WorldWideScience

Sample records for actinium 223

  1. Production of high-purity radium-223 from legacy actinium-beryllium neutron sources.

    Soderquist, Chuck Z; McNamara, Bruce K; Fisher, Darrell R

    2012-07-01

    Radium-223 is a short-lived alpha-particle-emitting radionuclide with potential applications in cancer treatment. Research to develop new radiopharmaceuticals employing (223)Ra has been hindered by poor availability due to the small quantities of parent actinium-227 available world-wide. The purpose of this study was to develop innovative and cost-effective methods to obtain high-purity (223)Ra from (227)Ac. We obtained (227)Ac from two surplus actinium-beryllium neutron generators. We retrieved the actinium/beryllium buttons from the sources and dissolved them in a sulfuric-nitric acid solution. A crude actinium solid was recovered from the solution by coprecipitation with thorium fluoride, leaving beryllium in solution. The crude actinium was purified to provide about 40 milligrams of actinium nitrate using anion exchange in methanol-water-nitric acid solution. The purified actinium was then used to generate high-purity (223)Ra. We extracted (223)Ra using anion exchange in a methanol-water-nitric acid solution. After the radium was separated, actinium and thorium were then eluted from the column and dried for interim storage. This single-pass separation produces high purity, carrier-free (223)Ra product, and does not disturb the (227)Ac/(227)Th equilibrium. A high purity, carrier-free (227)Th was also obtained from the actinium using a similar anion exchange in nitric acid. These methods enable efficient production of (223)Ra for research and new alpha-emitter radiopharmaceutical development. PMID:22697483

  2. New method for large scale production of medically applicable Actinium-225 and Radium-223

    Alpha-emitters (211At, 212Bi, 213Bi, 223Ra, 225Ac) are promising for targeted radiotherapy of cancer. Only two alpha decays near a cell membrane result in 50% death of cancer cell and only a single decay inside the cell is required for this. 225Ac may be used either directly or as a mother radionuclide in 213Bi isotope generator. Production of 225Ac is provided by three main suppliers - Institute for Transuranium Elements in Germany, Oak Ridge National Laboratory in USA and Institute of Physics and Power Engineering in Obninsk, Russia. The current worldwide production of 225Ac is approximately 1.7 Ci per year that corresponds to only 100-200 patients that could be treated annually. The common approach for 225Ac production is separation from mother 229Th or irradiation of 226Ra with protons in a cyclotron. Both the methods have some practical limitations to be applied routinely. 225Ac can be also produced by irradiation of natural thorium with medium energy protons . Cumulative cross sections of 225Ac, 227Ac, 227Th, 228Th formations have been obtained recently. Thorium targets (1-9 g) were irradiated by 114-91 MeV proton beam (1-50 μA) at INR linear accelerator. After dissolution in 8 M HNO3 + 0.004 M HF thorium was removed by double LLX by HDEHP in toluene (1:1). Ac and REE were pre-concentrated and separated from Ra and most fission products by DGA-Resin (Triskem). After washing out by 0.01 M HNO3 Ac was separated from REE by TRU Resin (Triskem) in 3 M HNO3 media. About 6 mCi 225Ac were separated in hot cell with chemical yield 85%. The method may be upscaled for production of Ci amounts of the radionuclide. The main impurity is 227Ac (0.1% at the EOB) but it does not hinder 225Ac from being used for medical 225Ac/213Bi generators. (author)

  3. Radium, thorium, and actinium extraction from seawater using an improved manganese-oxide-coated fiber

    Laboratory experiments were conducted to determine the efficiency with which improved manganese-oxide-coated acrylic fibers extract radium, thorium, and actinium from seawater. Tests were made using surface seawater spiked with 227Ac, 227Th and 223Ra. For sample volumes of approximately 30 liters and flow rates up to 0.5 liters per minute, radium and actinium are removed quantitatively. Approximately 80-95% of the thorium is removed under these same conditions. (Auth.)

  4. Separation of Actinium 227 from the uranium minerals

    The purpose of this work was to separate Actinium 227, whose content is 18%, from the mineral carnotite found in Gomez Chihuahua mountain range in Mexico. The mineral before processing is is pre-concentrated and passed, first through anionic exchange resins, later the eluate obtained is passed through cationic resins. The resins were 20-50 MESH QOWEX and 100-200 MESH 50 X 8-20 in some cased 200-400 MESH AG 50W-X8, 1X8 in other cases. The eluates from the ionic exchange were electrodeposited on stainless steel polished disc cathode and platinum electrode as anode; under a current ODF 10mA for 2.5 to 5 hours and of 100mA for .5 of an hour. it was possible to identify the Actinium 227 by means of its descendents, TH-227 and RA-223, through alpha spectroscopy. Due to the radiochemical purity which the electro deposits were obtained the Actinium 227 was low and was not quantitatively determined. A large majority of the members of the natural radioactive series 3 were identified and even alpha energies reported in the literature with very low percentages of non-identified emissions were observed. We conclude that a more precise study is needed concerning ionic exchange and electrodeposit to obtain an Actinium 227 of radiochemical purity. (Author)

  5. A francium-223 reservoir source

    By improving and accelerating a method which had been earlier tried for caesium-rubidium separation on a cellulose column, i.e. elution with 2N HCl-equilibrated phenol, the author succeeded in obtaining consecutive and quasi-selective elutions of francium-223, starting with actinium-227 fixed at the top of a small cellulose column to which ZrO2 had been added. The francium-223, rapidly eluted under pressure, is extracted by water while the phenol is extracted by ether; it can easily be cleared of any residual traces of radioactive contaminants (thallium-207, radium-223, thorium-227) by two consecutive BaSO4 precipitations. The preparation of a Fr223 solution (HCl-H2SO4) requires approximately 20 min; the time noted for Fr223 was closer to 22 than to 21 min. (author)

  6. Extraction of actinium with di-(2-ethylhexyl)phosphoric acid from hydrochloric and nitric acid solutions

    The extraction of actinium with HDEHP from Cl- and NO3- systems has been investigated. It was found that extraction of actinium from HCl solutions is much better than from HNO3 solutions. Stability constants of actinium complexes Ac(X-)+2 with Cl- and NO3- ligands were determined. Our results show that the actinium formed less stable complexes with Cl- than with NO3- ligands. 5 refs., 3 figs., 1 tab. (author)

  7. The sorption of polonium, actinium and protactinium onto geological materials

    This paper describes a combined experimental and modeling program of generic sorption studies to increase confidence in the performance assessment for a potential high-level radioactive waste repository in Japan. The sorption of polonium, actinium and protactinium onto geological materials has been investigated. Sorption of these radioelements onto bentonite, tuff and granodiorite from equilibrated de-ionized water was studied under reducing conditions at room temperature. In addition, the sorption of actinium and protactinium was investigated at 60 C. Thermodynamic chemical modeling was carried out to aid interpretation of the results

  8. Spectroscopic and computational investigation of actinium coordination chemistry.

    Ferrier, Maryline G; Batista, Enrique R; Berg, John M; Birnbaum, Eva R; Cross, Justin N; Engle, Jonathan W; La Pierre, Henry S; Kozimor, Stosh A; Lezama Pacheco, Juan S; Stein, Benjamin W; Stieber, S Chantal E; Wilson, Justin J

    2016-01-01

    Actinium-225 is a promising isotope for targeted-α therapy. Unfortunately, progress in developing chelators for medicinal applications has been hindered by a limited understanding of actinium chemistry. This knowledge gap is primarily associated with handling actinium, as it is highly radioactive and in short supply. Hence, Ac(III) reactivity is often inferred from the lanthanides and minor actinides (that is, Am, Cm), with limited success. Here we overcome these challenges and characterize actinium in HCl solutions using X-ray absorption spectroscopy and molecular dynamics density functional theory. The Ac-Cl and Ac-OH2O distances are measured to be 2.95(3) and 2.59(3) Å, respectively. The X-ray absorption spectroscopy comparisons between Ac(III) and Am(III) in HCl solutions indicate Ac(III) coordinates more inner-sphere Cl(1-) ligands (3.2±1.1) than Am(III) (0.8±0.3). These results imply diverse reactivity for the +3 actinides and highlight the unexpected and unique Ac(III) chemical behaviour. PMID:27531582

  9. Discovery of the actinium, thorium, protactinium, and uranium isotopes

    Fry, C; Thoennessen, M

    2012-01-01

    Currently, 31 actinium, 31 thorium, 28 protactinium, and 23 uranium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  10. Groundwater seepage from the Ranger uranium mine tailings dam: radioisotopes of radium, thorium and actinium. Supervising Scientist report 106

    Monitoring of bores near the Ranger uranium mine tailings dam has revealed deterioration in water quality in several bores since 1983. In a group of bores to the north of the dam, increases have been observed of up to 500 times for sulphate concentrations and of up to 5 times for 226Ra concentrations. Results are presented here of measurements of members of the uranium, thorium and actinium decay series in borewater samples collected between 1985 and 1993. In particular, measurements of all four naturally-occurring radium isotopes have been used in an investigation of the mechanism of radium concentration changes. For the most seepage-affected bores the major findings of the study include: 228Ra/226Ra 223Ra /226Ra and 224Ra/228Ra ratios all increased over the course of the study; barium concentrations show high seasonal variability, being lower in November than May, but strontium concentrations show a steady increase with time. Calculations show that the groundwater is probably saturated with respect to barite but not with respect to celestite or anglesite; sulphide concentrations are low in comparison with sulphate, and are higher in November than in May; and 227Ac concentrations have increased with time, but do not account for the high 223Ra/226Ra ratios. It is concluded on the basis of these observations that increases in Ra isotope concentrations observed in a number of seepage-affected bores arise from increases in salinity leading to desorption of radium from adsorption sites in the vicinity of the bore rather by direct transport of radium from the tailings. Increased salinity is also causing the observed increases in 227Ac and strontium concentrations, while formation of a barite solid phase in the groundwater is causing the removal of some radium from solution. This is the cause of the increasing radium isotope ratios noted above

  11. Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232

    The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces ∼100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 GeV protons

  12. Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232

    Harvey, James T.; Nolen, Jerry; Vandergrift, George; Gomes, Itacil; Kroc, Tom; Horwitz, Phil; McAlister, Dan; Bowers, Del; Sullivan, Vivian; Greene, John

    2011-12-30

    The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces {approx}100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 Ge

  13. Neutron-Induced Fission of Actinium-227, Protactinium-231 and Neptunium-237: Mass Distribution

    Results of radiochemical studies on the mass distribution in the neutron-induced fission of actinium-227, protactinium-231 and neptunium-237 have been presented. This work has been carried out as part of a programme to determine the mass distribution in the fission of heavy elements as a function of Z and A. All irradiations have been carried out in the core of the swimming-pool type reactor APSARA with cadmium shielding wherever necessary. Relative yields of several fission product nuclides have been obtained by a method involving a comparison of the fission product activities from the respective targets with those formed from uranium-235 simultaneously irradiated. Thermal-neutron fission yields of uranium-235 have been assumed. These results indicate a predominantly asymmetric mass distribution in all the three cases, and also a distinct though small symmetric peak in the case of actinium-227. (author)

  14. A new method for the determination of low-level actinium-227 in geological samples

    We developed a new method for the determination of 227Ac in geological samples. The method uses extraction chromatographic techniques and alpha-spectrometry and is applicable for a range of natural matrices. Here we report on the procedure and results of the analysis of water (fresh and seawater) and rock samples. Water samples were acidified and rock samples underwent total dissolution via acid leaching. A DGA (N,N,N',N'-tetra-n-octyldiglycolamide) extraction chromatographic column was used for the separation of actinium. The actinium fraction was prepared for alpha spectrometric measurement via cerium fluoride micro-precipitation. Recoveries of actinium in water samples were 80 ± 8 % (number of analyses n = 14) and in rock samples 70 ± 12 % (n = 30). The minimum detectable activities (MDA) were 0.017-0.5 Bq kg-1 for both matrices. Rock sample 227Ac activities ranged from 0.17 to 8.3 Bq kg-1 and water sample activities ranged from below MDA values to 14 Bq kg-1of 227Ac. From the analysis of several standard rock and water samples with the method we found very good agreement between our results and certified values. (author)

  15. Comment: 223 [Taxonomy Icon

    Full Text Available 223.png Shinobu Okamoto (Kazusa DNA Research Institute ) licensed under CC Attribution2.1 Japan シアノバクテリア 電子顕微鏡写真 撮影:岡本忍(かずさDNA研究所) bando 2009/11/05 18:33:52 2010/02/16 10:25:27 ...

  16. 22 CFR 223.11 - Appropriate action.

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Appropriate action. 223.11 Section 223.11...-EMPLOYMENT RESTRICTIONS § 223.11 Appropriate action. The Administrator may take appropriate action in the... action....

  17. Analysis of the gamma spectra of the uranium, actinium, and thorium decay series

    Momeni, M.H.

    1981-09-01

    This report describes the identification of radionuclides in the uranium, actinium, and thorium series by analysis of gamma spectra in the energy range of 40 to 1400 keV. Energies and absolute efficiencies for each gamma line were measured by means of a high-resolution germanium detector and compared with those in the literature. A gamma spectroscopy method, which utilizes an on-line computer for deconvolution of spectra, search and identification of each line, and estimation of activity for each radionuclide, was used to analyze soil and uranium tailings, and ore.

  18. Analysis of the gamma spectra of the uranium, actinium, and thorium decay series

    This report describes the identification of radionuclides in the uranium, actinium, and thorium series by analysis of gamma spectra in the energy range of 40 to 1400 keV. Energies and absolute efficiencies for each gamma line were measured by means of a high-resolution germanium detector and compared with those in the literature. A gamma spectroscopy method, which utilizes an on-line computer for deconvolution of spectra, search and identification of each line, and estimation of activity for each radionuclide, was used to analyze soil and uranium tailings, and ore

  19. 50 CFR 223.203 - Anadromous fish.

    2010-10-01

    ... pursuant to 50 CFR 223.209 and the government-to-government processes therein that implementing and... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Anadromous fish. 223.203 Section 223.203... Threatened Marine and Anadromous Species § 223.203 Anadromous fish. Available guidance documents cited in...

  20. In-source laser spectroscopy developments at TRILIS—towards spectroscopy on actinium and scandium

    Resonance Ionization Laser Ion Sources (RILIS) have become a versatile tool for production and study of exotic nuclides at Isotope Separator On-Line (ISOL) facilities such as ISAC at TRIUMF. The recent development and addition of a grating tuned spectroscopy laser to the TRIUMF RILIS solid state laser system allows for wide range spectral scans to investigate atomic structures on short lived isotopes, e.g., those from the element actinium, produced in uranium targets at ISAC. In addition, development of new and improved laser ionization schemes for rare isotope production at ISAC is ongoing. Here spectroscopic studies on bound states, Rydberg states and autoionizing (AI) resonances on scandium using the existing off-line capabilities are reported. These results allowed to identify a suitable ionization scheme for scandium via excitation into an autoionizing state at 58,104 cm − 1 which has subsequently been used for ionization of on-line produced exotic scandium isotopes.

  1. 36 CFR 223.279 - Personal use.

    2010-07-01

    .... In conjunction with determining sustainable harvest levels under § 223.219, the responsible Forest... 223.279 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE SALE AND DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER Forest Botanical Products § 223.279 Personal use. (a)...

  2. 32 CFR 223.4 - Policy.

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Policy. 223.4 Section 223.4 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS DEPARTMENT OF DEFENSE UNCLASSIFIED CONTROLLED NUCLEAR INFORMATION (DOD UCNI) § 223.4 Policy. It is DoD policy: (a)...

  3. 31 CFR 223.5 - Business.

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Business. 223.5 Section 223.5 Money... OF THE TREASURY FINANCIAL MANAGEMENT SERVICE SURETY COMPANIES DOING BUSINESS WITH THE UNITED STATES § 223.5 Business. (a) The company must engage in the business of suretyship whether or not also...

  4. 40 CFR 265.223 - Containment system.

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Containment system. 265.223 Section 265.223 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES (CONTINUED... FACILITIES Surface Impoundments § 265.223 Containment system. All earthen dikes must have a protective...

  5. 49 CFR 234.223 - Gate arm.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Gate arm. 234.223 Section 234.223 Transportation... Maintenance Standards § 234.223 Gate arm. Each gate arm, when in the downward position, shall extend across... clearly viewed by approaching highway users. Each gate arm shall start its downward motion not less...

  6. 32 CFR 223.5 - Responsibilities.

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 223.5 Section 223.5 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS DEPARTMENT OF DEFENSE UNCLASSIFIED CONTROLLED NUCLEAR INFORMATION (DOD UCNI) § 223.5 Responsibilities....

  7. 36 CFR 223.227 - Sale advertisement.

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Sale advertisement. 223.227 Section 223.227 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE SALE AND DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER Special Forest Products Advertisement and Bids § 223.227 Sale advertisement. (a) The Forest Service...

  8. 7 CFR 1280.223 - Reports.

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Reports. 1280.223 Section 1280.223 Agriculture... INFORMATION ORDER Lamb Promotion, Research, and Information Order Reports, Books, and Records § 1280.223 Reports. Each first handler required to remit assessments to the Board for live lambs pursuant to §...

  9. 13 CFR 134.223 - Evidence.

    2010-01-01

    ... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Evidence. 134.223 Section 134.223... OFFICE OF HEARINGS AND APPEALS Rules of Practice for Most Cases § 134.223 Evidence. (a) Federal Rules of Evidence. Unless contrary to a particular rule in this part, or an order of the Judge, the Federal Rules...

  10. 14 CFR 16.223 - Evidence.

    2010-01-01

    ... party other than the agency except as provided in Department of Transportation regulations at 49 CFR... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Evidence. 16.223 Section 16.223 Aeronautics... PRACTICE FOR FEDERALLY-ASSISTED AIRPORT ENFORCEMENT PROCEEDINGS Hearings § 16.223 Evidence. (a) General....

  11. Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL

    Raeder, S.; Bastin, B.; Block, M.; Creemers, P.; Delahaye, P.; Ferrer, R.; Fléchard, X.; Franchoo, S.; Ghys, L.; Gaffney, L. P.; Granados, C.; Heinke, R.; Hijazi, L.; Huyse, M.; Kron, T.; Kudryavtsev, Yu.; Laatiaoui, M.; Lecesne, N.; Luton, F.; Moore, I. D.; Martinez, Y.; Mogilevskiy, E.; Naubereit, P.; Piot, J.; Rothe, S.; Savajols, H.; Sels, S.; Sonnenschein, V.; Traykov, E.; Van Beveren, C.; Van den Bergh, P.; Van Duppen, P.; Wendt, K.; Zadvornaya, A.

    2016-06-01

    To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.

  12. Level Scheme of 223Fr

    A study has been made of the decay of 227 Ac at levels of 223Fr, means of alpha Spectrometers of Si barrier detector and gamma Spectrometers of Ge(Li). The rotational bands 1/2-(541 ↓ ] , 1/2-(530 ↑ ) and 3/2-(532 ↓ ) have been identified, as well as two octupolar bands associated with the fundamental one. The results obtained indicate that the unified model is applicable in this intermediate zone of the nuclide chart. (Author) 150 refs

  13. 36 CFR 2.23 - Recreation fees.

    2010-07-01

    ... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Recreation fees. 2.23 Section... PROTECTION, PUBLIC USE AND RECREATION § 2.23 Recreation fees. (a) Recreation fees shall be established as... sites, facilities, equipment or services, or participating in group activities, recreation events,...

  14. 18 CFR 3b.223 - Fees.

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Fees. 3b.223 Section 3b... INFORMATION Rules for Disclosure of Records § 3b.223 Fees. (a) Fees will be charged for the direct cost of... the records. Any person may obtain a copy of the Commission's schedule of fees by telephone, by...

  15. 36 CFR 223.63 - Advertised rates.

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Advertised rates. 223.63... DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER Timber Sale Contracts Appraisal and Pricing § 223.63 Advertised rates. Timber shall be advertised for sale at its appraised value. The road construction cost used...

  16. 27 CFR 46.223 - Tax credit.

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Tax credit. 46.223 Section 46.223 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF... PAPERS AND TUBES Floor Stocks Tax on Certain Tobacco Products, Cigarette Papers, and Cigarette Tubes...

  17. 31 CFR 223.20 - Final decisions.

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Final decisions. 223.20 Section 223.20 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE SURETY COMPANIES DOING BUSINESS WITH THE...

  18. 31 CFR 223.21 - Reinstatement.

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Reinstatement. 223.21 Section 223.21 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE SURETY COMPANIES DOING BUSINESS WITH THE...

  19. 31 CFR 223.17 - Revocation.

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Revocation. 223.17 Section 223.17 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE SURETY COMPANIES DOING BUSINESS WITH THE...

  20. 31 CFR 223.4 - Deposits.

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Deposits. 223.4 Section 223.4 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE SURETY COMPANIES DOING BUSINESS WITH THE UNITED...

  1. 31 CFR 223.8 - Financial reports.

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Financial reports. 223.8 Section 223.8 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE SURETY COMPANIES DOING BUSINESS WITH THE...

  2. 36 CFR 223.35 - Performance bond.

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Performance bond. 223.35 Section 223.35 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE SALE AND... Performance bond. Timber sale contracts may require the purchaser to furnish a performance bond...

  3. 7 CFR 1220.223 - Assessments.

    2010-01-01

    ... CONSUMER INFORMATION Soybean Promotion and Research Order Expenses and Assessments § 1220.223 Assessments... the first purchaser must establish to the satisfaction of the Board that the producer has...

  4. Dosimetry of radium-223 and progeny

    Fisher, D.R. [Pacific Northwest National Lab., Richland, WA (United States); Sgouros, G. [Memorial Sloan-Kettering Cancer Center, New York, NY (United States)

    1999-01-01

    Radium-223 is a short-lived (11.4 d) alpha emitter with potential applications in radioimmunotherapy of cancer. Radium-223 can be complexed and linked to protein delivery molecules for specific tumor-cell targeting. It decays through a cascade of short-lived alpha- and beta-emitting daughters with emission of about 28 MeV of energy through complete decay. The first three alpha particles are essentially instantaneous. Photons associated with Ra-223 and progeny provide the means for tumor and normal-organ imaging and dosimetry. Two beta particles provide additional therapeutic value. Radium-223 may be produced economically and in sufficient amounts for widescale application. Many aspects of the chemistry of carrier-free isotope preparation, complexation, and linkage to the antibody have been developed and are being tested. The radiation dosimetry of a Ra-223-labeled antibody shows favorable tumor to normal tissue dose ratios for therapy. The 11.4-d half-life of Ra-223 allows sufficient time for immunoconjugate preparation, administration, and tumor localization by carrier antibodies before significant radiological decay takes place. If 0.01 percent of a 37 MBq (1 mCi) injection deposits in a one gram tumor mass, and if the activity is retained with a typical effective half-time (75 h), the absorbed dose will be 163 mGy MBq{sup {minus}1} (600 rad mCi{sup {minus}1}) administered. 49 refs., 5 figs., 2 tabs.

  5. Recrystallization of 223Ra with barium sulfate

    In this work, the kinetics of barium sulfate recrystallization has been studied in acidic 0.01 mol dm-3 sodium sulfate solution using 223Ra and 133Ba tracers at very low total radium concentration, i.e. less than 10-13 mol dm-3. It was found that the system follows the homogeneous recrystallization model and that recrystallization rates, inferred by the decrease of 223Ra and 133Ba in the aqueous solution, are fast. Therefore, even at very low concentrations, below the solubility limit, radium will be retained by barium sulfate-a mineral present in the deep underground repository. (author)

  6. 36 CFR 223.88 - Bidding methods.

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Bidding methods. 223.88... methods. (a) Competitive sales of National Forest timber shall be offered through either sealed or oral auction bidding. The method chosen for each sale will: (1) Insure open and fair competition, (2)...

  7. 36 CFR 223.231 - Bidding methods.

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Bidding methods. 223.231... methods. The Contracting Officer or designated forest officer shall offer advertised sales of special forest products through sealed bid or sealed bid followed by oral auction. The method selected shall:...

  8. 17 CFR 256.223 - Advances from associate companies.

    2010-04-01

    ... companies. 256.223 Section 256.223 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) UNIFORM SYSTEM OF ACCOUNTS FOR MUTUAL SERVICE COMPANIES AND SUBSIDIARY SERVICE COMPANIES, PUBLIC UTILITY HOLDING COMPANY ACT OF 1935 6. Long-Term Debt § 256.223 Advances from associate companies....

  9. 31 CFR 223.6 - Requirements applicable to surety companies.

    2010-07-01

    ... companies. 223.6 Section 223.6 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE SURETY COMPANIES DOING BUSINESS WITH THE UNITED STATES § 223.6 Requirements applicable to surety companies. Every company now...

  10. 48 CFR 223.570 - Drug-free work force.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Drug-free work force. 223.570 Section 223.570 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM... TECHNOLOGIES, OCCUPATIONAL SAFETY, AND DRUG-FREE WORKPLACE Drug-Free Workplace 223.570 Drug-free work force....

  11. 14 CFR 223.3 - Mandatory free transportation.

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Mandatory free transportation. 223.3 Section 223.3 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS FREE AND REDUCED-RATE TRANSPORTATION General Provisions § 223.3...

  12. 31 CFR 223.2 - Application for certificate of authority.

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Application for certificate of authority. 223.2 Section 223.2 Money and Finance: Treasury Regulations Relating to Money and Finance... BUSINESS WITH THE UNITED STATES § 223.2 Application for certificate of authority. Every company wishing...

  13. 31 CFR 223.9 - Valuation of assets and liabilities.

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Valuation of assets and liabilities. 223.9 Section 223.9 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued... WITH THE UNITED STATES § 223.9 Valuation of assets and liabilities. In determining the...

  14. 50 CFR 223.201 - Guadalupe fur seal.

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Guadalupe fur seal. 223.201 Section 223... Applicable to Threatened Marine and Anadromous Species § 223.201 Guadalupe fur seal. (a) Prohibitions. The... seal except as provided in paragraph (b) of this section. (b) Exceptions. (1) The...

  15. 36 CFR 223.164 - Penalty for falsification.

    2010-07-01

    .... 223.164 Section 223.164 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE SALE AND DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER Timber Export and Substitution Restrictions § 223.164 Penalty for falsification. For false certification of documents relating to export or...

  16. 31 CFR 223.10 - Limitation of risk.

    2010-07-01

    ... SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE SURETY COMPANIES DOING BUSINESS WITH THE UNITED STATES § 223.10 Limitation of risk. Except as provided in § 223.11, no company holding a... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Limitation of risk. 223.10...

  17. 36 CFR 223.228 - Contents of advertisement.

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Contents of advertisement. 223.228 Section 223.228 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE SALE AND DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER Special Forest Products Advertisement and Bids § 223.228 Contents of advertisement. The...

  18. 36 CFR 223.82 - Contents of advertisement.

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Contents of advertisement. 223.82 Section 223.82 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE SALE AND DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER Timber Sale Contracts Advertisement and Bids § 223.82 Contents of advertisement. (a) A timber...

  19. 36 CFR 223.80 - When advertisement is required.

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false When advertisement is required. 223.80 Section 223.80 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE SALE AND DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER Timber Sale Contracts Advertisement and Bids § 223.80 When advertisement is required. Except...

  20. 50 CFR 223.202 - Steller sea lion.

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Steller sea lion. 223.202 Section 223.202... Threatened Marine and Anadromous Species § 223.202 Steller sea lion. (a) General prohibitions. The... the eastern population of Steller sea lions: (1) No discharge of firearms. Except as provided...

  1. 31 CFR 223.7 - Investment of capital and assets.

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Investment of capital and assets. 223.7 Section 223.7 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued... WITH THE UNITED STATES § 223.7 Investment of capital and assets. The cash capital and other funds...

  2. Dicty_cDB: SLI223 [Dicty_cDB

    Full Text Available SL (Link to library) SLI223 (Link to dictyBase) - - - Contig-U15456-1 SLI223Z (Link to Original ... 85_1( EF193385 |pid:none) Musca domestica aspartic proteinas ... 47 4e-09 EF070454_1( EF070454 |pid:none) Macone ...

  3. 14 CFR 21.223 - Class II provisional airworthiness certificates.

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Class II provisional airworthiness certificates. 21.223 Section 21.223 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF... the aircraft has been issued to the manufacturer. (c) The applicant must submit a statement by...

  4. 46 CFR 108.223 - Guards on exposed equipment.

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Guards on exposed equipment. 108.223 Section 108.223 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) A-MOBILE OFFSHORE DRILLING UNITS DESIGN... contact by personnel. Helicopter Facilities...

  5. 31 CFR 223.3 - Issuance of certificates of authority.

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Issuance of certificates of authority. 223.3 Section 223.3 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued... United States or of any State, or it is limited by its articles of incorporation or corporate charter...

  6. 31 CFR 223.1 - Certificate of authority.

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Certificate of authority. 223.1 Section 223.1 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE SURETY COMPANIES DOING BUSINESS WITH...

  7. 31 CFR 223.12 - Recognition as reinsurer.

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Recognition as reinsurer. 223.12 Section 223.12 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE SURETY COMPANIES DOING BUSINESS WITH...

  8. 36 CFR 223.137 - Causes for debarment.

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Causes for debarment. 223.137... DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER Suspension and Debarment of Timber Purchasers § 223.137 Causes for debarment. The debarring official may debar a purchaser for any of the following causes:...

  9. Complete Genome Sequence of Biocontrol Strain Pseudomonas fluorescens LBUM 223

    Roquigny, Roxane; Arseneault, Tanya; Gadkar, Vijay J.; Novinscak, Amy; Joly, David L.; Filion, Martin

    2015-01-01

    Pseudomonas fluorescens LBUM 223 is a plant growth-promoting rhizobacterium (PGPR) with biocontrol activity against various plant pathogens. It produces the antimicrobial metabolite phenazine-1-carboxylic acid, which is involved in the biocontrol of Streptomyces scabies, the causal agent of common scab of potato. Here, we report the complete genome sequence of P. fluorescens LBUM 223.

  10. 24 CFR 248.223 - Alternative State strategy.

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Alternative State strategy. 248.223... Preservation Act of 1987 § 248.223 Alternative State strategy. (a) The Commissioner may approve a State strategy providing for State approval of plans of action that involve termination of low...

  11. 49 CFR 223.15 - Requirements for existing passenger cars.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Requirements for existing passenger cars. 223.15... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION SAFETY GLAZING STANDARDS-LOCOMOTIVES, PASSENGER CARS AND CABOOSES Specific Requirements § 223.15 Requirements for existing passenger cars. (a) Passenger cars built...

  12. Dicty_cDB: CHB223 [Dicty_cDB

    Full Text Available CH (Link to library) CHB223 (Link to dictyBase) - - - Contig-U16243-1 CHB223P (Link to Original ... o... 657 0.0 X75329_1( X75329 |pid:none) M.indica (Manila ) THMF5 mRNA for 3-ket... 370 e-101 AF062589_2( AF0 ...

  13. 36 CFR 223.89 - Relation to other bidders.

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Relation to other bidders. 223.89 Section 223.89 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE....89 Relation to other bidders. Any bidder or applicant for a sale may be required to furnish...

  14. 48 CFR 1852.223-70 - Safety and health.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Safety and health. 1852.223... 1852.223-70 Safety and health. As prescribed in 1823.7004(c), insert the following clause: Safety and Health (APR 2002) (a) Safety is the freedom from those conditions that can cause death,...

  15. Dicty_cDB: CHM223 [Dicty_cDB

    Full Text Available CH (Link to library) CHM223 (Link to dictyBase) - - - Contig-U10738-1 | Contig-U12609-1 CHM223P ... significant alignments: (bits) Value N BU803755 | polymer ase (RNA) II (DNA directed) polypeptide B (140kD) [ ... 5 |AY485615.1 Candida tropicalis DNA-dependent RNA polymer ase II second largest subunit gene, partial cds. 80 ...

  16. Level Scheme of {sup 223}Fr; Estudio del esquema de niveles del {sup 223}Fr

    Gaeta, R.; Gonzalez, L.; Roldan, C.

    1972-07-01

    A study has been made of the decay of {sup 227}Ac at levels of {sub 223}Fr, means of alpha Spectrometers of Si barrier detector and gamma Spectrometers of Ge(Li). The rotational bands 1/2-(541 {down_arrow}), 1/2-(530 {up_arrow}) and 3/2-(532 {down_arrow}) have been identified, as well as two octupolar bands associated with the fundamental one. The results obtained indicate that the unified model is applicable in this intermediate zone of the nuclide chart. (Author) 150 refs.

  17. Direct measurement of the half-life of 223Ra

    Radioactive decay half-life measurements of 223Ra, a member of the 235U naturally occurring radioactive decay series, have been performed of a radiochemically pure solution with an ionisation chamber. The radioactive decay of 223Ra was followed for 50 days, approximately 4.4 half-lives. The deduced half-life of 223Ra was found to be 11.4358 (28) days, supporting the other published direct measurements. A detailed uncertainty budget is presented. A new evaluation of the published half-life values was performed, indicating significant variation across the existing published values, suggesting that further measurements of the half-life of 223Ra are required. A new evaluated half-life has been calculated using a power moderated weighted mean of selected experimental values, with a new value of the recommended half-life for 223Ra of 11.4354 (17) days. - Highlights: • Direct measurement of the 223Ra half-life using an ionisation chamber. • New measured half-life of 11.4358 (28) days. • Result consistent with the most precise published value

  18. New 223-nm excimer laser surgical system for photorefractive keratectomy

    Bagaev, Sergei N.; Razhev, Alexander M.; Zhupikov, Andrey A.

    1999-02-01

    The using of KrCl (223 nm) excimer laser in ophthalmic devices for Photorefractive Keratectomy (PRK) and phototherapeutic Keratectomy (PTK) is offered. The structure and functions of a new surgical UV ophthalmic laser systems Medilex using ArF (193 nm) or KrCl (223 nm) excimer laser for corneal surgery are presented. The systems Medilex with the new optical delivery system is used for photoablative reprofiling of the cornea to correct refraction errors (myopia, hyperopia and astigmatism) and to treat a corneal pathologies. The use of the 223 nanometer laser is proposed to have advantages over the 193 nanometer laser. The results of application of the ophthalmic excimer laser systems Medilex for treatment of myopia are presented.

  19. 76 FR 72996 - Eleventh Meeting: RTCA Special Committee 223 Airport Surface Wireless Communications

    2011-11-28

    ... Federal Aviation Administration Eleventh Meeting: RTCA Special Committee 223 Airport Surface Wireless...: Notice of RTCA Special Committee 223 Airport Surface Wireless Communications Eleventh Meeting. SUMMARY..., Airport Surface Wireless Communications Eleventh Meeting DATES: The meeting will be held December...

  20. 31 CFR 223.16 - List of certificate holding companies.

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false List of certificate holding companies...) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE SURETY COMPANIES DOING BUSINESS WITH THE UNITED STATES § 223.16 List of certificate holding companies. A list of qualified companies...

  1. 36 CFR 223.62 - Timber purchaser road construction credit.

    2010-07-01

    ... § 223.62 Timber purchaser road construction credit. Appraisal may also establish stumpage value as if... timber is appraised and sold on such basis, purchaser credit for road construction, not to exceed the... deposits for slash disposal and road maintenance. As used in this section estimated construction...

  2. 40 CFR 98.223 - Calculating GHG emissions.

    2010-07-01

    ... (CONTINUED) MANDATORY GREENHOUSE GAS REPORTING Nitric Acid Production § 98.223 Calculating GHG emissions. (a... nitric acid train “t” (fraction of annual production that abatement technology is operating). Pa t = Total annual nitric acid production from nitric acid train “t” (ton acid produced, 100 percent...

  3. 31 CFR 223.11 - Limitation of risk: Protective methods.

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Limitation of risk: Protective... BUSINESS WITH THE UNITED STATES § 223.11 Limitation of risk: Protective methods. The limitation of risk... underwriting limitations. Each company shall limit its liability upon the face of the bond or policy, to...

  4. THE METABOLSIM AND TOXICITY OF RADIUM-223 IN RATS

    Durbin, Patricia; Durbin, Patricia W.; Asling, C. Willet.; Jeung, Nylan; Williams, Marilyn H.; Post, James.; Johnston, Muriel E.; Hamilton, Joseph G.

    1958-02-21

    This report covers studies of the excretion and retention of 'tracer' and toxic doses of the 11.2-day Ra{sup 223} isotope, its acute toxicity (organ weight changes, gross and microscopic pathology, and Fe{sup 59} utilization by the bone marrow), and long-term histopathological changes and alterations in the hemogram.

  5. 36 CFR 223.229 - Contents of prospectus.

    2010-07-01

    ... AND DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER Special Forest Products Advertisement and Bids § 223.229...: (a) The minimum acceptable value or unit price for a product and the amount or rate of any deposits required in addition to the unit price of a product; (b) The amount of the bid guarantee that...

  6. 36 CFR 223.85 - Noncompetitive sale of timber.

    2010-07-01

    ... SALE AND DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER Timber Sale Contracts Advertisement and Bids § 223... further advertisement, at not less than appraised value, any timber previously advertised for competitive... of competitive interest in the product. (b) Extraordinary conditions, as provided for in 16...

  7. 36 CFR 223.142 - Causes for suspension.

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Causes for suspension. 223... Causes for suspension. (a) The suspending official may suspend a purchaser suspected, upon adequate... responsibility of a purchase of Government timber. (2) Indictment for any of the causes listed in paragraph...

  8. 31 CFR 223.14 - Schedules of single risks.

    2010-07-01

    ... SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE SURETY COMPANIES DOING BUSINESS WITH THE UNITED STATES § 223.14 Schedules of single risks. During the months of January, April, July, and October... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Schedules of single risks....

  9. 14 CFR 125.223 - Airborne weather radar equipment requirements.

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Airborne weather radar equipment... Equipment Requirements § 125.223 Airborne weather radar equipment requirements. (a) No person may operate an airplane governed by this part in passenger-carrying operations unless approved airborne weather...

  10. 48 CFR 52.223-6 - Drug-Free Workplace.

    2010-10-01

    ... further defined in regulation at 21 CFR 1308.11-1308.15. Conviction means a finding of guilt (including a... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Drug-Free Workplace. 52....223-6 Drug-Free Workplace. As prescribed in 23.505, insert the following clause: Drug-Free...

  11. Dicty_cDB: SHJ223 [Dicty_cDB

    Full Text Available SH (Link to library) SHJ223 (Link to dictyBase) - - - Contig-U16405-1 - (Link to Original site) ... ikyc*glyi*cfgfsilsksiqfei* *ktkniw*ryshywlifkiiwws*fpy *fh*ck*tfcc*r*fl*sif*l**yycnistri rki*vvl**nwg*scti ...

  12. Radium-223 in metastatic castration resistant prostate cancer

    Winston Vuong; Oliver Sartor; Sumanta K Pal

    2014-01-01

    In 2004, docetaxel was approved for the treatment of metastatic castration-resistant prostate cancer (mCRPC). For the next several years, there was a lull in drug approvals. However, from 2010 onwards, 5 additional therapies have been approved on the basis of showing a survival beneift in phase III studies. These agents include sipuleucel-T, cabazitaxel, abiraterone, enzalutamide and (most recently) radium-223. Amongst radiopharmaceuticals currently used for advanced prostate cancer (e.g. samarium-153 and strontium-89), radium-223 possesses several unique properties. As an alpha-emitting compound, the agent produces a high-energy output over a short range, facilitating selective destruction of tissue within the bone in the region of osteoblastic lesions while sparing surrounding normal tissue. The current review will outline biological rationale for radium-223 and also provide an overview of preclinical and clinical development of the agent. Rational sequencing of radium-223 and combinations, in the increasingly complex landscape of mCRPC will be discussed, along with factors inlfuencing clinical implementation.

  13. 36 CFR 223.185 - Scope and applicability.

    2010-07-01

    ....185 Section 223.185 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE SALE AND DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER The Forest Resources Conservation and Shortage Relief... Forest Resources Conservation and Shortage Relief Act of 1990 (16 U.S.C. 620, et seq.) that...

  14. 36 CFR 223.38 - Standards for road design and construction.

    2010-07-01

    ... Provisions § 223.38 Standards for road design and construction. Road construction authorized under timber... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Standards for road design and construction. 223.38 Section 223.38 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT...

  15. 36 CFR 223.84 - Small business bid form provisions on sales with specified road construction.

    2010-07-01

    ... provisions on sales with specified road construction. 223.84 Section 223.84 Parks, Forests, and Public... specified road construction. For each sale described in § 223.82(b), the bid form must include provision for a small business concern: (a) To elect road construction by the Forest Service and where...

  16. 36 CFR 223.41 - Payment when purchaser elects government road construction.

    2010-07-01

    ... government road construction. 223.41 Section 223.41 Parks, Forests, and Public Property FOREST SERVICE... Conditions and Provisions § 223.41 Payment when purchaser elects government road construction. Each contract... or more shall include a provision to ensure that if the purchaser elects government road...

  17. 36 CFR 223.47 - Date of completion of permanent road construction.

    2010-07-01

    ... permanent road construction. 223.47 Section 223.47 Parks, Forests, and Public Property FOREST SERVICE... Conditions and Provisions § 223.47 Date of completion of permanent road construction. (a) The date of completion of permanent road construction obligations as set forth in the Notice of Sale shall...

  18. 14 CFR 223.21 - Free and reduced-rate transportation authorized by statute or regulation.

    2010-01-01

    ... authorized by statute or regulation. 223.21 Section 223.21 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS FREE AND REDUCED-RATE TRANSPORTATION International Travel § 223.21 Free and reduced-rate transportation authorized by statute or regulation. (a)...

  19. 31 CFR 223.22 - Fees for services of the Treasury Department.

    2010-07-01

    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Fees for services of the Treasury Department. 223.22 Section 223.22 Money and Finance: Treasury Regulations Relating to Money and Finance... BUSINESS WITH THE UNITED STATES § 223.22 Fees for services of the Treasury Department. (a) Fees shall...

  20. 12 CFR 303.223 - Applicant's right to hearing following denial.

    2010-01-01

    ... Criminal Offenses) § 303.223 Applicant's right to hearing following denial. An applicant may request a... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Applicant's right to hearing following denial. 303.223 Section 303.223 Banks and Banking FEDERAL DEPOSIT INSURANCE CORPORATION PROCEDURE AND RULES...

  1. 36 CFR 223.281 - Monitoring and revising sustainable harvest levels.

    2010-07-01

    ... sustainable harvest levels. 223.281 Section 223.281 Parks, Forests, and Public Property FOREST SERVICE....281 Monitoring and revising sustainable harvest levels. The Forest Service shall monitor and revise sustainable harvest levels for forest botanical products in accordance with § 223.219 of subpart G....

  2. 18 CFR 2.23 - Use of reserved authority in hydropower licenses to ameliorate cumulative impacts.

    2010-04-01

    ... authority in hydropower licenses to ameliorate cumulative impacts. 2.23 Section 2.23 Conservation of Power... § 2.23 Use of reserved authority in hydropower licenses to ameliorate cumulative impacts. The... opportunity for hearing by the licensee and all interested parties. Hydropower licenses also contain...

  3. 36 CFR 223.12 - Permission to cut, damage, or destroy trees without advertisement.

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Permission to cut, damage, or destroy trees without advertisement. 223.12 Section 223.12 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE SALE AND DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER General Provisions § 223.12 Permission to cut, damage,...

  4. 36 CFR 223.232 - Disclosure of relation to other bidders.

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Disclosure of relation to other bidders. 223.232 Section 223.232 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF... § 223.232 Disclosure of relation to other bidders. The Forest Service may require any prospective...

