-1,2-dihydro-2,2,4-trimethylquinolin-6-ol hydrochloride and 1-benzyl-1,2-dihydro-2,2,4-trimethylquinolin-6-yl acetate showed outstanding in vitro selectivity for Trypanosoma brucei compared to the HepG2, Hep3B, Huh7, and PLC5 hepatocyte cell lines. 1-Benzyl-1,2-dihydro-2,2,4-trimethylquinolin-6-ol hydrochloride and 1-(2-methoxybenzyl)-1,2-dihydro-2,2,4-trimethylquinolin-6-yl acetate were not mutagenic when screened in the Ames assay, with or without metabolic activation. The latter 2 compounds promoted time- and dose-dependent formation of methemoglobin when incubated in whole human blood, but such levels were below those typically required to produce symptoms of methemoglobinemia in humans. Although compounds capable of quinone imine formation require careful evaluation, these in vitro studies indicate that antitrypanosomal dihydroquinolines merit further study as drug candidates against the neglected tropical disease human African trypanosomiasis. © The Author(s) 2014.

ORF Alignment: NC_003063 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available LDEVSLGLRYGLSRTPVREIFRRLEGEGYIDIRANRGARVIP 60 ... Query: 224 RFHALIGDMSGNVYLQASLGRLLIDHARIGHT...FYRPRNDDMRQRLNLAVEHHDGFIAAIQ 283 ... RFHALIGDMSGNVYLQASLGRLLIDHARIGHTFYRPRNDDMRQRLNLAVEHHDGF...IAAIQ Sbjct: 121 RFHALIGDMSGNVYLQASLGRLLIDHARIGHTFYRPRNDDMRQRLNLAVEHHDGFIAAIQ 180 ...

Emanations and 'induced' radioactivity: from mystery to (mis)use

International Nuclear Information System (INIS)

Kolar, Z.I.

1999-01-01

The natural Rn isotopes were discovered within the period 1899-1902 and at that time referred to as emanations because they came out (emanated) of sources/materials containing actinium, thorium and radium, respectively. The (somewhat mysterious) emanations appeared to disintegrate into radioactive decay products which by depositing at solid surfaces gave rise to 'induced' radioactivity i.e. radioactive substances with various half-lives. Following the discovery of the emanations the volume of the research involving them and their disintegration products grew steeply. The identity of a number of these radioactive products was soon established. Radium emanation was soon used as a source of RaD ( 210 Pb) to be applied as an 'indicator' (radiotracer) for lead in a study on the solubility of lead sulphide and lead chromate. Moreover, radium and its emanation were introduced into the medical practice. Inhaling radon and drinking radon-containing water became an accepted medicinal use (or misuse?) of that gas. Shortly after the turn of the century, the healing (?) action of natural springs (spas) was attributed to their radium emanation, i.e. radon. Bathing in radioactive spring water and drinking it became very popular. Even today, bathing in radon-containing water is still a common medical treatment in Jachymov, Czech Republic. (author)

Study of Soil Decontamination Method Using Supercritical Carbon Dioxide and TBP

International Nuclear Information System (INIS)

Park, Jihye; Park, Kwangheon; Jung, Wonyoung

2014-01-01

The result of this study means that we have a possible new method for cheap and less wasteful nuclear waste decontamination. When severe accidents such as the incident at the Fukushima nuclear site occur, the soil near the power plant is contaminated with fission products or the activation metal structure of the power plant. The soil pollution form depends on the environment and soil characteristics of the contaminated areas. Thus, a- single-decontamination method is not effective for site cleanup. In addition, some soil decontamination methods are expensive and large amounts of secondary waste are generated. Therefore, we need new soil decontamination methods. In this study, instead of using a conventional solvent method that generates secondary waste, supercritical carbon dioxide was used to remove metal ions from the soil. Supercritical carbon dioxide is known for good permeation characteristics. We expect that we will reduce the cost of soil pollution management. Supercritical carbon dioxide can decontaminate soil easily, as it has the ability to penetrate even narrow gaps with very good moisture permeability. We used TBP, which is a known for extractant of actinium metal. TBP is usually used for uranium and strontium extraction. Using TBP-HNO 3 complex and supercritical carbon dioxide, we did extraction experiments for several heavy metals in contaminated soil

Study of Soil Decontamination Method Using Supercritical Carbon Dioxide and TBP

Energy Technology Data Exchange (ETDEWEB)

Park, Jihye; Park, Kwangheon; Jung, Wonyoung [Kyunghee Univ., Yongin (Korea, Republic of)

2014-05-15

The result of this study means that we have a possible new method for cheap and less wasteful nuclear waste decontamination. When severe accidents such as the incident at the Fukushima nuclear site occur, the soil near the power plant is contaminated with fission products or the activation metal structure of the power plant. The soil pollution form depends on the environment and soil characteristics of the contaminated areas. Thus, a- single-decontamination method is not effective for site cleanup. In addition, some soil decontamination methods are expensive and large amounts of secondary waste are generated. Therefore, we need new soil decontamination methods. In this study, instead of using a conventional solvent method that generates secondary waste, supercritical carbon dioxide was used to remove metal ions from the soil. Supercritical carbon dioxide is known for good permeation characteristics. We expect that we will reduce the cost of soil pollution management. Supercritical carbon dioxide can decontaminate soil easily, as it has the ability to penetrate even narrow gaps with very good moisture permeability. We used TBP, which is a known for extractant of actinium metal. TBP is usually used for uranium and strontium extraction. Using TBP-HNO{sub 3} complex and supercritical carbon dioxide, we did extraction experiments for several heavy metals in contaminated soil.