  5. Radiation exposure of relatives of patients treated with Ra-223 dichloride; Strahlenexposition von Angehoerigen bei Therapie mit Ra-223-Dichlorid

    Wanke, C.; Szermerski, B.; Solle, A.; Geworski, L. [Medizinische Hochschule Hannover (Germany). Stabsstelle Strahlenschutz und Abt. Medizinische Physik; Pinkert, J. [Bayer Vital GmbH, Leverkusen (Germany); Kranert, W.T. [Frankfurt Univ. (Germany). Klinik fuer Nuklearmedizin; Andreeff, M. [Universitaetsklinikum ' ' Carl Gustav Carus' ' TU Dresden (Germany). Klinik fuer Nuklearmedizin

    2015-07-01

    Since November 2013, a radiopharmaceutical containing Ra-223 dichloride as active substance is approved in the European Union for patients with castration resistant prostate cancer with symptomatic bone metastases and no known visceral metastases. Ra-223 (T{sub 1/2} = 11.43 d) decays via a chain of 4 alpha and 2 beta decays. This therapy is presently the only application of an alpha emitter in clinical routine therapy. To show that the exposure of relatives and caregivers of patients treated with Ra-223 dichloride in an outpatient setting does not exceed a value of 1 mSv, the multicenter study ''RAPSODY'' was conducted. As Ra-223 and most of its progeny emit alpha particles, the internal exposure had to be evaluated in particular. Within this study, measurements of the radiation emitted from the patient were performed using standard dose-rate meters. Wipe-tests were taken in the patients' homes to identify significant contaminations and evaluated by liquid scintillation counting. Samples of saliva and sweat were taken and measured using gamma spectrometry. Ra-223 disintegrates to the noble gas Rn-219 and was measured in the exhaled breath from the patients using conventional Radon Monitors. Furthermore, a computational fluid dynamics simulation (CFD) was performed to assess the radioactivity in the air, which could be inhaled by persons close to the patient. Conclusions: The potential exposure of relatives and caregivers by external irradiation and incorporation of radioactivity exhaled or excreted by the patient with saliva or sweat is well below 1 mSv. No objections are seen regarding outpatient treatment. This paper summarizes contents of a poster presented at the Annual Meeting of the Society of Nuclear Medicine and Molecular Imaging.

  6. Radium-223 dichloride in clinical practice: a review.

    Florimonte, Luigia; Dellavedova, Luca; Maffioli, Lorenzo Stefano

    2016-09-01

    The onset of skeletal metastases is typical of advanced-stage prostate cancer and requires a multidisciplinary approach to alleviate bone pain and try to delay disease progression. The current therapeutic armamentarium includes conventional analgesics, chemotherapeutic agents, immunotherapy, androgen-deprivation therapy, osteoclast inhibitors (bisphosphonates, denosumab), surgical interventions, external-beam radiotherapy and radionuclide metabolic therapy. Many studies in recent decades have demonstrated the efficacy of various radiopharmaceuticals, including strontium-89 and samarium-153, for palliation of pain from diffuse skeletal metastases, but no significant benefit in terms of disease progression and overall survival has been shown. The therapeutic landscape of metastatic skeletal cancer significantly changed after the introduction of radium-223, the first bone-homing radiopharmaceutical with disease-modifying properties. In this paper we extensively review the literature on the use of radium-223 dichloride in metastatic castration-resistant prostate cancer. PMID:27121689

  7. Determination of Ra-223 in human excretion samples by means of α-spectrometry; Bestimmung von {sup 223}Ra in Ausscheidungsproben mittels α-Spektrometrie

    Zoriy, M.V.; Froning, M.; Hill, P. [Forschungszentrum Juelich GmbH (Germany). Geschaeftsbereich Strahlenschutz und Sicherheit

    2015-07-01

    To ensure the safety of occupationally exposed person for possible incorporation of {sup 223}Ra during the handling with Alpharadin / Xofigo {sup registered}, the determination of {sup 223}Ra activity in its excretion sample (e.g, in a stool sample) might be of great importance. To assess the {sup 223}Ra activity in human faeces samples a new analytical method was developed in our laboratory. The determination is performed by means of grid-ionization a-spectrometry. After a relatively simple sample preparation procedure (usually within max. 6 hours) and the addition of an internal standard, a direct determination of {sup 223}Ra with the grid ionization chamber (GIK) is possible. The method was optimized and successfully tested. The procedure-related LOD for {sup 223}Ra in a 24-hour faeces sample was 0.1 Bq/Probe.

  8. 223Ra for endoradiotherapeutic applications prepared from an immobilized 227Ac/227Th source

    A method is described for the production of 223Ra (t1/2 = 11.4 d) in a quality useful for endoradiotherapeutic applications. The method is based on a long term operating generator with a source of 227Ac (t1/2 = 21.7 years), from which 223Ra is eluted. The 227Ac was isolated from a 231Pa source using the f-element selective extraction chromatographic material TRU-resin. The purified 227Ac/227Th source was subsequently applied to another extraction chromatographic resin, containing the extractant P,P'-di(2-ethylhexyl)methanediphosphonic acid on silica (Dipex-2) and used as a generator for 223Ra. From the generator column, the yield of 223Ra was about 60 kBq per 100 kBq of 227Ac with a highly effective separation of 223Ra from the precursors. In production runs, the activity of 227Ac was found to be 6 x 10-6 relative to the eluted activity of 223Ra. By using a second column of Dipex-2 for additional purification, the activity of Ac was reduced to below 7 x 10-8 relative to 223Ra with nearly quantitative recovery of 223Ra. The described procedure resulted in a high purity 223Ra preparation, potentially useful in, e.g., targeted radiotherapy of tumors. (orig.)

  9. Therapy palliative with 223Ra without special radiation protection measures?

    For nearly 2 years now as a therapy of the castration resistant prostata carcinoma a nuclide therapy with 223Ra-Dichloride (trade-mark Xofigo) is applied. Xofigo is applied by a medical specialist for nuclear medicine altogether 6 times in a monthly distance. The activity used in each case is according to the body weight (50 kBq/kg BW). This therapy is licensed by the supervisory authorities of the German federal countries as an ambulant therapy. Special radiation protection measures are only required when exceeding a given number of 17 patients per year as incorparation measurements.

  10. 48 CFR 952.223 - Clauses related to environment, energy and water efficiency, renewable energy technologies...

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Clauses related to environment, energy and water efficiency, renewable energy technologies, occupational safety, and drug-free workplace. 952.223 Section 952.223 Federal Acquisition Regulations System DEPARTMENT OF ENERGY CLAUSES AND FORMS SOLICITATION PROVISIONS AND...

  11. 36 CFR 223.280 - Waiver of fees and/or fair market value.

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Waiver of fees and/or fair market value. 223.280 Section 223.280 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF... fees and/or fair market value. The Forest Service waives the collection of fees otherwise...

  12. Radium-223 treatment of bone metastases from castration-resistant prostate cancer

    Mortensen, Jann; Højgaard, Liselotte

    2014-01-01

    The alpha emitter Radium-223 ((22)3Ra-Cl2) is a bone-seeking radionuclide studied as a new treatment for patients with bone metastases from hormone refractory prostate cancer. More than 1,000 patients have been included in clinical phase I-III tests showing significant reduction in alkaline...

  13. 75 FR 30899 - Fourth Meeting: RTCA Special Committee 223: Airport Surface Wireless Communications

    2010-06-02

    ... Federal Aviation Administration Fourth Meeting: RTCA Special Committee 223: Airport Surface Wireless...: Airport Surface Wireless Communications meeting. SUMMARY: The FAA is issuing this notice to advise the public of a meeting of RTCA Special Committee 223: Airport Surface Wireless Communications. DATES:...

  14. 78 FR 13395 - Meeting: RTCA Special Committee 223, Airport Surface Wireless Communications

    2013-02-27

    ... Federal Aviation Administration Meeting: RTCA Special Committee 223, Airport Surface Wireless...: Meeting Notice of RTCA Special Committee 223, Airport Surface Wireless Communications SUMMARY: The FAA is... Wireless Communications. DATES: The meeting will be held March 19-21, 2013, from 9:00 a.m.--5:00 p.m....

  15. 76 FR 6179 - Eighth Meeting: RTCA Special Committee 223: Airport Surface Wireless Communications

    2011-02-03

    ... Federal Aviation Administration Eighth Meeting: RTCA Special Committee 223: Airport Surface Wireless... of RTCA Special Committee 223: Airport Surface Wireless Communications meeting. SUMMARY: The FAA is... Wireless Communications. DATES: The meeting will be held February 22-23, 2011 from 9 a.m. to 5...

  16. 75 FR 14483 - Third Meeting: RTCA Special Committee 223: Airport Surface Wireless Communications

    2010-03-25

    ... Federal Aviation Administration Third Meeting: RTCA Special Committee 223: Airport Surface Wireless...: Airport Surface Wireless Communications meeting. SUMMARY: The FAA is issuing this notice to advise the public of a meeting of RTCA Special Committee 223: Airport Surface Wireless Communications. DATES:...

  17. 75 FR 66423 - Seventh Meeting: RTCA Special Committee 223: Airport Surface Wireless Communications

    2010-10-28

    ... Federal Aviation Administration Seventh Meeting: RTCA Special Committee 223: Airport Surface Wireless... of RTCA Special Committee 223: Airport Surface Wireless Communications meeting. SUMMARY: The FAA is... Wireless Communications. DATES: The meeting will be held November 16-17, 2010 from 9 a.m.-5 p.m....

  18. 77 FR 55894 - Thirteenth Meeting: RTCA Special Committee 223, Airport Surface Wireless Communications

    2012-09-11

    ... Federal Aviation Administration Thirteenth Meeting: RTCA Special Committee 223, Airport Surface Wireless...: Meeting Notice of RTCA Special Committee 223, Airport Surface Wireless Communications. SUMMARY: The FAA is..., Airport Surface Wireless Communications. DATES: The meeting will be held October 2-3, 2012, from 9...

  19. 78 FR 33145 - Meeting: RTCA Special Committee 223, Airport Surface Wireless Communications

    2013-06-03

    ... Federal Aviation Administration Meeting: RTCA Special Committee 223, Airport Surface Wireless...: Meeting Notice of RTCA Special Committee 223, Airport Surface Wireless Communications. SUMMARY: The FAA is... Wireless Communications. DATES: The meeting will be held June 26-28, 2013, from 9:00 a.m.-5:00 p.m....

  20. 75 FR 54421 - Sixth Meeting: RTCA Special Committee 223: Airport Surface Wireless Communications

    2010-09-07

    ... Federal Aviation Administration Sixth Meeting: RTCA Special Committee 223: Airport Surface Wireless... of RTCA Special Committee 223: Airport Surface Wireless Communications meeting. SUMMARY: The FAA is... Wireless Communications. DATES: The meeting will be held September 28-30, 2010 from 0900 a.m.- 1600...

  1. 77 FR 71028 - Twelfth Meeting: RTCA Special Committee 223, Airport Surface Wireless Communications

    2012-11-28

    ... Federal Aviation Administration Twelfth Meeting: RTCA Special Committee 223, Airport Surface Wireless...: Meeting Notice of RTCA Special Committee 223, Airport Surface Wireless Communications. SUMMARY: The FAA is... Wireless Communications. DATES: The meeting will be held December 4-6, 2012, from 9:00 a.m.-5:00...

  2. 75 FR 44306 - Fifth Meeting: RTCA Special Committee 223: Airport Surface Wireless Communications

    2010-07-28

    ... Federal Aviation Administration Fifth Meeting: RTCA Special Committee 223: Airport Surface Wireless... of RTCA Special Committee 223: Airport Surface Wireless Communications meeting. SUMMARY: The FAA is... Wireless Communications. DATES: The meeting will be held August 17-18, 2010 from 9 a.m.-5 p.m....

  3. 14 CFR 120.223 - Alcohol misuse information, training, and substance abuse professionals.

    2010-01-01

    ... personal life; signs and symptoms of an alcohol problem; available methods of evaluating and resolving... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Alcohol misuse information, training, and substance abuse professionals. 120.223 Section 120.223 Aeronautics and Space FEDERAL AVIATION...

  4. 40 CFR 86.223-94 - Oxides of nitrogen analyzer calibration.

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Oxides of nitrogen analyzer calibration. 86.223-94 Section 86.223-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... nitrogen analyzer calibration. The provisions of § 86.123-78 apply to this subpart if NOX measurements...

  5. MiR-223 suppresses cell proliferation by targeting IGF-1R.

    Cheng You Jia

    Full Text Available To study the roles of microRNA-223 (miR-223 in regulation of cell growth, we established a miR-223 over-expression model in HeLa cells infected with miR-223 by Lentivirus pLL3.7 system. We observed in this model that miR-223 significantly suppressed the proliferation, growth rate, colony formation of HeLa cells in vitro, and in vivo tumorigenicity or tumor formation in nude mice. To investigate the mechanisms involved, we scanned and examined the potential and putative target molecules of miR-223 by informatics, quantitative PCR and Western blot, and found that insulin-like growth factor-1 receptor (IGF-1R was the functional target of miR-223 inhibition of cell proliferation. Targeting IGF-1R by miR-223 was not only seen in HeLa cells, but also in leukemia and hepatoma cells. The downstream pathway, Akt/mTOR/p70S6K, to which the signal was mediated by IGF-1R, was inhibited as well. The relative luciferase activity of the reporter containing wild-type 3'UTR(3'untranslated region of IGF-1R was significantly suppressed, but the mutant not. Silence of IGF-1R expression by vector-based short hairpin RNA resulted in the similar inhibition with miR-223. Contrarily, rescued IGF-1R expression in the cells that over-expressed miR-223, reversed the inhibition caused by miR-223 via introducing IGF-1R cDNA that didn't contain the 3'UTR. Meanwhile, we also noted that miR-223 targeted Rasa1, but the downstream molecules mediated by Rasa1 was neither targeted nor regulated. Therefore we believed that IGF-1R was the functional target for miR-223 suppression of cell proliferation and its downstream PI3K/Akt/mTOR/p70S6K pathway suppressed by miR-223 was by targeting IGF-1R.

  6. Determination of Ra-223 in human excretion samples by means of α-spectrometry

    To ensure the safety of occupationally exposed person for possible incorporation of 223Ra during the handling with Alpharadin / Xofigo registered, the determination of 223Ra activity in its excretion sample (e.g, in a stool sample) might be of great importance. To assess the 223Ra activity in human faeces samples a new analytical method was developed in our laboratory. The determination is performed by means of grid-ionization a-spectrometry. After a relatively simple sample preparation procedure (usually within max. 6 hours) and the addition of an internal standard, a direct determination of 223Ra with the grid ionization chamber (GIK) is possible. The method was optimized and successfully tested. The procedure-related LOD for 223Ra in a 24-hour faeces sample was 0.1 Bq/Probe.

  7. 48 CFR 952.223-71 - Integration of environment, safety, and health into work planning and execution.

    2010-10-01

    ... Provisions and Clauses 952.223-71 Integration of environment, safety, and health into work planning and... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Integration of environment, safety, and health into work planning and execution. 952.223-71 Section 952.223-71 Federal...

  8. Daily temperature and precipitation data for 223 USSR Stations

    Razuvaev, V.N.; Apasova, E.G.; Martuganov, R.A. [Research Institute of Hydrometeorological Information, Obninsk (Russian Federation); Vose, R.S. [Univ. of Tennessee, Knoxville, TN (United States); Steurer, P.M. [National Climatic Data Center, Asheville, NC (United States)

    1993-11-01

    On- May 23, 1972, the United States and the USSR established a bilateral initiative known as the Agreement on Protection of the Environment. Given recent interest in possible greenhouse gas-induced climate change, Working Group VIII (Influence of Environmental Changes on Climate) has become particularly useful to the scientific communities of both nations. Among its many achievements, Working Group VIII has been instrumental in the exchange of climatological information between the principal climate data centers of each country [i.e., the National Climatic Data Center (NCDC) in Asheville, North Carolina, and the Research Institute of Hydrometeorological Information in Obninsk, Russia]. Considering the relative lack of climate records previously available for the USSR, data obtained via this bilateral exchange are particularly valuable to researchers outside the former Soviet Union. To expedite the dissemination of these data, NOAA`s Climate and Global Change Program funded the Carbon Dioxide Information Analysis Center (CDIAC) and NCDC to distribute one of the more useful archives acquired through this exchange: a 223-station daily data set covering the period 1881-1989. This data set contains: (1) daily mean, minimum, and maximum temperature data; (2) daily precipitation data; (3) station inventory information (WMO No., name, coordinates, and elevation); (4) station history information (station relocation and rain gauge replacement dates); and (5) quality assurance information (i.e., flag codes that were assigned as a result of various data checks). The data set is available, free of charge, as a Numeric Data Package (NDP) from CDIAC. The NDP consists of 18 data files and a printed document which describes both the data files and the 223-station network in detail.

  9. Radium-223 behandling af knoglemetastaser ved kastrationsrefraktær prostatacancer

    Mortensen, Jann; Højgaard, Liselotte

    2014-01-01

    The alpha emitter Radium-223 ((22)3Ra-Cl2) is a bone-seeking radionuclide studied as a new treatment for patients with bone metastases from hormone refractory prostate cancer. More than 1,000 patients have been included in clinical phase I-III tests showing significant reduction in alkaline...... phosphatase- and PSA level and prolonged survival. Adverse events are usually mild to moderate and comprise gastrointestinal and myelotoxic symp-toms. Intravenously administered (22)3Ra-Cl2 (half-life 11.4 days) will likely be given every four weeks for six treatments to out-patients....

  10. First In Vivo Evaluation of Liposome-encapsulated 223Ra as a Potential Alpha-particle-emitting Cancer Therapeutic Agent

    Jonasdottir, Thora J.; Fisher, Darrell R.; Borrebaek, Jorgen; Bruland, Oyvind S.; Larsen, Roy H.

    2006-09-13

    Liposomes carrying chemotherapeutics have had some success in cancer treatment and may be suitable carriers for therapeutic radionuclides. This study was designed to evaluate the biodistribution of and to estimate the radiation doses from the alpha emitter 223Ra loaded into pegylated liposomes in selected tissues. 223Ra was encapsulated in pegylated liposomal doxorubicin by ionophore-mediated loading. The biodistribution of liposomal 223Ra was compared to free cationic 223Ra in Balb/C mice. We showed that liposomal 223 Ra circulated in the blood with an initial half-time in excess of 24 hours, which agreed well with that reported for liposomal doxorubicin in rodents, while the blood half-time of cationic 223Ra was considerably less than one hour. When liposomal 223 Ra was catabolized, the released 223Ra was either excreted or taken up in the skeleton. This skeletal uptake increased up to 14 days after treatment, but did not reach the level seen with free 223Ra. Pre-treatment with non-radioactive liposomal doxorubicin 4 days in advance lessened the liver uptake of liposomal 223 Ra. Dose estimates showed that the spleen, followed by bone surfaces, received the highest absorbed doses. Liposomal 223 Ra was relatively stable in vivo and may have potential for radionuclide therapy and combination therapy with chemotherapeutic agents.

  11. Dosing, administration, and safety of radium-223: How I do it.

    Dan, Tu D; Doyle, Laura; Raval, Amar J; Pridjian, Andrew; Gomella, Leonard G; Den, Robert B

    2016-06-01

    Radium-223 dichloride is a first-in-class bone-directed radiopharmaceutical that has been shown to prolong survival in men with metastatic castrate resistant prostate cancer (mCRPC). Unlike other radiopharmaceuticals, radium-223 uniquely uses alpha-emission to deliver high intensity, short range cytoxic treatments resulting in minimal myelosuppression. Following the results of the ALSYMPCA trial, radium-223 (Xofigo) was FDA approved in the United States in May 2013 and approved by Health Canada in December 2013 for the treatment of mCRPC with symptomatic bone metastases and no visceral disease. This 'How I do it' article describes the background of radium 223 as well as the methods and techniques that our institution uses for safe and effective administration and notes the subtle differences when administering the drug in Canada. PMID:27347625

  12. The Q223R polymorphism in LEPR is associated with obesity in Pacific Islanders.

    Furusawa, Takuro; Naka, Izumi; Yamauchi, Taro; Natsuhara, Kazumi; Kimura, Ryosuke; Nakazawa, Minato; Ishida, Takafumi; Inaoka, Tsukasa; Matsumura, Yasuhiro; Ataka, Yuji; Nishida, Nao; Tsuchiya, Naoyuki; Ohtsuka, Ryutaro; Ohashi, Jun

    2010-03-01

    Various Pacific Island populations have experienced a marked increase in the prevalence of obesity in past decades. This study examined the association of a promoter polymorphism of the leptin gene (LEP), G-2548A (rs7799039), and two non-synonymous single nucleotide polymorphisms of the leptin receptor gene (LEPR), K109R (rs1137100) and Q223R (rs1137101), with body weight, body mass index (BMI) and obesity (BMI > or = 30) in Pacific Islanders. A total of 745 Austronesian (AN)-speaking participants were analyzed after adjusting for age, gender, and population differences. The results revealed that carriers of the 223Q alleles of LEPR had significantly higher body weight (P = 0.0009) and BMI (P = 0.0022) than non-carriers (i.e., 223R homozygotes); furthermore, the 223Q carriers also had a signiWcantly higher risk of obesity in comparison to non-carriers (P = 0.0222). The other two polymorphisms, G-2548A and K109R, were associated with neither body weight, BMI, nor obesity. The 223Q allele was widely found among the AN-speaking study subjects, thus suggesting that the LEPR Q223R polymorphism is one of the factors contributing to the high prevalence of obesity in the Pacific Island populations. PMID:20183928

  13. 2-(2,3-Dihydro-1H-indol-3-yl)ethanol

    Frydenvang, Karla Andrea; Sommer, Michael Bech; Heckmann, Dieter;

    2004-01-01

    The first direct resolution of racemic 2-(2,3-dihydro-lH-indol-3-yl)ethanol-prepared by catalytic hydrogenation of 2-(lH-indol-3-yl)ethanol-has been accomplished by chiral simulated moving bed (SMB) chromatography. The single enantiomers were isolated as their dihydrogen phosphate salts. Single......-crystal X-ray analyses were successful, revealing that the (+)-enantiomer of 2-(2,3-dihydro-lH-indol-3-yl)ethanol has the (S) configuration. Chirality 16:126-130, 2004....

  14. 77 FR 52696 - Federal Acquisition Regulation; Information Collection; Drug-Free Workplace (FAR 52.223-6)

    2012-08-30

    ... clause 52.223-6, Drug-Free Workplace, requires (1) Contractor employees to notify their employer of any... Regulation; Information Collection; Drug-Free Workplace (FAR 52.223-6) AGENCY: Department of Defense (DOD... approved information collection requirement concerning drug- free workplace. Public comments...

  15. 78 FR 5445 - Federal Acquisition Regulation; Submission for OMB Review; Drug-Free Workplace (FAR 52.223-6)

    2013-01-25

    ... FAR clause 52.223-6, Drug-Free Workplace, requires (1) contractor employees to notify their employer... Regulation; Submission for OMB Review; Drug- Free Workplace (FAR 52.223-6) AGENCY: Department of Defense (DOD... approved information collection requirement concerning drug- free workplace. A notice was published in...

  16. 5 CFR 531.223 - Rates of basic pay that may not be used as the highest previous rate.

    2010-01-01

    .... 7701(b)(2)(A); (g) A special rate established under 5 U.S.C. 5305 and 5 CFR part 530, subpart C, or 38... rate otherwise contrary to applicable law or regulation; (i) A rate received as a member of the... as the highest previous rate. 531.223 Section 531.223 Administrative Personnel OFFICE OF...

  17. 12 CFR 223.52 - What transactions with affiliates or others must comply with section 23B's market terms requirement?

    2010-01-01

    ... must comply with section 23B's market terms requirement? 223.52 Section 223.52 Banks and Banking... transactions with affiliates or others must comply with section 23B's market terms requirement? (a) The market..., including an asset subject to an agreement to repurchase; (3) The payment of money or the furnishing of...

  18. 30 CFR 285.223 - What does MMS do if there is a tie for the highest bid?

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What does MMS do if there is a tie for the highest bid? 285.223 Section 285.223 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE... is a tie for the highest bid? (a) Unless otherwise specified in the Final Sale Notice, except in...

  19. Determination of photon emission probabilities for the main gamma-rays of 223Ra in equilibrium with its progeny

    The currently published 223Ra gamma-ray emission probabilities display a wide variation in the values depending on the source of the data. The National Institute of Standards and Technology performed activity measurements on a 223Ra solution that was used to prepare several sources that were used to determine the photon emission probabilities for the main gamma-rays of 223Ra in equilibrium with its progeny. Several high purity germanium (HPGe) detectors were used to perform the gamma-ray spectrometry measurements. - Highlights: • Measurements of photon emission probabilities of 223Ra in equilibrium with its progeny. • Use of high purity germanium detectors for gamma-ray spectrometry measurements. • Use of the primary activity determination of 223Ra sources

  20. MicroRNA223 promotes pathogenic T-cell development and autoimmune inflammation in central nervous system in mice.

    Satoorian, Tiffany; Li, Bo; Tang, Xiaolei; Xiao, Jidong; Xing, Weirong; Shi, Weixing; Lau, Kin-Hing William; Baylink, David J; Qin, Xuezhong

    2016-08-01

    Multiple sclerosis (MS) is an incurable central nervous system autoimmune disease. Understanding MS pathogenesis is essential for the development of new MS therapies. In the present study, we identified a novel microRNA (miR) that regulates experimental autoimmune encephalomyelitis (EAE), an animal model of MS. Expression of miR223 was up-regulated specifically in spinal cords and lymphoid organs but not in other examined tissues. A global miR223 knockout (miR223(-/-) ) in mice led to a significant delay in EAE onset, reduction in spinal cord lesion, and lessening of neurological symptoms. These protective effects could be reproduced in bone marrow chimeras reconstituted with miR223(-/-) haematopoietic stem cells. We also found that miR223 deficiency reduced T helper type 1 (Th1) and Th17 infiltration into spinal cords. To address underlying mechanisms, we investigated the role of miR223 in regulating the function, development and interaction of the major immune cells. Expression of the genes associated with dendritic cell (DC) activation (CD86 and MHC II) and Th1 and Th17 differentiation [interleukin-12 (IL-12) and IL-23, respectively] was significantly decreased in the spleens of miR223(-/-) mice bearing EAE. The miR223(-/-) DCs expressed significantly lower levels of basal and lipopolysaccharide-induced IL-12 and IL-23 compared with the wild-type DCs. These data are consistent with the observed lower efficiency of miR223(-/-) DCs to support Th1 and Th17 differentiation from naive T cells over-expressing an EAE antigen-specific T-cell receptor. Our data suggest that miR223 promotes EAE, probably through enhancing DC activation and subsequently the differentiation of naive T cells toward Th1 and Th17 effector cells. PMID:27083389

  1. A single VLSI chip for computing syndromes in the (225, 223) Reed-Solomon decoder

    Hsu, I. S.; Truong, T. K.; Shao, H. M.; Deutsch, L. J.

    1986-11-01

    A description of a single VLSI chip for computing syndromes in the (255, 223) Reed-Solomon decoder is presented. The architecture that leads to this single VLSI chip design makes use of the dual basis multiplication algorithm. The same architecture can be applied to design VLSI chips to compute various kinds of number theoretic transforms.

  2. INFLUENCE OF SODIUM METABISULPHITE (E 223) ON MITOTIC DIVISION IN CALENDULA OFFICINALIS L.s

    Romeo-Cristian Marc; Gabriela Capraru

    2008-01-01

    This paper presents the cytogenetic effects induced by sodium metabisulphite (E 223) (a food additive used as preservative) in meristematic cells of Calendula officinalis L. root tips. The treatment has determined the lessening of the mitotic index (comparative with the control variant), until mitotic division total inhibition, as well as a growth frequency of division aberration in anaphase and telophase.

  3. 48 CFR 52.223-18 - Contractor Policy to Ban Text Messaging While Driving.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Contractor Policy to Ban... Text of Provisions and Clauses 52.223-18 Contractor Policy to Ban Text Messaging While Driving. As prescribed in 23.1105, insert the following clause: CONTRACTOR POLICY TO BAN TEXT MESSAGING WHILE...

  4. Yeast Interacting Proteins Database: YBR223C, YDR510W [Yeast Interacting Proteins Database

    Full Text Available YBR223C TDP1 Tyrosyl-DNA Phosphodiesterase I, hydrolyzes 3' and 5'-phosphotyrosyl bonds, involve ... iated proteolysis, DNA replication and septin ring dynamics ; phosphorylated at Ser2 Rows with this prey as pre ... iated proteolysis, DNA replication and septin ring dynamics ; phosphorylated at Ser2 Rows with this prey as pre ...

  5. 12 CFR 223.21 - What valuation and timing principles apply to credit transactions?

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false What valuation and timing principles apply to...) Valuation and Timing Principles Under Section 23A § 223.21 What valuation and timing principles apply to credit transactions? (a) Valuation—(1) Initial valuation. Except as provided in paragraph (a)(2) or...

  6. 12 CFR 223.22 - What valuation and timing principles apply to asset purchases?

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false What valuation and timing principles apply to...) Valuation and Timing Principles Under Section 23A § 223.22 What valuation and timing principles apply to asset purchases? (a) Valuation—(1) In general. Except as provided in paragraph (a)(2) of this section,...

  7. 48 CFR 952.223-72 - Radiation protection and nuclear criticality.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Radiation protection and....223-72 Radiation protection and nuclear criticality. As prescribed in 923.7003 the clause set forth... (including agreements with states under section 274 of the Atomic Energy Act): Radiation Protection...

  8. Fine structures in 14C emission of 223Ra and 224Ra

    The measurement of the energy spectrum of 14C nuclei emitted in the spontaneous radioactivity from 223Ra and 224Ra has been carried out, using thin and intense sources (480 MBq for 223Ra and 3550 MBq for 224Ra). The sources were obtained by implanting mass-separated beams from ISOLDE (CERN) into Al and vitreous C catchers. The measurement was performed with the supraconducting solenoidal spectrometer SOLENO installed at Orsay. The discovery, of a fine structure in the energy spectrum of 14C emission from 223Ra, which is analogous to the one known for α emission, is confirmed. Only 13% of the branching ratio in 14C decay leads to the ground state of the residual nucleus, while 8l% to the first excited state. For 14C emission of 224Ra, a lower limit of 2 for the hindrance factor has been measured for the transition to the first excited state in the residual nucleus. Also, a precise identification in Z with a E·ΔE telescope has been performed for the radiation from the 223Ra source. (author) 22 refs., 11 figs., 1 tab

  9. Fine structure in 14C emission from 223Ra and 224Ra

    The measurement of the energy spectrum of 14C nuclei emitted in the spontaneous radioactivity of 223Ra and 224Ra has been carried out, using thin and intense sources (480 MBq for 223Ra and 3550 MBq for 224Ra). The sources were obtained by implanting mass-separated beams into Al and vitreous C catchers. The measurement was performed with a superconducting solenoidal spectrometer. Our discovery, previously reported, of fine structure in the energy spectrum of 14C emission from 223Ra, which is analogous to the one known for α emission, is confirmed. Only 13% of the branching ratio in 14C decay leads to the ground state of the residual nucleus, while 81% to the first excited state. For 14C emission from 224Ra, a lower limit of 2 for the hindrance factor has been measured for the transition to the first excited state in the residual nucleus. Also, a precise identification in Z with an ExΔE telescope has been performed for the radiation from the 223Ra source. Our measurements of fine structure in 14C emissions open this field to nuclear structure studies

  10. 48 CFR 52.223-15 - Energy Efficiency in Energy-Consuming Products.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Energy Efficiency in... Provisions and Clauses 52.223-15 Energy Efficiency in Energy-Consuming Products. As prescribed in 23.206, insert the following clause: Energy Efficiency in Energy-Consuming Products (DEC 2007) (a) Definition....

  11. 36 CFR 223.193 - Procedures for reporting acquisition and disposition of unprocessed Federal timber.

    2010-07-01

    ... Regulations at 13 CFR part 121; and (ix) A certificate stating that the certifier has read and understands the... Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE SALE AND DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER The Forest Resources Conservation and Shortage Relief Act of 1990 Program § 223.193 Procedures for...

  12. 12 CFR 223.54 - What advertisements and statements are prohibited by section 23B?

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false What advertisements and statements are... (REGULATION W) General Provisions of Section 23B § 223.54 What advertisements and statements are prohibited by section 23B? (a) In general. A member bank and its affiliates may not publish any advertisement or...

  13. 48 CFR 52.223-12 - Refrigeration Equipment and Air Conditioners.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Refrigeration Equipment... Provisions and Clauses 52.223-12 Refrigeration Equipment and Air Conditioners. As prescribed in 23.804(b), insert the following clause: Refrigeration Equipment and Air Conditioners (MAY 1995) The Contractor...

  14. 48 CFR 3052.223-90 - Accident and fire reporting (USCG).

    2010-10-01

    ... PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 3052.223-90 Accident and fire reporting (USCG). As prescribed in USCG guidance at (HSAR) 48 CFR 3023.9000(a), insert the following clause: Accident... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Accident and...

  15. Treatment of Metastatic Bone Disease and the Emerging Role of Radium-223.

    Coleman, Robert

    2016-03-01

    Bone metastases are common in advanced malignancy and, despite the developments in both anticancer and bone-targeted therapies in recent years, new therapeutic strategies are still needed. Traditionally, radioisotopes have been rarely used in part owing to concerns about bone marrow toxicity that limits retreatment and may prevent safe administration of subsequent chemotherapy. Radium-223 dichloride (Ra-223) is a calcium mimetic that binds preferentially to newly formed bone in areas of bone metastases, is the first alpha-emitting radionuclide to be developed for clinical use, and is approved for treatment of castration-resistant prostate cancer and symptomatic bone metastases. In this setting, it improves overall survival and delays symptomatic skeletal complications. The high linear energy transfer of the emitted alpha particles causes predominantly nonrepairable double-stranded deoxyribonucleic acid breaks in tumor cells, and the large size of the alpha particle, compared with other forms of radiation, results in a short path length and highly localized tissue destruction. As a result, Ra-223 has a highly favorable safety profile with a low level of myelosuppression. The role of Ra-223 in malignancy is discussed and the prospects for future development outlined. PMID:26897713

  16. 39 CFR 223.2 - Channels of communication, headquarters with area offices.

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Channels of communication, headquarters with area... RELATIONSHIPS AND COMMUNICATION CHANNELS § 223.2 Channels of communication, headquarters with area offices. (a) General. Headquarters organizational units formulate the directives to provide guidance to area...

  17. X-ray crystal structure of divalent metal-activated ß-xyloisdase, RS223BX

    We report the first X-ray structure of a glycoside hydrolase family 43 ß-xylosidase, RS223BX, which is strongly activated by the addition of divalent metal cations. The 2.69 Å structure reveals that the Ca2+ cation is located at the back of the active site pocket. The Ca2+ coordinates to H274 to sta...

  18. Dosimetry of 223Ra-chloride: dose to normal organs and tissues

    223Ra-Chloride (also called Alpharadin registered) targets bone metastases with short range alpha particles. In recent years several clinical trials have been carried out showing, in particular, the safety and efficacy of palliation of painful bone metastases in patients with castration-resistant prostate cancer using 223Ra-chloride. The purpose of this work was to provide a comprehensive dosimetric calculation of organ doses after intravenous administration of 223Ra-chloride according to the present International Commission on Radiological Protection (ICRP) model for radium. Absorbed doses were calculated for 25 organs or tissues. Bone endosteum and red bone marrow show the highest dose coefficients followed by liver, colon and intestines. After a treatment schedule of six intravenous injections with 0.05 MBq/kg of 223Ra-chloride each, corresponding to 21 MBq for a 70 kg patient, the absorbed alpha dose to the bone endosteal cells is about 16 Gy and the corresponding absorbed dose to the red bone marrow is approximately 1.5 Gy. The comprehensive list of dose coefficients presented in this work will assist in comparing and evaluating organ doses from various therapy modalities used in nuclear medicine and will provide a base for further development of patient-specific dosimetry. (orig.)

  19. 12 CFR 223.33 - What rules apply to derivative transactions?

    2010-01-01

    ... Requirements Under Section 23A § 223.33 What rules apply to derivative transactions? (a) Market terms requirement. Derivative transactions between a member bank and its affiliates (other than depository... 12 Banks and Banking 3 2010-01-01 2010-01-01 false What rules apply to derivative...

  20. 27 CFR 25.223 - Destruction of beer off brewery premises.

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Destruction of beer off... TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS BEER Voluntary Destruction § 25.223 Destruction of beer off brewery premises. (a) Destruction without supervision. A brewer may destroy beer...

  1. 42 CFR 435.223 - Individuals who would be eligible for AFDC if coverage under the State's AFDC plan were as broad...

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Individuals who would be eligible for AFDC if coverage under the State's AFDC plan were as broad as allowed under title IV-A. 435.223 Section 435.223... and Children § 435.223 Individuals who would be eligible for AFDC if coverage under the State's...

  2. Radiation exposure of relatives of patients treated with Ra-223 dichloride

    Since November 2013, a radiopharmaceutical containing Ra-223 dichloride as active substance is approved in the European Union for patients with castration resistant prostate cancer with symptomatic bone metastases and no known visceral metastases. Ra-223 (T1/2 = 11.43 d) decays via a chain of 4 alpha and 2 beta decays. This therapy is presently the only application of an alpha emitter in clinical routine therapy. To show that the exposure of relatives and caregivers of patients treated with Ra-223 dichloride in an outpatient setting does not exceed a value of 1 mSv, the multicenter study ''RAPSODY'' was conducted. As Ra-223 and most of its progeny emit alpha particles, the internal exposure had to be evaluated in particular. Within this study, measurements of the radiation emitted from the patient were performed using standard dose-rate meters. Wipe-tests were taken in the patients' homes to identify significant contaminations and evaluated by liquid scintillation counting. Samples of saliva and sweat were taken and measured using gamma spectrometry. Ra-223 disintegrates to the noble gas Rn-219 and was measured in the exhaled breath from the patients using conventional Radon Monitors. Furthermore, a computational fluid dynamics simulation (CFD) was performed to assess the radioactivity in the air, which could be inhaled by persons close to the patient. Conclusions: The potential exposure of relatives and caregivers by external irradiation and incorporation of radioactivity exhaled or excreted by the patient with saliva or sweat is well below 1 mSv. No objections are seen regarding outpatient treatment. This paper summarizes contents of a poster presented at the Annual Meeting of the Society of Nuclear Medicine and Molecular Imaging.

  3. MicroRNA-223 Regulates the Differentiation and Function of Intestinal Dendritic Cells and Macrophages by Targeting C/EBPβ

    Haibo Zhou

    2015-11-01

    Full Text Available Dendritic cells (DCs and macrophages play important roles in maintaining intestinal homeostasis. However, the molecular mechanisms that regulate the differentiation and responses of intestinal DCs and macrophages remain poorly understood. Here, we have identified microRNA miR-223 as a key molecule for regulating these processes. Deficiency of miR-223 led to a significantly decreased number of intestinal CX3CR1hi macrophages at steady state. Both intestinal CX3CR1hi macrophages and CD103+ conventional DCs (cDCs in miR-223-deficient mice exhibited a strong pro-inflammatory phenotype. Moreover, miR-223-deficient monocytes gave rise to more monocyte-derived DCs (moDCs and produced more pro-inflammatory cytokines upon stimulation. Using a mouse model of colitis, we demonstrated that the miR-223 deficiency resulted in more severe colitis. Target gene analysis further identified that the effects of miR-223 on DCs and macrophages were mediated by directly targeting C/EBPβ. Taken together, our study identifies a role for miR-223 as a critical regulator of intestinal homeostasis.

  4. Estimation of dose rate of a package ({sup 223+}Ra) and evaluation of transport index; Dosisleistungsabschaetzung bei einem Versandstueck ({sup 223+}Ra) und Ermittlung der Transportkennzahl nach ADR

    Bittner, Michael [TUEV SUED Industrie Services GmbH, Region Nordost, Leipzig (Germany). Anlagensicherheit/Strahlenschutz; Richter, Jens [TUEV SUED Industrie Services GmbH, Region Nordost, Dresden (Germany). Anlagensicherheit/Strahlenschutz

    2016-08-01

    The transport index of a package is to be determined according to provisions of the ADR. It is directly related to the maximum radiation level in mSv/h at a distance of 1 m from the external surface of the package or pallet. To evaluate the existing distribution of the dose equivalent outside the package or pallet calculations of photon dose rates are required. For Monte-Carlo simulations with MCNP5 a three-dimensional model of a package containing Xofigo trademark was created, which contains all relevant sources from {sup 223}Ra and its decay chain.

  5. Therapy palliative with {sup 2}23Ra without special radiation protection measures?; Palliative Therapie mit {sup 223}Ra ohne besondere Strahlenschutzmassnahmen?

    Just, Guenther [Forschungsbuero Radonbalneologie (FRB), Grosspoesna (Germany); Petzold, Juergen

    2015-07-01

    For nearly 2 years now as a therapy of the castration resistant prostata carcinoma a nuclide therapy with {sup 223}Ra-Dichloride (trade-mark Xofigo) is applied. Xofigo is applied by a medical specialist for nuclear medicine altogether 6 times in a monthly distance. The activity used in each case is according to the body weight (50 kBq/kg BW). This therapy is licensed by the supervisory authorities of the German federal countries as an ambulant therapy. Special radiation protection measures are only required when exceeding a given number of 17 patients per year as incorparation measurements.

  6. Factors affecting {sup 223}Ra therapy: clinical experience after 532 cycles from a single institution

    Etchebehere, Elba C. [The University of Texas MD Anderson Cancer Center, Department of Nuclear Medicine, Houston, TX (United States); Campinas State University (Unicamp), Department of Nuclear Medicine, Campinas (Brazil); Milton, Denai R. [The University of Texas MD Anderson Cancer Center, Department of Biostatistics, Houston, TX (United States); Araujo, John C. [The University of Texas MD Anderson Cancer Center, Department of Genitourinary Medical Oncology, Houston, TX (United States); Swanston, Nancy M.; Macapinlac, Homer A.; Rohren, Eric M. [The University of Texas MD Anderson Cancer Center, Department of Nuclear Medicine, Houston, TX (United States)

    2016-01-15

    The aim of this study was to identify baseline features that predict outcome in {sup 223}Ra therapy. We retrospectively reviewed 110 patients with metastatic castration-resistant prostate cancer treated with {sup 223}Ra. End points were overall survival (OS), progression-free survival (PFS), bone event-free survival (BeFS), and bone marrow failure (BMF). The following parameters were evaluated prior to the first {sup 223}Ra cycle: serum levels of hemoglobin (Hb), prostate-specific antigen (PSA), alkaline phosphatase (ALP), Eastern Cooperative Oncology Group (ECOG) status, pain score, use of chemotherapy, and external beam radiation therapy (EBRT). During/after {sup 223}Ra we evaluated: the total number of radium cycles (Ra{sub Tot}), the PSA doubling time (PSA{sub DT}), and the use of chemotherapy, EBRT, abiraterone, and enzalutamide. A significant reduction of ALP (p < 0.001) and pain score (p = 0.041) occurred throughout the {sup 223} Ra cycles. The risk of progression was associated with declining ECOG status [hazard ratio (HR) = 3.79; p < 0.001] and decrease in PSA{sub DT} (HR = 8.22; p < 0.001). Ra{sub Tot}, ALP, initial ECOG status, initial pain score, and use of abiraterone were associated with OS (p ≤ 0.008), PFS (p ≤ 0.003), and BeFS (p ≤ 0.020). Ra{sub Tot}, ALP, initial ECOG status, and initial pain score were significantly associated with BMF (p ≤ 0.001) as well as Hb (p < 0.001) and EBRT (p = 0.009). On multivariable analysis, only Ra{sub Tot} and abiraterone remained significantly associated with OS (p < 0.001; p = 0.033, respectively), PFS (p < 0.001; p = 0.041, respectively), and BeFS (p < 0.001; p = 0.019, respectively). Additionally, Ra{sub Tot} (p = 0.027) and EBRT (p = 0.013) remained significantly associated with BMF. Concomitant use of abiraterone and {sup 223}Ra seems to have a beneficial effect, while the EBRT may increase the risk of BMF. (orig.)

  7. Factors affecting 223Ra therapy: clinical experience after 532 cycles from a single institution

    The aim of this study was to identify baseline features that predict outcome in 223Ra therapy. We retrospectively reviewed 110 patients with metastatic castration-resistant prostate cancer treated with 223Ra. End points were overall survival (OS), progression-free survival (PFS), bone event-free survival (BeFS), and bone marrow failure (BMF). The following parameters were evaluated prior to the first 223Ra cycle: serum levels of hemoglobin (Hb), prostate-specific antigen (PSA), alkaline phosphatase (ALP), Eastern Cooperative Oncology Group (ECOG) status, pain score, use of chemotherapy, and external beam radiation therapy (EBRT). During/after 223Ra we evaluated: the total number of radium cycles (RaTot), the PSA doubling time (PSADT), and the use of chemotherapy, EBRT, abiraterone, and enzalutamide. A significant reduction of ALP (p < 0.001) and pain score (p = 0.041) occurred throughout the 223 Ra cycles. The risk of progression was associated with declining ECOG status [hazard ratio (HR) = 3.79; p < 0.001] and decrease in PSADT (HR = 8.22; p < 0.001). RaTot, ALP, initial ECOG status, initial pain score, and use of abiraterone were associated with OS (p ≤ 0.008), PFS (p ≤ 0.003), and BeFS (p ≤ 0.020). RaTot, ALP, initial ECOG status, and initial pain score were significantly associated with BMF (p ≤ 0.001) as well as Hb (p < 0.001) and EBRT (p = 0.009). On multivariable analysis, only RaTot and abiraterone remained significantly associated with OS (p < 0.001; p = 0.033, respectively), PFS (p < 0.001; p = 0.041, respectively), and BeFS (p < 0.001; p = 0.019, respectively). Additionally, RaTot (p = 0.027) and EBRT (p = 0.013) remained significantly associated with BMF. Concomitant use of abiraterone and 223Ra seems to have a beneficial effect, while the EBRT may increase the risk of BMF. (orig.)

  8. Precise Study of Fine Structure in $^{14}$C Emission from $^{223}$Ra

    2002-01-01

    We request 10 shifts in two sessions of beam time at ISOLDE for the production of a $^{223}$Ra source. This source will be used with the superconducting spectrometer SOLENO at Orsay for a precise measurement (good statistics and energy resolution) of the fine stucture in the energy spectrum of $^{14}$C nuclei emitted by $^{223}$Ra, discovered at Orsay in July 1989. The measurement will be devoted to carry out the hindrance factors of the transitions to 15$\\!^-\\!$/2$\\,$ (1.423 MeV) and 5$\\!^+\\!$/2$\\,$ (1.567 MeV) excited states of $^{209}$Pb, which present a particular interest for obtaining spectroscopic information and testing nuclear models.

  9. Swift observations of black hole candidate XTE J1752-223 during outburst

    Curran, P. A.; Casella, P.; Maccarone, T.J.; Evans, P. A.; Landsman, W.; Krimm, H. A.; Brocksopp, C.; Still, M.

    2011-01-01

    Here we summarise the Swift broadband observations of the recently discovered X-ray transient and black hole candidate, XTE J1752-223,obtained over the period of outburst from October 2009 to June 2010. We offer a phenomenological treatment of the spectra as an indication of the canonical spectral state of the source during different periods of the outburst. We find that the high energy hardness-intensity diagrams over two separate bands follows the canonical behavior, confirming the spectral...

  10. Potential role of miR-9 and miR-223 in recurrent ovarian cancer

    McGuinness Eamonn

    2008-04-01

    Full Text Available Abstract Background MicroRNAs (miRNAs are small, noncoding RNAs that negatively regulate gene expression by binding to target mRNAs. miRNAs have not been comprehensively studied in recurrent ovarian cancer, yet an incurable disease. Results Using real-time RT-PCR, we obtained distinct miRNA expression profiles between primary and recurrent serous papillary ovarian adenocarcinomas (n = 6 in a subset of samples previously used in a transcriptome approach. Expression levels of top dysregulated miRNA genes, miR-223 and miR-9, were examined using TaqMan PCR in independent cohorts of fresh frozen (n = 18 and FFPE serous ovarian tumours (n = 22. Concordance was observed on TaqMan analysis for miR-223 and miR-9 between the training cohort and the independent test cohorts. Target prediction analysis for the above miRNA "recurrent metastatic signature" identified genes previously validated in our transcriptome study. Common biological pathways well characterised in ovarian cancer were shared by miR-9 and miR-223 lists of predicted target genes. We provide strong evidence that miR-9 acts as a putative tumour suppressor gene in recurrent ovarian cancer. Components of the miRNA processing machinery, such as Dicer and Drosha are not responsible for miRNA deregulation in recurrent ovarian cancer, as deluded by TaqMan and immunohistochemistry. Conclusion We propose a miRNA model for the molecular pathogenesis of recurrent ovarian cancer. Some of the differentially deregulated miRNAs identified correlate with our previous transcriptome findings. Based on integrated transcriptome and miRNA analysis, miR-9 and miR-223 can be of potential importance as biomarkers in recurrent ovarian cancer.

  11. Kinetics of leptin binding to the Q223R leptin receptor.

    Hans Verkerke

    Full Text Available Studies in human populations and mouse models of disease have linked the common leptin receptor Q223R mutation to obesity, multiple forms of cancer, adverse drug reactions, and susceptibility to enteric and respiratory infections. Contradictory results cast doubt on the phenotypic consequences of this variant. We set out to determine whether the Q223R substitution affects leptin binding kinetics using surface plasmon resonance (SPR, a technique that allows sensitive real-time monitoring of protein-protein interactions. We measured the binding and dissociation rate constants for leptin to the extracellular domain of WT and Q223R murine leptin receptors expressed as Fc-fusion proteins and found that the mutant receptor does not significantly differ in kinetics of leptin binding from the WT leptin receptor. (WT: ka 1.76×106±0.193×106 M-1 s-1, kd 1.21×10-4±0.707×10-4 s-1, KD 6.47×10-11±3.30×10-11 M; Q223R: ka 1.75×106±0.0245×106 M-1 s-1, kd 1.47×10-4±0.0505×10-4 s-1, KD 8.43×10-11±0.407×10-11 M. Our results support earlier findings that differences in affinity and kinetics of leptin binding are unlikely to explain mechanistically the phenotypes that have been linked to this common genetic variant. Future studies will seek to elucidate the mechanism by which this mutation influences susceptibility to metabolic, infectious, and malignant pathologies.

  12. XTE J1752-223: Optical spectroscopy and infrared counterpart detection

    Torres, M. A. P.; Steeghs, D.; Jonker, P. G.; Thompson, I.; Soderberg, A. M.

    2009-10-01

    Prompted by the discovery of its bright optical counterpart and the announcement of increased X-ray activity (ATels #2258, #2259, #2261, #2265, #2263), we have acquired additional observations of XTE J1752-223 at optical and near-infrared wavelengths. OPTICAL SPECTROSCOPY: An optical spectrum covering 3330-9165 Angstrom was obtained with the MIKE echelle spectrograph on the Magellan Clay telescope starting on 2009 Oct 26 UT 23:52.

  13. Kepler-223: A Resonant Chain of Four Transiting, Sub-Neptune Planets

    Mills, Sean; Fabrycky, Daniel C.; Migaszewski, Cezary; Ford, Eric B.; Petigura, Erik; Isaacson, Howard T.

    2016-05-01

    Surveys have revealed an abundance of multi-planet systems containing super-Earths and Neptunes in few-day to few-month orbits. Orbital periods of pairs of planets in the same system occasionally lie near, but generally not exactly on, ratios of small integers (resonances), allowing for the detection of the planets perturbing each other. There is debate whether in situ assembly or significant inward migration is the dominant mechanism of their formation. Simulations suggest migration creates tightly-packed, resonant systems, often in chains of resonance. Of the hundreds of multi-planet systems of sub-Neptunes, there is weak statistical enhancement near resonances, but no individual system has been identified that requires migration. Here we describe dynamical modeling of the system Kepler-223, which has a series of resonances among its four planets. We observe transit timing variations (TTVs), model them as resonant angle librations, and compute long-term stability, combining these analyses to constrain dynamical parameters and planetary masses. The detailed architecture of Kepler-223 is too finely tuned for formation by scattering, whereas numerical simulations demonstrate its properties are natural outcomes of the migration hypothesis. Similar systems could be destabilized by many mechanisms contributing to the observed period distribution. Planetesimal interactions in particular are thought to be responsible for establishing thecurrent orbits of the four giant planets in our own Solar System by disrupting a theoretical initial resonant chain like that actually observed in Kepler-223.

  14. MicroRNA-223 and miR-143 are important systemic biomarkers for disease activity in psoriasis

    Løvendorf, Marianne B; Zibert, John R; Gyldenløve, Mette; Røpke, Mads A; Skov, Lone

    2014-01-01

    including miR-223 and miR-143 which were found to be significantly upregulated in the PBMCs from patients with psoriasis compared with healthy controls (FCH=1.63, P<0.01; FCH=2.18, P<0.01, respectively). In addition, miR-223 and miR-143 significantly correlated with the PASIscore (r=0.46, P<0.05; r=0.55, P......<0.02, respectively). Receiver-operating characteristic analysis (ROC) showed that miR-223 and -143 have the potential to distinguish between psoriasis and healthy controls (miR-223: area under the curve (AUC)=0.80, miR-143: AUC=0.75). Interestingly, after 3-5 weeks of treatment with methotrexate...... following a significant decrease in psoriasis severity, miR-223 and miR-143 were significantly downregulated in the PBMCs from patients with psoriasis. CONCLUSION: We suggest that changes in the miR-223 and miR-143 expressions in PBMCs from patients with psoriasis may serve as novel biomarkers for disease...

  15. MicroRNA-223 Attenuates Hypoxia-induced Vascular Remodeling by Targeting RhoB/MLC2 in Pulmonary Arterial Smooth Muscle Cells

    Zeng, Yan; Zhang, Xiaoying; Kang, Kang; Chen, Jidong; Wu, Zhiqin; Huang, Jinyong; Lu, Wenju; Chen, Yuqin; Zhang, Jie; Wang, Zhiwei; Zhai, Yujia; Qu, Junle; Ramchandran, Ramaswamy; Raj, J. Usha; Wang, Jian; Gou, Deming

    2016-01-01

    There is growing evidence that microRNAs are implicated in pulmonary arterial hypertension (PAH), but underlying mechanisms remain elusive. Here, we identified that miR-223 was significantly downregulated in chronically hypoxic mouse and rat lungs, as well as in pulmonary artery and pulmonary artery smooth muscle cells (PASMC) exposed to hypoxia. Knockdown of miR-223 increased PASMC proliferation. In contrast, miR-223 overexpression abrogated cell proliferation, migration and stress fiber formation. Administering miR-223 agomir in vivo antagonized hypoxia-induced increase in pulmonary artery pressure and distal arteriole muscularization. RhoB, which was increased by hypoxia, was identified as one of the targets of miR-223. Overexpressed miR-223 suppressed RhoB and inhibited the consequent phosphorylation of myosin phosphatase target subunit (MYPT1) and the expression of myosin light chain of myosin II (MLC2), which was identified as another target of miR-223. Furthermore, serum miR-223 levels were decreased in female patients with PAH associated with congenital heart disease. Our study provides the first evidence that miR-223 can regulate PASMC proliferation, migration, and actomyosin reorganization through its novel targets, RhoB and MLC2, resulting in vascular remodeling and the development of PAH. It also highlights miR-223 as a potential circulating biomarker and a small molecule drug for diagnosis and treatment of PAH. PMID:27121304

  16. MicroRNA-223 Induced Repolarization of Peritoneal Macrophages Using CD44 Targeting Hyaluronic Acid Nanoparticles for Anti-Inflammatory Effects

    Tran, Thanh-Huyen; Krishnan, Swathi; Amiji, Mansoor M.

    2016-01-01

    The aim of this study was to evaluate macrophages repolarization from pro-inflammatory M1 to anti-inflammatory M2 phenotype upon transfection with microRNA-223 (miR-223) duplexes and miR-223 expressing plasmid DNA encapsulated in CD44-targeting hyaluronic acid-poly(ethyleneimine) (HA-PEI) nanoparticles (NPs). The HA-PEI/miR-223 NPs with spherical shape and an average diameter of 200 nm were efficiently internalized by J774A.1 alveolar and primary peritoneal macrophages and non-cytotoxic at HA-PEI concentration less than 200 μg/mL. Transfection of HA-PEI/miR-223 NPs in J774A.1 macrophages showed significantly higher miR-223 expression than that with HA-PEI/plasmid DNA expressing miR-223 (pDNA-miR-223). HA-PEI/miR-223 NPs mediated transfection increased miR-223 expression to 90 fold in primary peritoneal macrophages compared to untreated cells. The overexpression of miR-223 in both J774A.1 and peritoneal macrophages induced a phenotypic change from M1 to M2 state as indicated by a decrease in iNOS-2 (M1 marker) and an increase in Arg-1 (M2 marker) levels compared to those in lipopolysaccharide (LPS) and interferon-gamma (IFN-γ)-stimulated macrophages (M1). The change in macrophage phenotype by HA-PEI/miR-223 NPs could suppress the inflammation in peritoneal macrophages induced by LPS as evidenced by a significant decrease in pro-inflammatory cytokine levels TNF-α, IL-1β and IL-6, compared to LPS-stimulated peritoneal macrophages without treatment. The results demonstrated that miR-223-encapsulated HA-PEI NPs modulated macrophage polarity toward an anti-inflammatory M2 phenotype, which has potential for the treatment of inflammatory diseases. PMID:27148749

  17. Dosimetry of bone metastases in targeted radionuclide therapy with alpha-emitting 223Ra-dichloride

    Ra-dichloride is an alpha-emitting radiopharmaceutical used in the treatment of bone metastases from castration-resistant prostate cancer. Image-based dosimetric studies remain challenging because the emitted photons are few. The aim of this study was to implement a methodology for in-vivo quantitative planar imaging, and to assess the absorbed dose to lesions using the MIRD approach. The study included nine Caucasian patients with 24 lesions (6 humeral head lesions, 4 iliac wing lesions, 2 scapular lesions, 5 trochanter lesions, 3 vertebral lesions, 3 glenoid lesions, 1 coxofemoral lesion). The treatment consisted of six injections (one every 4 weeks) of 50 kBq per kg body weight. Gamma-camera calibrations for 223Ra included measurements of sensitivity and transmission curves. Patients were statically imaged for 30 min, using an MEGP collimator, double-peak acquisition, and filtering to improve the image quality. Lesions were delineated on 99mTc-MDP whole-body images, and the ROIs superimposed on the 223Ra images after image coregistration. The activity was quantified with background, attenuation, and scatter correction. Absorbed doses were assessed deriving the S values from the S factors for soft-tissue spheres of OLINDA/EXM, evaluating the lesion volumes by delineation on the CT images. In 12 lesions with a wash-in phase the biokinetics were assumed to be biexponential, and to be monoexponential in the remainder. The optimal timing for serial acquisitions was between 1 and 5 h, between 18 and 24 h, between 48 and 60 h, and between 7 and 15 days. The error in cumulated activity neglecting the wash-in phase was between 2 % and 12 %. The mean effective half-life (T1/2eff) of 223Ra was 8.2 days (range 5.5-11.4 days). The absorbed dose (D) after the first injection was 0.7 Gy (range 0.2-1.9 Gy). Considering the relative biological effectiveness (RBE) of alpha particles (RBE = 5), DRBE = 899 mGy/MBq (range 340-2,450 mGy/MBq). The percent uptake of 99mTc and 223Ra

  18. Effects of miR-223 on expression of IL-1β and IL-6 in human gingival fibroblasts.

    Matsui, Sari; Ogata, Yorimasa

    2016-01-01

    MicroRNAs (miRNAs) are small non-coding RNAs that regulate post-transcriptional expression by translational inhibition or mRNA degradation. miRNAs bind to target mRNAs through partial complementarity, and can regulate many genes. In the present study, we investigated the effects of miR-223 on the expression of inflammatory cytokines in human gingival fibroblasts (HGF). To determine the effects of miR-223 on the expressions of interleukin-1β (IL-1β) and IL-6, HGF were stimulated by IL-1β (1 ng/mL) or tumor necrosis factor-α (TNF-α; 10 ng/mL) and transfected with a miR-223 expression plasmid. Levels of mRNA for IL-1β, IL-6, inhibitor of kappa-B kinase α (IKKα) and mitogen-activated protein kinase phosphatase-5 (MKP-5) were measured by real-time PCR, and levels IL-1β, IL-6 and IKKα protein were determined by enzyme-linked immunosorbent assay and Western blotting. Expression of IL-1β and IL-6 mRNAs was induced by IL-1β and TNF-α and further increased by miR-223 overexpression. IL-1β and TNF-α induced the expression of IL-1β and IL-6 mRNAs, and this was reduced by miR-223 inhibitor. Overexpression of miR-223 decreased the levels of IKKα protein and MKP-5 mRNA in HGF. These findings indicate that miR-223 might control the inflammatory response via IKKα and MKP-5 in periodontal tissue. (J Oral Sci 58, 101-108, 2016). PMID:27021546

  19. MicroRNA-223 Enhances Radiation Sensitivity of U87MG Cells In Vitro and In Vivo by Targeting Ataxia Telangiectasia Mutated

    Liang, Liping; Zhu, Ji [Departments of Radiation Oncology, Fudan University Shanghai Cancer Center, Department of Oncology, Shanghai Medical College, Fudan University, Shanghai (China); Zaorsky, Nicholas G. [Department of Radiation Oncology, Fox Chase Cancer Center, Philadelphia, Pennsylvania (United States); Deng, Yun [Departments of Radiation Oncology, Fudan University Shanghai Cancer Center, Department of Oncology, Shanghai Medical College, Fudan University, Shanghai (China); Wu, Xingzhong [Department of Biochemistry and Molecular Biology, Shanghai Medical College, Fudan University, Shanghai (China); Liu, Yong [Departments of Radiation Oncology, Fudan University Shanghai Cancer Center, Department of Oncology, Shanghai Medical College, Fudan University, Shanghai (China); Liu, Fangqi; Cai, Guoxiang; Gu, Weilie [Department of Colorectal Cancer, Fudan University, Shanghai Cancer Center, Shanghai (China); Shen, Lijun [Departments of Radiation Oncology, Fudan University Shanghai Cancer Center, Department of Oncology, Shanghai Medical College, Fudan University, Shanghai (China); Zhang, Zhen, E-mail: zhenzhang6@hotmail.com [Departments of Radiation Oncology, Fudan University Shanghai Cancer Center, Department of Oncology, Shanghai Medical College, Fudan University, Shanghai (China)

    2014-03-15

    Purpose: Ataxia telangiectasia mutated (ATM) protein is important in the DNA damage response because it repairs radiation-induced damage in cancers. We examined the effect of microRNA-223 (miR-223), a regulator of ATM expression, on radiation sensitivity of cancer cells. Methods and Materials: Human embryonic kidney 293 T (293T) cells were infected with pLL3.7-miR-223 plasmid to generate the pLL3.7-miR-223 and -empty virus (EV) lentivirus (miR-223 and EV). A dual luciferase assay in which the reporter contained wild-type 3′ untranslated region (UTR) of ATM was performed. U87MG cells were infected with miR-223 or EV to establish the overexpressed stable cell lines (U87-223 or U87-EV, respectively). Cells were irradiated in vitro, and dose enhancement ratios at 2 Gy (DER{sub 2}) were calculated. Hind legs of BALB/c athymic mice were injected with U87-223 or U87-EV cells; after 2 weeks, half of the tumors were irradiated. Tumor volumes were tracked for a total of 5 weeks. Results: The dual luciferase reporter assay showed a significant reduction in luciferase activity of 293T cells cotransfected with miR-223 and the ATM 3′UTR compared to that in EV control. Overexpression of miR-223 in U87MG cells showed that ATM expression was significantly downregulated in the U87-223 cells compared to that in U87-EV (ATM/β-actin mRNA 1.0 vs 1.5, P<.05). U87-223 cells were hypersensitive to radiation compared to U87-EV cells in vitro (DER{sub 2} = 1.32, P<.01). Mice injected with miR-223-expressing tumors had almost the same tumors after 3 weeks (1.5 cm{sup 3} vs 1.7 cm{sup 3}). However, irradiation significantly decreased tumor size in miR-223-expressing tumors compared to those in controls (0.033 cm{sup 3} vs 0.829 cm{sup 3}). Conclusions: miR-223 overexpression downregulates ATM expression and sensitizes U87 cells to radiation in vitro and in vivo. MicroRNA-223 may be a novel cancer-targeting therapy, although its cancer- and patient-specific roles are

  20. MicroRNA-223 Enhances Radiation Sensitivity of U87MG Cells In Vitro and In Vivo by Targeting Ataxia Telangiectasia Mutated

    Purpose: Ataxia telangiectasia mutated (ATM) protein is important in the DNA damage response because it repairs radiation-induced damage in cancers. We examined the effect of microRNA-223 (miR-223), a regulator of ATM expression, on radiation sensitivity of cancer cells. Methods and Materials: Human embryonic kidney 293 T (293T) cells were infected with pLL3.7-miR-223 plasmid to generate the pLL3.7-miR-223 and -empty virus (EV) lentivirus (miR-223 and EV). A dual luciferase assay in which the reporter contained wild-type 3′ untranslated region (UTR) of ATM was performed. U87MG cells were infected with miR-223 or EV to establish the overexpressed stable cell lines (U87-223 or U87-EV, respectively). Cells were irradiated in vitro, and dose enhancement ratios at 2 Gy (DER2) were calculated. Hind legs of BALB/c athymic mice were injected with U87-223 or U87-EV cells; after 2 weeks, half of the tumors were irradiated. Tumor volumes were tracked for a total of 5 weeks. Results: The dual luciferase reporter assay showed a significant reduction in luciferase activity of 293T cells cotransfected with miR-223 and the ATM 3′UTR compared to that in EV control. Overexpression of miR-223 in U87MG cells showed that ATM expression was significantly downregulated in the U87-223 cells compared to that in U87-EV (ATM/β-actin mRNA 1.0 vs 1.5, P<.05). U87-223 cells were hypersensitive to radiation compared to U87-EV cells in vitro (DER2 = 1.32, P<.01). Mice injected with miR-223-expressing tumors had almost the same tumors after 3 weeks (1.5 cm3 vs 1.7 cm3). However, irradiation significantly decreased tumor size in miR-223-expressing tumors compared to those in controls (0.033 cm3 vs 0.829 cm3). Conclusions: miR-223 overexpression downregulates ATM expression and sensitizes U87 cells to radiation in vitro and in vivo. MicroRNA-223 may be a novel cancer-targeting therapy, although its cancer- and patient-specific roles are currently undefined

  1. A software simulation study of a (255,223) Reed-Solomon encoder-decoder

    Pollara, F.

    1985-04-01

    A set of software programs which simulates a (255,223) Reed-Solomon encoder/decoder pair is described. The transform decoder algorithm uses a modified Euclid algorithm, and closely follows the pipeline architecture proposed for the hardware decoder. Uncorrectable error patterns are detected by a simple test, and the inverse transform is computed by a finite field FFT. Numerical examples of the decoder operation are given for some test codewords, with and without errors. The use of the software package is briefly described.

  2. Superconductivity in 2-2-3 system Y2Ba2Cu2O(8+delta)

    Joshi, H. H.; Baldha, G. J.; Jotania, R. B.; Joshi, S. M.; Mohan, H.; Pandya, P. B.; Pandya, H. N.; Kulkarni, R. G.

    1991-01-01

    Researchers synthesized a new high T(sub c) 2-2-3 superconductor Y2Ba2Cu3O(8+delta) by a special preparation technique and characterized it by ac-susceptibility measurements. Diamagnetism and Meissner effect sets in at low fields and superconducting transition onsets at 90 K. The systematic investigation of the real and imaginary components of ac-susceptibility as a function of temperature and applied ac magnetic field reveals that the magnetic behavior is that of a granular type superconductor.

  3. Cutting Edge: MicroRNA-223 Regulates Myeloid Dendritic Cell-Driven Th17 Responses in Experimental Autoimmune Encephalomyelitis.

    Ifergan, Igal; Chen, Siqi; Zhang, Bin; Miller, Stephen D

    2016-02-15

    Myeloid cells play a crucial role in the induction and sustained inflammation in neuroinflammatory disorders, such as multiple sclerosis. miR-223, a myeloid cell-specific microRNA, is one of the most upregulated microRNAs in multiple sclerosis patients. We demonstrate that miR-223-knockout mice display significantly reduced active and adoptive-transfer experimental autoimmune encephalomyelitis that is characterized by reduced numbers of myeloid dendritic cells (mDCs) and Th17 cells in the CNS. Knockout mDCs have increased PD-L1 and decreased IL-1β, IL-6, and IL-23 expression, as well as a reduced capacity to drive Th17, but not Th1, cell differentiation. Thus, miR-223 controls mDC-induced activation of pathologic Th17 responses during autoimmune inflammation. PMID:26783338

  4. STRUCTURAL CONSEQUENCES OF THE POLYMORPHISM Q223R IN THE HUMAN LEPTIN RECEPTOR: A MOLECULAR DYNAMICS STUDY

    Jonathan P. Carrillo-Vázquez

    2013-01-01

    Full Text Available Leptin Receptor (LEPR is a component of a signaling pathway related to appetite and energy expenditure. Single Nucleotide Polymorphisms (SNP of Leptin receptor gene (lepr have been proposed as possible modulator of adipose tissue and body weight. The main phenomenological consequence reported of these SNPs is the modulation of the LEP-LEPR interaction promoting the weight gain. Particularly, Q223R polymorphism has been associated with human obesity in some populations. In this work, we analyze the structural effects of Q223R substitution in a model of the extracellular region of LEPR comparing the stability between LEPR-Q and its Q223R variant (rs1137101 by Molecular Dynamics (MD simulations. These results showed different behavior between both molecules after one nanosecond (ns of simulation and significant differences in the secondary structure content were evidenced.

  5. The design plan of a VLSI single chip (255, 223) Reed-Solomon decoder

    Hsu, I. S.; Shao, H. M.; Deutsch, L. J.

    1987-11-01

    The very large-scale integration (VLSI) architecture of a single chip (255, 223) Reed-Solomon decoder for decoding both errors and erasures is described. A decoding failure detection capability is also included in this system so that the decoder will recognize a failure to decode instead of introducing additional errors. This could happen whenever the received word contains too many errors and erasures for the code to correct. The number of transistors needed to implement this decoder is estimated at about 75,000 if the delay for received message is not included. This is in contrast to the older transform decoding algorithm which needs about 100,000 transistors. However, the transform decoder is simpler in architecture than the time decoder. It is therefore possible to implement a single chip (255, 223) Reed-Solomon decoder with today's VLSI technology. An implementation strategy for the decoder system is presented. This represents the first step in a plan to take advantage of advanced coding techniques to realize a 2.0 dB coding gain for future space missions.

  6. Stochastic simulation of radium-223 dichloride therapy at the sub-cellular level.

    Gholami, Y; Zhu, X; Fulton, R; Meikle, S; El-Fakhri, G; Kuncic, Z

    2015-08-01

    Radium-223 dichloride ((223)Ra) is an alpha particle emitter and a natural bone-seeking radionuclide that is currently used for treating osteoblastic bone metastases associated with prostate cancer. The stochastic nature of alpha emission, hits and energy deposition poses some challenges for estimating radiation damage. In this paper we investigate the distribution of hits to cells by multiple alpha particles corresponding to a typical clinically delivered dose using a Monte Carlo model to simulate the stochastic effects. The number of hits and dose deposition were recorded in the cytoplasm and nucleus of each cell. Alpha particle tracks were also visualized. We found that the stochastic variation in dose deposited in cell nuclei ([Formula: see text]40%) can be attributed in part to the variation in LET with pathlength. We also found that [Formula: see text]18% of cell nuclei receive less than one sigma below the average dose per cell ([Formula: see text]15.4 Gy). One possible implication of this is that the efficacy of cell kill in alpha particle therapy need not rely solely on ionization clustering on DNA but possibly also on indirect DNA damage through the production of free radicals and ensuing intracellular signaling. PMID:26216391

  7. Phosphazene like film formation on InP in liquid ammonia (223 K)

    An anodic photo-galvanostatic treatment at low current density (1 μA·cm−2) is carried out on n-InP semiconductor in liquid ammonia (223 K). The gradual chemical evolution of the surface is studied as a function of the anodic charge. Proof and reproducibility of the chemical transformation of the surface are clearly evidenced by X-ray photoelectron spectroscopy (XPS) analyses. Like by cyclic voltammetry, the perfect coverage of the InP surface by a thin phosphazene like film is also revealed by XPS data. However, a low anodic charge (≈ 0.5 mC·cm−2) is required by photo-galvanostatic treatment while a higher anodic charge (≈ 7 mC·cm−2) is involved by cyclic voltammetry. The excess of charge could be related to ammonia oxidation during the formation of the passivating film. This result proves the electrochemical oxidation of the solvent as a determinant step of the mechanism film formation. - Highlights: ► Cyclic voltammetry and galvanostatic modes on n-InP in liquid ammonia (223 K). ► A thin film growth is reached by photo-anodic polarization. ► The same phosphazene like film is evidenced by X-ray photoelectron spectroscopy. ► An excess of charge is observed by cyclic voltammetry. ► An electrochemical oxidation step of the solvent is assumed

  8. Integral Field Spectroscopy Of The Brightest Knots Of Hh 223 In L723

    López, R; Estalella, R; Riera, A; Carrasco-González, C; Gómez, G

    2012-01-01

    HH 223 is the optical counterpart of a larger scale H2 outflow, driven by the protostellar source VLA 2A, in L723. Its poorly collimated and rather chaotic morphology suggested the Integral Field Spectroscopy (IFS) as an appropriate option to map the emission for deriving the physical conditions and the kinematics. Here we present new results based on the IFS observations made with the INTEGRAL system at the WHT. The brightest knots of HH 223 (\\sim16 arcsec, 0.02 pc at a distance of 300 pc) were mapped with a single pointing in the spectral range 6200-7700 A. We obtained the emission-line intensity maps for Halpha, [NII] 6584 A and [SII] 6716, 6731 A, and explored the distribution of the excitation and electron density from [NII]/Halpha, [SII]/Halpha, and [SII] 6716/6731 line-ratio maps. Maps of the radial velocity field were obtained. We analysed the 3D-kinematics by combining the knot radial velocities, derived from IFS data, with the knot proper motions derived from multi-epoch, narrow-band images. The int...

  9. Precise measurements of the absolute γ-ray emission probabilities of 223Ra and decay progeny in equilibrium

    Precise measurements of the absolute γ-ray emission probabilities have been made of radiochemically pure solutions of 223Ra in equilibrium with its decay progeny, which had been previously standardised by 4π(liquid scintillation)-γ digital coincidence counting techniques. Two high-purity germanium γ-ray spectrometers were used which had been accurately calibrated using a suite of primary and secondary radioactive standards. Comparison of the activity concentration determined by the primary technique against γ-ray spectrometry measurements using the nuclear data evaluations of the Decay Data Evaluation Project exhibited a range of ~18% in the most intense γ-ray emissions (>1% probability) of the 223Ra decay series. Absolute γ-ray emission probabilities and standard uncertainties have been determined for the decay of 223Ra, 219Rn, 215Po, 211Pb, 211Bi and 207Tl in equilibrium. The standard uncertainties of the measured γ-ray emission probabilities quoted in this work show a significant improvement over previously reported γ-ray emission probabilities. Correlation coefficients for pairs of the measured γ-ray emission probabilities from the decays of the radionuclides 223Ra, 219Rn and 211Pb have been determined and are presented. The α-transition probabilities of the 223Ra have been deduced from P(γ+ce) balance using the γ-ray emission probabilities determined in this work with some agreement observed with the published experimental values of the α-emission probabilities. - Highlights: • Discrepancies found within currently published γ-ray emission probabilities. • Absolute γ-ray emission probabilities of decay series in equilibrium determined. • Significant improvement in precision of measured values. • Closer agreement between deduced and experimental α transition probabilities. • Correlation coefficients presented for γ-emissions of 223Ra, 219Rn and 211Pb

  10. Radium-223 chloride: a potential new treatment for castration-resistant prostate cancer patients with metastatic bone disease

    Radium-223 chloride (223Ra; Alpharadin) is an alpha-emitting radioisotope that targets areas of osteoblastic metastasis and is excreted by the small intestine. When compared with beta-emitters (eg, strontium-89, samarium-153), 223Ra delivers a high quantity of energy per track length with short tissue penetration. This review describes the mechanism, radiobiology, and preclinical development of 223Ra and discusses the clinical data currently available regarding its safety and efficacy profile. Data from clinical trials including abstracts were collected and reviewed using the PubMed Database, as well as the American Society of Clinical Oncology abstract database. Current bone-targeted therapies fall into two main categories: antiresorptive agents (eg, zoledronic acid, denosumab), which have been shown to delay skeletal-related events, and radiopharmaceuticals (eg, samarium-153), which may have a role in pain palliation. Historically, neither antiresorptive agents nor radiopharmaceuticals have shown definitive evidence of improved overall survival or other antitumor effects in metastatic castrate-resistant prostate cancer (mCRPC). Radiopharmaceuticals are limited by myelosuppresion, thrombocytopenia, and renal excretion. In a recently reported randomized Phase III trial in men with symptomatic bone-metastatic CRPC who had received or were ineligible for docetaxel chemotherapy, 223Ra treatment resulted in improved overall survival and delayed skeletal-related events. Toxicity consisted of minor gastrointestinal side effects and mild neutropenia and thrombocytopenia that were rarely severe. Pending regulatory approval, 223Ra may represent a unique and distinct option for an important subgroup of patients with mCRPC; future trials should address its use in combination or in sequence with existing and novel agents

  11. Preparation and Photo-thermal Isomerization of Azo [2.2.1]-and Azo[2.2.3]metacyclophane Tweezers

    Sawada, Tsuyoshi; Thiemann, Thies; Mataka, Shuntaro

    1999-01-01

    Azo[2.2.1]metacyclophane (MCP) tweezer 11 and azo[2.2.3]MCP tweezer 12 were prepared from [2.2.1]MCP 1a and [2.2.3]MCP 8, respectively, by ipso-nitration followed by reductive coupling using LiAlH_4. The photochemical and thermal isomerization of azo[2.2.n]MCP tweezers were studied by UV spectroscopy. The activation parameter (E_a) of the thermal cis-trans isomerization of 11 and 12 was determined as 81.7 kJmol^ and 90.9 kJmol^, respectively.

  12. A 380-kb Duplication in 7p22.3 Encompassing the LFNG Gene in a Boy with Asperger Syndrome

    Vulto-van Silfhout, A.T.; Brouwer, A.F. de; Leeuw, N. de; Obihara, C.C.; Brunner, H.G.; Vries, B.B. de

    2012-01-01

    De novo genomic aberrations are considered an important cause of autism spectrum disorders. We describe a de novo 380-kb gain in band p22.3 of chromosome 7 in a patient with Asperger syndrome. This duplicated region contains 9 genes including the LNFG gene that is an important regulator of NOTCH sig

  13. 12 CFR 223.24 - What valuation principles apply to extensions of credit secured by affiliate securities?

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false What valuation principles apply to extensions... THEIR AFFILIATES (REGULATION W) Valuation and Timing Principles Under Section 23A § 223.24 What valuation principles apply to extensions of credit secured by affiliate securities? (a) Valuation...

  14. Leptin receptor polymorphism Gln223Arg (rs1137101) in oral squamous cell carcinoma and potentially malignant oral lesions.

    Domingos, Patrícia Luciana Batista; Farias, Lucyana Conceição; Pereira, Camila Santos; das Graças Pena, Geórgia; Reis, Tatiana Carvalho; Silva, Rosângela Ramos Veloso; Fraga, Carlos Alberto de Carvalho; de Souza, Marcela Gonçalves; Soares, Mariana Batista; Jones, Kimberly Marie; Menezes, Elytania Veiga; Nobre, Sérgio Avelino Mota; Rodrigues Neto, João Felício; de Paula, Alfredo Maurício Batista; Velásquez-Meléndez, Jorge Gustavo; Sena Guimarães, André Luiz

    2014-01-01

    The purpose of this study was to assess the LEPR gene Gln223Arg polymorphism (rs1137101) in oral squamous cell carcinoma (OSCC) and in potentially malignant oral lesions (PMOL) in comparison to normal oral mucosa in a Brazilian population. Smokers (n = 89) were selected from a representative sample of 471 individuals from the general population of Montes Claros, Brazil. Participants were age and gender matched to patients with OSCC (n = 25) and oral epithelial dysplasia (n = 25). We investigated the LEPR Gln223Arg polymorphism (A>G; rs1137101) in these groups. Genotype variants were assessed by RFLP-PCR, using MspI (HPAII) restriction endonuclease. The institutional review board of the Universidade Estadual de Montes Claros approved the study (process number 2667/2011). Written informed consent for this study was obtained from all participants. The GG genotype (Arg223Arg) appears to be the more relevant polymorphic variant in OSCC. It occurred, approximately, twice as frequently in OSCC patients than in the general population. In contrast, the A allele in its homozygosis form (Gln223Gln) is significantly associated with the development of PMOL; 80% of the samples from the PMOL group exhibit AA genotype. Our findings suggest new insights regarding LEPR gene variations in the development of OSCC and PMOL. PMID:26034683

  15. Determination of 226Ra, 224Ra, 223Ra and 228Ra in mineral water samples of the Slovak Republic

    The Slovak Republic is very rich in mineral water sources. In recent years, it has been discovered that a number of mineral waters in the Slovak Republic contain high levels of 226Ra and 228Ra. Moreover, there is a lack of information on 224Ra and 223Ra concentrations in mineral waters as well. The currently approved techniques for alpha emitting radium isotopes are based on radon emanation methods. Due to the long ingrowth periods required by these techniques, any 224Ra and 223Ra in the sample decay away and go undetected. For this reason, we have used an alpha spectrometric method for the simultaneous determination of 226Ra, 223Ra and 224Ra. Radium was concentrated by a lead sulphate co-precipitation. The precipitate was dissolved in EDTA and the radium isotopes were separated from possible interfering radionuclides using barium sulphate micro precipitation. The radium-barium precipitate was filtered and counted by alpha spectrometry. 133Ba was used to quantify the yield by gamma spectrometry. In our laboratory, gamma spectrometry was also used for the determination of 228Ra in mineral water samples. Radium was concentrated by a lead-barium sulphate co-precipitation. 133Ba was used to quantify the yield, found to be 97 % on the average, by gamma spectrometry. Furthermore, the committed effective doses for 226Ra, 224Ra, 223Ra, 228Ra intake via ingestion of mineral waters for the members of public were calculated. (author)

  16. A transcription map of the 6p22.3 reading disability locus identifying candidate genes

    Gruen Jeffrey R

    2003-06-01

    Full Text Available Abstract Background Reading disability (RD is a common syndrome with a large genetic component. Chromosome 6 has been identified in several linkage studies as playing a significant role. A more recent study identified a peak of transmission disequilibrium to marker JA04 (G72384 on chromosome 6p22.3, suggesting that a gene is located near this marker. Results In silico cloning was used to identify possible candidate genes located near the JA04 marker. The 2 million base pairs of sequence surrounding JA04 was downloaded and searched against the dbEST database to identify ESTs. In total, 623 ESTs from 80 different tissues were identified and assembled into 153 putative coding regions from 19 genes and 2 pseudogenes encoded near JA04. The identified genes were tested for their tissue specific expression by RT-PCR. Conclusions In total, five possible candidate genes for RD and other diseases mapping to this region were identified.

  17. IMAGING OF THE CCS 22.3 GHz EMISSION IN THE TAURUS MOLECULAR CLOUD COMPLEX

    Thioxoethenylidene (CCS) is an abundant interstellar molecule and a good tracer of high density and evolutionary stage of dense molecular clouds. It is also a suitable candidate for Zeeman splitting observations for its high splitting factor and narrow thermal line widths. We report here Expanded Very Large Array 22.3 GHz observations of three dense molecular cores TMC-1, TMC-1C, and L1521B in the Taurus molecular cloud complex to image the CCS 21-10 transition. For all three sources, the clumpy CCS emission is most likely tracing the starless cores. However, these compact structures account for only ∼1%-13% of the integrated emission detected in single-dish observations, indicating the presence of significant large-scale diffuse emission in favorable conditions for producing CCS.

  18. Crystal Structure of D-Valine at the Temperature of 293, 270, 223 and 173K

    WANG Wen-Qing; GONG Yan; WANG Zhe-Ming; YAN Chun-Hua

    2003-01-01

    The crystal structure of D-valine has been determined by Mo-Kα (λ = 0.71073 A) X-ray diffraction method for the first time. It crystallizes in monoclinic, space group P21 (Z = 4) with a = 9.6728(5), b = 5.2722(3), c = 12.0425(8) A, β = 90.750(2)° at 293 K. The asymmetric unit contains two crystallographically independent molecules — A (trans form) and B (gauche I form). They are rotational isomers with two kinds of conformations about the Cα -Cβ bond. The results of measurements of crystal structure at 293, 270, 223 and 173 K show a little change in bond lengths and geometries as a function of temperature. No evidence was obtained for the existence of configuration transformation from D- to L-valine.

  19. Integral field spectroscopy of the brightest knots of HH 223 in L723

    López, R.; García-Lorenzo, B.; Estalella, R.; Riera, A.; Carrasco-González, C.; Gómez, G.

    2012-08-01

    HH 223 is the optical counterpart of a larger scale H2 outflow, driven by the protostellar source VLA 2A, in L723. Its poorly collimated and rather chaotic morphology suggested Integral Field Spectroscopy (IFS) as an appropriate option to map the emission in order to derive the physical conditions and kinematics. Here we present new results based on IFS observations made with the INTEGRAL system at the William Herschel Telescope. The brightest knots of HH 223 (˜16 arcsec, ≃0.02 pc at a distance of 300 pc) were mapped with a single pointing in the spectral range 6200-7700 Å. We obtained emission-line intensity maps for Hα, [N II] 6584 Å and [S II] 6716, 6731 Å and explored the distribution of the excitation and electron density from [N II]/Hα, [S II]/Hα and [S II] 6716/6731 line-ratio maps. Maps of the radial velocity field were obtained. We analysed the three-dimensional kinematics by combining the knot radial velocities derived from IFS data with the knot proper motions derived from multi-epoch narrow-band images. The intensity maps built from IFS data reproduced the morphology found in the narrow-band images well. We checked the results obtained from previous long-slit observations with those derived from IFS spectra extracted with a similar spatial sampling. At the positions intersected by the slit, the physical conditions and kinematics derived from IFS are compatible with those derived from long-slit data. In contrast, significant discrepancies were found when the results from long-slit data were compared with the ones derived from IFS spectra extracted at positions shifted a few arcsec from those intersected by the slit. This clearly revealed IFS observations as the best choice to obtain a reliable picture of the HH emission properties.

  20. A Turner syndrome neurocognitive phenotype maps to Xp22.3

    Elder Frederick F

    2007-05-01

    Full Text Available Abstract Background Turner syndrome (TS is associated with a neurocognitive phenotype that includes selective nonverbal deficits, e.g., impaired visual-spatial abilities. We previously reported evidence that this phenotype results from haploinsufficiency of one or more genes on distal Xp. This inference was based on genotype/phenotype comparisons of individual girls and women with partial Xp deletions, with the neurocognitive phenotype considered a dichotomous trait. We sought to confirm our findings in a large cohort (n = 47 of adult women with partial deletions of Xp or Xq, enriched for subjects with distal Xp deletions. Methods Subjects were recruited from North American genetics and endocrinology clinics. Phenotype assessment included measures of stature, ovarian function, and detailed neurocognitive testing. The neurocognitive phenotype was measured as a quantitative trait, the Turner Syndrome Cognitive Summary (TSCS score, derived from discriminant function analysis. Genetic analysis included karyotyping, X inactivation studies, fluorescent in situ hybridization, microsatellite marker genotyping, and array comparative genomic hybridization. Results We report statistical evidence that deletion of Xp22.3, an interval containing 31 annotated genes, is sufficient to cause the neurocognitive phenotype described by the TSCS score. Two other cardinal TS features, ovarian failure and short stature, as well as X chromosome inactivation pattern and subject's age, were unrelated to the TSCS score. Conclusion Detailed mapping suggests that haploinsufficiency of one or more genes in Xp22.3, the distal 8.3 megabases (Mb of the X chromosome, is responsible for a TS neurocognitive phenotype. This interval includes the 2.6 Mb Xp-Yp pseudoautosomal region (PAR1. Haploinsufficiency of the short stature gene SHOX in PAR1 probably does not cause this TS neurocognitive phenotype. Two genes proximal to PAR1 within the 8.3 Mb critical region, STS and NLGN4X, are

  1. A bone marrow toxicity model for 223Ra alpha-emitter radiopharmaceutical therapy

    Hobbs, Robert F.; Song, Hong; Watchman, Christopher J.; Bolch, Wesley E.; Aksnes, Anne-Kirsti; Ramdahl, Thomas; Flux, Glenn D.; Sgouros, George

    2012-05-01

    Ra-223, an α-particle emitting bone-seeking radionuclide, has recently been used in clinical trials for osseous metastases of prostate cancer. We investigated the relationship between absorbed fraction-based red marrow dosimetry and cell level-dosimetry using a model that accounts for the expected localization of this agent relative to marrow cavity architecture. We show that cell level-based dosimetry is essential to understanding potential marrow toxicity. The GEANT4 software package was used to create simple spheres representing marrow cavities. Ra-223 was positioned on the trabecular bone surface or in the endosteal layer and simulated for decay, along with the descendants. The interior of the sphere was divided into cell-size voxels and the energy was collected in each voxel and interpreted as dose cell histograms. The average absorbed dose values and absorbed fractions were also calculated in order to compare those results with previously published values. The absorbed dose was predominantly deposited near the trabecular surface. The dose cell histogram results were used to plot the percentage of cells that received a potentially toxic absorbed dose (2 or 4 Gy) as a function of the average absorbed dose over the marrow cavity. The results show (1) a heterogeneous distribution of cellular absorbed dose, strongly dependent on the position of the cell within the marrow cavity; and (2) that increasing the average marrow cavity absorbed dose, or equivalently, increasing the administered activity resulted in only a small increase in potential marrow toxicity (i.e. the number of cells receiving more than 4 or 2 Gy), for a range of average marrow cavity absorbed doses from 1 to 20 Gy. The results from the trabecular model differ markedly from a standard absorbed fraction method while presenting comparable average dose values. These suggest that increasing the amount of radioactivity may not substantially increase the risk of toxicity, a result unavailable to the

  2. miR-223 enhances the sensitivity of non-small cell lung cancer cells to erlotinib by targeting the insulin-like growth factor-1 receptor.