Formation of cubic phases from large unilamellar vesicles of dioleoylphosphatidylglycerol/monoolein membranes induced by low concentrations of Ca2+.

Science.gov (United States)

Awad, Tarek S; Okamoto, Yoshihide; Masum, Shah Md; Yamazaki, Masahito

2005-12-06

We developed a new method for the transformation of large unilamellar vesicles (LUVs) into the cubic phase. We found that the addition of low concentrations of Ca(2+) to suspensions of multilamellar vesicles (MLVs) of membranes of monoolein (MO) and dioleoylphosphatidylglycerol (DOPG) mixtures (DOPG/MO) changed their L(alpha) phase to the cubic phases. For instance, the addition of 15-25 mM Ca(2+) to 30%-DOPG/70%-MO-MLVs induced the Q(229) phase, whereas the addition of > or =28 mM Ca(2+) induced the Q(224) phase. LUVs of DOPG/MO membranes containing > or =25 mol % DOPG were prepared easily. Low concentrations of Ca(2+) transformed these LUVs in excess buffer into the Q(224) or the Q(229) phase, depending on the Ca(2+) concentration. For example, 15 and 50 mM Ca(2+) induced the Q(224) and Q(229) phase in the 30%-DOPG/70%-MO-LUVs at 25 degrees C, respectively. This finding is the first demonstration of transformation of LUVs of lipid membranes into the cubic phase under excess water condition.

Crystallization and preliminary X-ray diffraction analysis of the carbohydrate-recognizing domain (VP8*) of bovine rotavirus strain NCDV

International Nuclear Information System (INIS)

Yu, Xing; Guillon, Annabel; Szyczew, Alex J.; Kiefel, Milton J.; Coulson, Barbara S.; Itzstein, Mark von; Blanchard, Helen

2008-01-01

NCDV VP8* 64–224 was expressed in E. coli, purified and crystallized in the presence of a sialic acid derivative. X-ray diffraction data were obtained to a resolution of 2.0 Å and the crystallographic structure was determined by molecular replacement. The infectivity of rotavirus is dramatically enhanced by proteolytic cleavage of its outer layer VP4 spike protein into two functional domains, VP8* and VP5*. The carbohydrate-recognizing domain VP8* is proposed to bind sialic acid-containing host cell-surface glycans and this is followed by a series of subsequent virus–cell interactions. Live attenuated human and bovine rotavirus vaccine candidates for the prevention of gastroenteritis have been derived from bovine rotavirus strain NCDV. The NCDV VP8* 64–224 was overexpressed, purified to homogeneity and crystallized in the presence of an N-acetylneuraminic acid derivative. X-ray diffraction data were collected to a resolution of 2.0 Å and the crystallographic structure of NCDV VP8* 64–224 was determined by molecular replacement

Combating Opium in Afghanistan. Strategic Forum, Number 224, November 2006

Science.gov (United States)

2006-11-01

strategy will be severely limited.17 Truffles, a fungi delicacy, are the only legal agricultural product whose value rivals that of opium poppy...to bear fruit and are not viable sources of income over the short term. Wheat , a favorite substitute of Western aid agencies, does not provide a...viable alternative for farmers. Income from poppy production is approximately $5,400 per hectare, while wheat brings in $500. Farmers claim that

Zoológico de Cali. (pág. 224-229

Directory of Open Access Journals (Sweden)

Ingrit Pineda

2010-07-01

Full Text Available Es un importante centro de conservación de especies en peligro de extinción, en el se encuentra gran cantidad de fauna perteneciente a nuestro continente y algunas otras traídas del África. Los animales se encuentran agrupadosy distribuidos de acuerdo al grupo taxonómico en el que se ubican; es decir encontraremos en lugares diferentes a los primates, reptiles y anfibios, aves, felinos, algunosotros mamíferos. Lavariedad de formas, colores y conductas de los animales, han hecho de este lugar un importante centro educativo, tanto de diversiónpara adultos y niños.Está catalogado como uno de los mejoreszoológicos deLatinoamérica.

People and things. CERN Courier, May 1982, v. 22(4)

International Nuclear Information System (INIS)

Anon.

1982-01-01

The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. The 1982 Summer Workshop on Proton Decay Experiments will be held from 7-11 June at Argonne National Laboratory. Its purpose is to bring together experimenters and theorists with an active interest in the next generation of proton decay experiments. A workshop will be held at Los Alamos from 19-22 July to discuss the LAMPF II project for a rapid cycling 16 GeV synchrotron providing 10 13 protons per pulse. 'The challenge of attaining ultra high energies' - This is the title of a meeting to review limitations and possibilities in particle acceleration to ultra high energies, organized jointly by ECFA and the Rutherford Laboratory. The topics for discussion will include the use of high electric fields generated in plasmas, external fields in short wave r.f. linacs, and laser illuminated gratings

25 CFR 224.63 - What provisions must a TERA contain?

Science.gov (United States)

2010-04-01

... RESOURCE AGREEMENTS UNDER THE INDIAN TRIBAL ENERGY DEVELOPMENT AND SELF DETERMINATION ACT Procedures for... cancelled checks; cash receipt vouchers; copies of money orders or cashiers checks; or verification of...

50 CFR 224.103 - Special prohibitions for endangered marine mammals.

Science.gov (United States)

2010-10-01

... breeding, nursing, or resting activities, attempts by a whale to shield a calf from a vessel or human...), commercial fishing means taking or harvesting fish or fishery resources to sell, barter, or trade. Commercial... sea lions, shall also apply to the western population of Steller sea lions, which consists of all...