    Zhao, Feng-Yi; Han, Jing; Chen, Xie-Wan; Wang, Jiang; Wang, Xu-Dong; Sun, Jian-Guo; Chen, Zheng-Tang

    2016-07-01

    Lung cancer is the leading cause of cancer-related fatalities worldwide, and non-small cell lung cancer (NSCLC) is the main pathological type. MicroRNAs (miRNAs or miRs) are a class of small non-coding RNAs, which are involved in tumor initiation and progression. miR‑223 is a tumor suppressor miRNA that has been reported in various types of cancer, including lung cancer. In the present study, to characterize the biological behavior of miR‑223 in NSCLC, we established an miR‑223 overexpression model in erlotinib-resistant PC‑9 (PC‑9/ER) cells by infection with lentivirus to induce the overexpression of miR‑223. As a result, miR‑223 enhanced the sensitivity of the PC‑9/ER cells to erlotinib by inducing apoptosis in vitro. Additionally, in vivo experiments were performed using nude mice which were injected with the cancer cells [either the PC‑9 (not resistant), PC‑9/ER, or the PC‑9/ER cells infected with miR‑223)]. We found that the tumor volumes were reduced in the rats injected with the cells infected with miR‑223. To further explore the underlying mechanisms, reverse transcription-quantitative polymerase chain reaction (RT-qPCR) and western blot analysis were used to identify the target molecules of miR‑223. miR‑223 was demonstrated to act as a local regulator of insulin-like growth factor-1 receptor (IGF-1R) in the acquired resistance to tyrosine kinase inhibitors (TKIs). Notably, the οverexpression of IGF-1R in NSCLC was downregulated by miR‑223, and the activation of Akt/S6, the downstream pathway, was also inhibited. The inhibition of IGF-1R by miR‑223 was attenuated by exogenous IGF-1 expression. Therefore, miR‑223 may regulate the acquired resistance of PC‑9/ER cells to erlotinib by targeting the IGF-1R/Akt/S6 signaling pathway. The overexpression of miR‑223 may partially reverse the acquired resistance to epidermal growth factor receptor-TKIs, thus, providing a potential therapeutic strategy for TKI

  3. Leptin receptor Gln223Arg polymorphism and breast cancer risk in Nigerian women: A case control study

    Leptin, a 16 kDa polypeptide hormone, implicated in various physiological processes, exerts its action through the leptin receptor, a member of the class I cytokine receptor family. Both leptin and leptin receptor have recently been implicated in processes leading to breast cancer initiation and progression in animal models and humans. An A to G transition mutation in codon 223 in exon 6 of the leptin receptor gene, resulting in glutamine to arginine substitution (Gln223Arg), lies within the first of two putative leptin-binding regions and may be associated with impaired signaling capacity of the leptin receptor. This study was designed to assess the role of this polymorphism in breast cancer susceptibility in Nigerian women. We utilized a polymerase chain reaction (PCR)-based restriction fragment length polymorphism (RFLP) assay to evaluate the association between the Gln223Arg polymorphism of the leptin receptor gene and breast risk in Nigeria in a case control study involving 209 women with breast cancer and 209 controls without the disease. Study participants were recruited from surgical outpatient clinics and surgical wards of four University Teaching Hospitals located in Midwestern and southeastern Nigeria between September 2002 and April 2004. Premenopausal women carrying at least one LEPR 223Arg allele were at a modestly increased risk of breast cancer after adjusting for confounders (OR = 1.8, 95% confidence interval [CI] 1.0–3.2, p = 0.07). There was no association with postmenopausal breast cancer risk (OR = 0.9, 95% CI 0.4–1.8, p = 0.68). Our results suggest that the LEPR Gln223Arg polymorphism in the extracellular domain of the LEPR receptor gene is associated with a modestly increased risk of premenopausal breast cancer in Nigerian women

  4. Oxidized Low-density Lipoprotein (ox-LDL) Cholesterol Induces the Expression of miRNA-223 and L-type Calcium Channel Protein in Atrial Fibrillation.

    He, Fengping; Xu, Xin; Yuan, Shuguo; Tan, Liangqiu; Gao, Lingjun; Ma, Shaochun; Zhang, Shebin; Ma, Zhanzhong; Jiang, Wei; Liu, Fenglian; Chen, Baofeng; Zhang, Beibei; Pang, Jungang; Huang, Xiuyan; Weng, Jiaqiang

    2016-01-01

    Atrial fibrillation (AF) is the most common sustained arrhythmia causing high morbidity and mortality. While changing of the cellular calcium homeostasis plays a critical role in AF, the L-type calcium channel α1c protein has suggested as an important regulator of reentrant spiral dynamics and is a major component of AF-related electrical remodeling. Our computational modeling predicted that miRNA-223 may regulate the CACNA1C gene which encodes the cardiac L-type calcium channel α1c subunit. We found that oxidized low-density lipoprotein (ox-LDL) cholesterol significantly up-regulates both the expression of miRNA-223 and L-type calcium channel protein. In contrast, knockdown of miRNA-223 reduced L-type calcium channel protein expression, while genetic knockdown of endogenous miRNA-223 dampened AF vulnerability. Transfection of miRNA-223 by adenovirus-mediated expression enhanced L-type calcium currents and promoted AF in mice while co-injection of a CACNA1C-specific miR-mimic counteracted the effect. Taken together, ox-LDL, as a known factor in AF-associated remodeling, positively regulates miRNA-223 transcription and L-type calcium channel protein expression. Our results implicate a new molecular mechanism for AF in which miRNA-223 can be used as an biomarker of AF rheumatic heart disease. PMID:27488468

  5. Oxidized Low-density Lipoprotein (ox-LDL) Cholesterol Induces the Expression of miRNA-223 and L-type Calcium Channel Protein in Atrial Fibrillation

    He, Fengping; Xu, Xin; Yuan, Shuguo; Tan, Liangqiu; Gao, Lingjun; Ma, Shaochun; Zhang, Shebin; Ma, Zhanzhong; Jiang, Wei; Liu, Fenglian; Chen, Baofeng; Zhang, Beibei; Pang, Jungang; Huang, Xiuyan; Weng, Jiaqiang

    2016-08-01

    Atrial fibrillation (AF) is the most common sustained arrhythmia causing high morbidity and mortality. While changing of the cellular calcium homeostasis plays a critical role in AF, the L-type calcium channel α1c protein has suggested as an important regulator of reentrant spiral dynamics and is a major component of AF-related electrical remodeling. Our computational modeling predicted that miRNA-223 may regulate the CACNA1C gene which encodes the cardiac L-type calcium channel α1c subunit. We found that oxidized low-density lipoprotein (ox-LDL) cholesterol significantly up-regulates both the expression of miRNA-223 and L-type calcium channel protein. In contrast, knockdown of miRNA-223 reduced L-type calcium channel protein expression, while genetic knockdown of endogenous miRNA-223 dampened AF vulnerability. Transfection of miRNA-223 by adenovirus-mediated expression enhanced L-type calcium currents and promoted AF in mice while co-injection of a CACNA1C-specific miR-mimic counteracted the effect. Taken together, ox-LDL, as a known factor in AF-associated remodeling, positively regulates miRNA-223 transcription and L-type calcium channel protein expression. Our results implicate a new molecular mechanism for AF in which miRNA-223 can be used as an biomarker of AF rheumatic heart disease.

  6. H1N1 2009 pandemic influenza virus: resistance of the I223R neuraminidase mutant explained by kinetic and structural analysis.

    Erhard van der Vries

    2012-09-01

    Full Text Available Two classes of antiviral drugs, neuraminidase inhibitors and adamantanes, are approved for prophylaxis and therapy against influenza virus infections. A major concern is that antiviral resistant viruses emerge and spread in the human population. The 2009 pandemic H1N1 virus is already resistant to adamantanes. Recently, a novel neuraminidase inhibitor resistance mutation I223R was identified in the neuraminidase of this subtype. To understand the resistance mechanism of this mutation, the enzymatic properties of the I223R mutant, together with the most frequently observed resistance mutation, H275Y, and the double mutant I223R/H275Y were compared. Relative to wild type, K(M values for MUNANA increased only 2-fold for the single I223R mutant and up to 8-fold for the double mutant. Oseltamivir inhibition constants (K(I increased 48-fold in the single I223R mutant and 7500-fold in the double mutant. In both cases the change was largely accounted for by an increased dissociation rate constant for oseltamivir, but the inhibition constants for zanamivir were less increased. We have used X-ray crystallography to better understand the effect of mutation I223R on drug binding. We find that there is shrinkage of a hydrophobic pocket in the active site as a result of the I223R change. Furthermore, R223 interacts with S247 which changes the rotamer it adopts and, consequently, binding of the pentoxyl substituent of oseltamivir is not as favorable as in the wild type. However, the polar glycerol substituent present in zanamivir, which mimics the natural substrate, is accommodated in the I223R mutant structure in a similar way to wild type, thus explaining the kinetic data. Our structural data also show that, in contrast to a recently reported structure, the active site of 2009 pandemic neuraminidase can adopt an open conformation.

  7. Notch-regulated miR-223 targets the aryl hydrocarbon receptor pathway and increases cytokine production in macrophages from rheumatoid arthritis patients

    Ogando, Jesús; Tardáguila, Manuel; Díaz-Alderete, Andrea; Usategui, Alicia; Miranda-Ramos, Vanessa; Martínez-Herrera, Dannys Jorge; de la Fuente, Lorena; García-León, María J.; Moreno, María C.; Escudero, Sara; Cañete, Juan D.; Toribio, María L.; Cases, Ildefonso; Pascual-Montano, Alberto; Pablos, José Luis; Mañes, Santos

    2016-01-01

    Evidence links aryl hydrocarbon receptor (AHR) activation to rheumatoid arthritis (RA) pathogenesis, although results are inconsistent. AHR agonists inhibit pro-inflammatory cytokine expression in macrophages, pivotal cells in RA aetiopathogenesis, which hints at specific circuits that regulate the AHR pathway in RA macrophages. We compared microRNA (miR) expression in CD14+ cells from patients with active RA or with osteoarthritis (OA). Seven miR were downregulated and one (miR-223) upregulated in RA compared to OA cells. miR-223 upregulation correlated with reduced Notch3 and Notch effector expression in RA patients. Overexpression of the Notch-induced repressor HEY-1 and co-culture of healthy donor monocytes with Notch ligand-expressing cells showed direct Notch-mediated downregulation of miR-223. Bioinformatics predicted the AHR regulator ARNT (AHR nuclear translocator) as a miR-223 target. Pre-miR-223 overexpression silenced ARNT 3’UTR-driven reporter expression, reduced ARNT (but not AHR) protein levels and prevented AHR/ARNT-mediated inhibition of pro-inflammatory cytokine expression. miR-223 counteracted AHR/ARNT-induced Notch3 upregulation in monocytes. Levels of ARNT and of CYP1B1, an AHR/ARNT signalling effector, were reduced in RA compared to OA synovial tissue, which correlated with miR-223 levels. Our results associate Notch signalling to miR-223 downregulation in RA macrophages, and identify miR-223 as a negative regulator of the AHR/ARNT pathway through ARNT targeting. PMID:26838552

  8. Isolation of generator-produced 223Ra in 0.9-% NaCl solutions containing EDTA for direct radiotherapeutic studies

    A novel approach to the preparation of the α-emitting radionuclide 223Ra was proposed to be applied for direct treatment of bone metastases and targeted alpha-radioimmunotherapy. The tandem generator system based on ion exchange columns was developed for isolation of 223Ra in the form of 223Ra-EDTA complexes in 0.9 % NaCl solutions at pH = 7.4-8.0. Advantages of the method for routine laboratory work and clinical implementations are discussed. (author)

  9. 6p22.3 amplification as a biomarker and potential therapeutic target of advanced stage bladder cancer

    Zhang, Jianmin; Underwood, Willie; Yang, Nuo; Frangou, Costa; Eng, Kevin; Head, Karen; Bollag, Roni J.; Kavuri, Sravan K.; Rojiani, Amyn M.; Li, Yingwei; Yan, Li; Hill, Annette; Woloszynska-Read, Anna; Wang, Jianmin; Liu, Song; Trump, Donald L.; Candace, Johnson S.

    2013-01-01

    Genetic and epigenetic alterations have been identified as to contribute directly or indirectly to the generation of transitional cell carcinoma of the urinary bladder (TCC-UB). In a comparative fashion much less is known about copy number alterations in TCC-UB, but it appears that amplification of chromosome 6p22 is one of the most frequent changes. Using fluorescence in situ hybridization (FISH) analyses, we evaluated chromosomal 6p22 amplification in a large cohort of bladder cancer patients with complete surgical staging and outcome data. We have also used shRNA knockdown candidate oncogenes in the cell based study. We found that amplification of chromosome 6p22.3 is significantly associated with the muscle-invasive transitional cell carcinoma of the urinary bladder (TCC-UB) (22%) in contrast to superficial TCC-UB (9%) (p=7.2-04). The rate of 6p22.3 amplification in pN>1 patients (32%) is more than twice that in pN0 (16%) patients (p=0.05). Interestingly, we found that 6p22.3 amplification is as twice as high (p=0.0201) in African American (AA) than European American (EA) TCC-UB patients. Moreover, we showed that the expression of some candidate genes (E2F3, CDKAL1 and Sox4) in the 6p22.3 region is highly correlated with the chromosomal amplification. In particular, knockdown of E2F3 inhibits cell proliferation in a 6p22.3-dependent manner, whereas knockdown of CDKAL1 and Sox4 has no effect on cell proliferation. Using gene expression profiling, we further identified some common as well as distinctive subset targets of the E2F3 family members. In summary, our data indicate that E2F3 is a key regulator of cell proliferation in a subset of bladder cancer and the 6p22.3 amplicon is a biomarker of aggressive phenotype in this tumor type. PMID:24231253

  10. Dosimetric study of radium-223 chloride and 153Sm-EDTMP for treatment of bone metastases using MCNPX code and available experimental data

    Radium-223 chloride is an alpha emitter radiopharmaceutical which recently has been used for treatment of bone metastases. Absorbed and equivalent doses of 223RaCl2 were studied using MCNPX Monte Carlo code in a phantom consisted of bone marrow, bone and soft tissue. 153Sm-EDTMP as a beta emitter was also simulated for comparison with 223RaCl2. Results show that by injection of 100 µCi 223RaCl2 against 70 mCi 153Sm-EDTMP to a 70 kg adult man, equivalent dose of metastatic bone can be increased about six times without significant increase in delivered dose to healthy tissues. These results demonstrated acceptable agreement with experimental data. (author)

  11. Multidrug resistant 2009 A/H1N1 influenza clinical isolate with a neuraminidase I223R mutation retains its virulence and transmissibility in ferrets.

    Erhard van der Vries

    2011-09-01

    Full Text Available Only two classes of antiviral drugs, neuraminidase inhibitors and adamantanes, are approved for prophylaxis and therapy against influenza virus infections. A major concern is that influenza virus becomes resistant to these antiviral drugs and spreads in the human population. The 2009 pandemic A/H1N1 influenza virus is naturally resistant to adamantanes. Recently a novel neuraminidase I223R mutation was identified in an A/H1N1 virus showing cross-resistance to the neuraminidase inhibitors oseltamivir, zanamivir and peramivir. However, the ability of this virus to cause disease and spread in the human population is unknown. Therefore, this clinical isolate (NL/2631-R223 was compared with a well-characterized reference virus (NL/602. In vitro experiments showed that NL/2631-I223R replicated as well as NL/602 in MDCK cells. In a ferret pathogenesis model, body weight loss was similar in animals inoculated with NL/2631-R223 or NL/602. In addition, pulmonary lesions were similar at day 4 post inoculation. However, at day 7 post inoculation, NL/2631-R223 caused milder pulmonary lesions and degree of alveolitis than NL/602. This indicated that the mutant virus was less pathogenic. Both NL/2631-R223 and a recombinant virus with a single I223R change (recNL/602-I223R, transmitted among ferrets by aerosols, despite observed attenuation of recNL/602-I223R in vitro. In conclusion, the I223R mutated virus isolate has comparable replicative ability and transmissibility, but lower pathogenicity than the reference virus based on these in vivo studies. This implies that the 2009 pandemic influenza A/H1N1 virus subtype with an isoleucine to arginine change at position 223 in the neuraminidase has the potential to spread in the human population. It is important to be vigilant for this mutation in influenza surveillance and to continue efforts to increase the arsenal of antiviral drugs to combat influenza.

  12. STRUCTURAL CONSEQUENCES OF THE POLYMORPHISM Q223R IN THE HUMAN LEPTIN RECEPTOR: A MOLECULAR DYNAMICS STUDY

    Jonathan P. Carrillo-Vázquez; Brenda Chimal-Vega; Beatriz Zamora-López; Marchat, Laurence A.; Claudia G. Benítez-Cardoza; César A.S. Reyes-López; Absalom Zamorano-Carrillo

    2013-01-01

    Leptin Receptor (LEPR) is a component of a signaling pathway related to appetite and energy expenditure. Single Nucleotide Polymorphisms (SNP) of Leptin receptor gene (lepr) have been proposed as possible modulator of adipose tissue and body weight. The main phenomenological consequence reported of these SNPs is the modulation of the LEP-LEPR interaction promoting the weight gain. Particularly, Q223R polymorphism has been associated with human obesity in some populations. In this work, we ana...

  13. Notch and NF-kB signaling pathways regulate miR-223/FBXW7 axis in T-cell acute lymphoblastic leukemia.

    Kumar, V; Palermo, R; Talora, C; Campese, A F; Checquolo, S; Bellavia, D; Tottone, L; Testa, G; Miele, E; Indraccolo, S; Amadori, A; Ferretti, E; Gulino, A; Vacca, A; Screpanti, I

    2014-12-01

    Notch signaling deregulation is linked to the onset of several tumors including T-cell acute lymphoblastic leukemia (T-ALL). Deregulated microRNA (miRNA) expression is also associated with several cancers, including leukemias. However, the transcriptional regulators of miRNAs, as well as the relationships between Notch signaling and miRNA deregulation, are poorly understood. To identify miRNAs regulated by Notch pathway, we performed microarray-based miRNA profiling of several Notch-expressing T-ALL models. Among seven miRNAs, consistently regulated by overexpressing or silencing Notch3, we focused our attention on miR-223, whose putative promoter analysis revealed a conserved RBPjk binding site, which was nested to an NF-kB consensus. Luciferase and chromatin immunoprecipitation assays on the promoter region of miR-223 show that both Notch and NF-kB are novel coregulatory signals of miR-223 expression, being able to activate cooperatively the transcriptional activity of miR-223 promoter. Notably, the Notch-mediated activation of miR-223 represses the tumor suppressor FBXW7 in T-ALL cell lines. Moreover, we observed the inverse correlation of miR-223 and FBXW7 expression in a panel of T-ALL patient-derived xenografts. Finally, we show that miR-223 inhibition prevents T-ALL resistance to γ-secretase inhibitor (GSI) treatment, suggesting that miR-223 could be involved in GSI sensitivity and its inhibition may be exploited in target therapy protocols. PMID:24727676

  14. Radiation dosimetry in digital breast tomosynthesis: Report of AAPM Tomosynthesis Subcommittee Task Group 223

    Sechopoulos, Ioannis, E-mail: isechop@emory.edu [Departments of Radiology and Imaging Sciences, Hematology and Medical Oncology and Winship Cancer Institute, Emory University, 1701 Uppergate Drive Northeast, Suite 5018, Atlanta, Georgia 30322 (United States); Sabol, John M. [GE Healthcare, Global Diagnostic X-Ray, Mailstop W-701, 3000 North Grandview Boulevard, Waukesha, Wisconsin 53188 (United States); Berglund, Johan [Research and Development, Philips Women' s Healthcare, Solna (Sweden); Bolch, Wesley E. [J. Crayton Pruitt Family Department of Biomedical Engineering, University of Florida, Gainesville, Florida 32611 (United States); Brateman, Libby [University of Florida, Gainesville, Florida 32611 (United States); Christodoulou, Emmanuel; Goodsitt, Mitchell [Department of Radiology, University of Michigan, 1500 East Medical Center Drive, Ann Arbor, Michigan 48109 (United States); Flynn, Michael [Department of Radiology, Henry Ford Health System, Radiology Research 2F, 1 Ford Place, Detroit, Michigan 48202 (United States); Geiser, William [Department of Imaging Physics, The University of Texas MD Anderson Cancer Center, Houston, Texas 77030-4009 (United States); Kyle Jones, A. [Department of Imaging Physics, The University of Texas MD Anderson Cancer Center, Houston, Texas 77030 (United States); Lo, Joseph Y.; Paul Segars, W. [Department of Radiology, Medical Physics Graduate Program, and Department of Biomedical Engineering, Carl E. Ravin Advanced Imaging Laboratories, Duke University, Durham, North Carolina 27705 (United States); Maidment, Andrew D. A. [Department of Radiology, Perelman School of Medicine at the University of Pennsylvania, Philadelphia, Pennsylvania 19104-4206 (United States); Nishino, Kazuyoshi [R and D X-ray Products Group, Shimadzu Corporation, Tokyo (Japan); Nosratieh, Anita [Biomedical Engineering Graduate Group, Department of Radiology, University of California, Davis, California 95817 (United States); and others

    2014-09-15

    The radiation dose involved in any medical imaging modality that uses ionizing radiation needs to be well understood by the medical physics and clinical community. This is especially true of screening modalities. Digital breast tomosynthesis (DBT) has recently been introduced into the clinic and is being used for screening for breast cancer in the general population. Therefore, it is important that the medical physics community have the required information to be able to understand, estimate, and communicate the radiation dose levels involved in breast tomosynthesis imaging. For this purpose, the American Association of Physicists in Medicine Task Group 223 on Dosimetry in Tomosynthesis Imaging has prepared this report that discusses dosimetry in breast imaging in general, and describes a methodology and provides the data necessary to estimate mean breast glandular dose from a tomosynthesis acquisition. In an effort to maximize familiarity with the procedures and data provided in this Report, the methodology to perform the dose estimation in DBT is based as much as possible on that used in mammography dose estimation.

  15. Studying Gender in Conference Talks -- data from the 223rd meeting of the American Astronomical Society

    Davenport, James R A; Grand, Erin; Hagen, Alex; Poppenhaeger, Katja; Watkins, Laura L

    2014-01-01

    We present a study on the gender balance, in speakers and attendees, at the recent major astronomical conference, the American Astronomical Society meeting 223, in Washington, DC. We conducted an informal survey, yielding over 300 responses by volunteers at the meeting. Each response included gender data about a single talk given at the meeting, recording the gender of the speaker and all question-askers. In total, 225 individual AAS talks were sampled. We analyze basic statistical properties of this sample. We find that the gender ratio of the speakers closely matched the gender ratio of the conference attendees. The audience asked an average of 2.8 questions per talk. Talks given by women had a slightly higher number of questions asked (3.2$\\pm$0.2) than talks given by men (2.6$\\pm$0.1). The most significant result from this study is that while the gender ratio of speakers very closely mirrors that of conference attendees, women are under-represented in the question-asker category. We interpret this to be a...

  16. Six- and three-hourly meteorological observations from 223 USSR stations

    Razuvaev, V.N.; Apasova, E.B.; Martuganov, R.A. [All-Russian Research Inst. of Hydrometeorologicl Information, Obninsk (Russia). World Data Centre; Kaiser, D.P. [Oak Ridge National Lab., TN (United States)

    1995-04-01

    This document describes a database containing 6- and 3-hourly meteorological observations from a 223-station network of the former Soviet Union. These data have been made available through cooperation between the two principal climate data centers of the United States and Russia: the National Climatic Data Center (NCDC), in Asheville, North Carolina, and the All-Russian Research Institute of Hydrometeorological Information -- World Data Centre (RIHMI-WDC) in Obninsk. Station records consist of 6- and 3-hourly observations of some 24 meteorological variables including temperature, weather type, precipitation amount, cloud amount and type, sea level pressure, relative humidity, and wind direction and speed. The 6-hourly observations extend from 1936 to 1965; the 3-hourly observations extend from 1966 through the mid-1980s (1983, 1984, 1985, or 1986; depending on the station). These data have undergone extensive quality assurance checks by RIHMI-WDC, NCDC, and the Carbon Dioxide Information Analysis Center (CDIAC). The database represents a wealth of meteorological information for a large and climatologically important portion of the earth`s land area, and should prove extremely useful for a wide variety of regional climate change studies. These data are available free of charge as a numeric data package (NDP) from CDIAC. The NDP consists of this document and 40 data files that are available via the Internet or on 8mm tape. The total size of the database is {approximately}2.6 gigabytes.

  17. Analysis of Gln223Agr Polymorphism of Leptin Receptor Gene in Type II Diabetic Mellitus Subjects among Malaysians

    Chong Pei Pei

    2013-09-01

    Full Text Available Leptin is known as the adipose peptide hormone. It plays an important role in the regulation of body fat and inhibits food intake by its action. Moreover, it is believed that leptin level deductions might be the cause of obesity and may play an important role in the development of Type 2 Diabetes Mellitus (T2DM, as well as in cardiovascular diseases (CVD. The Leptin Receptor (LEPR gene and its polymorphisms have not been extensively studied in relation to the T2DM and its complications in various populations. In this study, we have determined the association of Gln223Agr loci of LEPR gene in three ethnic groups of Malaysia, namely: Malays, Chinese and Indians. A total of 284 T2DM subjects and 281 healthy individuals were recruited based on International Diabetes Federation (IDF criteria. Genomic DNA was extracted from the buccal specimens of the subjects. The commercial polymerase chain reaction (PCR method was carried out by proper restriction enzyme MSP I to both amplify and digest the Gln223Agr polymorphism. The p-value among the three studied races was 0.057, 0.011 and 0.095, respectively. The values such as age, WHR, FPG, HbA1C, LDL, HDL, Chol and Family History were significantly different among the subjects with Gln223Agr polymorphism of LEPR (p < 0.05.

  18. Biocontrol of Potato Common Scab is Associated with High Pseudomonas fluorescens LBUM223 Populations and Phenazine-1-Carboxylic Acid Biosynthetic Transcript Accumulation in the Potato Geocaulosphere.

    Arseneault, Tanya; Goyer, Claudia; Filion, Martin

    2016-09-01

    Pseudomonads are often used as biocontrol agents because they display a broad range of mechanisms to control diseases. Common scab of potato, caused by Streptomyces scabies, was previously reported to be controlled by Pseudomonas fluorescens LBUM223 through phenazine-1-carboxylic acid (PCA) production. In this study, we aimed at characterizing the population dynamics of LBUM223 and the expression of phzC, a key gene involved in the biosynthesis of PCA, in the rhizosphere and geocaulosphere of potato plants grown under controlled and field conditions. Results obtained from controlled experiments showed that soil populations of LBUM223 significantly declined over a 15-week period. However, at week 15, the presence of S. scabies in the geocaulosphere was associated with significantly higher populations of LBUM223 than when the pathogen was absent. It also led to the detection of significantly higher phzC gene transcript numbers. Under field conditions, soil populations of LBUM223 followed a similar decline in time when a single inoculation was applied in spring but remained stable when reinoculated biweekly, which also led to greater phzC gene transcripts accumulation. Taken together, our findings suggest that LBUM223 must colonize the potato geocaulosphere at high levels (10(7) bacteria/g of soil) in order to achieve biocontrol of common scab through increased PCA production. PMID:27088392

  19. Synthesis and characterization of lanthanum phosphate nanoparticles as carriers for 223Ra and 225Ra for targeted alpha therapy

    Introduction: Targeted alpha therapy (TAT) has the potential for killing micro-metastases with minimum collateral damage to surrounding healthy tissue. In-vivo generator radionuclides, such as223Ra, 225Ra, and 225Ac, are of special interest for radiotherapeutic applications as they emit multiple α-particles during their decay. Utilizing appropriate carriers capable of retaining both the parent radioisotope as well as daughter products is important for the effective delivery of the radioisotope to the tumor site while mitigating global in vivo radiotoxicity. In this work, LaPO4 core and core + 2 shells nanoparticles (NPs) (NPs with 2 layers of cold LaPO4 deposited on the core surfaces) were synthesized containing either 223Ra or225Ra/225Ac, and the retention of the parents and daughters within the NPs in vitro was investigated. Methods: Core LaPO4 NPs were synthesized in aqueous solution by reacting 1 equivalent of La(NO3)3, along with few microcuries of either 223Ra or 225Ra/225Ac, with 1 equivalent of sodium tripolyphosphate (TPP) under moderate heating and purified by membrane dialysis. Core-shell NPs were also synthesized with one (core + 1 shell) and two (core + 2 shells) cold LaPO4 layers deposited onto the radioactive cores. The NPs were then characterized by transmission electron microscopy (TEM) and powder x-ray diffraction (XRD). Identification and quantification of radioactive parents and daughters released from the NPs in vitro were investigated using gamma-ray spectroscopy. Results: XRD and TEM analysis revealed that the NPs crystallized in the rhabdophane phase with mean diameters of 3.4 and 6.3 nm for core and core + 2 shells, respectively. The core LaPO4 NPs retained up to 88% of 223Ra over 35 days. However, in the core + 2 shells NPs, the retention of 223Ra and its daughter, 211Pb, was improved to > 99.9% over 27 days. Additionally, the retention of 225Ra/225Ac parents was > 99.98% and ~ 80% for the 221Fr and 213Bi daughters over 35 days for the

  20. Dosimetry of bone metastases in targeted radionuclide therapy with alpha-emitting {sup 223}Ra-dichloride

    Pacilio, Massimiliano [Azienda Ospealiera San Camillo Forlianini, Rome (Italy). Dept. of Medical Physics; Ventroni, Guido; Mango, Lucio [Azienda Ospealiera San Camillo Forlianini, Rome (Italy). Dept. of Nuclear Medicin; De Vincentis, Giuseppe; Di Castro, Elisabetta; Frantellizzi, Viviana; Follacchio, Giulia Anna; Garkavaya, Tatiana [Rome Univ. (Italy). Dept. of Radiological, Oncological and Anatomo Pathological Sciences; Cassano, Bartolomeo; Lorenzon, Leda [Rome Univ. (Italy). Postgraduate School of Medical Physics; Pellegrini, Rosanna; Pani, Roberto [Rome Univ. (Italy). Dept. of Molecular Medicine; Ialongo, Pasquale [Azienda Ospealiera San Camillo Forlianini, Rome (Italy). Dept. of Radiology

    2016-01-15

    Ra-dichloride is an alpha-emitting radiopharmaceutical used in the treatment of bone metastases from castration-resistant prostate cancer. Image-based dosimetric studies remain challenging because the emitted photons are few. The aim of this study was to implement a methodology for in-vivo quantitative planar imaging, and to assess the absorbed dose to lesions using the MIRD approach. The study included nine Caucasian patients with 24 lesions (6 humeral head lesions, 4 iliac wing lesions, 2 scapular lesions, 5 trochanter lesions, 3 vertebral lesions, 3 glenoid lesions, 1 coxofemoral lesion). The treatment consisted of six injections (one every 4 weeks) of 50 kBq per kg body weight. Gamma-camera calibrations for {sup 223}Ra included measurements of sensitivity and transmission curves. Patients were statically imaged for 30 min, using an MEGP collimator, double-peak acquisition, and filtering to improve the image quality. Lesions were delineated on {sup 99m}Tc-MDP whole-body images, and the ROIs superimposed on the {sup 223}Ra images after image coregistration. The activity was quantified with background, attenuation, and scatter correction. Absorbed doses were assessed deriving the S values from the S factors for soft-tissue spheres of OLINDA/EXM, evaluating the lesion volumes by delineation on the CT images. In 12 lesions with a wash-in phase the biokinetics were assumed to be biexponential, and to be monoexponential in the remainder. The optimal timing for serial acquisitions was between 1 and 5 h, between 18 and 24 h, between 48 and 60 h, and between 7 and 15 days. The error in cumulated activity neglecting the wash-in phase was between 2 % and 12 %. The mean effective half-life (T{sub 1/2eff}) of {sup 223}Ra was 8.2 days (range 5.5-11.4 days). The absorbed dose (D) after the first injection was 0.7 Gy (range 0.2-1.9 Gy). Considering the relative biological effectiveness (RBE) of alpha particles (RBE = 5), D{sub RBE} = 899 mGy/MBq (range 340-2,450 mGy/MBq). The

  1. miR-223 reverses the resistance of EGFR-TKIs through IGF1R/PI3K/Akt signaling pathway.

    Han, Jing; Zhao, Fengyi; Zhang, Jing; Zhu, Haizhen; Ma, Hu; Li, Xuetao; Peng, Lina; Sun, Jianguo; Chen, Zhengtang

    2016-05-01

    Acquired resistance to epidermal growth factor receptor (EGFR) tyrosine kinase inhibitors (TKIs), such as gefitinib and erlotinib, is a critical issue for the treatment of EGFR mutant-positive non-small cell lung cancer (NSCLC). Recent evidence supports the role of microRNA-223 (miR‑223) in modulating chemotherapeutic drug sensitivity, but its role in the resistance to EGFR-TKIs in NSCLC remains unclear. To this end, we investigated the involvement of miR‑223 in erlotinib resistance, using two pairs of TKI-sensitive or resistant cell lines, PC9 vs PC9/ER, and HCC827 vs HCC827/ER, as well as PC9/CD133+, which are lung cancer stem-like cells derived from PC9 cells. Downregulation of miR‑223 expression in PC9/ER and PC9/CD133+ cells was detected, and the reverse correlation of miR-233 and insulin-like growth factor 1 receptor (IGF1R) in these cells was also revealed. Next, levels of IGF1R mRNA and p-Akt were significantly reduced in miR‑223 stably transfected PC9/ER and PC9/CD133+ cells. However, the sensitivity of PC9/ER and PC9/CD133+ cells to erlotinib was partially restored, after overexpression of miR‑223 in those cells. Similar results were also observed in vivo. Furthermore, miR‑223-mediated inhibition of the IGF1R/PI3K/Akt signaling pathway may have been reversed by the agonist of IGF1R in miR‑223 transfected cells. Our findings indicated that downregulation of miR‑223, which can induce activation of the IGF1R/phosphatidylinositol 3-kinase (PI3K)/Akt pathway in PC9/ER and PC9/CD133+ cells, may be responsible for the resistance of PC9/ER and PC9/CD133+ cells to erlotinib, suggesting that miR‑223 is a potential therapeutic target for overcoming EGFR-TKIs resistance. PMID:26936292

  2. Radium-223 in the Treatment of Osteoblastic Metastases: A Critical Clinical Review

    The element radium (Ra) was discovered by the Curies in 1898 and within a decade was in broad scientific testing for the management of several forms of cancer. The compound was known to give rise to a series of both high-energy particulate and penetrating γ-emissions. The latter found an important role in early 20th century brachytherapy applications, but the short-range α-particles seemed much less useful. Although highly cytotoxic when released within a few cell diameters of critical cell nuclei, the dense double-strand break damage was poorly repaired, and concerns regarding treatment-related toxicities and secondary malignancies halted clinical development. Moreover, the most common isotope of Ra has an exceptionally long half-life (>1600 years for 226Ra) that proved daunting when aiming for a systemic cancer therapy. Fortunately, other radium isotopes have more convenient half-lives while still producing cytotoxic α particles. Radium-223 dichloride has a half-life of 11.4 days, and this isotope was identified as an excellent candidate for radionuclide therapy of cancers metastatic to bone. The calcium-mimetic chemical properties of the radium allowed intravenous infusion with rapid uptake to sites of new bone formation. The highly efficient bone localization suggested a potential therapeutic role for osteoblastic bone metastases, and a series of phase 1, 2, and 3 clinical trials was undertaken to explore this possibility. This series of clinical explorations culminated in the ALSYMPCA trial, an international, placebo-controlled, phase 3 study that accrued 921 symptomatic men with bone-metastatic, castrate-resistant prostate cancer. Results of this trial demonstrated a prolongation of overall survival, and regulatory agencies around the world have now approved this product as a treatment for advanced prostate cancer

  3. Radium-223 in the Treatment of Osteoblastic Metastases: A Critical Clinical Review

    Humm, John L. [Department of Medical Physics, Memorial Sloan-Kettering Cancer Center, New York, New York (United States); Sartor, Oliver [Departments of Medicine and Urology, Tulane Cancer Center, Tulane University School of Medicine, New Orleans, Louisiana (United States); Parker, Chris [Department of Clinical Oncology, Institute of Cancer Research, Sutton (United Kingdom); Bruland, Oyvind S. [Department of Oncology, Norwegian Radium Hospital and Institute for Clinical Medicine, University of Oslo, Oslo (Norway); Macklis, Roger, E-mail: rmmacklis@gmail.com [Department of Radiation Oncology, University Hospitals of Cleveland and Case Western Reserve University, Cleveland, Ohio (United States)

    2015-04-01

    The element radium (Ra) was discovered by the Curies in 1898 and within a decade was in broad scientific testing for the management of several forms of cancer. The compound was known to give rise to a series of both high-energy particulate and penetrating γ-emissions. The latter found an important role in early 20th century brachytherapy applications, but the short-range α-particles seemed much less useful. Although highly cytotoxic when released within a few cell diameters of critical cell nuclei, the dense double-strand break damage was poorly repaired, and concerns regarding treatment-related toxicities and secondary malignancies halted clinical development. Moreover, the most common isotope of Ra has an exceptionally long half-life (>1600 years for {sup 226}Ra) that proved daunting when aiming for a systemic cancer therapy. Fortunately, other radium isotopes have more convenient half-lives while still producing cytotoxic α particles. Radium-223 dichloride has a half-life of 11.4 days, and this isotope was identified as an excellent candidate for radionuclide therapy of cancers metastatic to bone. The calcium-mimetic chemical properties of the radium allowed intravenous infusion with rapid uptake to sites of new bone formation. The highly efficient bone localization suggested a potential therapeutic role for osteoblastic bone metastases, and a series of phase 1, 2, and 3 clinical trials was undertaken to explore this possibility. This series of clinical explorations culminated in the ALSYMPCA trial, an international, placebo-controlled, phase 3 study that accrued 921 symptomatic men with bone-metastatic, castrate-resistant prostate cancer. Results of this trial demonstrated a prolongation of overall survival, and regulatory agencies around the world have now approved this product as a treatment for advanced prostate cancer.

  4. Mid-IR Photometry and Near-IR Spectroscopy of the FU Ori Protostar V2775 Ori (HOPS 223)

    Fischer, William J.; Safron, Emily J.; Megeath, S. Thomas; Terebey, Susan; Soto, Edith; Wilson, Thomas L.; Adams, Joseph D.

    2016-02-01

    On 2015 November 20.39, we obtained mid-IR photometry of V2775 Ori (HOPS 223) with the FORCAST instrument aboard SOFIA. This is a low-mass embedded young stellar object that was reported to have undergone a luminosity outburst by Caratti o Garatti et al. (2011, A & A, 526, L1). Fischer et al. (2012, ApJ, 756, 99) dated the beginning of the outburst to between 2005 April and 2007 March and discussed the similarity of its near-IR spectrum to that of FU Orionis.

  5. Superconductivity in 2-2-3 Y2Ba2Cu3O(sub 8+ delta)

    Joshi, H. H.; Baldha, G. J.; Jotania, R. B.; Joshi, S. M.; Mohan, H.; Pandya, P. B.; Pandya, H. N.; Kulkarni, R. G.

    1990-01-01

    Researchers synthesized a new high T(sub c) 2-2-3 superconductor (Y2Ba2Cu3O8+delta) by a special preparation technique and characterized it by ac-susceptibility measurements. Diamagnetism and Meissner effect sets in at low fields and superconducting transition onsets at 90 K. The systematic investigation of the real and imaginary components of ac-susceptibility as a function of temperature and applied ac magnetic field reveals that the magnetic behavior is that of a granular type superconductor.

  6. Leptin receptor polymorphism Gln223Arg (rs1137101) in oral squamous cell carcinoma and potentially malignant oral lesions

    Domingos, Patrícia Luciana Batista; Farias, Lucyana Conceição; Pereira, Camila Santos; das Graças Pena, Geórgia; Reis, Tatiana Carvalho; Silva, Rosângela Ramos Veloso; Fraga, Carlos Alberto de Carvalho; de Souza, Marcela Gonçalves; Soares, Mariana Batista; Jones, Kimberly Marie; Menezes, Elytania Veiga; Nobre, Sérgio Avelino Mota; Rodrigues Neto, João Felício; de Paula, Alfredo Maurício Batista; Velásquez-Meléndez, Jorge Gustavo

    2014-01-01

    The purpose of this study was to assess the LEPR gene Gln223Arg polymorphism (rs1137101) in oral squamous cell carcinoma (OSCC) and in potentially malignant oral lesions (PMOL) in comparison to normal oral mucosa in a Brazilian population. Smokers (n = 89) were selected from a representative sample of 471 individuals from the general population of Montes Claros, Brazil. Participants were age and gender matched to patients with OSCC (n = 25) and oral epithelial dysplasia (n = 25). We investiga...

  7. Nance-Horan syndrome: localization within the region Xp21.1-Xp22.3 by linkage analysis.

    Stambolian, D; Lewis, R. A.; Buetow, K; Bond, A; Nussbaum, R.

    1990-01-01

    Nance-Horan Syndrome (NHS) or X-linked cataract-dental syndrome (MIM 302350) is a disease of unknown pathogenesis characterized by congenital cataracts and dental anomalies. We performed linkage analysis in three kindreds with NHS by using six RFLP markers between Xp11.3 and Xp22.3. Close linkage was found between NHS and polymorphic loci DXS43 (theta = 0 with lod score 2.89), DXS41 (theta = 0 with lod score 3.44), and DXS67 (theta = 0 with lod score 2.74), defined by probes pD2, p99-6, and p...

  8. A late jet rebrightening revealed from multi-wavelength monitoring of the black hole candidate XTE J1752-223

    Russell, D.M.; Curran, P.A.; Muñoz-Darias, T.; Lewis, F.; Motta, S.; Stiele, H.; Belloni, T.; Miller-Jones, J. C. A.; Jonker, P.G.; O'Brien, K; Homan, J.; P. Casella; P Gandhi; Soleri, P.; Markoff, S.

    2011-01-01

    We present optical monitoring of the black hole candidate XTE J1752-223 during its 2009 - 2010 outburst and decay to quiescence. The optical light curve can be described by an exponential decay followed by a plateau, then a more rapid fade towards quiescence. The plateau appears to be due to an extra component of optical emission that brightens and then fades over ~ 40 days. We show evidence for the origin of this optical 'flare' to be the synchrotron jet during the decaying hard state, and w...

  9. Development of separation technology for the removal of radium-223 from decayed thorium-227 in drug formulations. Material screening and method development.

    Frenvik, Janne Olsen; Kristensen, Solveig; Ryan, Olav B

    2016-08-01

    Targeted thorium conjugates are currently being investigated as a new class of alpha-radiopharmaceuticals. The natural decay of thorium-227 ((227)Th) results in the ingrowth of radium-223 ((223)Ra). Consideration must, therefore, be given to define acceptable limits of (223)Ra in the drug product at the time of dose administration. By effective sequestration of (223)Ra, we aim to improve the radiochemical purity and extend the effective user window of drug products containing (227)Th. (223)Ra is the first progeny of (227)Th and the only one with a long half-life (days). We have, therefore, focused on the removal of this specific species since the progenies of (223)Ra will have a very limited lifetime in the formulation once (223)Ra is removed. In this study, we investigated a multitude of materials for their ability to reduce the (223)Ra level by: (1) passive diffusion or (2) by cartridge filtration on gravity columns. In addition, we probe the compatibility of these materials in the presence of antibody trastuzumab to assess the level of protein binding and estimate the quenching of radiolysis by binding of radionuclides. A screening matrix of organic and inorganic materials was established, i.e. strontium and calcium alginate gel beads, distearoyl phosphatidylglycerol (DSPG) liposomes, ceramic hydroxyapatite, Zeolite UOP type 4A and cation exchange resins AG50W-X8 and SOURCE 30S. First, passive diffusional uptake of (223)Ra by suspended materials present in the formulation was measured as a decrease in sample radioactivity after separation. Second, selected materials were packed on gravity columns in order to evaluate the efficiency of column separation versus diffusional adsorption. The retention of (223)Ra and (227)Th were characterized by measuring the radioactivity in the eluate and on the columns. Finally, the compatibility between trastuzumab, as a selected model antibody, and suspensions of the binding materials was analyzed during storage of the drug

  10. Pain, PSA flare, and bone scan response in a patient with metastatic castration-resistant prostate cancer treated with radium-223, a case report

    Radium-223 has been shown to improve overall survival in men with metastatic castration-resistant prostate cancer with symptomatic bone metastases. The bone scan response to radium-223 has only been described in one single center trial of 14 patients, none of whom achieved the outstanding bone scan response presented in the current case. In this case report, we describe a 75 year-old white man with extensively pre-treated metastatic castration-resistant prostate cancer and symptomatic bone metastases who experienced a flare in pain and prostate-specific antigen, followed by dramatic clinical (pain), biochemical (prostate-specific antigen), and imaging (bone scan) response. The flare phenomena and bone scan response we observed have not previously been described with radium-223. This case suggests that the degree and duration of bone scan response may be predictive of overall survival benefit

  11. Reflection Spectroscopy of the Black Hole Binary XTE J1752-223 in the Bright Hard State

    Garcia, Javier; Steiner, James F.; Grinberg, Victoria; McClintock, Jeffrey E.; Dauser, Thomas; Remillard, Ronald A.

    2016-04-01

    During its rise to maximum in 2009, XTE J1752-223 stalled for a full month in the bright hard state at about 30% of its peak (Eddington) luminosity. Along this extended period, 60 RXTE pointed observations showed the luminosity and hardness ratio of the source to be extraordinarily stable, resulting in a unique data set of exceptional quality. We combined all these 300 ks of RXTE data into a single PCA (3-45 keV) spectrum with 82 million counts and a single HEXTE spectrum (20-250 keV) with 10.4 million counts. Using our calibration tools PCACORR and HEXBCORR, we greatly enhanced the sensitivity of the detectors to faint spectral features, such as the Fe line and edge. Fitting the PCA+HEXTE spectrum using an advanced version of our reflection code, which includes a physical model of Comptonization, we constrained: the spin of the black hole (or alternatively the inner radius of the accretion disk); the inclination of the system; the ionization state and Fe abundance of the disk's atmosphere; and the temperature and optical depth of the corona. We compare these results with similar ones we reported earlier for GX 339-4 in the bright hard state. XTE J1752-223 and GX 339-4 are the first two of 29 black hole binaries we propose to study using recalibrated RXTE archival data and our reflection models.

  12. The Gln223Arg polymorphism of the leptin receptor in Pima Indians: influence on energy expenditure, physical activity and lipid metabolism

    Stefan, N; Vozarova, B; Del Parigi, A;

    2002-01-01

    Leptin regulates body weight by its receptor-mediated anorectic, thermogenic and antisteatotic effects. Recently, lower leptin binding to the soluble form of the leptin receptor (LEPR) was shown in carriers of the Arg223-encoding allele of the Gln223Arg polymorphism of the LEPR. To investigate wh...... who had undergone percutaneous fat biopsies from the periumbilical region (n=184). Genotype was not associated with percent body fat (P>0.39), but was associated with 24 h EE, PAL and mean subcutaneous abdominal adipocyte size (SAAS all P...

  13. MiR-223-3p as a Novel MicroRNA Regulator of Expression of Voltage-Gated K+ Channel Kv4.2 in Acute Myocardial Infarction

    Xue Liu

    2016-06-01

    Full Text Available Background/Aims: Acute myocardial infarction (AMI is a devastating cardiovascular disease with a high rate of morbidity and mortality, partly due to enhanced arrhythmogenicity. MicroRNAs (miRNAs have been shown to participate in the regulation of cardiac ion channels and the associated arrhythmias. The purpose of this study was to test our hypothesis that miR-223-3p contributes to the electrical disorders in AMI via modulating KCND2, the gene encoding voltage-gated channel Kv4.2 that carries transient outward K+ current Ito. Methods: AMI model was established in male Sprague-Dawley (SD rats by left anterior descending artery (LAD ligation. Evans blue and TTC staining was used to measure infarct area. Ito was recorded in isolated ventricular cardiomyocytes or cultured neonatal rat ventricular cells (NRVCs by whole-cell patch-clamp techniques. Western blot analysis was employed to detect the protein level of Kv4.2 and real-time RT-PCR to determine the transcript level of miR-223-3p. Luciferase assay was used to examine the interaction between miR-223-3p and KCND2 in cultured NRVCs. Results: Expression of miR-223-3p was remarkably upregulated in AMI relative to sham control rats. On the contrary, the protein level of Kv4.2 and Ito density were significantly decreased in AMI. Consistently, transfection of miR-223-3p mimic markedly reduced Kv4.2 protein level and Ito current in cultured NRVCs. Co-transfection of AMO-223-3p (an antisense inhibitor of miR-223-3p reversed the repressive effect of miR-223-3p. Luciferase assay showed that miR-223-3p, but not the negative control, substantially suppressed the luciferase activity, confirming the direct binding of miR-223-3p to the seed site within the KCND2 sequence. Finally, direct intramuscular injection of AMO-223-3p into the ischemic myocardium to knockdown endogenous miR-223-3p decreased the propensity of ischemic arrhythmias. Conclusions: Upregulation of miR-223-3p in AMI repressed the expression of

  14. Efficient program for decoding the /255, 223/ Reed-Solomon code over GF/2 to the 8th/ with both errors and erasures, using transform decoding

    Miller, R. L.; Truong, T. K.; Reed, I. S.

    1980-07-01

    The paper deals with a method developed for decoding a (255, 223) Reed-Solomon code over GF(2 to the 8th) with both errors and erasures. The matrix of decoding times for correcting errors and erasures of the code using a simplified decoder is presented. It is shown that the algorithm proposed is faster by a factor of from three to seven.

  15. Changes in skeletal tumor activity on {sup 18}F-choline PET/CT in patients receiving {sup 223}radium radionuclide therapy for metastatic prostate cancer

    Miyazaki, Kyle S. [Oncology Research Dept. and Hamamatsu/Queen' s PET Imaging Center, The Queen' s Medical Center, Honolulu (United States); Kang, Yu; Kwee, Sandi A. [Dept. of Medical Physics, School of Allied Health Sciences, University of Nevada Las Vegas, Las Vegas (United States)

    2015-06-15

    Radium-223 dichloride is an alpha-emitting radiopharmaceutical shown to prolong survival in patients with castrate-resistant prostate cancer (CRPC) and symptomatic skeletal metastases. This report describes in two patients the acute changes in bone metastatic activity detected by F-18 choline PET/CT imaging midway during treatment with radium-223 dichloride. In addition to visual and standardized uptake value analysis, changes in the whole-body tumor burden were quantified by measuring the difference in net metabolically active tumor volume (MATV) and total lesion activity (TLA) between pre- and mid-treatment PET scans. After the third dose of radium-223 dichloride, near-total disappearance of abnormal skeletal activity was observed in one case (net MATV change from 260.7 to 0.8 cc; net TLA change from 510.7 to 2.1), while a heterogeneous tumor response was observed in the other (net MATV change from 272.2 to 241.3 cc; net TLA change from 987.1 to 779.4). Corresponding normalization and persistent elevation in serum alkaline phosphatase levels were observed in these cases, respectively. Further research is needed to determine the predictive value of serial F-18 choline PET/CT imaging in patients receiving radium-223 dichloride for CRPC.

  16. Perspectives of using the 223-nm wavelength of the KrCl excimer laser for refractive surgery and for the treatment of some eye diseases

    Bagayev, Sergei N.; Chernikh, Valery V.; Razhev, Alexander M.; Zhupikov, Andrey A.

    2000-06-01

    The new surgical UV ophthalmic laser system Medilex based on the KrCl (223 nm) excimer laser for refractive surgery was created. The comparative analysis of using the UV ophthalmic laser systems Medilex based on the ArF (193 nm) and the KrCl (223 nm) excimer lasers for the correction of refractive errors was performed. The system with the radiation wavelength of 223 nanometer of the KrCl excimer laser for refractive surgery was shown to have several medical and technical advantages over the system with the traditionally used radiation wavelength of 193 nanometer of the ArF excimer laser. In addition the use of the wavelength of 223 nanometer extends functional features of the system, allowing to make not only standard for this type systems surgical and therapeutic procedures but also to treat such ocular diseases as the glaucoma and herpetic keratities. For the UV ophthalmic laser systems Medilex three variations of the beam delivery system including special rotating masks and different beam homogenize systems were developed. All created beam delivery systems are able to make the correction of myopia, hyperopia, astigmatism and myopic or hyperopic astigmatism and may be used for therapeutic procedures. The results of the initial treatments of refractive error corrections using the UV ophthalmic laser systems Medilex for both photorefractive keratectomy (PRK) and LASIK procedures are presented.

  17. Radium-223-Dichloride in Castration Resistant Metastatic Prostate Cancer—Preliminary Results of the Response Evaluation Using F-18-Fluoride PET/CT

    Kalevi Kairemo

    2015-10-01

    Full Text Available The purpose of this study was to evaluate the outcome after Radium-223-dichloride (223RaCl2 treatment of patients with skeletal metastases of castration resistant prostate cancer using whole-body 18F-Fluoride PET/CT. Sodium 18F-fluoride [18F]-NaF PET/CT was performed prior the treatment of 223RaCl2, after the first cycle and after the sixth cycle. The skeletal metastases were analyzed quantitatively using modified PET response evaluation PERCIST criteria. The patients were also analyzed for S-PSA. All ten patients responded in [18F]-NaF scans after 6 cycles, but interim analysis after the 1st cycle did not give additional information about the outcome. The S-PSA decrease correlated with [18F]-NaF response, only 1 patient demonstrated progressive disease, i.e., >25% increase in S-PSA values during 223RaCl2. Our results (although preliminary suggest that 18F-Fluoride PET/CT is useful in the follow-up of castration resistant prostate cancer with skeletal metastases.

  18. miRNA-197 and miRNA-223 Predict Cardiovascular Death in a Cohort of Patients with Symptomatic Coronary Artery Disease.

    Christian Schulte

    Full Text Available Circulating microRNAs (miRNAs have been described as potential diagnostic biomarkers in cardiovascular disease and in particular, coronary artery disease (CAD. Few studies were undertaken to perform analyses with regard to risk stratification of future cardiovascular events. miR-126, miR-197 and miR-223 are involved in endovascular inflammation and platelet activation and have been described as biomarkers in the diagnosis of CAD. They were identified in a prospective study in relation to future myocardial infarction.The aim of our study was to further evaluate the prognostic value of these miRNAs in a large prospective cohort of patients with documented CAD.Levels of miR-126, miR-197 and miR-223 were evaluated in serum samples of 873 CAD patients with respect to the endpoint cardiovascular death. miRNA quantification was performed using real time polymerase chain reaction (RT-qPCR.The median follow-up period was 4 years (IQR 2.78-5.04. The median age of all patients was 64 years (IQR 57-69 with 80.2% males. 38.9% of the patients presented with acute coronary syndrome (ACS, 61.1% were diagnosed with stable angina pectoris (SAP. Elevated levels of miRNA-197 and miRNA-223 reliably predicted future cardiovascular death in the overall group (miRNA-197: hazard ratio (HR 1.77 per one standard deviation (SD increase (95% confidence interval (CI 1.20; 2.60, p = 0.004, C-index 0.78; miRNA-223: HR 2.23 per one SD increase (1.20; 4.14, p = 0.011, C-index 0.80. In ACS patients the prognostic power of both miRNAs was even higher (miRNA-197: HR 2.24 per one SD increase (1.25; 4.01, p = 0.006, C-index 0.89; miRA-223: HR 4.94 per one SD increase (1.42; 17.20, p = 0.012, C-index 0.89.Serum-derived circulating miRNA-197 and miRNA-223 were identified as predictors for cardiovascular death in a large patient cohort with CAD. These results reinforce the assumption that circulating miRNAs are promising biomarkers with prognostic value with respect to future

  19. An N-terminally truncated envelope protein encoded by a human endogenous retrovirus W locus on chromosome Xq22.3

    Roebke Christina

    2010-08-01

    Full Text Available Abstract Background We previously showed that the envelope (env sequence of a human endogenous retrovirus (HERV-W locus on chromosome Xq22.3 is transcribed in human peripheral blood mononuclear cells. The env open reading frame (ORF of this locus is interrupted by a premature stop at codon 39, but otherwise harbors a long ORF for an N-terminally truncated 475 amino acid Env protein, starting at an in-frame ATG at codon 68. We set out to characterize the protein encoded by that ORF. Results Transient expression of the 475 amino acid Xq22.3 HERV-W env ORF produced an N-terminally truncated HERV-W Env protein, as detected by the monoclonal anti-HERV-W Env antibodies 6A2B2 and 13H5A5. Remarkably, reversion of the stop at codon 39 in Xq22.3 HERV-W env reconstituted a full-length HERV-W Xq22.3 Env protein. Similar to the full-length HERV-W Env protein Syncytin-1, reconstituted full-length Xq22.3 HERV-W Env is glycosylated, forms oligomers, and is expressed at the cell surface. In contrast, Xq22.3 HERV-W Env is unglycosylated, does not form oligomers, and is located intracellularly, probably due to lack of a signal peptide. Finally, we reconfirm by immunohistochemistry that monoclonal antibody 6A2B2 detects an antigen expressed in placenta and multiple sclerosis brain lesions. Conclusions A partially defective HERV-W env gene located on chromosome Xq22.3, which we propose to designate ERVWE2, has retained coding capacity and can produce ex vivo an N-terminally truncated Env protein, named N-Trenv. Detection of an antigen by 6A2B2 in placenta and multiple sclerosis lesions opens the possibility that N-Trenv could be expressed in vivo. More generally, our findings are compatible with the idea that defective HERV elements may be capable of producing incomplete HERV proteins that, speculatively, may exert functions in human physiology or pathology.

  20. Stathmin1 plays oncogenic role and is a target of microRNA-223 in gastric cancer.

    Wei Kang

    Full Text Available Stathmin1 (STMN1 is a candidate oncoprotein and prognosis marker in several kinds of cancers. This study was aimed to analyze its expression and biological functions in gastric cancer. The expression of STMN1 was evaluated by qRT-PCR, western blot and immunohistochemistry. The biological function of STMN1 was determined by MTT proliferation assays, monolayer colony formation and cell invasion assays using small interference RNA technique in gastric cancer cell lines. We also explored the regulation of STMN1 expression by microRNA-223. STMN1 was upregulated in gastric cancer cell lines and primary gastric adenocarcinomas. STMN1-positive tumors were more likely to be found in old age group and associated with p53 nuclear expression. In diffuse type gastric adenocarcinomas, STMN1 expression was correlated with age (p = 0.043, T stage (p = 0.004 and lymph node metastasis (p = 0.046. Expression of STMN1 in diffuse type gastric adenocarcinoma was associated with poor disease specific survival by univariate analysis (p = 0.01. STMN1 knockdown in AGS and MKN7 cell lines suppressed proliferation (p<0.001, reduced monolayer colony formation (p<0.001, inhibited cell invasion and migration ability (p<0.001 and induced G1 phase arrest. siSTMN1 could also suppress cell growth in vivo (p<0. 01. We finally confirmed that STMN1 is a putative downstream target of miR-223 in gastric cancer. Our findings supported an oncogenic role of STMN1 in gastric cancer. STMN1 might serve as a prognostic marker and a potential therapeutic target for gastric cancer.

  1. SU-E-T-588: Optimization of Imaging Following 223Ra Administration in Targeted Alpha-Emitting Radionuclide Therapy of Bone Metastases

    Purpose: With a growing demand of alpha-emitting radiopharmaceuticals, especially Xofigo (223RaCl2) which is used in the treatment of metastatic bone disease, the optimization of dosimetry becomes necessary. Indeed, in Europe, as stated on the council directive 2013/59/euratom, exposures of target volumes for radiotherapeutic purposes shall be individually planned taking into account that doses to non-target volumes and tissues shall be as low as reasonably achievable. To that aim, the possibility of imaging 223Ra was first investigated. Methods: The experiments were conducted at the Hopital Europeen Georges Pompidou with an Infinia Hawkeye 4 gamma camera, equipped with a medium-energy collimator. Imaging parameters, such as sensibility, spatial resolution and energy spectrum, were determined using several physical phantoms with a source of 6 MBq of 223Ra. Bone metastases were modeled with a NEMA Body Phantom to investigate image degradation based on the concentration of 223Ra. Results: The acquired energy spectrum allowed to visualize several photon peaks: at 85, 154 and 270 keV. Camera sensitivity measured from the phantom study was 102.3 cps/MBq for the 85 keV ± 20 %, 89.9 cps/MBq for the 154 ± 20 % window and 65.4 cps/MBq for the 270 ± 10 % window. The spatial resolution (full-width at half-maximum) was respectively 1.7, 1.9 and 1.8 cm for the three energy windows. SPECT/CT images of NEMA Body Phantom without and with attenuation have permitted to determine the best reconstruction parameters. Conclusion: This study has demonstrated that it is possible to obtain clinically relevant information from images of 223Ra. All these results will be valuable to analyze biodistribution imaging of the radiopharmaceutical in the patient body and go further in the reconstruction of patient images in order to personalize the dosimetry

  2. A polymorphism in the leptin receptor gene at position 223 is associated with growth hormone replacement therapy responsiveness in idiopathic short stature and growth hormone deficiency patients.

    Su, Pen-Hua; Yang, Shun-Fa; Yu, Ju-Shan; Chen, Suh-Jen; Chen, Jia-Yuh

    2012-12-01

    We hypothesized that responses to growth hormone (GH) therapy by idiopathic short stature (ISS) and growth hormone deficiency (GHD) patients were associated with single nucleotide polymorphisms (SNPs) in the leptin (LEP) and leptin receptor (LEPR) genes. We retrospectively enrolled ISS (n = 32) and GHD (n = 38) patients and forty healthy age-and gender-matched children. They were genotyped for the LEP promoter at nt.-2548, and LEPR K109R and LEPR Q223R polymorphisms. Clinical and laboratory variables were determined before and after 2 years of GH treatment. ISS patients with G/A or A/A genotypes of the LEPR Q223R SNP had a significantly higher height velocity (cm/y) than ISS patients with the G/G genotype at 2 years after GH treatment. For GHD patients, G/A or A/A genotype of the LEPR K109R SNP was associated with higher body weight, higher BMI, and higher weight velocity than patients with the G/G genotype before GH treatment, but not after GH treatment. G/A or A/A genotype of the LEPR Q223R SNP was associated with a significantly higher body weight, higher height velocity before treatment, but not after GH treatment. G/A or A/A genotype of the LEPR Q223R SNP was associated with a significantly higher weight velocity before treatment, but a significantly lower weight velocity was found at 2 years after GH treatment. These results suggest LEPR Q223R SNP (rs1137101) is associated with outcomes of GH replacement therapy in ISS and GHD patients. PMID:23009903

  3. SU-E-T-588: Optimization of Imaging Following 223Ra Administration in Targeted Alpha-Emitting Radionuclide Therapy of Bone Metastases

    Benabdallah, N; Bernardini, M [Hopital Europeen George Pompidou, Paris, Ile de France (France); Desbree, A [Institut de Radioprotection et de Surete Nucleaire, Fontenay-aux-roses, Ile-de-France (France); Labriolle-Vaylet, C de [Hopital Trousseau, Paris, Ile de France (France); Franck, D [Institut de Radioprotection et de Suretu Nucleaire, Fontenay Aux Roses, Ile de France (France)

    2015-06-15

    Purpose: With a growing demand of alpha-emitting radiopharmaceuticals, especially Xofigo ({sup 223}RaCl{sub 2}) which is used in the treatment of metastatic bone disease, the optimization of dosimetry becomes necessary. Indeed, in Europe, as stated on the council directive 2013/59/euratom, exposures of target volumes for radiotherapeutic purposes shall be individually planned taking into account that doses to non-target volumes and tissues shall be as low as reasonably achievable. To that aim, the possibility of imaging {sup 223}Ra was first investigated. Methods: The experiments were conducted at the Hopital Europeen Georges Pompidou with an Infinia Hawkeye 4 gamma camera, equipped with a medium-energy collimator. Imaging parameters, such as sensibility, spatial resolution and energy spectrum, were determined using several physical phantoms with a source of 6 MBq of {sup 223}Ra. Bone metastases were modeled with a NEMA Body Phantom to investigate image degradation based on the concentration of {sup 223}Ra. Results: The acquired energy spectrum allowed to visualize several photon peaks: at 85, 154 and 270 keV. Camera sensitivity measured from the phantom study was 102.3 cps/MBq for the 85 keV ± 20 %, 89.9 cps/MBq for the 154 ± 20 % window and 65.4 cps/MBq for the 270 ± 10 % window. The spatial resolution (full-width at half-maximum) was respectively 1.7, 1.9 and 1.8 cm for the three energy windows. SPECT/CT images of NEMA Body Phantom without and with attenuation have permitted to determine the best reconstruction parameters. Conclusion: This study has demonstrated that it is possible to obtain clinically relevant information from images of {sup 223}Ra. All these results will be valuable to analyze biodistribution imaging of the radiopharmaceutical in the patient body and go further in the reconstruction of patient images in order to personalize the dosimetry.

  4. RADIATION SAFETY CONSIDERATIONS FOR THE USE OF 223RaCl2 DE IN MEN WITH CASTRATION-RESISTANT PROSTATE CANCER

    Dauer, Lawrence T.; Williamson, Matthew J.; Humm, John; O’Donoghue, Joseph; Ghani, Rashid; Awadallah, Robert; Carrasquillo, Jorge; Pandit-Taskar, Neeta; Aksnes, Anne-Kirsti; Biggin, Colin; Reinton, Vigdis; Morris, Michael; St Germain, Jean

    2016-01-01

    The majority of patients with late stage castration-resistant prostate cancer (CRPC) develop bone metastases that often result in significant bone pain. Therapeutic palliation strategies can delay or prevent skeletal complications and may prolong survival. An alpha-particle based therapy, radium-223 dichloride (223RaCl2), has been developed that delivers highly localized effects in target areas and likely reduces toxicity to adjacent healthy tissue, particularly bone marrow. Radiation safety aspects were evaluated for a single comprehensive cancer center clinical phase 1, open-label, single ascending-dose study for three cohorts at 50, 100, or 200 kBq kg−1 body weight. Ten patients received administrations, and six patients completed the study with 1 y follow-up. Dose rates from patients administered 223Ra dichloride were typically less than 2 μSv h−1 MBq−1 on contact and averaged 0.02 μSv h−1 MBq−1 at 1 m immediately following administration. Removal was primarily by fecal excretion, and whole body effective half-lives were highly dependent upon fecal compartment transfer, ranging from 2.5–11.4 d. Radium-223 is safe and straightforward to administer using conventional nuclear medicine equipment. For this clinical study, few radiation protection limitations were recommended post-therapy based on facility evaluations. Specific precautions are dependent on local regulatory authority guidance. Subsequent studies have demonstrated significantly improved overall survival and very low toxicity, suggesting that 223Ra may provide a new standard of care for patients with CRPC and bone metastases. PMID:24562070

  5. Reflections on the therapeutic use of 223RaCl2 for bone metastases resulting from prostate cancer resistant to castration

    In January 2014 the Comision Federal para la Proteccion contra Riesgos Sanitarios of the Ministry of Health in Mexico, authorize the use of 223RaCl2 as the first radiopharmaceutical emitter α for therapeutic purposes in cases of bone metastases resulting from prostate cancer resistant to castration. The paper analyzes the main variables that affect the metrological traceability using activity meters to evaluate the gamma activity of 223RaCl2 in hospitals, because it has a chain of complex decay with alpha, beta and gamma emitters, so was important to verify if a gamma activity measurement for a multiple emitter is reliable to determine the total alpha absorbed dose to bone in a patient. (Author)

  6. Autosomal dominant congenital cataract in a Libyan Jewish family: cosegregation with a reciprocal chromosomal translocation [t(3;5)(p22.3; p15.1)

    Zafer, Emre; Meck, Jeanne; Gerrad, Liora; Pras, Elon; Frydman, Moshe; Reish, Orit; Avni, Isaac; Pras, Eran

    2008-01-01

    Purpose To describe a Jewish family of Libyan ancestry in which autosomal dominant congenital cataract segregates with an apparently balanced reciprocal chromosomal translocation. Methods Detailed family history and clinical data were recorded. Cytogenetic studies were performed on 13 family members. Results Embryonal cataracts cosegregated through three generations with a balanced chromosomal translocation [t(3;5)(p22.3; p15.1)] while the unbalanced translocation product, 46,XY,-5,+der(5)t(3...

  7. Relationships between plasma leptin levels, leptin G2548A, leptin receptor Gln223Arg polymorphisms and gestational diabetes mellitus in Chinese population

    Mei Yang; Songxu Peng; Wei Li; Zhihua Wan; Linlin Fan; Yukai Du

    2016-01-01

    The purposes of this study were to examine concentrations of leptin and biochemical parameters in gestational diabetes mellitus (GDM) patients and normal glucose tolerance (NGT) individuals, and also to explore the links of leptin (LEP) G2548A and leptin receptor (LEPR) Gln223Arg polymorphisms with leptin levels and GDM risk among Chinese. Our study included 357 GDM and 355 NGT individuals who were at 24~30 gestational weeks. Plasma leptin and insulin levels were analyzed by ELISA. Gene polym...

  8. Plasmid stability in immobilized and free recombinant Escherichia coli JM105(pKK223-200): importance of oxygen diffusion, growth rate, and plasmid copy number.

    de Taxis du Poët, P; Arcand, Y; Bernier, R.; Barbotin, J N; Thomas, D.

    1987-01-01

    Stability of the plasmid pKK223-200 in Escherichia coli JM105 was studied for both free and immobilized cells during continuous culture. The relationship between plasmid copy number, xylanase activity, which was coded for by the plasmid, and growth rate and culture conditions involved complex interactions which determined the plasmid stability. Generally, the plasmid stability was enhanced in cultured immobilized cells compared with free-cell cultures. This stability was associated with modif...

  9. RNA Interference of Endochitinases in the Sugarcane Endophyte Trichoderma virens 223 Reduces Its Fitness as a Biocontrol Agent of Pineapple Disease

    Aline S Romão-Dumaresq; Welington Luiz Araújo; Nicholas J Talbot; Thornton, Christopher R.

    2012-01-01

    The sugarcane root endophyte Trichoderma virens 223 holds enormous potential as a sustainable alternative to chemical pesticides in the control of sugarcane diseases. Its efficacy as a biocontrol agent is thought to be associated with its production of chitinase enzymes, including N-acetyl-ß-D-glucosaminidases, chitobiosidases and endochitinases. We used targeted gene deletion and RNA-dependent gene silencing strategies to disrupt N-acetyl-ß-D-glucosaminidase and endochitinase activities of t...

  10. Association of LEP G2548A and LEPR Q223R polymorphisms with cancer susceptibility: evidence from a meta-analysis.

    Jing He

    Full Text Available BACKGROUND: Numerous epidemiological studies have examined associations of genetic variations in LEP (G2548A, -2548 nucleotide upstream of the ATG start site and LEPR (Q223R, nonsynonymous SNP in exon 6 with cancer susceptibility; however, the findings are inconsistent. Therefore, we performed a meta-analysis to comprehensively evaluate such associations. METHODS: We searched published literature from MEDLINE, EMBASE, Web of Science and CBM for eligible publications. We also assessed genotype-based mRNA expression data from HapMap for rs7799039 (G2548A and rs1137101 (Q223R in normal cell lines derived from 270 subjects with different ethnicities. RESULTS: The final analysis included 16 published studies of 6569 cases and 8405 controls for the LEP G2548A and 19 studies of 7504 cases and 9581 controls for the LEPR Q223R. Overall, LEP G2548A was statistically significantly associated with an increased risk of overall cancer (AA vs. GG: OR=1.27, 95% CI=1.05-1.54; recessive model: OR=1.19, 95% CI=1.00-1.41. Further stratifications by cancer type showed an increased risk for prostate cancer (recessive model: OR=1.26, 95% CI=1.05-1.51 but not for other cancers. For LEPR Q223R, no statistical evidence for an association with risk of cancer was found for all; however, further stratification by ethnicity showed an increased risk for Africans but not for other ethnicities. No significantly differences in LEP and LEPR mRNA expression were found among genotypes or by ethnicity. CONCLUSIONS: Despite some limitations, this meta-analysis found some statistical evidence for an association between the LEP 2548AA genotype and overall risk of cancer, particularly for prostate cancer, but given this variant did not have an effect on mRNA expression, this association warrants additional validation in large and well-designed studies.

  11. MULTIWAVELENGTH OBSERVATIONS OF THE BLACK HOLE TRANSIENT XTE J1752–223 DURING ITS 2010 OUTBURST DECAY

    Galactic black hole transients show many interesting phenomena during outburst decays. We present simultaneous X-ray (RXTE, Swift, and INTEGRAL), and optical/near-infrared (O/NIR) observations (SMARTS) of the X-ray transient XTE J1752–223 during its outburst decay in 2010. The multiwavelength observations over 150 days in 2010 cover the transition from soft to hard spectral state. We discuss the evolution of radio emission with respect to the O/NIR light curve which shows several flares. One of those flares is bright and long, starting about 60 days after the transition in X-ray timing properties. During this flare, the radio spectral index becomes harder. Other smaller flares occur along with the X-ray timing transition, and also right after the detection of the radio core. We discuss the significances of these flares. Furthermore, using the simultaneous broadband X-ray spectra including INTEGRAL, we find that a high energy cut-off with a folding energy near 250 keV is necessary around the time that the compact jet is forming. The broadband spectrum can be fitted equally well with a Comptonization model. In addition, using photoelectric absorption edges in the XMM-Newton Reflection Grating Spectrometer X-ray spectra and the extinction of red clump giants in the direction of the source, we find a lower limit on the distance of >5 kpc.

  12. The CALYMHA survey: Ly$\\alpha$ escape fraction and its dependence on galaxy properties at $z=2.23$

    Matthee, Jorryt; Oteo, Ivàn; Best, Philip; Smail, Ian; Röttgering, Huub; Paulino-Afonso, Ana

    2016-01-01

    We present the first results from our CAlibrating LYMan-$\\alpha$ with H$\\alpha$ (CALYMHA) pilot survey at the Isaac Newton Telescope. We measure Ly$\\alpha$ emission for 488 H$\\alpha$ selected galaxies at $z=2.23$ from HiZELS in the COSMOS and UDS fields with a specially designed narrow-band filter ($\\lambda_c$ = 3918 {\\AA}, $\\Delta\\lambda$= 52 {\\AA}). We find 17 dual H$\\alpha$-Ly$\\alpha$ emitters ($f_{\\rm Ly\\alpha} >5\\times10^{-17}$ erg s$^{-1}$ cm$^{-2}$, of which 5 are X-ray AGN). For star-forming galaxies, we find a range of Ly$\\alpha$ escape fractions (f$_{\\rm esc}$, measured with 3$"$ apertures) from $2$\\%$-30$\\%. These galaxies have masses from $3\\times10^8$ M$_{\\odot}$ to 10$^{11}$ M$_{\\odot}$ and dust attenuations E$(B-V)=0-0.5$. Using stacking, we measure a median escape fraction of $1.6\\pm0.5$\\% ($4.0\\pm1.0$\\% without correcting H$\\alpha$ for dust), but show that this depends on galaxy properties. The stacked f$_{\\rm esc}$ tends to decrease with increasing SFR and dust attenuation. However, at the h...

  13. Development and physical analysis of YAC contigs covering 7 Mb of Xp22.3-p22.2

    Herrell, S.; Novo, F.J.; Charlton, R. [Univ. of Cambridge (United Kingdom)] [and others

    1995-01-20

    A total of YAC clones have been isolated from the region of Xp22.2-p22.3 extending from the amelogenin gene locus to DXS31. Restriction analysis of these clones in association with STS contenting and end clone analysis has facilitated the construction of 6 contigs covering a total of 7 Mb in which 20 potential CpG islands have been located. Thirty new STSs have been developed from probe and YAC end clone sequences, and these have been used in the analysis of patients suffering from different combinations of chondrodysplasia punctata, mental retardation, X-linked ichthyosis, and Kallmann syndrome. The results suggest that (1) the gene for chondrodysplasia punctata must lie between the X chromosome pseudoautosomal boundary (PABX) and DXS1145; (2) a gene for mental retardation lies between DXS1145 and the sequence tagged site GS1; and (3) the gene for ocular albinism type 1 lies proximal to the STS G13. The CpG islands within the YAC contigs constitute valuable markers for the potential positions of genes. Genes found associated with any of these potential CpG islands would be possible candidates for the disease genes mentioned above. 47 refs., 3 figs., 5 tabs.

  14. RNA interference of endochitinases in the sugarcane endophyte Trichoderma virens 223 reduces its fitness as a biocontrol agent of pineapple disease.

    Aline S Romão-Dumaresq

    Full Text Available The sugarcane root endophyte Trichoderma virens 223 holds enormous potential as a sustainable alternative to chemical pesticides in the control of sugarcane diseases. Its efficacy as a biocontrol agent is thought to be associated with its production of chitinase enzymes, including N-acetyl-ß-D-glucosaminidases, chitobiosidases and endochitinases. We used targeted gene deletion and RNA-dependent gene silencing strategies to disrupt N-acetyl-ß-D-glucosaminidase and endochitinase activities of the fungus, and to determine their roles in the biocontrol of soil-borne plant pathogens. The loss of N-acetyl-ß-D-glucosaminidase activities was dispensable for biocontrol of the plurivorous damping-off pathogens Rhizoctonia solani and Sclerotinia sclerotiorum, and of the sugarcane pathogen Ceratocystis paradoxa, the causal agent of pineapple disease. Similarly, suppression of endochitinase activities had no effect on R. solani and S. sclerotiorum disease control, but had a pronounced effect on the ability of T. virens 223 to control pineapple disease. Our work demonstrates a critical requirement for T. virens 223 endochitinase activity in the biocontrol of C. paradoxa sugarcane disease, but not for general antagonism of other soil pathogens. This may reflect its lifestyle as a sugarcane root endophyte.

  15. RNA interference of endochitinases in the sugarcane endophyte Trichoderma virens 223 reduces its fitness as a biocontrol agent of pineapple disease.

    Romão-Dumaresq, Aline S; de Araújo, Welington Luiz; Talbot, Nicholas J; Thornton, Christopher R

    2012-01-01

    The sugarcane root endophyte Trichoderma virens 223 holds enormous potential as a sustainable alternative to chemical pesticides in the control of sugarcane diseases. Its efficacy as a biocontrol agent is thought to be associated with its production of chitinase enzymes, including N-acetyl-ß-D-glucosaminidases, chitobiosidases and endochitinases. We used targeted gene deletion and RNA-dependent gene silencing strategies to disrupt N-acetyl-ß-D-glucosaminidase and endochitinase activities of the fungus, and to determine their roles in the biocontrol of soil-borne plant pathogens. The loss of N-acetyl-ß-D-glucosaminidase activities was dispensable for biocontrol of the plurivorous damping-off pathogens Rhizoctonia solani and Sclerotinia sclerotiorum, and of the sugarcane pathogen Ceratocystis paradoxa, the causal agent of pineapple disease. Similarly, suppression of endochitinase activities had no effect on R. solani and S. sclerotiorum disease control, but had a pronounced effect on the ability of T. virens 223 to control pineapple disease. Our work demonstrates a critical requirement for T. virens 223 endochitinase activity in the biocontrol of C. paradoxa sugarcane disease, but not for general antagonism of other soil pathogens. This may reflect its lifestyle as a sugarcane root endophyte. PMID:23110120

  16. Open clusters. II. Fundamental parameters of B stars in Collinder 223, Hogg 16, NGC 2645, NGC 3114, and NGC 6025

    Aidelman, Y.; Cidale, L. S.; Zorec, J.; Panei, J. A.

    2015-05-01

    Context. The knowledge of accurate values of effective temperature, surface gravity, and luminosity of stars in open clusters is very important not only to derive cluster distances and ages but also to discuss the stellar structure and evolution. Unfortunately, stellar parameters are still very scarce. Aims: Our goal is to study five open clusters to derive stellar parameters of the B and Be star population and discuss the cluster properties. In a near future, we intend to gather a statistically relevant samples of Be stars to discuss their origin and evolution. Methods: We use the Barbier-Chalonge-Divan spectrophotometric system, based on the study of low-resolution spectra around the Balmer discontinuity, since it is independent of the interstellar and circumstellar extinction and provides accurate Hertzsprung-Russell diagrams and stellar parameters. Results: We determine stellar fundamental parameters, such as effective temperatures, surface gravities, spectral types, luminosity classes, absolute and bolometric magnitudes and colour gradient excesses of the stars in the field of Collinder 223, Hogg 16, NGC 2645, NGC 3114, and NGC 6025. Additional information, mainly masses and ages of cluster stellar populations, is obtained using stellar evolution models. In most cases, stellar fundamental parameters have been derived for the first time. We also discuss the derived cluster properties of reddening, age and distance. Conclusions: Collinder 223 cluster parameters are overline{E(B-V) = 0.25 ± 0.03} mag and overline{(mv - M_v)0 = 11.21 ± 0.25} mag. In Hogg 16, we clearly distinguish two groups of stars (Hogg 16a and Hogg 16b) with very different mean true distance moduli (8.91 ± 0.26 mag and 12.51 ± 0.38 mag), mean colour excesses (0.26 ± 0.03 mag and 0.63 ± 0.08 mag), and spectral types (B early-type and B late-/A-type stars, respectively). The farthest group could be merged with Collinder 272. NGC 2645 is a young cluster (114 are overline{E(B-V) = 0.10 ± 0

  17. The CALYMHA survey: Lyα escape fraction and its dependence on galaxy properties at z = 2.23

    Matthee, Jorryt; Sobral, David; Oteo, Iván; Best, Philip; Smail, Ian; Röttgering, Huub; Paulino-Afonso, Ana

    2016-05-01

    We present the first results from our CAlibrating LYMan α with Hα (CALYMHA) pilot survey at the Isaac Newton Telescope. We measure Lyα emission for 488 Hα selected galaxies at z = 2.23 from High-z Emission Line Survey in the COSMOS and UDS fields with a specially designed narrow-band filter (λc = 3918 Å, Δλ = 52 Å). We find 17 dual Hα-Lyα emitters [fLyα > 5 × 10-17 erg s-1 cm-2, of which five are X-ray active galactic nuclei (AGN)]. For star-forming galaxies, we find a range of Lyα escape fractions (fesc, measured with 3 arcsec apertures) from 2 to 30 per cent. These galaxies have masses from 3 × 108 M⊙ to 1011 M⊙ and dust attenuations E(B - V) = 0-0.5. Using stacking, we measure a median escape fraction of 1.6 ± 0.5 per cent (4.0 ± 1.0 per cent without correcting Hα for dust), but show that this depends on galaxy properties. The stacked fesc tends to decrease with increasing star formation rate and dust attenuation. However, at the highest masses and dust attenuations, we detect individual galaxies with fesc much higher than the typical values from stacking, indicating significant scatter in the values of fesc. Relations between fesc and UV slope are bimodal, with high fesc for either the bluest or reddest galaxies. We speculate that this bimodality and large scatter in the values of fesc is due to additional physical mechanisms such as outflows facilitating fesc for dusty/massive systems. Lyα is significantly more extended than Hα and the UV. fesc continues to increase up to at least 20 kpc (3σ, 40 kpc [2σ]) for typical star-forming galaxies and thus the aperture is the most important predictor of fesc.

  18. Do clinicians and patients agree regarding symptoms? A comparison after definitive radiochemotherapy in 223 uterine cervical cancer patients

    Background: In clinical cancer research of morbidity, low associations between clinician-assessed toxicity/morbidity and patient-reported symptoms are consistently described in the literature. While morbidity grading systems are supposed to follow more or less objective criteria, patient reported symptoms inherently are based on a subjective self-evaluation of the impact on quality of life. The aim of this study was to focus on major discrepancies with high clinical relevance and to evaluate its impact with regard to underreporting of morbidity. Material and methods: Early morbidity assessed by clinicians with CTCAEv.3 and patient reported quality of life (EORTC-QLQ-C30/CX24) were compared regarding 12 overlapping symptoms in 223 patients with uterine cervical cancer 3 months after definitive radio(chemo)therapy in the ongoing EMBRACE study. Mismatches showing discrepancies between both grading systems were classified, if patients reported substantial symptoms (quite a bit/very much) and CTCAE grading was rated G0. Results: In total, 360 substantial symptoms were reported by patients by EORTC-QLQ; 159 (44%) of those were not recognized by CTCAE. Symptoms with the highest occurrence of mismatches overall are urinary frequency, fatigue, and insomnia. Large institutional differences were found, showing two centers with 4 vs. 71% of patients with at least one mismatch. Conclusion: Analysis of mismatches indicated a high risk of underestimation of early morbidity. Thus, nearly half of the patient-reported substantial symptoms were not recognized by CTCAE scoring (G0) 3 months after treatment. Prospective assessment of morbidity in clinical studies should, therefore, integrate patient reported symptoms to receive a complete and comprehensive picture. (orig.)

  19. Dosimetric characterization of a 2-D array of 223 solid state detectors for daily morning checks in Tomo Therapy equipment

    Tomo Therapy is a new technique for the cancer treatment; however, the equipment must meet nearly all mechanical and dosimetric characteristics of a conventional linear accelerator for medical use. Daily quality controls are vital to the good operation of the equipment and thus guarantee excellent quality in the daily delivery of treatments. This paper presents the procedure of the dosimetric characterization of a two-dimensional array of 223 solid state detectors, called TomoDose of the Sun Nuclear Company. Dosimetric important criteria are established to perform these checks quickly and accurately. Dosimetric tests proposed are: repeatability, linearity, dependence of Sad and SSD. Some results are compared with readings of the ionization chamber Exradim A1SL. Finally the results of 30 consecutive days are presented to establish criteria for evidence of dose, field size, symmetry and flattening of the radiation beam on Tomo Therapy equipment. Expected values for daily verification are: Dose constancy of 194.89 c Gy, σ= 1.31 c Gy, symmetry in the X axis of -0.19 %, σ=0.08 %, symmetry in the Y axis of 1.66 %, σ= 0.05 %, flattened in the X axis of 25.71 %, σ= 0.05 % and flattened in the Y axis of 6.41 %, σ= 10.23 %. Field sizes obtained were 40.45 cm in the X axis and 5.10 on the Y axis, with standard deviations of 0.02 cm and 0.01 cm, respectively. TomoDose dosimetric values, compared to the values obtained with ionization chamber, presented differences smaller than 2%. (Author)

  20. Do clinicians and patients agree regarding symptoms? A comparison after definitive radiochemotherapy in 223 uterine cervical cancer patients

    Kirchheiner, K.; Poetter, R. [Medical Univ. Vienna (Austria). Dept. of Radiotherapy; Nout, R. [University Medical Center Leiden (Netherlands). Dept. of Clinical Oncology; Lindegaard, J. [University Hospital Aarhus (Denmark). Dept. of Oncology; Petric, P. [Institute of Oncology Ljubljana (Slovenia). Dept. of Radiotherapy; Limbergen, E.V. [University Hospital Leuven (Belgium). Dept. of Radiotherapy; Juergenliemk-Schulz, I.M. [University Medical Center Utrecht (Netherlands). Dept. of Radiation Oncology; Haie-Meder, C. [Institut Gustave-Roussy, Villejuif (France). Dept. of Radiotherapy; Doerr, W. [Technische Univ. Dresden (Germany). Dept. of Radiotherapy and Radiooncology

    2012-10-15

    Background: In clinical cancer research of morbidity, low associations between clinician-assessed toxicity/morbidity and patient-reported symptoms are consistently described in the literature. While morbidity grading systems are supposed to follow more or less objective criteria, patient reported symptoms inherently are based on a subjective self-evaluation of the impact on quality of life. The aim of this study was to focus on major discrepancies with high clinical relevance and to evaluate its impact with regard to underreporting of morbidity. Material and methods: Early morbidity assessed by clinicians with CTCAEv.3 and patient reported quality of life (EORTC-QLQ-C30/CX24) were compared regarding 12 overlapping symptoms in 223 patients with uterine cervical cancer 3 months after definitive radio(chemo)therapy in the ongoing EMBRACE study. Mismatches showing discrepancies between both grading systems were classified, if patients reported substantial symptoms (quite a bit/very much) and CTCAE grading was rated G0. Results: In total, 360 substantial symptoms were reported by patients by EORTC-QLQ; 159 (44%) of those were not recognized by CTCAE. Symptoms with the highest occurrence of mismatches overall are urinary frequency, fatigue, and insomnia. Large institutional differences were found, showing two centers with 4 vs. 71% of patients with at least one mismatch. Conclusion: Analysis of mismatches indicated a high risk of underestimation of early morbidity. Thus, nearly half of the patient-reported substantial symptoms were not recognized by CTCAE scoring (G0) 3 months after treatment. Prospective assessment of morbidity in clinical studies should, therefore, integrate patient reported symptoms to receive a complete and comprehensive picture. (orig.)

  1. Distribution of (223)Ra and (224)Ra in the Bo Sea embayment in Tianjin and its implication of submarine groundwater discharge.

    Liu, Lingling; Yi, Lixin; Cheng, Xiaoqing; Tang, Guoqiang

    2015-12-01

    Submarine groundwater discharge (SGD) is now recognized as an important pathway between land and sea. In this study, in order to analyze the distribution of naturally occurring short-lived radium isotopes and the relative SGD effect in Bo Sea embayment, (223)Ra and (224)Ra were measured in three parts of the embayment with the radium-delayed coincidence counting (RaDeCC) system. Subsequently, the mixing process was studied by the calculation of diffusion coefficients (Kx and Kz) and advection velocities (Vx and Vz) based on the 2D advection-diffusion model. Additionally, the apparent residence ages and SGD flux were quantified based on the (224)Ra and (223)Ra activities. The results showed that the Ra activities exponentially decreased with the distance offshore, and both the Kx and Vx took the order of northern part > southern part > middle part. In vertical direction, there was the maximum value of Vz and minimum Kz in middle part and the maximum Kz and minimum Vz in southern part. The average ages for the northern, middle and southern parts were 4.28, 7.38 and 3.73 days, respectively. The final SGD flux yielded by (224)Ra was 0.09, 0.01 and 0.03 m d(-1) in the northern, middle and southern parts, respectively. The SGD flux yielded by (223)Ra was 0.08, 0.01 and 0.03 m d(-1) in northern, middle and southern parts, respectively. The result indicates that there is the fastest exchange rate and the biggest SGD flux in the southern part in Bo Sea embayment. PMID:26318773

  2. C/EBPa-mediated activation of microRNAs 34a and 223 inhibits Lef1 expression to achieve efficient reprogramming into macrophages.

    Rodriguez-Ubreva, Javier; Ciudad, Laura; van Oevelen, Chris; Parra, Maribel; Graf, Thomas; Ballestar, Esteban

    2014-03-01

    MicroRNAs (miRNAs) exert negative effects on gene expression and influence cell lineage choice during hematopoiesis. C/EBPa-induced pre-B cell-to-macrophage transdifferentiation provides an excellent model to investigate the contribution of miRNAs to hematopoietic cell identity, especially because the two cell types involved fall into separate lymphoid and myeloid branches. In this process, efficient repression of the B cell-specific program is essential to ensure transdifferentation and macrophage function. miRNA profiling revealed that upregulation of miRNAs is highly predominant compared with downregulation and that C/EBPa directly regulates several upregulated miRNAs. We also determined that miRNA 34a (miR-34a) and miR-223 sharply accelerate C/EBPa-mediated transdifferentiation, whereas their depletion delays this process. These two miRNAs affect the transdifferentiation efficiency and activity of macrophages, including their lipopolysaccharide (LPS)-dependent inflammatory response. miR-34a and miR-223 directly target and downregulate the lymphoid transcription factor Lef1, whose ectopic expression delays transdifferentiation to an extent similar to that seen with miR-34a and miR-223 depletion. In addition, ectopic introduction of Lef1 in macrophages causes upregulation of B cell markers, including CD19, Pax5, and Ikzf3. Our report demonstrates the importance of these miRNAs in ensuring the erasure of key B cell transcription factors, such as Lef1, and reinforces the notion of their essential role in fine-tuning the control required for establishing cell identity. PMID:24421386

  3. Reflections on the therapeutic use of {sup 223}RaCl{sub 2} for bone metastases resulting from prostate cancer resistant to castration; Reflexiones sobre el uso terapeutico de {sup 223}RaCl{sub 2} para metastasis osea derivada de cancer de prostata resistente a la castracion

    Astudillo V, A. J.; Paredes G, L., E-mail: armando.astudillo@inin.gob.mx [ININ, Carretera Mexico-Toluca s/n, 52750 Ocoyoacac, Estado de Mexico (Mexico)

    2015-10-15

    In January 2014 the Comision Federal para la Proteccion contra Riesgos Sanitarios of the Ministry of Health in Mexico, authorize the use of {sup 223}RaCl{sub 2} as the first radiopharmaceutical emitter α for therapeutic purposes in cases of bone metastases resulting from prostate cancer resistant to castration. The paper analyzes the main variables that affect the metrological traceability using activity meters to evaluate the gamma activity of {sup 223}RaCl{sub 2} in hospitals, because it has a chain of complex decay with alpha, beta and gamma emitters, so was important to verify if a gamma activity measurement for a multiple emitter is reliable to determine the total alpha absorbed dose to bone in a patient. (Author)

  4. Untersuchungen zur Funktion der MicroRNAs miR-199a/b-3p und miR-223 im kardiovaskulären System

    Leierseder, Simon Johannes

    2016-01-01

    In MicroRNA-Expressionsanalysen an isolierten Herzzellen wurden miR-199a/b 3p und miR-223 als hochgradig in kardialen Fibroblasten gegenüber Kardiomyozyten angereicherte MicroRNAs identifiziert und deshalb für weiterführende Studien ausgewählt. Die Ergebnisse von Untersuchungen an kultivierten Fibroblasten und in Mausmodellen für kardialen Stress legen nahe, dass beide MicroRNAs wichtige Rollen im Herz übernehmen. Darüber hinaus zeigte die Untersuchung von Blutplättchen und Megakaryozyten, da...

  5. Multidrug resistant 2009 a/h1n1 influenza clinical isolate with a neuraminidase i223r mutation retains its virulence and transmissibility in ferrets

    Vries, Erhard; Kroeze, E.J.B.V.; Stittelaar, Koert; Linster, Martin; Linden, A; Schrauwen, Eefje; Leijten, Lonneke; Amerongen, Geert; Schutten, Martin; Kuiken, Thijs; Osterhaus, Albert; Fouchier, Ron; Boucher, Charles; Herfst, Sander

    2011-01-01

    textabstractOnly two classes of antiviral drugs, neuraminidase inhibitors and adamantanes, are approved for prophylaxis and therapy against influenza virus infections. A major concern is that influenza virus becomes resistant to these antiviral drugs and spreads in the human population. The 2009 pandemic A/H1N1 influenza virus is naturally resistant to adamantanes. Recently a novel neuraminidase I223R mutation was identified in an A/H1N1 virus showing cross-resistance to the neuraminidase inh...

  6. Newly developed semi-empirical formulas for (, ) at 17.9 MeV and (, ) at 22.3 MeV reaction cross-sections

    Eyyup Tel; Abdullah Aydin; E Gamze Aydin; Abdullah Kaplan; Ömer Yavaş; İskender A Reyhancan

    2010-06-01

    In this study, we have investigated the asymmetry term effect for the (, ) and (, ) reaction cross-sections and obtained new coefficients for the (, ) and (, ) reaction cross-sections at 17.9 and 22.3 MeV energies. We have suggested semi-empirical formulas including the non-elastic effects of optical model found by fitting two parameters for proton-induced reactions. The coefficients were determined by least-square fitting method. The obtained cross-section formulas with new coefficients have been discussed and compared with the available experimental data.

  7. Post-traumatic stress symptoms and post-traumatic growth in 223 childhood cancer survivors: predictive risk factors

    Marta eTremolada

    2016-02-01

    Full Text Available With modern therapies and supportive care, survival rates of childhood cancer have increased considerably. However, there are long-term psychological sequelae of these treatments that may not manifest until pediatric survivors are into adulthood. The prevalence of post-traumatic stress disorder (PTSD in young adult survivors of childhood cancer ranges from 6.2% to 22%; associated risk factors are young age at the assessment, female gender, low education level and some disease-related factors. The aim of this study was to investigate, in adolescent and young adult (AYA survivors of childhood cancer, the incidence and severity of post-traumatic stress symptoms (PTSS, and to identify the risk factors and the associated post-traumatic growth (PTG index.Participants were 223 AYA cancer survivors recruited during follow-up visits in the Oncohematology Clinic of the Department of Child and Woman’s Health, University of Padua. Data were collected from self-report questionnaires on PTSS incidence, PTG mean score, perceived social support, and medical and socio-demographic factors. Ex-patients’ mean age at the assessment was 19.33 years (SD = 3.01, 15-25, 123 males and 100 females, with a mean of years off-therapy of 9.64 (SD=4.17. Most (52.5% had survived an hematological disorder and 47.5% a solid tumor when they were aged, on average, 8.02 years (SD=4.40.The main results indicated a moderate presence of clinical (≥9 symptoms: 9.4% and sub-clinical PTSS (6-8 symptoms: 11.2%, with the avoidance criterion most often encountered. Re-experience symptoms and PTG mean score were significantly associated (r=0.24 p=0.0001. A hierarchical regression model (R2 = 0.08; F = 1.46; p = 0.05 identified female gender (β = 0.16; p = 0.05 and less perceived social support (β = -0.43; p = 0.05 as risk factors to developing PTSS. Another hierarchical regression model assessed the possible predictors of the PTG total score (R2 = 0.36; F = 9.1; p = 0.0001, with

  8. B-Cell Chronic Lymphocytic Leukemia with 11q22.3 Rearrangement in Patient with Chronic Myeloid Leukemia Treated with Imatinib.

    Lewandowski, Krzysztof; Gniot, Michał; Lewandowska, Maria; Wache, Anna; Ratajczak, Błażej; Czyż, Anna; Jarmuż-Szymczak, Małgorzata; Komarnicki, Mieczysław

    2016-01-01

    The coexistence of two diseases chronic myeloid leukemia (CML) and B-cell chronic lymphocytic leukemia (B-CLL) is a rare phenomenon. Both neoplastic disorders have several common epidemiological denominators (they occur more often in men over 50 years of age) but different origin and long term prognosis. In this paper we described the clinical and pathological findings in patient with CML in major molecular response who developed B-CLL with 11q22.3 rearrangement and Coombs positive hemolytic anemia during the imatinib treatment. Due to the presence of the symptoms of autoimmune hemolytic anemia and optimal CML response to the imatinib treatment, the decision about combined therapy with prednisone and imatinib was made. During the follow-up, the normalization of complete blood count and resolution of peripheral lymphadenopathy were noted. The hematologic response of B-CLL was diagnosed. The repeated FISH analysis of cultured peripheral blood lymphocytes showed 2% of cells carrying 11q22.3 rearrangement. At the same time, molecular monitoring confirmed the deep molecular response of CML. The effectiveness of such combination in the described case raises the question about the best therapeutic option in such situation, especially in patients with good imatinib tolerance and optimal response. PMID:27034682

  9. Genotype/phenotype correlation in a female patient with 21q22.3 and 12p13.33 duplications.

    Mekkawy, Mona K; Mazen, Inas M; Kamel, Alaa K; Vater, Inga; Zaki, Maha S

    2016-04-01

    Many chromosomal rearrangements that lead to copy-number gains or losses have been shown to cause distinctive and recognizable clinical phenotypes. Conventional cytogenetic analysis can detect many, but not all, rearrangements depending on its power of resolution. The wide use of whole-genome array-based comparative genomic hybridization (array-CGH) techniques has allowed the detection of novel syndromes and to establish genotype-phenotype correlations by delineating at high resolution the regions involved in specific chromosomal aberrations. We report on a two and half-year-old female patient with intellectual disability and distinctive phenotypic features resulting from a de novo duplication of about 0.3 Mb in 21q22.3 associated with duplication of about 0.3 Mb in 12p13.33. The patient's chromosomal abnormalities were identified at the cytogenetic molecular level, using SNP array analysis, while GTG banding technique revealed a normal karyotype. Clinical findings of the patient were compared with Down syndrome and 12p duplication syndrome. This study suggests that an area of contiguous genes on the distal part of chromosome 21 (21q22.3) contribute to the Down syndrome phenotype and indicates that genes in the distal region of 12p (12p13.33) account for many facial characteristics and hypotonia of trisomy 12p syndrome. PMID:26749249

  10. Concurrent Supermassive Black Hole and Galazy Growth: Linking Environment and Nuclear Activity in Zeta Equals 2.23 H Alpha Emitters

    Lehmer, B. D.; Lucy, A. B.; Alexander, D. M.; Best, P. N.; Geach, J. E.; Harrison, C. M.; Hornschemeier, A. E.; Matsuda, Y.; Mullaney, J. R.; Smail, Ian; Sobral, D.; Swinbank, A. M.

    2013-01-01

    We present results from an approximately equal 100 ks Chandra observation of the 2QZ Cluster 1004+00 structure at z = 2.23 (hereafter 2QZ Clus). 2QZ Clus was originally identified as an overdensity of four optically-selected QSOs at z = 2.23 within a 15 × 15 arcmin square region. Narrow-band imaging in the near-IR (within the K band) revealed that the structure contains an additional overdensity of 22 z = 2.23 H alpha-emitting galaxies (HAEs), resulting in 23 unique z = 2.23 HAEs/QSOs (22 within the Chandra field of view). Our Chandra observations reveal that three HAEs in addition to the four QSOs harbor powerfully accreting supermassive black holes (SMBHs), with 2-10 keV luminosities of approximately equal (8-60) × 10(exp 43) erg s(exp-1) and X-ray spectral slopes consistent with unobscured active galactic nucleus (AGN). Using a large comparison sample of 210 z = 2.23 HAEs in the Chandra-COSMOS field (C-COSMOS), we find suggestive evidence that the AGN fraction increases with local HAE galaxy density. The 2QZ Clus HAEs reside in a moderately overdense environment (a factor of approximately equal 2 times over the field), and after excluding optically-selected QSOs, we find that the AGN fraction is a factor of approximately equal 3.5(+3.8/ -2.2) times higher than C-COSMOS HAEs in similar environments. Using stacking analyses of the Chandra data and Herschel SPIRE observations at 250micrometers, we respectively estimate mean SMBH accretion rates ( M(BH)) and star formation rates (SFRs) for the 2QZ Clus and C-COSMOS samples. We find that the mean 2QZ Clus HAE stacked X-ray luminosity is QSO-like (L(2-10 keV) approximately equal [6-10] × 10(exp 43) erg s(exp -1)), and the implied M(BH)/SFR approximately equal (1.6-3.2) × 10(exp -3) is broadly consistent with the local M(BH)/Stellar Mass relation and z approximately equal 2 X-ray selected AGN. In contrast, the C-COSMOS HAEs are on average an order of magnitude less X-ray luminous and have M(BH)/SFR approximately

  11. Physical Mapping of the Holoprosencephaly Critical Region in 21q22.3, Exclusion of SIM2 as a Candidate Gene for Holoprosencephaly, and Mapping of SIM2 to a Region of Chromosome 21 Important for Down Syndrome

    Muenke, Maximilian; Bone, Linda J.; Mitchell, Heather F.; Hart, Iris; Walton, Katy; Hall-Johnson, Karen; Ippel, Elly F; Dietz-Band, Jeanne; Kvaløy, Kirsti; Fan, Chen-Ming; Tessier-Lavigne, Marc; Patterson, David

    1995-01-01

    We set out to define the holoprosencephaly (HPE) critical region on chromosome 21 and also to determine whether there were human homologues of the Drosophila single-minded (sim) gene that might be involved in HPE. Analysis of somatic cell hybrid clones that contained rearranged chromosomes 21 from HPE patients defined the HPE minimal critical region in 21q22.3 as D21S113 to qter. We used established somatic cell hybrid mapping panels to map SIM2 to chromosome 21 within subbands q22.2-q22.3. A...

  12. Deletions in chromosome 6p22.3-p24.3, including ATXN1, are associated with developmental delay and autism spectrum disorders

    Celestino-Soper Patrícia BS

    2012-04-01

    Full Text Available Abstract Interstitial deletions of the short arm of chromosome 6 are rare and have been associated with developmental delay, hypotonia, congenital anomalies, and dysmorphic features. We used array comparative genomic hybridization in a South Carolina Autism Project (SCAP cohort of 97 subjects with autism spectrum disorders (ASDs and identified an ~ 5.4 Mb deletion on chromosome 6p22.3-p23 in a 15-year-old patient with intellectual disability and ASDs. Subsequent database queries revealed five additional individuals with overlapping submicroscopic deletions and presenting with developmental and speech delay, seizures, behavioral abnormalities, heart defects, and dysmorphic features. The deletion found in the SCAP patient harbors ATXN1, DTNBP1, JARID2, and NHLRC1 that we propose may be responsible for ASDs and developmental delay.

  13. Thermodynamic and Spectroscopic Investigation of Interactions between Reactive Red 223 and Reactive Orange 122 Anionic Dyes and Cetyltrimethyl Ammonium Bromide (CTAB Cationic Surfactant in Aqueous Solution

    Muhammad Irfan

    2014-01-01

    Full Text Available The present study describes the conductometric and spectroscopic study of the interaction of reactive anionic dyes, namely, reactive red 223 and reactive orange 122 with the cationic surfactant cetyltrimethyl ammonium bromide (CTAB. In a systematic investigation, the electrical conductivity data was used to calculate various thermodynamic parameters such as free energy (ΔG, enthalpy (ΔH, and the entropy (ΔS of solubilization. The trend of change in these thermodynamic quantities indicates toward the entropy driven solubilization process. Moreover, the results from spectroscopic data reveal high degree of solubilization, with strong interactions observed in the cases of both dyes and the CTAB. The spontaneous nature of solubilization and binding was evident from the observed negative values of free energies (ΔGp and ΔGb.

  14. Restrictions in Quality of Life after Intramedullary Nailing of Tibial Shaft Fracture. A retrospective follow-up study of 223 cases

    Larsen, Peter; Lund, Hans; Læssøe, Uffe;

    2014-01-01

    -2008. The participants completed Knee Injury and Osteoarthritis Outcome Score (KOOS) and these data were compared with published reference population. INTERVENTION: Intramedullary nailing of tibial shaft fracture. MAIN OUTCOME MEASURES: KOOS RESULTS:A total of 223 patients agreed to participate (76%). Mean......OBJECTIVE: To evaluate the long term outcome after intramedullary nailing of tibial shaft fracture. DESIGN: Retrospective, Cross sectional study. SETTING: Level I, Trauma Center. METHODS: Retrospective review of 294 patients treated with intramedullary nailing after tibial shaft fracture from 1998...... time of follow-up was 7.9 years. Compared to reference population, the study group reported 44% higher incidence of knee pain, 39% higher incidence of ADL limitations, 58% higher incidence of limitations in QOL and 60% higher incidence of limitations during sports activities. Comparison of age related...

  15. Discovery and Monitoring of a New Black Hole Candidate XTE J1752-223 with RXTE: Rms Spectrum Evolution, Black Hole Mass, and the Source Distance

    Shaposhnikov, Nikolai; Markwardt, Craig; Swank, Jean; Krimm, Hans

    2010-11-01

    We report on the discovery and monitoring observations of a new galactic black hole (BH) candidate XTE J1752-223 by Rossi X-ray Timing Explorer (RXTE). The new source appeared on the X-ray sky on 2009 October 21 and was active for almost 8 months. Phenomenologically, the source exhibited the low-hard/high-soft spectral state bi-modality and the variability evolution during the state transition that matches standard behavior expected from a stellar mass BH binary. We model the energy spectrum throughout the outburst using a generic Comptonization model assuming that part of the input soft radiation in the form of a blackbody spectrum gets reprocessed in the Comptonizing medium. We follow the evolution of fractional root-mean-square (rms) variability in the RXTE/PCA energy band with the source spectral state and conclude that broadband variability is strongly correlated with the source hardness (or Comptonized fraction). We follow changes in the energy distribution of rms variability during the low-hard state and the state transition, and find further evidence that variable emission is strongly concentrated in the power-law spectral component. We discuss the implication of our results to the Comptonization regimes during different spectral states. Correlations of spectral and variability properties provide measurements of the BH mass and distance to the source. The spectral-timing correlation scaling technique applied to the RXTE observations during the hard-to-soft state transition indicates a mass of the BH in XTE J1752-223 between 8 and 11 solar masses and a distance to the source of about 3.5 kpc.

  16. Discovery and Monitoring of a new Black Hole Candidate XTE J1752-223 with RXTE: RMS spectrum evolution, BH mass and the source distance

    Shaposhnikov, Nikolai; Markwardt, Craig; Swank, Jean; Krimm, Hans

    2010-12-01

    I will report on the discovery and monitoring observations of a new galactic black hole candidate XTE J1752-223 by Rossi X-ray Timing Explorer (RXTE). The new source appeared on the X-ray sky on October 21 2009 and was active for almost 8 months. Phenomenologically, the source exhibited the low-hard/high-soft spectral state bi-modality and the variability evolution during the state transition that matches standard behavior expected from a stellar mass black hole binary. We model the energy spectrum throughout the outburst using a generic Comptonization model assuming that part of the input soft radiation in the form of a black body spectrum gets reprocessed in the Compromising medium. We follow the evolution of fractional root-mean-square (RMS) variability in the RXTE/PCA energy band with the source spectral state and conclude that broad band variability is strongly correlated with the source hardness (or Comptonized fraction). We follow changes in the energy distribution of rms variability during the low-hard state and the state transition and find further evidence that variable emission is strongly concentrated in the power-law spectral component. We discuss the implication of our results to the Comptonization regimes during different spectral states. Correlations of spectral and variability properties provide measurements of the BH mass and distance to the source. The spectral-timing correlation scaling technique applied to the RXTE observation during the hard-to-soft state transition indicates a mass of the BH in XTE J1752-223 between 8 and 11 solar masses and a distance to the source about 3.5 kiloparsec.

  17. DISCOVERY AND MONITORING OF A NEW BLACK HOLE CANDIDATE XTE J1752-223 WITH RXTE: RMS SPECTRUM EVOLUTION, BLACK HOLE MASS, AND THE SOURCE DISTANCE

    We report on the discovery and monitoring observations of a new galactic black hole (BH) candidate XTE J1752-223 by Rossi X-ray Timing Explorer (RXTE). The new source appeared on the X-ray sky on 2009 October 21 and was active for almost 8 months. Phenomenologically, the source exhibited the low-hard/high-soft spectral state bi-modality and the variability evolution during the state transition that matches standard behavior expected from a stellar mass BH binary. We model the energy spectrum throughout the outburst using a generic Comptonization model assuming that part of the input soft radiation in the form of a blackbody spectrum gets reprocessed in the Comptonizing medium. We follow the evolution of fractional root-mean-square (rms) variability in the RXTE/PCA energy band with the source spectral state and conclude that broadband variability is strongly correlated with the source hardness (or Comptonized fraction). We follow changes in the energy distribution of rms variability during the low-hard state and the state transition, and find further evidence that variable emission is strongly concentrated in the power-law spectral component. We discuss the implication of our results to the Comptonization regimes during different spectral states. Correlations of spectral and variability properties provide measurements of the BH mass and distance to the source. The spectral-timing correlation scaling technique applied to the RXTE observations during the hard-to-soft state transition indicates a mass of the BH in XTE J1752-223 between 8 and 11 solar masses and a distance to the source of about 3.5 kpc.

  18. Discovery and Monitoring of a New Black Hole Candidate XTE J1752-223 with RXTE: RMS Spectrum Evolution, BH Mass and the Source Distance

    Shaposhinikov, Nikolai; Markwardt, Craig; Swank, Jean; Krimm, Hans

    2010-01-01

    We report on the discovery and monitoring observations of a new galactic black hole candidate XTE J1752-223 by Rossi X-ray Timing Explorer (RXTE). The new source appeared on the X-ray sky on October 21 2009 and was active for almost 8 months. Phenomenologically, the source exhibited the low-hard/highsoft spectral state bi-modality and the variability evolution during the state transition that matches standard behavior expected from a stellar mass black hole binary. We model the energy spectrum throughout the outburst using a generic Comptonization model assuming that part of the input soft radiation in the form of a black body spectrum gets reprocessed in the Comptonizing medium. We follow the evolution of fractional root-mean-square (RMS) variability in the RXTE/PCA energy band with the source spectral state and conclude that broad band variability is strongly correlated with the source hardness (or Comptonized fraction). We follow changes in the energy distribution of rms variability during the low-hard state and the state transition and find further evidence that variable emission is strongly concentrated in the power-law spectral component. We discuss the implication of our results to the Comptonization regimes during different spectral states. Correlations of spectral and variability properties provide measurements of the BH mass and distance to the source. The spectral-timing correlation scaling technique applied to the RXTE observations during the hardto- soft state transition indicates a mass of the BH in XTE J1752-223 between 8 and 11 solar masses and a distance to the source about 3.5 kiloparsec.

  19. Environmental analysis report : emergency embankment stabilization project for the Richelieu River along Route 223 in the municipalities of Saint-Marc-sur-Richelieu and Saint-Antoine-sur-Richelieu; Rapport d'analyse environnementale : Projet de stabilisation d'urgence de berges de la riviere Richelieu le long de la route 223 sur le territoire des municipalites de Saint-Marc-sur-Richelieu et Saint-Antoine-sur-Richelieu

    Delaitre, F.; Brunet, G. [Quebec Ministere du Developpement durable, de l' Environnement et des Parcs, Quebec, PQ (Canada); Forgues, G. (ed.)

    2006-06-15

    In January 2005, Quebec's Minister of Transport requested an environmental impact study prior to commencing a proposed project to stabilize the Richelieu River embankment at 36 sites along Routes 133 and 223 between Saint-Basile-le-Grand and Saint-Ours. However, heavy rains in May 2006 affected the slopes of 4 of the studied sites within the framework of the proposed stabilization project. The slope instability has threatened the integrity of route 223 and the safety of its users. Three of these sites are located in the Municipality of Saint-Marc-sur-Richelieu and one in the Municipality of Saint-Antoine-sur-Richelieu. In response, the Quebec Ministry of Transport wishes to act as soon as possible to protect the integrity of Route 223. As such, a request was filed to proceed with emergency measures at the four problematic sites. A request was also filed to withdraw the environmental impact assessment and that a certificate of authorization be granted according to provisions in Article 31.6 of the Law on environmental quality. The mitigation efforts will consist primarily of adding rockfill to ensure temporary protection while until the Minister for Transport obtains the authorizations necessary under the terms of section 4.1 of the Law on the environmental quality before proceeding with the work suggested in the impact study previously mentioned. Since the main objective of this emergency measure is maintain the integrity of Route 223 and the safety of its users, the extent of work is limited and should be supplemented. No negative impact is anticipated on fauna and its habitats. In consideration of these events, the request by the Quebec Minister of Transport was justified and it was recommended that a certificate of authorization be granted as an exception, in order to proceed with the emergency stabilization the Richelieu River embankments along Route 223 without waiting for the results of an environmental assessment report from the Ministry of Environment

  20. Expression of miR-146a, miR-155, and miR-223 in formalin-fixed paraffin-embedded synovial tissues of patients with rheumatoid arthritis and osteoarthritis.

    Kriegsmann, Mark; Randau, Thomas M; Gravius, Sascha; Lisenko, Katharina; Altmann, Carolin; Arens, Norbert; Kriegsmann, Jörg

    2016-07-01

    Rheumatoid arthritis (RA) is a chronic autoimmune disease with a heterogeneous clinical presentation affecting about 1 % of adults in developed countries. Currently, the diagnosis is based on the revised criteria of the American College of Rheumatology (ACR) and the European League Against Rheumatism (EULAR) from 2010. These criteria include clinical and laboratory parameters. Because of the variability of the clinical picture, delayed diagnosis of RA occurs in a significant subset of patients. Therefore, the discovery of novel biomarkers that improve the diagnosis of RA is of particular interest. Recently, it became evident that miRNAs have regulatory activities in physiologic processes and human diseases. Upregulation of miR-146a, miR-155, and miR-223 has been shown in various compartments such as serum, blood, synovial fluid, and tissues in patients with RA. A total of 87 samples were analyzed (RA 50, osteoarthritis (OA) 37). RNA was isolated from formalin-fixed paraffin-embedded synovial tissue (FFPE). The relative expression of miR-146a, miR-155, and miR-223 was determined by comparison to a housekeeping RNA molecule (snRNA U6) and an RNA pool from histologically and clinically verified OA samples. miR-146a, miR-155, and miR-223 were significantly elevated in RA compared to OA synovial tissues (p < 0.001). A strong correlation between the miRNAs could be observed. The sensitivity and specificity for the detection of RA were 0.76/0.80 (miR-146a), 0.80/0.95 (miR-155), and 0.86/0.81 (miR-223). The combination of miR-155 and miR-223 resulted in the highest area under the curve (AUC 0.92) with a sensitivity and specificity of 0.84/0.91, respectively. Significantly higher expression levels of miR-146a, miR-155, and miR-223 in FFPE synovial tissue samples of patients with established RA compared to patients with OA were shown. The usefulness of these miRs for the differential diagnosis of early phases of RA against OA remains to be investigated. PMID:27079198

  1. Tectonic Influence on Magma Storage and Ascent During the Older Evolutionary Stages (223-105 ka) of the Lipari Island (Aeolian Archipelago, Southern Italy)

    di Martino, C.; Frezzotti, M.; Lucchi, F.; Peccerillo, A.; Tranne, C.; Diamond, L.

    2008-12-01

    Pure CO2 fluid inclusions are observed in fifteen quartz-rich xenoliths collected in basaltic-andesitic to andesitic volcanic products relevant to the older evolutionary stages of Lipari Island (223-105 ka). In volcanics forming central composite volcanoes (M. Mazzacaruso, 223-127 ka; M. S.Angelo, 105 ka), fluid inclusions are trapped during two distinct events: early Type I inclusions formed before host magma transport, and late (i.e. secondary) Type II inclusions trapped during magma ascent. Early Type I inclusions show homogenization temperatures corresponding to densities from 0.9 to 0.6 g/cc, while Type II inclusions record a considerably lower density interval between 0.38 and 0.1 g/cc. At the estimated trapping temperatures between 950 and 1090°C, obtained density values correspond to pressures of 0.58- 0.25 GPa (22-10 km) for Type I, and 0.13-0.03 GPa (5.5-1 km) for Type II inclusions, respectively. In those magmas erupted from fissural eruptive vents aligned along the main regional NNW-SSE and E-W faults systems (Timpone Ospedale, Monterosa and M. Chirica; 223-127 ka) only early Type I inclusions are observed. Density values form to two distinct intervals between 0.87 and 0.6 g/cc (0.53-0.25 GPa; 20-10 km; M. Chirica), and between 0.68-0.18 g/cc (0.32-0.05 GPa; 12-2 km; Timpone Ospedale and Monterosa). Fluid inclusion data together with tectonic features outline a complex magma storage and ascent evolution during the Lipari's older evolutionary stages. Beneath the central volcanoes of M. Mazzacaruso, M. S.Angelo and the M. Chirica, two magma reservoirs, located at lower crustal depths (~22 km; close to the Moho) and at very shallow levels (5.5-1 km), are present. Mantle-Derived magmas are accumulated into the deep magma chamber and may then reside in the shallower reservoir for a short period of time before being erupted to the surface. Such a magma feeding system is similar to those outlined for the Alicudi and Stromboli volcanoes, and for most of the

  2. Genome-wide association analysis of genetic generalized epilepsies implicates susceptibility loci at 1q43, 2p16.1, 2q22.3 and 17q21.32

    Steffens, M.; Leu, C.; Ruppert, A. K.; Zara, F.; Striano, P.; Robbiano, A.; Capovilla, G.; Tinuper, P.; Gambardella, A.; Bianchi, A.; La Neve, A.; Crichiutti, G.; de Kovel, C. G. F.; Trenite, D. K. N.; de Haan, G. J.; Lindhout, D.; Gaus, V.; Schmitz, B.; Janz, D.; Weber, Y. G.; Becker, F.; Lerche, Henriette; Steinhoff, B. J.; Kleefuss-Lie, A. A.; Kunz, W. S.; Surges, R.; Elger, C. E.; Muhle, H.; von Spiczak, S.; Ostertag, P.; Helbig, I.; Stephani, U.; Moller, R. S.; Hjalgrim, H.; Dibbens, L. M.; Bellows, S.; Oliver, K.; Mullen, S.; Scheffer, I. E.; Berkovic, S. F.; Everett, K. V.; Gardiner, M. R.; Marini, C.; Guerrini, R.; Lehesjoki, A. E.; Siren, Anu Kristiina; Guipponi, M.; Malafosse, A.; Thomas, P.; Nabbout, R.; Baulac, S.; Leguern, E.; Guerrero, R.; Serratosa, J. M.; Reif, P. S.; Rosenow, F.; Morzinger, M.; Feucht, M.; Zimprich, F.; Kapser, C.; Schankin, C. J.; Suls, A.; Smets, K.; De Jonghe, P.; Jordanova, A.; Caglayan, H.; Yapici, Z.; Yalcin, D. A.; Baykan, B.; Bebek, N.; Ozbek, U.; Gieger, C.; Wichmann, H. E.; Balschun, T.; Ellinghaus, D.; Franke, A.; Meesters, C.; Becker, Thomas; Wienker, T. F.; Hempelmann, A.; Schulz, Hellfried; Ruschendorf, F.; Leber, M.; Pauck, S. M.; Trucks, H.; Toliat, M. R.; Nurnberg, P.; Avanzini, G.; Koeleman, B. P. C.; Sander, Torben; Consortium, Epicure; Consortium, Eminet

    2012-01-01

    associations for GAEs at 2q22.3 (rs10496964, P-meta 9.1 10(9), OR[T] 0.68) and at 1q43 for JME (rs12059546, P-meta 4.1 10(8), OR[G] 1.42). Suggestive evidence for an association with GGEs was found in the region 2q24.3 (rs11890028, P-meta 4.0 10(6)) nearby the SCN1A gene, which is currently the gene with the...... largest number of known epilepsy-related mutations. The associated regions harbor high-ranking candidate genes: CHRM3 at 1q43, VRK2 at 2p16.1, ZEB2 at 2q22.3, SCN1A at 2q24.3 and PNPO at 17q21.32. Further replication efforts are necessary to elucidate whether these positional candidate genes contribute to...

  3. Physical mapping of the holoprosencephaly critical region in 21q22.3, exclusion of SIM2 as a candidate gene for holoprosencephaly, and mapping of SIM2 to a region of chromosome 21 important for Down syndrome

    Muenke, M.; Bone, L.J.; Mitchell, H.F. [Children`s Hospital of Philadelphia, PA (United States)] [and others

    1995-11-01

    We set out to define the holoprosencephaly (HPE) critical region on chromosome 21 and also to determine whether there were human homologues of the Drosophila single-minded (sim) gene that might be involved in HPE. Analysis of somatic cell hybrid clones that contained rearranged chromosomes 21 from HPE patients defined the HPE minimal critical region in 21q22.3 as D21S113 to qter. We used established somatic cell hybrid mapping panels to map SIM2 to chromosome 21 within subbands q22.2-q22.3. Analysis of the HPE patient-derived somatic cell hybrids showed that SIM2 is not deleted in two of three patients and thus is not a likely candidate for HPE1, the HPE gene on chromosome 21. However, SIM2 does map within the Down syndrome critical region and thus is a candidate gene that might contribute to the Down syndrome phenotype. 31 refs., 2 figs., 1 tab.

  4. Physical Mapping of the Holoprosencephaly Critical Region in 21q22.3, Exclusion of SIM2 as a Candidate Gene for Holoprosencephaly, and Mapping of SIM2 to a Region of Chromosome 21 Important for Down Syndrome

    Muenke, Maximilian; Bone, Linda J.; Mitchell, Heather F.; Hart, Iris; Walton, Katy; Hall-Johnson, Karen; Ippel, Elly F.; Dietz-Band, Jeanne; Kvaløy, Kirsti; Fan, Chen-Ming; Tessier-Lavigne, Marc; Patterson, David

    1995-01-01

    We set out to define the holoprosencephaly (HPE) critical region on chromosome 21 and also to determine whether there were human homologues of the Drosophila single-minded (sim) gene that might be involved in HPE. Analysis of somatic cell hybrid clones that contained rearranged chromosomes 21 from HPE patients defined the HPE minimal critical region in 21q22.3 as D21S113 to qter. We used established somatic cell hybrid mapping panels to map SIM2 to chromosome 21 within subbands q22.2-q22.3. Analysis of the HPE patient–derived somatic cell hybrids showed that SIM2 is not deleted in two of three patients and thus is not a likely candidate for HPE1, the HPE gene on chromosome 21. However, SIM2 does map within the Down syndrome critical region and thus is a candidate gene that might contribute to the Down syndrome phenotype. ImagesFigure 1 PMID:7485157

  5. Method of probe of solar plasma using gamma-radiation in the 2.223 MeV line originated in solar flare and analysis of the experimental data

    The model calculations of the γ-radiation fluxes in the 2.223 MeV line originating by the solar flare neutrons capture through the hydrogen nuclei are carried out. The neutron nonradiation capture by helium-3 and the γ-quanta flux relaxation by passing through the Sun atmosphere in dependence on the central angle are accounted for the calculations. The results were applied to the data on the γ-radiation of the flare in the 2.223 line on March 22, 1991 registered at the cosmic observatory Granat. It is shown that the best correspondence with the experimental data is achieved by the model with increased plasma density in the photosphere as compared with the basic model

  6. Two cases of partial trisomy 8p and partial monosomy 21q in a family with a reciprocal translocation (8;21)(p21.1;q22.3).

    Plomp, A.S.; Engelen, J.J.; Albrechts, J C; de Die-Smulders, C E; Hamers, A J

    1998-01-01

    We report on two mentally retarded adults with an unbalanced karyotype resulting from a familial balanced translocation between chromosomes 8 and 21, t(8;21)(p21.1;q22.3). This translocation has not been reported before. Both patients had partial trisomy 8p and partial monosomy 21q. Fluorescence in situ hybridisation (FISH) was used to determine the chromosomal breakpoints more precisely. The first patient showed mild mental retardation and facial dysmorphism, slightly resembling the earlier ...

  7. Health Economics and Radium-223 (Xofigo®) in the Treatment of Metastatic Castration-Resistant Prostate Cancer (mCRPC): A Case History and a Systematic Review of the Literature

    Norum, Jan; Traasdahl, Erik R.; Totth, Arpad; Nieder, Carsten; Olsen, Jan Abel

    2016-01-01

    Objectives: Prostate cancer (PC) is the most common cancer in Western countries. Recent advances in the treatment of metastatic castration resistant prostate cancer (mCRPC) have caused significant pressure on health care budgets. We aimed to exemplify this dilemma presenting an example, radium-223 (Xofigo®), and review the literature. Methods: A 74-year-old man diagnosed with mCRPC was referred to our department in October 2014 for radium-223 therapy. We faced the following dilemma: is radium-223 standard therapy? Is it cost-effective? Medline was searched employing the following search criteria: “radium-223”, “alpharadin”, “Xofigo” and “prostate”. Exclusion and inclusion criteria were applied. Guidelines and cost-effectiveness analyses were focused. We also searched the websites of ASCO, ESMO and ISPOR. The web was searched, using Yahoo and Google search engines, for Health Technology Assessments (HTAs). Results: 181 publications were identified in the Medline database. Only four studies included the word “cost”, three “economics” and none “budget” in heading or abstract. None of the publications were thorough of cost analysis (cost-effectiveness, cost-utility, cost-minimizing or cost-of-illness analysis). Six HTAs and eight national guidelines were identified. The cost per quality adjusted life years was indicated €80.000-94,000. HTAs concluded reimbursement being not recommendable or no ultimate statement could be made. One pointed towards a limited use with caution. Conclusion: Guidelines were based on data from randomized clinical trials (RCTs). Health economics was not considered when guidelines were made. Most HTAs concluded this therapy not cost-effective or there was insufficient data for final conclusions. Licensing and reimbursement processes should be run simultaneously. PMID:26573043

  8. Discovery and Monitoring of a new Black Hole Candidate XTE J1752-223 with RXTE: RMS spectrum evolution, BH mass and the source distance

    Shaposhnikov, Nikolai; Swank, Jean; Krimm, Hans

    2010-01-01

    We report on the discovery and monitoring observations of a new galactic black hole candidate XTE J1752-223 by Rossi X-ray Timing Explorer (RXTE). The new source appeared on the X-ray sky on October 21 2009 and was active for almost 8 months. Phenomenologically, the source exhibited the low-hard/high-soft spectral state bi-modality and the variability evolution during the state transition that matches standard behavior expected from a stellar mass black hole binary. We model the energy spectrum throughout the outburst using a generic Comptonization model assuming that part of the input soft radiation in the form of a black body spectrum gets reprocessed in the Comptonizing medium. We follow the evolution of fractional root-mean-square (RMS) variability in the RXTE/PCA energy band with the source spectral state and conclude that broad band variability is strongly correlated with the source hardness (or Comptonized fraction). We follow changes in the energy distribution of rms variability during the low-hard st...

  9. Fructose-1,6-bisphosphatase: Genetic and physical mapping to human chromosome 9q22.3 and evaluation in non-insulin-dependent diabetes mellitus

    Rothschild, C.B.; Akots, G.; Roh, B. [Wake Forest Univ., Winston-Salem, NC (United States)] [and others

    1995-09-01

    PCR primers specific to the human liver fructose-1,6-bisphosphatase (FBP) gene were designed and used to isolate a cosmid clone. Physical mapping of the FBP cosmid by FISH, and genetic mapping of an associated GA repeat polymorphism (PIC = 0.35), located the liver FBP gene to chromosome 9q22.3 with no recombination between FBP and the index markers D9S196 (Z{sub max} = 13.2), D9S280 (Z{sub max} = 11.7), D9S287 (Z{sub max} = 15.6), and D9S176 (Z{sub max} = 14.4). Amplification using FBP exon-specific primers with a YAC contig from this region of chromosome 9 further refined the placement of FBP genomic sequences to an approximately 1.7-cM region flanked by D9S280 and D9S287, near the gene for Fanconi anemia group C. Precise localization of the FBP gene enabled evaluation of FBP as a candidate gene for maturity-onset diabetes of the young (MODY) and non-insulin-dependent diabetes (NIDDM) in both Caucasian and African-American families, using the highly informative markers D9S287 and D9S176. Although FBP is a rate-limiting enzyme in gluconeogenesis, using both parametric and nonparametric analysis there was no evidence for linkage of FBP to diabetes in these families. 30 refs., 4 figs., 2 tabs.

  10. Prognostic factors in patients treated with stereotactic image-guided robotic radiosurgery for brain metastases: a single-center retrospective analysis of 223 patients.

    Pontoriero, Antonio; Conti, Alfredo; Iatì, Giuseppe; Mondello, Stefania; Aiello, Dario; Rifatto, Carmen; Risoleti, Edoarda; Mazzei, Micol; Tomasello, Francesco; Pergolizzi, Stefano; De Renzis, Costantino

    2016-07-01

    In this retrospective study, we evaluated the overall survival (OS) and local control (LC) of brain metastases (BM) in patients treated with stereotactic radiosurgery (SRS). The scope was to identify host, tumor, and treatment factors predictive of LC and survival and define implications for clinical decisions. A total of 223 patients with 360 BM from various histologies treated with SRS alone or associated with whole brain radiotherapy (WBRT) in our institution between July 1, 2008 and August 31, 2013 were retrospectively reviewed. Among other prognostic factors, we had also evaluated retrospectively Karnofsky performance status scores (KPS) and graded prognostic assessment (GPA). Overall survival (OS) and local control (LC) were the primary endpoints. Kaplan-Meier and Cox proportional hazards models were used to estimate OS and LC and identify factors predictive of survival and local control. The median duration of follow-up time was 9 months (range 0.4-51 months). Median overall survival of all patients was 11 months. The median local control was 38 months. No statistical difference in terms of survival or LC between patients treated with SRS alone or associated with WBRT was found. On multivariate analysis, KPS was the only statistically significant predictor of OS (hazard ratio [HR] 2.53, p = 0.006). On univariate analysis, KPS and GPA were significantly prognostic for survival. None of the host, tumor, or treatment factors analyzed in the univariate model factors were significantly associated with local failure. PMID:27106896

  11. Relationships between plasma leptin levels, leptin G2548A, leptin receptor Gln223Arg polymorphisms and gestational diabetes mellitus in Chinese population

    Yang, Mei; Peng, Songxu; Li, Wei; Wan, Zhihua; Fan, Linlin; Du, Yukai

    2016-01-01

    The purposes of this study were to examine concentrations of leptin and biochemical parameters in gestational diabetes mellitus (GDM) patients and normal glucose tolerance (NGT) individuals, and also to explore the links of leptin (LEP) G2548A and leptin receptor (LEPR) Gln223Arg polymorphisms with leptin levels and GDM risk among Chinese. Our study included 357 GDM and 355 NGT individuals who were at 24~30 gestational weeks. Plasma leptin and insulin levels were analyzed by ELISA. Gene polymorphisms were genotyped using TaqMan real-time polymerase chain reaction assay. The results showed that plasma leptin levels were significantly higher in the impaired fasting glucose (IFG) group than NGT group (34.35 (26.54, 56.48) ng/mL vs 26.31 (17.99, 37.87) ng/mL, P  0.05). Our findings showed that high leptin level was associated with GDM. And larger and more rigorous researches were needed to further explore the association of LEP and LEPR gene polymorphisms and GDM among Chinese population. PMID:27034205

  12. Cloning of the cDNA for a human homologue of the Drosophila white gene and mapping to chromosome 21q22.3

    Haiming Chen; Lalioti, M.D.; Perrin, G.; Antonarakis, S.E. [Univ. of Geneva Medical School (Switzerland)] [and others

    1996-07-01

    In an effort to contribute to the transcript map of human chromosome 21 and the understanding of the pathophysiology of trisomy 21, we have used exon trapping to identify fragments of chromosome 21 genes. Two trapped exons, from pools of chromosome 21-specific cosmids, showed homology to the Drosophila white (w) gene. We subsequently cloned the corresponding cDNA for a human homologue of the Drosophila w gene (hW) from human retina and fetal brain cDNA libraries. The gene belongs to the ATP-binding cassette transporter gene family and is homologous to Drosophila w (and to 2 genes from other species) and to a lesser extent to Drosophila brown (bw) and scarlet (st) genes that are all involved in the transport of eye pigment precursor molecules. A DNA polymorphism with 62% heterozygosity due to variation of a poly (T) region in the 3{prime} UTR of the hW has been identified and used for the incorporation of this gene to the genetic map of chromosome 21. The hW is located at 21q22.3 between DNA markers D21S212 and D21S49 in a P1 clone that also contains marker BCEI. The gene is expressed at various levels in many human tissues. The contributions of this gene to the Down syndrome phenotypes, to human eye color, and to the resulting phenotypes of null or missense mutations are presently unknown. 56 refs., 8 figs., 1 tab.

  13. Psychiatric disorder in a familial 15;18 translocation and sublocalization of myelin basic protein to 18q22.3

    Calzolari, E.; Aiello, V.; Palazzi, P.; Sensi, A. [Universita Ferrara (Italy)] [and others

    1996-04-09

    Two related patients with similar clinical features consisting of a few dysmorphic signs and psychiatric disturbance were reported to have a partial trisomy of chromosomes 15(pter-q13.3) and 18(q23-qter) deriving from a familial translocation t(15;18). One patient is affected by bipolar disorder and the other by schizoaffective disorder. Both cases have a predominantly affective course; nevertheless, a clear diagnosis is difficult in the first patient, who is 15 years of age, and only a longitudinal course will allow us to establish a definite diagnosis. The possibility that these two pathologies belong to a single category is discussed, and the presence of a susceptibility locus on chromosome 18 is hypothesized. Cytogenetic data, FISH, and DNA studies indicate that the myelin basic protein (MPB) gene is not involved in the translocation, and localize it centromeric to the breakpoint on chromosome 18(q22.3). Thus, it is unlikely to be involved in the disease. 58 refs., 8 figs.

  14. MicroRNA-223 and microRNA-92a in stool and plasma samples act as complementary biomarkers to increase colorectal cancer detection

    Chang, Pi-Yueh; Chen, Chia-Chun; Chang, Yu-Sun; Tsai, Wen-Sy; You, Jeng-Fu; Lin, Geng-Ping; Chen, Ting-Wen; Chen, Jinn-Shiun; Chan, Err-Cheng

    2016-01-01

    Aberrant levels of circulating miRNAs are potential biomarkers for the early detection of colorectal cancer (CRC). However, no previous systematic study has examined miRNAs in various specimen types from the same patient to evaluate their clinical utility. In this study, we compiled information from ∼450 articles published before 2012, and selected the 46 most frequently reported CRC-related miRNAs as candidates. We then established a 46-miRNA multiplex RT-qPCR method, and efficiently examined two clinically accessible samples: stool from fecal occult blood test and EDTA plasma. A total of 62 tissue, 447 stool, and 398 plasma samples were collected from CRC patients and healthy controls. Good correlations of detectable miRNAs were noticed in paired tumor tissues, stool, and plasma samples of 62 CRC patients. Using these 62 CRC patients and 62 matched healthy controls as the training set, 5 and 11 differentially expressed miRNAs achieved the area under the ROC curve (AUC) greater than 0.7 in stool and plasma samples, respectively. The selected miRNAs was subsequently validated using the remaining enrolled samples as the test cohort; 4 miRNAs in stool and 6 miRNAs in plasma were maintained discriminating powers for CRC patients. After examining the complementary effect, combined analysis of miR-223 and miR-92a, which were commonly present in stool and plasma samples, yielded the highest sensitivity of 96.8% and the specificity of 75% for CRC (AUC = 0.907). These results allowed us to establish a two-miRNA biosignature in two types of CRC clinical specimens with a high sensitivity for CRC detection. PMID:26848774

  15. 农药残留认知与主要影响因素研究——河南省223个小麦种植农户的案例%tudy on the Perception of Pesticide Residues and the Impact Factors:Based on the 223 Cases of Wheat Farmers in Henan Province

    侯博; 山丽杰; 牛亮云

    2012-01-01

    文章以中国河南省三个不同地区的6个县的223个小麦种植农户为案例,以计划行为理论为主要分析工具,基于结构方程模型研究了影响小麦种植农户农药残留认知的主要因素。研究表明,小麦种植农户的地域、性别、年龄、受教育年限、家庭总人口、农业生产人口、家庭年收入、农药培训、农业技术人员的指导、对小麦安全性的担忧等因素均不同程度地影响其对农药残留的认知。文章的研究发现,小麦种植农户的知觉行为控制、行为态度、主观规范和自身特征因素间的交互作用明显,初步验证了计划行为理论对生产农户的农药残留认知的主要影响因素的研究具有普适性。%This paper explores the main factors affecting farmers' perception of pesticide residues based on the structural equation model(SEM) and samples of 223 farmers in 6 counties of 3 districts in Henan Province of China.The results show that factors of geography,gender,age,years of education,total family population,farming population,annual household income,pesticide training,on site guidance by agricultural technicians and security concerns of wheat all affect farmers' cognition of pesticide residue in different degrees.Besides,it is found that there are apparent interactions between perceived behavioral control,behavioral attitude,subjective norm and self-characteristics of wheat farmers,which primarily validated there is generality for the theory of planned behavior to study the Impact Factors on farmer Perception of Pesticide Residues.

  16. A case report of image-based dosimetry of bone metastases with Alpharadin ((223)Ra-dichloride) therapy: inter-fraction variability of absorbed dose and follow-up.

    Pacilio, Massimiliano; Ventroni, Guido; Cassano, Bartolomeo; Ialongo, Pasquale; Lorenzon, Leda; Di Castro, Elisabetta; Recine, Federica; Sternberg, Cora N; Mango, Lucio

    2016-02-01

    A 70-year-old man affected by bone metastases from castration resistant prostate cancer underwent Alpharadin ((223)Ra-dichloride) therapy (6 administrations of 50 kBq per kg i.v., once every 4 weeks). The inter-fraction variability of the absorbed dose to lesions was evaluated for four injections. Dosimetric assessments were performed following the MIRD approach and a recently published methodology. The mean absorbed dose and standard deviation for 4 lesions [mean (σ %)] were: 434 mGy (15 %) and 516 mGy (21 %) for the right and left humeral head, 1205 mGy (14 %) and 781 mGy (8 %) for the right and left glenoid. The estimated total absorbed dose after the whole treatment, considering also the relative-biological effectiveness of alpha particles (RBE = 5), yielded a D RBE range of 13-36 Gy. A good correlation between (99m)Tc and (223)Ra uptake was obtained (R (2) = 0.7613). The tumour-non-tumour (TNT) ratio of 8 lesions (those above, plus 4 additional), monitored by six (99m)Tc-MDP bone scans over a period of about 10 months, evidenced a TNT reduction in two lesions (-42 and -48 %), but in most lesions the TNT remained fairly constant, evidencing that (223)Ra-dichloride therapy tends to prevent further progression of osseous disease, leading to chronicity of the metastatic status. PMID:26613714

  17. catena-Poly[[bis[2-(2,3-dimethylanilinobenzoato-κO]cadmium(II]-di-μ-3-pyridylmethanol-κ2N:O;κ2O:N

    Tadeusz Lis

    2008-03-01

    Full Text Available In the crystal structure of the title compound, [Cd(C15H14NO22(C6H7NO2]n, the Cd atom displays a distorted octahedral geometry, including two pyridine N atoms and two hydroxyl O from four symmetry-related 3-pyridylmethanol (3-pyme ligands and two carboxylate O atoms from mefenamate [2-(2,3-dimethylanilinobenzoate] anions. The Cd atoms are connected via the bridging 3-pyme ligands into chains, that extend in the a-axis direction. The Cd atom is located on a center of inversion, whereas the 3-pyme ligands and the mefenamate anions occupy general positions.

  18. Vapor-liquid equilibrium data for the carbon dioxide and nitrogen (CO2+N2) system at the temperatures 223, 270, 298 and 303 K and pressures up to 18 MPa

    Westman, Snorre Foss; Stang, Hans Georg Jacob; Løvseth, Sigurd Weidemann; Austegard, Anders; Snustad, Ingrid; Størset, Sigmund Østtveit; Ertesvåg, Ivar Ståle

    2015-01-01

    A new setup for the measurement of vapor-liquid phase equilibria of CO2-rich mixtures relevant for carbon capture and storage (CCS) transport conditions is presented. An isothermal analytical method with a variable volume cell is used. The apparatus is capable of highly accurate measurements in terms of pressure, temperature and composition, also in the critical region. Vapor-liquid equilibrium (VLE) measurements for the binary system CO2+N2 are reported at 223, 270, 298 and 303 K, with estim...

  19. Cytogenetic and clinical studies in gonadal dysgenesis with 46,X,Xt(qter leads to p221::p223 leads to qter) karyotype: review and phenotype/karyotype correlations.

    M. Ferraro; de Capoa, A.; Mostacci, C; Pelliccia, F; Zulli, P; Baldini, M A; Di Nisio, Q

    1980-01-01

    Chromosome analysis by Q, R, and C banding was performed in a case diagnosed clinically as gonadal dysgenesis and the karyotype was shown to be 46,X,Xt(qter leads to p221::p223 leads to qter). Localisation of the breakpoints in the fused X chromosomes and replication studies have led to a hypothesis on the origin of the translocation. A comparison of clinical and cytogenetical findings in this and other published cases has also been made in an attempt to detect some phenotype/karyotype correl...

  20. 南极深海底泥中度嗜盐菌盐单胞菌属Nj223 ectC基因的克隆表达及ectoine合成酶性质分析%Characterization of the ectC gene and its expression product in Halomonas sp.Nj223 from Antarctica deep-sea sediment

    陈志亮; 傅英楠; 姜蔚宇; 陈荣忠

    2007-01-01

    从南极深海底泥中筛选得到一株中度嗜盐菌 Halomonas sp.Nj223,利用PCR技术,以该菌株基因组为模板,扩增出 ectC 基因.将目的基因的PCR扩增产物克隆至表达载体pET-his.经酶切、PCR鉴定、测序验证结果表明,目的基因插入的位置、大小和读码框均正确,表达载体构建成功.经SDS-PAGE分析,出现预期大小的目的蛋白条带.分离纯化复性的ectoine合成酶后测定其酶活力,在体外验证了ectoine的部分生物合成途径.进一步分析了pH和温度对酶活的影响发现,该酶最适pH为8.0,最适温度为25℃.

  1. A SINFONI Integral Field Spectroscopy Survey for Galaxy Counterparts to Damped Lyman-alpha Systems - II. Dynamical Properties of the Galaxies towards Q0302-223 and Q1009-0026

    Peroux, Celine; Kulkarni, Varsha P; York, Donald G; Vladilo, Giovanni

    2010-01-01

    Details of processes through which galaxies convert their gas into stars need to be studied in order to obtain a complete picture of galaxy formation. One way to tackle these phenomena is to relate the HI gas and the stars in galaxies. Here, we present dynamical properties of Damped and sub-Damped Lyman-alpha Systems identified in H-alpha emission with VLT/SINFONI at near infra-red wavelengths. While the DLA towards Q0302-223 is found to be dispersion-dominated, the sub-DLA towards Q1009-0026 shows clear signatures of rotation. We use a proxy to circular velocity to estimate the mass of the halo in which the sub-DLA resides and find M_halo=10^12.6 M_sun. We also derive dynamical masses of these objects, and find M_dyn=10^10.3 M_sun and 10^10.9 M_sun. For one of the two systems (towards Q0302-223), we are able to derive a stellar mass of M_*=10^9.5 M_sun from Spectral Energy Distribution fit. The gas fraction in this object is 1/3rd, comparable to similar objects at these redshifts. Our work illustrates that d...

  2. The gene for human U2 snRNP auxiliary factor small 35-kDa subunit (U2AF1) maps to the progressive myoclonus epilepsy (EPM1) critical region on chromosome 21q22.3

    Lalioti, M.D.; Rossier, C.; Antonarakis, S.E. [Univ. of Geneva Medical School (Switzerland)] [and others

    1996-04-15

    We used targeted exon trapping to clone portions of genes from human chromosome 21q22.3. One trapped sequence showed complete homology with the cDNA of human U2AF{sup 35} (M96982; HGM-approved nomenclature U2AF1), which encodes for the small 35-kDa subunit of the U2 snRNP auxiliary factor. Using the U2AF1 cDNA as a probe, we mapped this gene to cosmid Q15D2, a P1, and YAC 350F7 of the Chumakov et al. contig, close to the cystathionine-{beta}-synthase gene (CBS) on 21q22.3. This localization was confirmed by PCR using oligonucleotides from the 3{prime} UTR and by FISH. As U2AF1 associated with a number of different factors during mRNA splicing, overexpression in trisomy 21 individuals could contribute to some Down syndrome phenotypes by interfering with the splicing process. Furthermore, because this gene maps in the critical region for the progressive myoclonus epilepsy I locus (EPM1), mutation analysis will be carried out in patients to evaluate the potential role of U2AF1 as a candidate for EPM1. 24 refs., 1 fig.

  3. Profiles of serum microRNAs; miR-125b-5p and miR223-3p serve as novel biomarkers for HBV-positive hepatocellular carcinoma.

    Giray, Burcu Gurer; Emekdas, Gurol; Tezcan, Seda; Ulger, Mahmut; Serin, Mehmet Sami; Sezgin, Orhan; Altintas, Engin; Tiftik, Eyup Naci

    2014-07-01

    Recently, circulating miRNAs have been reported as promising biomarkers for various pathologic conditions including cancer. Certain microRNAs (miRNAs) have been shown early diagnostic potential for many types of cancer. The objective of this study was to investigate the potential of certain serum/plasma miRNAs as novel non-invasive biomarkers for early diagnosis of hepatitis B virus (HBV) related hepatocellular carcinoma (HCC). For this reason, the expression levels of 24 miRNA (let-7c, miR-92a-3p, 423-5p, 150-5p, 223-3p, 125b-5p, 342-3p, miR-206, 122-5p, 375, 223-5p, 10a-5p, 23b-5p, 99a-5p, 23a-5p, 10a-3p, 122-3p, 125b-1-3p, 23b-3p, 125b-2-3p, 23a-3p, 92a-1-5p, 92a-2-5p, 99a-3p) were analyzed in plasma of patients with chronic hepatitis B, HBV-positive cirrhosis and HBV-positive HCC and compared with control group samples. Totally 94 plasma samples; 28 control and 66 patient plasma (24 CHB, 22 HBV-positive cirrhosis, 20 HBV-positive HCC) and were included in this study. The expression levels of 24 miRNAs were detected for all control and patient group plasma samples by qRT-PCR using BioMark™ 96.96 Dynamic Array (Fluidigm Corporation) system. The expression levels of miR-125b-5p were detected 2.85 fold, 2.46 fold and 1.89 fold (p = 0.01513, p = 0.0009440, p = 0.0001446) up regulated in CHB, HBV-positive cirrhosis and HBV-positive HCC, respectively when compared versus control group individually by Mann-Whitney U test. The expression levels of miR-223-3p were detected 5.55 fold, 13.88 fold and 12.65 fold (p = 0.01513, p = 0.0009440, p = 0.0001446) down regulated in same comparisons. When all groups were compared versus control group by one-way ANOVA test, the expression levels of miR-223-3p were also found statistically significant (p < 0.05). Although not statistically significant, miR-125b-5p tended to be upregulated. (p = 0.07192). These results significantly imply that miR-125b-5p and miR223-3p could be used as novel non-invasive biomarkers of HBV-positive HCC

  4. Dosimetric characterization of a 2-D array of 223 solid state detectors for daily morning checks in Tomo Therapy equipment; Caracterizacion dosimetrica de un arreglo 2D de 223 detectores de estado solido para verificaciones matutinas diarias en un equipo de Tomo Terapia

    Reyes S, U.; Sosa A, M. [Universidad de Guanajuato, Division de Ciencias e Ingenieria, Lomas del Bosque No. 103, Col. Lomas del Campestre, 37150 Leon, Guanajuato (Mexico); Vega C, H. R., E-mail: uvaldoreyes@hotmail.com [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas, Zac. (Mexico)

    2015-10-15

    Tomo Therapy is a new technique for the cancer treatment; however, the equipment must meet nearly all mechanical and dosimetric characteristics of a conventional linear accelerator for medical use. Daily quality controls are vital to the good operation of the equipment and thus guarantee excellent quality in the daily delivery of treatments. This paper presents the procedure of the dosimetric characterization of a two-dimensional array of 223 solid state detectors, called TomoDose of the Sun Nuclear Company. Dosimetric important criteria are established to perform these checks quickly and accurately. Dosimetric tests proposed are: repeatability, linearity, dependence of Sad and SSD. Some results are compared with readings of the ionization chamber Exradim A1SL. Finally the results of 30 consecutive days are presented to establish criteria for evidence of dose, field size, symmetry and flattening of the radiation beam on Tomo Therapy equipment. Expected values for daily verification are: Dose constancy of 194.89 c Gy, σ= 1.31 c Gy, symmetry in the X axis of -0.19 %, σ=0.08 %, symmetry in the Y axis of 1.66 %, σ= 0.05 %, flattened in the X axis of 25.71 %, σ= 0.05 % and flattened in the Y axis of 6.41 %, σ= 10.23 %. Field sizes obtained were 40.45 cm in the X axis and 5.10 on the Y axis, with standard deviations of 0.02 cm and 0.01 cm, respectively. TomoDose dosimetric values, compared to the values obtained with ionization chamber, presented differences smaller than 2%. (Author)

  5. Variations in HDL-carried miR-223 and miR-135a concentrations after consumption of dietary trans fat are associated with changes in blood lipid and inflammatory markers in healthy men - an exploratory study.

    Desgagné, Véronique; Guay, Simon-Pierre; Guérin, Renée; Corbin, François; Couture, Patrick; Lamarche, Benoit; Bouchard, Luigi

    2016-06-01

    A high consumption of trans fatty acids (TFAs) is associated with an increased risk of cardiovascular diseases (CVDs). High-density lipoproteins (HDLs) have many cardioprotective properties and transport functional microRNAs (miRNAs) to recipient cells. We hypothesized that dietary TFAs modify the HDL-carried miRNA profile, therefore modulating its cardioprotective properties. We assessed whether consumption of dietary TFAs modifies HDL-carried miR-223-3p and miR-135a-3p concentration and the inter-relationship between diet-induced changes in HDL-carried miRNA concentration and CVD risk markers. In a double blind, randomized, crossover, controlled study, 9 men were fed each of 3 experimental isoenergetic diets: 1) High in industrial TFA (iTFA; 3.7% energy); 2) High in TFA from ruminants (rTFA; 3.7% energy); 3) Low in TFA (control; 0.8% energy) for 4 weeks each. HDLs were isolated by ultracentrifugation and miRNAs were quantified by RT-qPCR. Variations in HDL-miR-223-3p concentration were negatively correlated with variations in HDL-cholesterol after the iTFA diet (rs = 0.82; P = 0.007), and positively correlated with variations in C-reactive protein concentration after the rTFA diet (rs = 0.75; P = 0.020). Variations in HDL-miR-135a-3p concentration were positively correlated with variations in total triglyceride (TG) concentration following the iTFA diet (rs = -0.82; P = 0.007), and with variations in low-density lipoprotein (LDL)-TG concentration following the rTFA diet (rs = 0.83; P = 0.005), compared to the control diet. However, the consumption of dietary TFAs has no significant unidirectional impact on HDL-carried miR-223-3p and miR-135a-3p concentrations. Our results suggest that the variability in the HDL-carried miRNAs response to TFA intake, by being associated with variations in CVD risk factors, might reflect physiological changes in HDL functions. PMID:27099924

  6. Reflection asymmetry in odd-A and odd-odd actinium nuclei

    Theoretical calculations and measurements indicate that octupole correlations are at a maximum in the ground states of the odd-proton nuclei Ac and Pa. It has been expected that odd-odd nuclei should have even larger amount of octupole-octupole correlations. We have recently made measurements on the structure of 224Ac. Although spin and parity assignments could not be made, two bands starting at 354.1 and 360.0 keV have properties characteristic of reflection asymmetric shape. These two bands have very similar rotational constants and also similar alpha decay rates, which suggest similarity between the wavefunctions of these bands. These signatures provide evidence for octupole correlations in these nuclides

  7. Bestimmung der Ionisationsenergie von Actinium und Ultraspurenanalyse von Plutonium mit resonanter Ionisationsmassenspektrometrie (RIMS)

    Waldek, Achim Marcus

    2001-01-01

    ZusammenfassungDie Resonanzionisationsmassenspektrometrie (RIMS) verbindet hohe Elementselektivität mit guter Nachweiseffizienz. Aufgrund dieser Eigenschaften ist die Methode für Ultraspurenanalyse und Untersuchungen an seltenen oder schwer handhabbaren Elementen gut geeignet. Für RIMS werden neutrale Atome mit monochromatischem Laserlicht ein- oder mehrfach resonant auf energetisch hoch liegende Niveaus angeregt und anschließend durch einen weiteren Laserstrahl oder durch ein elektrisches Fe...

  8. Radium-228 analysis of natural waters by Cherenkov counting of Actinium-228

    The activities of 228Ra in natural waters were determined by the Cherenkov counting of the daughter nuclide 228Ac. The radium was pre-concentrated on MnO2 and the radium purified via ion exchange and, after a 2-day period of incubation to allow for secular equilibrium between the parent-daughter 228Ra(228Ac), the daughter nuclide 228Ac was isolated by ion exchange according to the method of Nour et al. [2004. Radium-228 determination of natural waters via concentration on manganese dioxide and separation using Diphonix ion exchange resin. Appl. Radiat. Isot. 61, 1173-1178]. The Cherenkov photons produced by 228Ac were counted directly without the addition of any scintillation reagents. The optimum Cherenkov counting window, sample volume, and vial type were determined experimentally to achieve optimum Cherenkov photon detection efficiency and lowest background count rates. An optimum detection efficiency of 10.9±0.1% was measured for 228Ac by Cherenkov counting with a very low Cherenkov photon background of 0.317±0.013 cpm. The addition of sodium salicylate into the sample counting vial at a concentration of 0.1 g/mL yielded a more than 3-fold increase in the Cherenkov detection efficiency of 228Ac to 38%. Tests of the Cherenkov counting technique were conducted with several water standards of known activity and the results obtained compared closely with a conventional liquid scintillation counting technique. The advantages and disadvantages of Cherenkov counting compared to liquid scintillation counting methods are discussed. Advantages include much lower Cherenkov background count rates and consequently lower minimal detectable activities for 228Ra and no need for expensive environmentally unfriendly liquid scintillation cocktails. The disadvantages of the Cherenkov counting method include the need to measure 228Ac Cherenkov photon detection efficiency and optimum Cherenkov counting volume, which are not at all required when liquid scintillation analysis is used

  9. Linear free energy relationship applied to trivalent cations with lanthanum and actinium oxide and hydroxide structure

    Linear free energy relationships for trivalent cations with crystalline M2O3 and, M(OH)3 phases of lanthanides and actinides were developed from known thermodynamic properties of the aqueous trivalent cations, modifying the Sverjensky and Molling equation. The linear free energy relationship for trivalent cations is as ΔGf,MvX0=aMvXΔGn,M3+0+bMvX+βMvXrM3+, where the coefficients aMvX, bMvX, and βMvX characterize a particular structural family of MvX, rM3+ is the ionic radius of M3+ cation, ΔGf,MvX0 is the standard Gibbs free energy of formation of MvX and ΔGn,M3+0 is the standard non-solvation free energy of the cation. The coefficients for the oxide family are: aMvX=0.2705, bMvX=-1984.75 (kJ/mol), and βMvX=197.24 (kJ/molnm). The coefficients for the hydroxide family are: aMvX=0.1587, bMvX=-1474.09 (kJ/mol), and βMvX=791.70 (kJ/molnm).

  10. Actinium: A RESTful Runtime Container for Scriptable Internet of Things Applications

    Kovatsch, Matthias; Lanter, Martin; Duquennoy, Simon

    2012-01-01

    Programming Internet of Things (IoT) applications is challenging because developers have to be knowledgeable in various technical domains, from low-power networking, over embedded operating systems, to distributed algorithms. Hence, it will be challenging to find enough experts to provide software for the vast number of expected devices, which must also be scalable and particularly safe due to the connection to the physical world. To remedy this situation, we propose an architecture that pr...

  11. Synthesis of chelating agents for actinium 225 complexation and its application in radioimmunotherapy

    Immunotherapy with radiolabeled antibodies should allow fairly specific targeting of certain cancers. However, iodine 131 may not be the best isotope for tumor therapy because of its limited specific activity, low beta-energy, relatively long half life and strong gamma emission. Another approach to improve therapeutic efficacy is the use of replacement isotopes with better physical properties. Chelator that can hold radio-metals with high stability under physiological conditions are essential to avoid excessive damage to non-target cells; Moreover, the development of new bifunctional chelating agents is essential for this purpose. Accordingly, our efforts have been directed, for several years, to the synthesis of original chelating agents likely to form stable complexes in vivo with the numerous potential candidates for such applications. Therefore, we have developed a new simple and efficient synthesis pathway of 2-(4-iso-thio-cyanate-benzyl)-1,4,7,10,13,16- hexa-aza-cyclo-hexadecane- 1,4,7,10,13,16-hexa-acetic acid, though functionalized on the cycle by a termination allowed coupling to an antibody or any other biological substance such as a hapten. (author)

  12. Purification of selenium from thorium, uranium, radium, actinium and potassium impurities for low background measurements

    A technique of selenium purification from 232Th, 238U, 226,228Ra, 227Ac and 40K was developed. This technique is simple to perform and employs a minimum number of highly pure reagents (bidistilled water, nitric acid). Operations carried out during purification (elution, evaporation) practically exclude losses of the target product (chemical yields of Se > 99%). A test purification of 100 g of selenium was carried out using this technique. The efficiency of this technique was confirmed by low background gamma spectrometry of the purified selenium sample. Distribution coefficients of Th, U, Ra and Ac on DOWEX 50W- x 8 cation-exchange resin at different concentrations of selenium and nitric acid were experimentally determinated. Instrumental neutron activation analysis of bidistilled water, deionized water and nitric acid was performed. (orig.)

  13. Purification of selenium from thorium, uranium, radium, actinium and potassium impurities for low background measurements

    Rakhimov, A.V. [Joint Institute for Nuclear Research (JINR), Dubna (Russian Federation); Uzbek Academy of Sciences, Tashkent (Uzbekistan). Inst. of Nuclear Physics (INP AS RUz); Warot, G. [CEA-CNRS, Modane (France). Laboratoire Souterrain de Modane (LSM); Karaivanov, D.V. [Joint Institute for Nuclear Research (JINR), Dubna (Russian Federation); Institute for Nuclear Research and Nuclear Energy (INRNE), Sofia (Bulgaria); Kochetov, O.I.; Lebedev, N.A.; Filosofov, D.V. [Joint Institute for Nuclear Research (JINR), Dubna (Russian Federation); Mukhamedshina, N.M.; Sadikov, I.I. [Uzbek Academy of Sciences, Tashkent (Uzbekistan). Inst. of Nuclear Physics (INP AS RUz)

    2013-07-01

    A technique of selenium purification from {sup 232}Th, {sup 238}U, {sup 226,228}Ra, {sup 227}Ac and {sup 40}K was developed. This technique is simple to perform and employs a minimum number of highly pure reagents (bidistilled water, nitric acid). Operations carried out during purification (elution, evaporation) practically exclude losses of the target product (chemical yields of Se > 99%). A test purification of 100 g of selenium was carried out using this technique. The efficiency of this technique was confirmed by low background gamma spectrometry of the purified selenium sample. Distribution coefficients of Th, U, Ra and Ac on DOWEX 50W- x 8 cation-exchange resin at different concentrations of selenium and nitric acid were experimentally determinated. Instrumental neutron activation analysis of bidistilled water, deionized water and nitric acid was performed. (orig.)

  14. Mandler, David. 2014. Kelet és nyugat mezsgyéjén – Vámbéry Ármin és a Brit Birodalom ('On the Border between East and West – Arminius Vámbéry and the British Empire'). Budapest: Múlt és Jövő Kiadó. 223 pp.

    Anna Szalai

    2016-01-01

    Mandler, David. 2014. Kelet és nyugat mezsgyéjén – Vámbéry Ármin és a Brit Birodalom ('On the Border between East and West – Arminius Vámbéry and the British Empire'). Budapest: Múlt és Jövő Kiadó. 223 pp. Reviewed by Anna Szalai, Independent Scholar, Israel

  15. Experimental water content measurements of carbon dioxide in equilibrium with hydrates at (223.15 to 263.15) K and (1.0 to 10.0) MPa

    Highlights: • Experimental water content data for carbon dioxide in equilibrium with hydrates. • Data required for setting drying requirements in carbon dioxide streams. • Comparison of experimental data with model predictions and available literature data. -- Abstract: The environmental impact of carbon dioxide has led to the need for capture and storage processes. Whenever water is present, at conditions inside the carbon dioxide hydrate stability zone, there is the possibility of hydrate formation which can cause problems such as pipeline restriction and blockage. To avoid such problems it is essential to know how dry the carbon dioxide needs to be. The measurement of the water content of carbon dioxide in equilibrium with hydrates at different temperature and pressure conditions gives a value below which hydrates will not form. There is a scarcity of relevant experimental data especially at low temperatures (<263.15 K). This is in part due to the challenging nature of making accurate equilibrium water content measurements at these conditions. The experimental data can be used to compare with predictions made using different thermodynamic models. This paper presents experimental equipment, methods and results for the water content of carbon dioxide in equilibrium with hydrates at temperatures between (223.15 and 263.15) K and pressures between (1.0 and 10.0) MPa, hence in both vapour and liquid phases. The experimental data are compared with predictions from an in-house (previously developed) thermodynamic model

  16. [OIII] emission line as a tracer of star-forming galaxies at high redshifts: Comparison between H$\\alpha$ and [OIII] emitters at $z$=2.23 in HiZELS

    Suzuki, T L; Sobral, D; Khostovan, A A; Hayashi, M; Shimakawa, R; Koyama, Y; Tadaki, K -i; Tanaka, I; Minowa, Y; Yamamoto, M; Smail, I; Best, P N

    2016-01-01

    We investigate the properties of $z$=2.23 H$\\alpha$ and [OIII]$\\lambda$5007 emitters using the narrow-band-selected samples obtained from the High-$z$ Emission Line Survey (HiZELS: Sobral et al. 2013). We construct two samples of the H$\\alpha$ and [OIII] emitters and compare their integrated physical properties. We find that the distribution of stellar masses, dust extinction, star formation rates (SFRs), and specific SFRs, is not statistically different between the two samples. When we separate the full galaxy sample into three subsamples according to the detections of the H$\\alpha$ and/or [OIII] emission lines, most of the sources detected with both H$\\alpha$ and [OIII] show ${\\rm log(sSFR_{UV})}$$\\gtrsim$-9.5. The comparison of the three subsamples suggests that sources with strong [OIII] line emission tend to have the highest star-forming activity out all galaxies that we study. We argue that the [OIII] emission line can be used as a tracer of star-forming galaxies at high redshift, and that it is especia...

  17. Serum microRNAs; miR-30c-5p, miR-223-3p, miR-302c-3p and miR-17-5p could be used as novel non-invasive biomarkers for HCV-positive cirrhosis and hepatocellular carcinoma.

    Oksuz, Zehra; Serin, Mehmet Sami; Kaplan, Engin; Dogen, Aylin; Tezcan, Seda; Aslan, Gonul; Emekdas, Gurol; Sezgin, Orhan; Altintas, Engin; Tiftik, Eyup Naci

    2015-03-01

    Recently, serum miRNAs have been evolved as possible biomarkers for different diseases including hepatocellular carcinoma and other types of cancers. Investigating certain serum miRNAs as novel non-invasive markers for early detection of HCV-positive cirrhosis and hepatocellular carcinoma (HCC). The expression profiles of 58 miRNA were analyzed in patient's plasma of chronic hepatitis C (CHC), HCV-positive cirrhosis and HCV-positive HCC and compared with control group samples. Totally 94 plasma samples; 64 patient plasma (26 CHC, 30 HCV-positive cirrhosis, 8 HCV-positive HCC) and 28 control group plasma, were included. The expression profiles of 58 miRNAs were detected for all patient and control group plasma samples by qRT-PCR using BioMarkTM 96.96 Dynamic Array (Fluidigm Corporation) system. In CHC group, expression profiles of miR-30a-5p, miR-30c-5p, miR-206 and miR-302c-3p were found significantly deregulated (p < 0.05) when compared versus control group. In HCV-positive cirrhosis group, expression profiles of miR-30c-5p, miR-223-3p, miR-302c-3p, miR-17-5p, miR-130a-3p, miR-93-5p, miR-302c-5p and miR-223-3p were found significantly deregulated (p < 0.05). In HCV-positive HCC group, expression profiles of miR-17-5p, miR-223-3p and miR-24-3p were found significant (p < 0.05). When all groups were compared versus control, miR-30c-5p, miR-223-3p, miR-302c-3p and miR-17-5p were found significantly deregulated for cirrhosis and HCC. These results imply that miR-30c-5p, miR-223-3p, miR-302c-3p and miR-17-5p could be used as novel non-invasive biomarkers of HCV-positive HCC in very early, even at cirrhosis stage of liver disease. PMID:25391771

  18. Human fructose-1,6-bisphosphatase gene (FBP1): Exon-intron organization, localization to chromosome bands 9q22.2-q22.3, and mutation screening in subjects with fructose-1,6-bisphosphatase deficiency

    El-Maghrabi, M.R.; Jiang, W. [State Univ. of New York, Stony Brook, NY (United States)] [and others

    1995-06-10

    Fructose-1,6-bisphosphatase (EC 3.1.3.11) is a key regulatory enzyme of gluconeogenesis that catalyzes the hydrolysis of fructose-1,6-bisphosphate to generate fructose-6-phosphate and inorganic phosphate. Deficiency of fructose-1,6-bisphosphatase is associated with fasting hypoglycemia and metabolic acidosis because of impaired gluconeogenesis. We have cloned and characterized the human liver fructose-1,6-bisphosphatase gene (FBP1). FBP1, localized to chromosome bands 9q22.2-q22.3 by fluorescence in situ hybridization, consists of seven exons that span > 31 kb, and the six introns are in the same position as in the rat gene. FBP1 was screened for mutations in two subjects with fructose-1,6-bisphosphatase deficiency. Four nucleotide substitutions were identified, two of which were silent mutations in the codons for Ala-216 (GCT {yields} GCC) and Gly-319 (GGG {yields} GGA). The other substitutions were in intron 3, a C {yields} T substitution 7 nucleotides downstream from the splice donor site, and in the promoter region, an A {yields} T substitution 188 nucleotides upstream from the start of transcription. These nucleotide substitutions were also found in normal unaffected subjects and thus are not the cause of fructose-1,6-bisphosphatase deficiency in the two subjects studied. The molecular basis of hepatic fructose-1,6-bisphosphatase deficiency in these subjects remains undetermined but could result from unidentified mutations in the promoter that decrease expression or from mutations in another gene that indirectly lead to decreased fructose-1,6-bisphosphatase activity. 18 refs., 3 figs., 3 tabs.

  19. Strong backlog growth of 22.3% compared to September 30, 2008. Strong third quarter revenue growth of 7.8%, bringing sales for the first nine months of 2009 to 9.7 billion, or +6.4%

    AREVA generated consolidated revenue of 9.686 billion euros over the first nine months of 2009 for growth of 6.4% (+4.0% like-for-like) compared with the same period in 2008. Revenue outside France was up 8.4% to 6.999 billion euros, representing 72% of total revenue. The main revenue growth engines were the Front End division and the Transmission and Distribution division, with growth of 7.6% and 12.4% respectively. Foreign exchange had a positive impact of 91 million euros. Changes in the consolidation scope had an impact of 117 million euros, corresponding to the consolidation of acquisitions made by AREVA TA and the Transmission and Distribution division in 2008 and 2009. Third quarter 2009 revenue rose 7.8% to 3.164 billion euros (+6.7% like-for-like) compared with the third quarter of 2008. Changes in the consolidation scope had a positive impact of 31 million euros. The foreign exchange impact was minimal for the period. Quarterly growth was fueled mostly by the Front End division (+13.7%), the Back End division (+7.1%) and the Transmission and Distribution division (+8.4%). The group's backlog stood at 47.5 billion euros as of September 30, 2009 for 22.3% growth year-on-year. The backlog is up 27.4% in Nuclear and down 5.6% in Transmission and Distribution. For 2009 as a whole, the group confirms its outlook, based on the consolidation scope as of June 30, 2009, for a strong growth in backlog and in revenue and operating income close to that of the financial year 2008

  20. 50 CFR 22.3 - Definitions.

    2010-10-01

    ..., POSSESSION, TRANSPORTATION, SALE, PURCHASE, BARTER, EXPORTATION, AND IMPORTATION OF WILDLIFE AND PLANTS..., feeding, or sheltering behavior, or (3) nest abandonment, by substantially interfering with normal breeding, feeding, or sheltering behavior. Eagle nest means any readily identifiable structure...

  1. 40 CFR 745.223 - Definitions.

    2010-07-01

    ... project designs, occupant protection plans, and abatement reports. Certified risk assessor means an... by EPA pursuant to § 745.226 to conduct risk assessments. A risk assessor also samples for the... any other skill taught in a training course. Hazardous waste means any waste as defined in 40 CFR...

  2. 48 CFR 223.803 - Policy.

    2010-10-01

    ... DEFENSE SOCIOECONOMIC PROGRAMS ENVIRONMENT, ENERGY AND WATER EFFICIENCY, RENEWABLE ENERGY TECHNOLOGIES... Senior Executive Service of the requiring activity in accordance with Section 326, Public Law 102-484...

  3. 48 CFR 223.7102 - Exceptions.

    2010-10-01

    ... OF DEFENSE SOCIOECONOMIC PROGRAMS ENVIRONMENT, ENERGY AND WATER EFFICIENCY, RENEWABLE ENERGY... explosives in order to protect the public or to assist agencies responsible for Federal law enforcement in... Secretary of Energy; (6) The storage of materials that constitute military resources intended to be...

  4. 8 CFR 223.2 - Processing.

    2010-01-01

    ..., may accept and adjudicate an application for a refugee travel document from an alien who previously... defined in 8 CFR 211.1(b)(1)(ii) or 211.1(b)(4); (ii) A permanent resident employed by a public... Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS REENTRY PERMITS, REFUGEE TRAVEL...

  5. Grievance Arbitration in Education. Fastback 223.

    Lovell, Ned B.

    This pamphlet provides information necessary to analyze existing grievance procedures and sets forth principles to guide the formulation of a more effective grievance process. The introduction defines the grievance procedure in a contractual contest, describes its benefits to management, union members, and private citizens; and briefly reviews key…

  6. 29 CFR 553.223 - Meal time.

    2010-07-01

    ... Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR REGULATIONS APPLICATION OF THE.... (a) If a public agency elects to pay overtime compensation to firefighters and law enforcement... history of the Act indicates Congressional intent to mandate a departure from the usual FLSA “hours...

  7. CopperCore 2.2.3

    Vogten, Hubert; Martens, Harrie; Koper, Rob

    2005-01-01

    Changes in this version: great number of bug fixes with regard to notifcation handling, allowed empty items in order to be more compatible with Reload, added QTI content type for CopperCore Service Integration, improved error handling, improved Clicc and fixed a bug regarding the else operation in a

  8. 36 CFR 223.50 - Periodic payments.

    2010-07-01

    ...) Total contract value is the product of the estimated volume of the sale multiplied by the rates bid by... equal 35 percent of the total contract value or 50 percent of the bid premium, whichever is greater....

  9. 36 CFR 223.186 - Definitions.

    2010-07-01

    ... DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER The Forest Resources Conservation and Shortage Relief Act of 1990...” are synonymous and are used interchangeably. Act means the Forest Resources Conservation and Shortage... disregard for the matter of whether the person's conduct is prohibited by the Forest Resources...

  10. Purification of radium-226 for the manufacturing of actinium-225 in a cyclotron for alpha-immunotherapy; Radium-Aufreinigung zur Herstellung von Actinium-225 am Zyklotron fuer die Alpha-Immuntherapie

    Marx, Sebastian Markus

    2014-09-23

    The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.

  11. Renal uptake of bismuth-213 and its contribution to kidney radiation dose following administration of actinium-225-labeled antibody

    Schwartz, J; O' Donoghue, J A; Humm, J L [Department of Medical Physics, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); Jaggi, J S [Bristol-Myers Squibb, Plainsboro, NJ (United States); Ruan, S; Larson, S M [Nuclear Medicine Service Department of Radiology, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); McDevitt, M; Scheinberg, D A, E-mail: schwarj1@mskcc.org [Molecular Pharmacology and Chemistry, Sloan-Kettering Institute, 1275 York Avenue, New York, NY 10065 (United States)

    2011-02-07

    Clinical therapeutic studies using {sup 225}Ac-labeled antibodies have begun. Of major concern is renal toxicity that may result from the three alpha-emitting progeny generated following the decay of {sup 225}Ac. The purpose of this study was to determine the amount of {sup 225}Ac and non-equilibrium progeny in the mouse kidney after the injection of {sup 225}Ac-huM195 antibody and examine the dosimetric consequences. Groups of mice were sacrificed at 24, 96 and 144 h after injection with {sup 225}Ac-huM195 antibody and kidneys excised. One kidney was used for gamma ray spectroscopic measurements by a high-purity germanium (HPGe) detector. The second kidney was used to generate frozen tissue sections which were examined by digital autoradiography (DAR). Two measurements were performed on each kidney specimen: (1) immediately post-resection and (2) after sufficient time for any non-equilibrium excess {sup 213}Bi to decay completely. Comparison of these measurements enabled estimation of the amount of excess {sup 213}Bi reaching the kidney ({gamma}-ray spectroscopy) and its sub-regional distribution (DAR). The average absorbed dose to whole kidney, determined by spectroscopy, was 0.77 (SD 0.21) Gy kBq{sup -1}, of which 0.46 (SD 0.16) Gy kBq{sup -1} (i.e. 60%) was due to non-equilibrium excess {sup 213}Bi. The relative contributions to renal cortex and medulla were determined by DAR. The estimated dose to the cortex from non-equilibrium excess {sup 213}Bi (0.31 (SD 0.11) Gy kBq{sup -1}) represented {approx}46% of the total. For the medulla the dose contribution from excess {sup 213}Bi (0.81 (SD 0.28) Gy kBq{sup -1}) was {approx}80% of the total. Based on these estimates, for human patients we project a kidney-absorbed dose of 0.28 Gy MBq{sup -1} following administration of {sup 225}Ac-huM195 with non-equilibrium excess {sup 213}Bi responsible for approximately 60% of the total. Methods to reduce renal accumulation of radioactive progeny appear to be necessary for the success of {sup 225}Ac radioimmunotherapy.

  12. Purification of radium-226 for the manufacturing of actinium-225 in a cyclotron for alpha-immunotherapy

    The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.

  13. Distribution of trace elements in land plants and botanical taxonomy with special reference to rare earth elements and actinium

    Distribution profiles of trace elements in land plants were studied by neutron activation analysis and radioactivity measurements without activation. Number of botanical samples analyzed were more than three thousand in which more than three hundred botanical species were included. New accumulator plants of Co, Cr, Zn, Cd, rare earth elements, Ac, U, etc., were found. Capabilities of accumulating trace elements can be related to the botanical taxonomy. Discussions are given from view points of inorganic chemistry as well as from botanical physiology

  14. 1:1 and 2:1 Lithium Zincates with Intramolecular Coordination. Structures of Li(thf)Zn(C6H4CH2NMe2-2)3 and Li2Zn(C6H4CH2NMe2-2)4

    van Koten, G; Rijnberg, E.; Jastrzebski, J.T.B.H.; Boersma, J.; Kooijman, H.; Veldman, N.; Spek, A.L.

    1997-01-01

    Homoleptic lithium zincates with intramolecular Li-N coordination, i.e., Li(thf)nZn(C6H4CH2NMe2-2)3 (n = 0 (1); n = 1 (1(thf))) and Li2Zn(C6H4CH2NMe2-2)4 (2) have been prepared by reacting [Li(C6H4CH2NMe2-2)]4 with Zn(C6H4CH2NMe2-2)2. In the solid state 1(thf) is a monomer containing a distorted tetrahedral zinc atom. The zinc is surrounded by three monoanionic C6H4CH2NMe2-2 (dmba) ligands, which all show a different bonding mode: 1-C bonding to zinc and nitrogen coordination to lithium; 1,2-...

  15. 49 CFR 571.223 - Standard No. 223; Rear impact guards.

    2010-10-01

    ... calculating the shaded area bounded by the curve in the force vs. deflection diagram and the abscissa (X-axis... the distance that the striking vehicle's front end slides under the rear end of the impacted vehicle... forward of the vehicle's rear extremity, as defined in S4 of 49 CFR 571.224, Rear Impact Protection....

  16. Isothermal phase (vapour + liquid) equilibrium data for binary mixtures of propene (R1270) with either 1,1,2,3,3,3-hexafluoro-1-propene (R1216) or 2,2,3-trifluoro-3-(trifluoromethyl)oxirane in the temperature range of (279 to 318) K

    Highlights: • Phase equilibrium data for propene and hexafluoropropylene. • Phase equilibrium data for propene and hexafluoropropylene oxide. • Systems exhibit pressure-maximum azeotropes. • Data well correlated by Peng–Robinson equation of state with the Wong–Sandler mixing rule. - Abstract: Isothermal (vapour + liquid) equilibrium data (P–x–y) are presented for the 1-propene 1,1,2,3,3,3-hexafluoro-1-propene and the 1-propene + 2,2,3-trifluoro-3-(trifluoromethyl)oxirane binary systems. Both binary systems were studied at five temperatures, ranging from (279.36 to 318.09) K, at pressures up to 2 MPa. The experimental (vapour + liquid) equilibrium data were measured using an apparatus based on the “(static + analytic)” method incorporating a single movable Rapid On-Line Sampler-Injector to sample the liquid and vapour phases at equilibrium. The expanded uncertainties are approximated on average as T = 0.07 K, 0.008 MPa, and 0.007 and 0.009 for the temperature, pressure, and the liquid and vapour mole fractions, respectively. A homogenous maximum-pressure azeotrope was observed for both binary systems at all temperatures studied. The experimental data were correlated with the Peng–Robinson equation of state using the Mathias–Copeman alpha function, paired with the Wong–Sandler mixing rule and the Non-Random Two Liquid activity coefficient model. The model provided satisfactory representation of the phase equilibrium data measured

  17. Soluble yttrium chalcogenides: syntheses, structures, and NMR properties of Y[eta 3-N(SPPh2)2]3 and Y[eta 2-N(SePPh2)2]2[eta 3-N(SePPh2)2].

    Pernin, C G; Ibers, J A

    2000-03-20

    The compounds Y[N(QPPh2)2]3 (Q = S (1), Se (2)) have been synthesized in good yield from the protonolysis reactions between Y[N(SiMe3)2]3 and HN(QPPh2)2 in methylene chloride (CH2Cl2). The compounds are not isostructural. In 1, the Y atom is surrounded by three similar [N(SPPh2)2]- ligands bound eta 3 through two S atoms and an N atom. The molecule possesses D3 symmetry, as determined in the solid state by X-ray crystallography and in solution by 89Y and 31P NMR spectroscopies. In 2, the Y atom is surrounded again by three [N(SePPh2)2]- ligands, but two are bound eta 2 through the two Se atoms and the other ligand is bound eta 3 through the two Se atoms and an N atom. Although a fluxional process is detected in the 31P and 77Se NMR spectra, a triplet is found in the 89Y NMR spectrum of 2 (delta = 436 ppm relative to YCl3 in D2O, 2JY-P = 5 Hz). This implies that on average the conformation of one eta 3- and two eta 2-bound ligands is retained in solution. Crystallographic data for 1: C72H60N3P6S6Y, rhombohedral, R3c, a = 14.927(5) A, c = 56.047(13) A, V = 10815(6) A3, T = 153 K, Z = 6, and R1(F) = 0.042 for the 1451 reflections with I > 2 sigma(I). Crystallographic data for 2: C72H60N3P6Se6Y.Ch2-Cl2, monoclinic, P2(1)n, a = 13.3511(17) A, b = 38.539(7) A, c = 14.108(2) A, beta = 94.085(13) degrees, V = 7241(2) A 3, T = 153 K, Z = 4, and R1(F) = 0.037 for the 8868 reflections with I > 2 sigma(I). PMID:12526414

  18. Dicty_cDB: VFI223 [Dicty_cDB

    Full Text Available kwfs*fnycgtscslv*ftcil*rikkiikrkwfinhlvlwfneny k***cssss*ktll*nnrrpilgtrekiy***ic*y*tif*kxn*kxnfss*invn**yd wllfimvricsihqsrkqrcftr...n*rnlvksxqnngw*fkin*cklpslydlikkgiktk slkkekksfistkyi*vsikifffnqfs Homology vs CSM-cDNA Score...*y***nditnsntnqi***iw*yk*il*kf*t niq**iifny*ftl**kkrscn*ywcw*wssnr*iskil*ksywi*titrsn*ecrknxq c*iqiissren*ft...M/FC/FC-BH/FC-BH06Q.Seq.d/ 1540 0.0 own update 2001.12. 4 Homology vs DNA Score E Sequences producing...some 13. 34 2e-04 23 AP003185 |AP003185.1 Clostridium perfringens DNA, complete genome, section 1/10. 44 3e-

  19. Dicty_cDB: VHG223 [Dicty_cDB

    Full Text Available .. 125 2e-27 X59960_1( X59960 |pid:none) H.sapiens mRNA for sphingomyelinase. 125 3e-27 AE013599_4075( AE013...r chromos... 125 3e-27 M81780_2( M81780 |pid:none) Homo sapiens acid sphingomyelinase (SM... 125 3e-27 prote

  20. Laser-driven ICF experiments: Laboratory Report No. 223

    Laser irradiation uniformity is a key issue and is treated in some detail. The basic irradiation uniformity requirements and practical ways of achieving these requirements are both discussed, along with two beam-smoothing techniques: induced spatial incoherence (ISI), and smoothing by spectral dispersion (SSD). Experiments to measure and control the irradiation uniformity are also highlighted. Following the discussion of irradiation uniformity, a brief review of coronal physics is given, including the basic physical processes and their experimental signatures, together with a summary of pertinent diagnostics and results from experiments. Methods of determining ablation rates and thermal transport are also described. The hydrodynamics of laser-driven targets must be fully understood on the basis of experiments. Results from implosion experiments, including a brief description of the diagnostics, are presented. Future experiments aimed at determining ignition scaling and demonstrating hydrodynamically equivalent physics applicable to high-gain designs

  1. 28 CFR 2.23 - Delegation to hearing examiners.

    2010-07-01

    ... may be conducted by a single examiner or by a panel of examiners. A Executive Hearing Examiner shall function as a hearing examiner for the purpose of obtaining a panel recommendation whenever the Regional... a hearing examiner and the Executive Hearing Examiner, shall be required to obtain a...

  2. 36 CFR 223.60 - Determining fair market value.

    2010-07-01

    ..., through issuance of agency directives (36 CFR 200.4). Valid methods to determine fair market value include... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Determining fair market value... Determining fair market value. The objective of Forest Service timber appraisals is to determine fair...

  3. 19 CFR 10.223 - Articles eligible for preferential treatment.

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Articles eligible for preferential treatment. 10...; DEPARTMENT OF THE TREASURY ARTICLES CONDITIONALLY FREE, SUBJECT TO A REDUCED RATE, ETC. United States-Caribbean Basin Trade Partnership Act Textile and Apparel Articles Under the United States-Caribbean...

  4. 48 CFR 1552.223-72 - Care of laboratory animals.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Care of laboratory animals... Care of laboratory animals. As prescribed in 1523.303-72, insert the following clause: Care of Laboratory Animals (OCT 2000) (a) Before undertaking performance of any contract involving the use...

  5. 24 CFR 884.223 - Leasing to eligible families.

    2010-04-01

    ... housing assistance payments for the family in accordance with 24 CFR part 5 because the owner determines... termination of assistance, or if the family constitutes a mixed family, as defined in 24 CFR part 5, the owner shall comply with the provisions of 24 CFR part 5 concerning assistance to mixed families, and...

  6. Laser-driven ICF experiments: Laboratory Report No. 223

    McCrory, R.L.

    1991-04-01

    Laser irradiation uniformity is a key issue and is treated in some detail. The basic irradiation uniformity requirements and practical ways of achieving these requirements are both discussed, along with two beam-smoothing techniques: induced spatial incoherence (ISI), and smoothing by spectral dispersion (SSD). Experiments to measure and control the irradiation uniformity are also highlighted. Following the discussion of irradiation uniformity, a brief review of coronal physics is given, including the basic physical processes and their experimental signatures, together with a summary of pertinent diagnostics and results from experiments. Methods of determining ablation rates and thermal transport are also described. The hydrodynamics of laser-driven targets must be fully understood on the basis of experiments. Results from implosion experiments, including a brief description of the diagnostics, are presented. Future experiments aimed at determining ignition scaling and demonstrating hydrodynamically equivalent physics applicable to high-gain designs.

  7. 36 CFR 223.100 - Award to highest bidder.

    2010-07-01

    ... from parties having direct or indirect common control or association in logging, processing or... bidder has elected Forest Service road construction in response to an advertisement extending such an option, the Forest Service cannot perform the construction and in response to solicitation has...

  8. Dicty_cDB: CHR223 [Dicty_cDB

    Full Text Available iana hemocytes normalized library Acanthoscurria gomesiana cDNA clone AR1005E06 5', mRNA...t Translated Amino Acid sequence (All Frames) Frame A: qchtxrfqelqslawvrkkiiiappmkrmktlvkqsvvvlkh*nqrm...quence 1278 from patent US 6562958. 46 0.002 3 DR445042 |DR445042.1 AR1015F06 A. gomesiana hemocytes norm...alized library Acanthoscurria gomesiana cDNA clone AR1015F06 5', mRNA sequence. 52 0....031 1 AY583235 |AY583235.1 Mycoplasma fermentans strain PG18 putative transport operon, partial sequence; b

  9. 50 CFR 223.210 - North American green sturgeon.

    2010-10-01

    ... that the likelihood of survival or recovery of the listed species is not reduced; a plan for minimizing... endangered species apply to the threatened Southern Distinct Population Segment (DPS) of North American green... (16 U.S.C. 1539) and other exceptions under the ESA relating to endangered species,...

  10. 36 CFR 223.216 - Special Forest Products definitions.

    2010-07-01

    ..., Christmas trees, cones, ferns, firewood, forbs, fungi (including mushrooms), grasses, mosses, nuts, pine..., derrick poles, minerals, animals, animal parts, insects, worms, rocks, water, and soil....

  11. 36 CFR 223.277 - Forest botanical products definition.

    2010-07-01

    ..., pine straw, roots, sedges, seeds, shrubs, transplants, tree sap, and wildflowers. Forest botanical..., minerals, posts and poles, rails, rocks, shingle and shake bolts, water, worms, and soil....

  12. 1935 15' Quad #223 Aerial Photo Mosaic Index

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  13. Radium-223 Improves Survival in Patients with Advanced Prostate Cancer

    ... and data sets for researchers Research by Cancer Type Find research about a specific cancer type Progress Annual Report ... Laws Careers Visitor Information Search Search Home Cancer Types Prostate Cancer Research Prostate Cancer Patient Prostate Cancer Treatment Prostate Cancer ...

  14. 36 CFR 223.42 - Transfer of effective purchaser credits.

    2010-07-01

    ... effective purchaser credit earned after December 16, 1975, from one timber sale account to another timber... procedures for the use of purchaser credit. Approval for transfer shall not be granted for amounts needed to satisfy unfulfilled payment obligations or claims for damages due the United States. Purchaser...

  15. Dicty_cDB: CFG223 [Dicty_cDB

    Full Text Available PVKKKKIKREIKILQNLCGGPNI ITLYDVVRDPQSKTPSLIFEYINNTDFKHLSPTLTDFDVRYYIRELLHAXDFCHSNGIMH RRC*tikryd*sskkkscissigvlpnfiiqikittl...ryd*sskkkscissigvlpnfiiqikittlelllvhtkdqnywliwkimiivl icgvlvvcllvcsskkihssmvmiili

  16. 36 CFR 223.61 - Establishing minimum stumpage rates.

    2010-07-01

    ... offering where deposits are to be required for reforestation under the Act of June 9, 1930, as amended (46... reforestation deposits and a minimum deposit to the Treasury. Minimum rates in timber sale contracts will not be... reforestation....

  17. 36 CFR 223.140 - Scope of debarment.

    2010-07-01

    ..., criminal, or other seriously improper conduct of one purchaser participating in a joint venture or similar... joint venture or similar arrangement or with the knowledge, approval, or acquiescence of those..., shareholder, partner, employee, or other individual associated with a purchaser may be imputed to a...

  18. 36 CFR 223.196 - Civil penalties for violation

    2010-07-01

    ... Secretary of Agriculture finds, on the record and after providing an opportunity for a hearing, that a... providing an opportunity for a hearing, that a person has violated any provision of the Act, or any... not have caused the export of unprocessed Federal timber in violation of such Act, the Secretary...

  19. Dicty_cDB: SHE223 [Dicty_cDB

    Full Text Available 5e-05 U59295_1( U59295 |pid:none) Placopecten magellanicus myosin heavy ... 51 7e...-05 U59294_1( U59294 |pid:none) Placopecten magellanicus myosin heavy ... 51 7e-05 AY823086_1( AY823086 |pid

  20. 36 CFR 223.101 - Determination of purchaser responsibility.

    2010-07-01

    ... purchaser has a satisfactory record of integrity and business ethics; (5) The purchaser has or is able to... and governmental business commitments; (3) The purchaser has a satisfactory performance record on... applicable laws and regulations. (c) If the prospective purchaser is a small business concern and...

  1. Failure modes and effects analysis (RADL Item 2-23)

    None

    1980-04-01

    The Pilot Plant is a central receiver design concept. It is comprised of five major subsystems as shown schematically, plus a set of equipment (Plant Support Subsystem) used to support total plant operation. The failure modes and effects analysis (FMEA) is a bottom-up analysis used to identify the failure characteristics of the system (total equipment used to produce electrical power), that is, the failure of a single component is assumed and the effect of that failure upon the system is determined. The FMEA is concerned with the plant from an operational standpoint (i.e., the production of electrical power). This analysis was performed to the component level. This was interpreted as a valve, computer, measurement sensor and its associated signal conditioning, an electronic black box, etc.

  2. 48 CFR 952.223-78 - Sustainable acquisition program.

    2010-10-01

    ... Executive Order 13514, Federal Leadership in Environmental, Energy, and Economic Performance (http://www... Federal Leadership in Environmental, Energy, and Economic Performance. This guide includes information... Leadership in Environmental, Energy, and Economic Performance...

  3. 36 CFR 223.187 - Determinations of unprocessed timber.

    2010-07-01

    ... AGRICULTURE SALE AND DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER The Forest Resources Conservation and Shortage... and substitution restrictions of the Forest Resources Conservation and Shortage Relief Act of 1990 (16... and substitution restrictions of the Forest Resources Conservation and Shortage Relief Act of 1990...

  4. 36 CFR 223.234 - Determination of responsibility.

    2010-07-01

    ... declared high bidder has a satisfactory record of integrity and business ethics; (4) The declared high... arose from circumstances beyond their reasonable control. (c) Affiliated concerns, as defined in 36...

  5. 48 CFR 352.223-70 - Safety and health.

    2010-10-01

    ... CFR 1910.1030, Bloodborne pathogens; 29 CFR 1910.1450, Occupational exposure to hazardous chemicals in... CFR Part 1910. These regulations are available at http://www.osha.gov. (ii) Nuclear Regulatory... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Safety and health....

  6. Study on laser atomic spectroscopy

    Laser atomic spectroscopic study on actinium element has been performed in many areas of spectroscopy. The study on characteristic of atomic vapor has been proceeded for copper atom and the spatial density distribution of copper vapor is measured. This experimental data has been compared with the theoretically calculated data. In spectroscopic experiment, the first and second excited states for actinium element are identified and the most efficient ionization scheme for actinium element is identified. In addition, the corrosion problem for filament material due to the heating of the actinium element has been studied. (Author)

  7. A Critical Review of Alpha Radionuclide Therapy-How to Deal with Recoiling Daughters?

    de Kruijff, Robin M; Wolterbeek, Hubert T; Denkova, Antonia G

    2015-01-01

    This review presents an overview of the successes and challenges currently faced in alpha radionuclide therapy. Alpha particles have an advantage in killing tumour cells as compared to beta or gamma radiation due to their short penetration depth and high linear energy transfer (LET). Touching briefly on the clinical successes of radionuclides emitting only one alpha particle, the main focus of this article lies on those alpha-emitting radionuclides with multiple alpha-emitting daughters in their decay chain. While having the advantage of longer half-lives, the recoiled daughters of radionuclides like 224Ra (radium), 223Ra, and 225Ac (actinium) can do significant damage to healthy tissue when not retained at the tumour site. Three different approaches to deal with this problem are discussed: encapsulation in a nano-carrier, fast uptake of the alpha emitting radionuclides in tumour cells, and local administration. Each approach has been shown to have its advantages and disadvantages, but when larger activities need to be used clinically, nano-carriers appear to be the most promising solution for reducing toxic effects, provided there is no accumulation in healthy tissue. PMID:26066613

  8. A Critical Review of Alpha Radionuclide Therapy—How to Deal with Recoiling Daughters?

    de Kruijff, Robin M.; Wolterbeek, Hubert T.; Denkova, Antonia G.

    2015-01-01

    This review presents an overview of the successes and challenges currently faced in alpha radionuclide therapy. Alpha particles have an advantage in killing tumour cells as compared to beta or gamma radiation due to their short penetration depth and high linear energy transfer (LET). Touching briefly on the clinical successes of radionuclides emitting only one alpha particle, the main focus of this article lies on those alpha-emitting radionuclides with multiple alpha-emitting daughters in their decay chain. While having the advantage of longer half-lives, the recoiled daughters of radionuclides like 224Ra (radium), 223Ra, and 225Ac (actinium) can do significant damage to healthy tissue when not retained at the tumour site. Three different approaches to deal with this problem are discussed: encapsulation in a nano-carrier, fast uptake of the alpha emitting radionuclides in tumour cells, and local administration. Each approach has been shown to have its advantages and disadvantages, but when larger activities need to be used clinically, nano-carriers appear to be the most promising solution for reducing toxic effects, provided there is no accumulation in healthy tissue. PMID:26066613

  9. A Critical Review of Alpha Radionuclide Therapy—How to Deal with Recoiling Daughters?

    Robin M. de Kruijff

    2015-06-01

    Full Text Available This review presents an overview of the successes and challenges currently faced in alpha radionuclide therapy. Alpha particles have an advantage in killing tumour cells as compared to beta or gamma radiation due to their short penetration depth and high linear energy transfer (LET. Touching briefly on the clinical successes of radionuclides emitting only one alpha particle, the main focus of this article lies on those alpha-emitting radionuclides with multiple alpha-emitting daughters in their decay chain. While having the advantage of longer half-lives, the recoiled daughters of radionuclides like 224Ra (radium, 223Ra, and 225Ac (actinium can do significant damage to healthy tissue when not retained at the tumour site. Three different approaches to deal with this problem are discussed: encapsulation in a nano-carrier, fast uptake of the alpha emitting radionuclides in tumour cells, and local administration. Each approach has been shown to have its advantages and disadvantages, but when larger activities need to be used clinically, nano-carriers appear to be the most promising solution for reducing toxic effects, provided there is no accumulation in healthy tissue.

  10. Radium-228 determination of natural waters via concentration on manganese dioxide and separation using Diphonix ion exchange resin

    The objective of this work was to establish a new procedure for 228Ra determination of natural waters via preconcentration of radium on MnO2 and separation of its daughter, 228Ac, using Diphonix ion exchange resin. Following removal of potential interferences via passage through an initial Diphonix Resin column, the first daughter of 228Ra, 228Ac, is isolated by chromatographic separation via a second Diphonix column. A holding time of >30 h for 228Ac ingrowth in between the two column separations ensures secular equilibrium. Barium-133 is used as a yield tracer. Actinium-228 is eluted from the second Diphonix Resin with 5 ml 1 M 1-Hydroxyethane-1,1-diphosphonic acid (HEDPA) and quantified by addition of scintillation cocktail and LSC counting. Radium (and 133Ba) from the load and rinse solutions from the 2nd Diphonix column may be prepared for alpha spectrometry (for determination of 223Ra, 224Ra, and 226Ra) by BaSO4 microprecipitation and filtration. Decontamination tests indicate that U, Th, and Ra series nuclides do not interfere with these measurements, although high contents of 90Sr (90Y) require additional treatment for accurate measurement of 228Ra. Addition of stable Sr as a 'hold back' carrier during the initial MnO2 preconcentration step was shown to remove most 90Sr interference

  11. Removal of actinium from europium for the determination of specific radioactivity of ultra low-level Eu-152 in a sample exposed to atomic-bomb neutrons in Nagasaki

    Measurements of specific radioactivities of residual neutron-induced radionuclides such as 152Eu and 60Co have been carried out to check the validity of a series of computer calculations employed for the atomic-bomb neutron dosimetry in Hiroshima (exposed to uranium bomb) and Nagasaki (exposed to plutonium bomb). The use of these nuclides for atomic-bomb neutron dosimetry, however, has been limited by the following difficulties: (1) today, these radionuclides are found only at extremely low concentrations in materials exposed to the atomic-bomb and (2) the neutrons that induced these radionuclides were thermal and epithermal, while the neutron dose received in Hiroshima and Nagasaki is attributable to fast neutrons. In order to overcome the first difficulty, we established a chemical procedure to extract Eu and Co from materials exposed to the atomic-bomb, and the chemical procedure has been successful for the materials exposed to atomic-bomb within 1400 m in slant distance from the explosion point. As for Nagasaki, materials exposed in the distances farther than 1200 m have never been subjected to the measurement of residual neutron-induced radionuclides. In this work, determination of specific radioactivity of 152Eu (half-life: 13.542 y) in a sample exposed to Nagasaki atomic-bomb at a distant place from the explosion point was undertaken. But, because of radioactive decay during this ∝60 years since 1945 and long distance from the explosion point, the present specific radioactivity of 152Eu in the sample is extremely low (estimated to be ∝3 x 10-4 Bq-152Eu/mg-Eu), and a serious problem is interferences from daughters of 227Ac (half-life: 21.8 y) in the measurement of ultra low-level radioactivity of 152Eu. Hence, our chemical procedure to obtain Eu-enriched counting source should be improved, and much attention is being denoted to removal of Ac from Eu. (orig.)

  12. 36 CFR 223.2 - Disposal of timber for administrative use.

    2010-07-01

    .... (d) For use in disaster relief work conducted by public agencies. (e) For disposal when removal is..., recreation areas or other improvements of value for the protection or the administration of Federal lands. (b... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Disposal of timber...

  13. 19 CFR 351.223 - Procedures for initiation of downstream product monitoring.

    2010-04-01

    ... 19 Customs Duties 3 2010-04-01 2010-04-01 false Procedures for initiation of downstream product... initiation of downstream product monitoring. (a) Introduction. Section 780 of the Act establishes a mechanism for monitoring imports of “downstream products.” In general, section 780 is aimed at situations...

  14. 36 CFR 223.219 - Sustainable harvest of special forest products.

    2010-07-01

    ....219 Sustainable harvest of special forest products. (a) Sustainable harvest levels. Prior to offering... product's sustainable harvest level. A special forest product's sustainable harvest level is the total... forest officers may consult with other appropriate parties to determine sustainable harvest levels...

  15. 36 CFR 223.52 - Market-related contract term additions.

    2010-07-01

    ... developed sites. (b) Determination of drastic wood product price reductions. (1) The Forest Service shall... drastic reduction in wood product prices applicable to the sale; and (ii) The purchaser makes a written... product characteristics, by volume, being harvested on the sale. The index specified shall represent...

  16. 4 CFR 22.3 - Appeals-How Taken [Rule 3].

    2010-01-01

    ... Washington, DC, or on the next business day if received after 5:30 p.m. (c) Service of the appeal; copies. An... to the Board by hand delivery or commercial carrier within 2 business days of the e-mailed or... docketing to all parties, or their counsel, with a copy of these rules. (e) Consolidation. The Board, in...

  17. 48 CFR 252.223-7004 - Drug-free work force.

    2010-10-01

    ... other than the foregoing requiring a high degree of trust and confidence. (2) Illegal drugs, as used in... the work being performed under the contract, the employee's duties, the efficient use of Contractor... employee to remain on duty or perform in a sensitive position who is found to use illegal drugs until...

  18. Current leads based on the Bi-223 HTSC for superconducting magnets

    The IHEP experience in the area of developing and manufacturing the current leads, intended for the particles accelerator superconducting magnets is summarized. The brief review of the 600 A current leads produced on the basis of the belt composite conductor with the Bi-2223 threads in the matrix from the Ag+1 at. % Au and Ag+10 at. % Au alloys is given. The results of studies on the current leads electrical and thermal properties are presented. The current leads showed their high stability in operation and reliability by the short-time overloading by the current

  19. Yeast Interacting Proteins Database: YLR223C, YOR247W [Yeast Interacting Proteins Database

    Full Text Available ractions with FHL1, overexpression interferes with silencing at telomeres and HM loci; potential Cdc28p substrate...ce of GPI-anchored mannoproteins; has a high serine-threonine content; expression is induced in cell wall mutants...rferes with silencing at telomeres and HM loci; potential Cdc28p substrate Rows with this...ins; has a high serine-threonine content; expression is induced in cell wall mutants Rows with this prey...in (YPD) 0 Alternative path with 2 intervening proteins (YPD) 0 IST hit 3 IST hit in the opposite bait/prey orientation - ...

  20. 36 CFR 223.195 - Procedures for identifying and marking unprocessed timber.

    2010-07-01

    ... procedures required herein. (f) Waiver of branding requirements. Regional Foresters may waive the branding... individual timber sale basis, all or a portion of the branding requirements pursuant to paragraph (c)(2) of...) Regions 5 and 6. On an individual timber sale basis, the branding requirement pursuant to paragraph...

  1. 32 CFR Appendix B to Part 223 - Guidelines for the Determination of DoD UCNI

    2010-07-01

    .... Vulnerability information available from unclassified vendor specifications. 6. Threat Response Capability and... Weapon Stockpile and Storage Requirement, Nuclear Weapon Destruction and Disablement Systems, and Nuclear... on nuclear weapon stockpile and storage requirements, nuclear weapon destruction and...

  2. PS2-23: Prevalence of Extreme Obesity in Southern California

    Koebnick, Corinna; Smith, Ning; Coleman, Karen; Getahun, Darios; Reynolds, Kristi; Quinn, Virginia; Porter, Amy; Der-Sarkissian, Jack; Jacobsen, Steven

    2010-01-01

    Background and Aims: Specific weight goals and treatment options for extremely obese children and adolescents have been suggested. The objective of this study is to provide current estimates of the prevalence of extreme obesity in a large multiethnic youth cohort.

  3. The dynamic interactome of human Aha1 upon Y223 phosphorylation

    Donald Wolfgeher; Dunn, Diana M; Woodford, Mark R.; Dimitra Bourboulia; Gennady Bratslavsky; Mehdi Mollapour; Kron, Stephen J.; Truman, Andrew W.

    2015-01-01

    Heat Shock Protein 90 (Hsp90) is an essential chaperone that supports the function of a wide range of signaling molecules. Hsp90 binds to a suite of co-chaperone proteins that regulate Hsp90 function through alteration of intrinsic ATPase activity. Several studies have determined Aha1 to be an important co-chaperone whose binding to Hsp90 is modulated by phosphorylation, acetylation and SUMOylation of Hsp90 [1], [2]. In this study, we applied quantitative affinity-purification mass spectromet...

  4. 50 CFR 223.102 - Enumeration of threatened marine and anadromous species.

    2010-10-01

    ... in Santa Cruz County, California, to (but not including) the Santa Maria River. 62 FR 43937; Aug 18... streams from the Russian River to Aptos Creek, Santa Cruz County, Californian (inclusive), and the...) Elkhorn coral Acropora palmata Wherever found. Includes United States Florida, Puerto Rico, U.S....

  5. PHITS: Particle and heavy ion transport code system, version 2.23

    A Particle and Heavy-Ion Transport code System PHITS has been developed under the collaboration of JAEA (Japan Atomic Energy Agency), RIST (Research Organization for Information Science and Technology) and KEK (High Energy Accelerator Research Organization). PHITS can deal with the transport of all particles (nucleons, nuclei, mesons, photons, and electrons) over wide energy ranges, using several nuclear reaction models and nuclear data libraries. Geometrical configuration of the simulation can be set with GG (General Geometry) or CG (Combinatorial Geometry). Various quantities such as heat deposition, track length and production yields can be deduced from the simulation, using implemented estimator functions called 'tally'. The code also has a function to draw 2D and 3D figures of the calculated results as well as the setup geometries, using a code ANGEL. Because of these features, PHITS has been widely used for various purposes such as designs of accelerator shielding, radiation therapy and space exploration. Recently PHITS introduces an event generator for particle transport parts in the low energy region. Thus, PHITS was completely rewritten for the introduction of the event generator for neutron-induced reactions in energy region less than 20 MeV. Furthermore, several new tallis were incorporated for estimation of the relative biological effects. This document provides a manual of the new PHITS. (author)

  6. 48 CFR 52.223-5 - Pollution Prevention and Right-to-Know Information.

    2010-10-01

    ... Environmental Leadership Workgroup or, alternatively, by an agency pursuant to section 503 of Executive Order 13148 of April 21, 2000, Greening the Government through Leadership in Environmental Management. Toxic chemical means a chemical or chemical category listed in 40 CFR 372.65. (b) Executive Order 13148...

  7. 77 FR 37732 - Fourteenth Meeting: RTCA Special Committee 223, Airport Surface Wireless Communications

    2012-06-22

    ... meeting Summary and action item status. General Presentations of interest. ICAO WG-S Status Aloke Roy. WiMAX Forum status WiMAX Forum. MSS interference analysis update NASA. AT4 Wireless analysis...

  8. 76 FR 38740 - Tenth Meeting: RTCA Special Committee 223: Airport Surface Wireless Communications

    2011-07-01

    ... General Presentation of Interest Antenna isolation and aircraft installation issues-- Honeywell WiMAX Forum coordination status--WiMAX Forum ] Tuesday Afternoon--MOPS WG Breakout Session Review Status...

  9. 76 FR 20436 - Ninth Meeting: RTCA Special Committee 223: Airport Surface Wireless Communications

    2011-04-12

    ... Status RTCA PMC Feedback and Guidance on WiMAX Forum Test Suites General Presentations of Interest Aero...-space requirements Interface Requirements Interoperability requirements Tour of WiMAX testing facility (return by 15:00) Wednesday Afternoon--MOPS WG Breakout Session RF Performance Tests WiMAX Forum...

  10. The association between LEPR Q223R polymorphisms and breast cancer risk.

    Wang, Yadong; Yang, Haiyan; Gao, Huiyan; Wang, Haiyu

    2015-05-01

    Recently, we have read with great interest the article entitled "The association between polymorphisms in the leptin receptor (LEPR) gene and risk of breast cancer: a systematic review and pooled analysis" published online by Wang et al. (Breast Cancer Res Treat 136:231-239, 2012). This article suggests that the A allele of LEPR gene rs1137101 variant was low-penetrant risk factor for developing breast cancer. The result is encouraging. Nevertheless, several key issues are worth noticing. PMID:25863476

  11. 33 CFR 223.1 - Mississippi River Water Control Management Board.

    2010-07-01

    ..., responsibilities and authority of the Mississippi River Water Control Management Board. (b) Applicability. This...) Composition. The Mississippi River Water Control Management Board is a continuing board consisting of the... improving inter-divisional coordination of water control management activities within the Mississippi...

  12. 24 CFR 884.223a - Preference for occupancy by elderly families.

    2010-04-01

    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Preference for occupancy by elderly... PROGRAM, SECTION 202 SUPPORTIVE HOUSING FOR THE ELDERLY PROGRAM AND SECTION 811 SUPPORTIVE HOUSING FOR... Preference for occupancy by elderly families. (a) Election of preference for occupancy by elderly...

  13. Iu. Ushakov & A. Stukalov, Front voennykh prokurorov [The Military Procurators’ Front], Moskva, Viatka, 2000, 223 pages.

    Vanessa Voisin

    2008-07-01

    Full Text Available Front voennykh prokurorov is a collection of essays written by two writers who are not known as specialists of military history, but obviously have access to archives, as proves the reprint, in the middle of the book, of several pages from the personal files of Afanas’ev, former Main Military Prosecutor of Soviet Armed Forces.The first part of the book is devoted to Nikolai Porfir’evich Afanas’ev’s memoirs, written, according to the editors, after his retirement in 1950. Afanas’ev, though les...

  14. 36 CFR 223.111 - Administration of contracts in designated disaster areas.

    2010-07-01

    ... or other specified development facility and, as a result of a major disaster in a designated area a... disaster, (2) The sale of such timber will assist in sustaining the economy of such area, or (3) The sale...-sharing arrangement in paragraph (a) of this section, he may allow cancellation of the...

  15. 36 CFR 223.191 - Sourcing area disapproval and review procedures.

    2010-07-01

    ... OF AGRICULTURE SALE AND DISPOSAL OF NATIONAL FOREST SYSTEM TIMBER The Forest Resources Conservation... knowledge and understanding of the requirements of the Forest Resources Conservation and Shortage Relief Act... disapproved sourcing area in the past 24 months, pursuant to the Forest Resources Conservation and...

  16. 36 CFR 223.282 - Deposit and expenditure of collected fees.

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Deposit and expenditure of... expenditure of collected fees. (a) Funds collected under the pilot program for the harvest and sale of forest... funds shall be available for expenditure at National Forests or National Grasslands where the funds...

  17. Chiroptical Properties of Cryptophane-223 and -233 Investigated by ECD, VCD, and ROA Spectroscopy.

    Brotin, Thierry; Daugey, Nicolas; Vanthuyne, Nicolas; Jeanneau, Erwann; Ducasse, Laurent; Buffeteau, Thierry

    2015-07-01

    Enantiopure cryptophane derivatives 1 and 2, possessing linkers of different nature (ethylenedioxy and propylenedioxy) connecting the two cyclotribenzylenes (CTB) units, were separated by HPLC using chiral stationary phases. X-ray crystallographic structures of the four enantiomers (+)-1, (-)-1, (+)-2, and (-)-2 have been obtained, allowing the unambiguous determination of their absolute configuration (AC) in the solid state. The chiroptical properties of compounds 1 and 2 were determined from polarimetry, electronic circular dichroism (ECD), vibrational circular dichroism (VCD), and Raman optical activity (ROA) experiments and were compared to those of cryptophane-A (3) derivative. VCD, ROA and ECD spectra of 1 and 2 were calculated by density functional theory (DFT) and time-dependent density functional theory (TDDFT) calculations, respectively, to confirm the AC of the cryptophane derivatives in solution. The (+)-PP and (-)-MM configurations were established for compounds 1 and 2 in chloroform solution, as already reported for the two enantiomers of 3. This result is in agreement with the X-ray structures of the two enantiomers of 1 and 2. PMID:26091242

  18. (S-(Z-Methyl 2-[2,3-bis(benzyloxycarbonylguanidino]-4-methylpentanoate

    Frank R. Fronczek

    2011-01-01

    Full Text Available The title molecule, C24H29N3O6, has a nearly planar ten-atom C3N3O4 core, on account of both N—H groups forming six-membered-ring intramolecular hydrogen bonds to carbamate carbonyl O atoms. The absolute configuration was determined from resonant scattering of light atoms in Mo Kα radiation, agreeing with the configuration of starting materials.

  19. International Bathymetric Chart of the Arctic Ocean, Version 2.23

    National Oceanic and Atmospheric Administration, Department of Commerce — The goal of this initiative is to develop a digital data base that contains all available bathymetric data north of 64 degrees North, for use by mapmakers,...

  20. Generator method of 225Ac production without a carrier for nuclear medicine

    The two-steps isotope generator scheme of 225Ac production from 229Th has been developed. The first step is used for separation of thorium, actinium, radium and daughter decay products (DDP), and removals of parent radionuclide. The second step provides additional separation of actinium from traces of radium and DDP, and conversion of actinium in the nitrate form. The chosen solutions provide optimal conditions for carry out of process. The yield of the 225Ac was 99.9% at minimal losses of parent 229Th (less than 0.1%)

  1. Astatine-211 Pathway from Radiochemistry to Clinical Investigation

    Particularly in clinical settings where tumour burden is low and cancers are located in close proximity to essential normal tissue structures, α-particle emitting radionuclides can offer significant advantages for targeted radionuclide therapy. One of the first alpha emitters to be evaluated for this purpose is the 7.2-h half-life radiohalogen Astatine-211 (211At). From a commercialization-potential perspective 211At, is less appealing than the longer half-life alpha particle emitters Radium-223, Actinium-225 and Thorium-227, which have become the focus of many laboratories. However, if methods for providing a better supply of 211At could be developed, this alpha emitter would be the radionuclide of choice for many potential therapeutic applications. With regard to the production of 211At, this can be readily be accomplished by bombarding natural bismuth targets with 28−29.5 MeV alpha particles via the 209Bi(α,2n)211At reaction. The goal is to utilize an alpha particle beam energy that provides the required balance for maximizing 211At production while minimizing creation of 210At, which is problematic because of its 138.4-day half life alpha-particle emitting daughter, 210Po. For most intended clinical applications, alpha particle beam energy of about 29 MeV offers the best compromise between maximizing yield and providing 211At with sufficient radionuclidic purity for clinical use. Clinically relevant levels of 211At have been produced at several institutions using both internal and external cyclotron targets

  2. Stathmin1 Plays Oncogenic Role and Is a Target of MicroRNA-223 in Gastric Cancer

    Kang, Wei; Tong, Joanna H. M.; Chan, Anthony W. H.; Raymond W M Lung; Chau, Shuk Ling; Queenie W L Wong; Wong, Nathalie; Yu, Jun; Cheng, Alfred S.L.; To, Ka Fai

    2012-01-01

    Stathmin1 (STMN1) is a candidate oncoprotein and prognosis marker in several kinds of cancers. This study was aimed to analyze its expression and biological functions in gastric cancer. The expression of STMN1 was evaluated by qRT-PCR, western blot and immunohistochemistry. The biological function of STMN1 was determined by MTT proliferation assays, monolayer colony formation and cell invasion assays using small interference RNA technique in gastric cancer cell lines. We also explored the reg...

  3. 48 CFR 952.223-76 - Conditional payment of fee or profit-safeguarding restricted data and other classified...

    2010-10-01

    ... that may warrant a reduction below the specified range (see 48 CFR 904.402(c) and 48 CFR 923.7002(a)(2... performance (including effective resource allocation) and to support DOE corporate decision-making (e.g... other information classified as Top Secret, any classification level of information in a Special...

  4. 24 CFR 207.252b - Premiums-mortgages insured pursuant to section 223(f) of the Act.

    2010-04-01

    ... HOUSING COMMISSIONER, DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES MULTIFAMILY HOUSING MORTGAGE INSURANCE Contract Rights.... (a) The mortgagee, upon the initial-final endorsement of the mortgage for insurance pursuant to...

  5. W-026 acceptance test report plant control system software(submittal {number_sign}223.02)

    Watson, T.L.

    1997-02-14

    Acceptance Testing of the WRAP 1 Plant Control System software was conducted throughout the construction of WRAP 1 with final testing on the glovebox software being completed in December 1996. The software tests were broken out into five sections; one for each of the four Local Control Units and one for the supervisory software modules. This document contains a completed copy of the software tests along with the applicable test log and completed Exception Test Reports. The ETRs outside the scope of the contractor are not signed off. These will be resolved by the Buyer and all 1280 open issues will be tracked on Buyer`s ETR database pending resolution.

  6. 12 CFR 223.56 - What transactions are exempt from the market-terms requirement of section 23B?

    2010-01-01

    ... money market mutual fund under SEC Rule 2a-7 (17 CFR 270.2a-7), if the member bank: (1) Purchases the... 12 Banks and Banking 3 2010-01-01 2010-01-01 false What transactions are exempt from the market... market-terms requirement of section 23B? The following transactions are exempt from the...

  7. 75 FR 4477 - Airworthiness Directives; Airbus Model A330-201, -202, -203, -223, -243, -301, -302, -303, -321...

    2010-01-28

    ..., 2009 (74 FR 45781). That NPRM proposed to correct an unsafe condition for the specified products. The... Procedures (44 FR 11034, February 26, 1979); and 3. Will not have a significant economic impact, positive or...], the bogie stop pad was found deformed and cracked. Upon removal of the bogie stop pad for...

  8. Aquastress D2.2.3 - Key research priorities for and major knowledge gaps in Water Stress mitigation

    Moors, E.; Manez, M.; Van den Wyngaert, I.; Bauer, M.; Inman, D.; Koundouri, P.; S. Loubier; Preziosi, E.; Tarnacki, K.

    2008-01-01

    In this report the factual analysis is compared with the stakeholder perceptions for different test sites. Based on these findings the following general conclusions could be drawn. To obtain a good insight in the bio-geophysical system as well as the socio-economic setting often data were inadequate. This made it difficult to assess the water stress. It also stresses the need for a good monitoring network. A number of sites indicated that the distribution of the amount of water over the diffe...

  9. Analysis of Gln223Agr Polymorphism of Leptin Receptor Gene in Type II Diabetic Mellitus Subjects among Malaysians

    Chong Pei Pei; Ahmad Khairuddin Mohamed Yusof; Seyyed Reza Pishva; Ahmad Fazli Abdul Aziz; Farzad Heidari; Vasudevan Ramachandran; Ali Etemad; Patimah Ismail

    2013-01-01

    Leptin is known as the adipose peptide hormone. It plays an important role in the regulation of body fat and inhibits food intake by its action. Moreover, it is believed that leptin level deductions might be the cause of obesity and may play an important role in the development of Type 2 Diabetes Mellitus (T2DM), as well as in cardiovascular diseases (CVD). The Leptin Receptor (LEPR) gene and its polymorphisms have not been extensively studied in relation to the T2DM and its complications in ...

  10. 75 FR 60655 - Airworthiness Directives; Airbus Model A330-201, -202, -203, -223, and -243 Airplanes; Airbus...

    2010-10-01

    ... Inspection Requirements'' (66 FR 23086, May 7, 2001). In addition to new airworthiness standards for... Policies and Procedures (44 FR 11034, February 26, 1979); and 3. Will not have a significant economic... power unit (APU) bleed leak detection system could result in overheat of the fuel tank located in...

  11. 76 FR 432 - Airworthiness Directives; Airbus Model A330-201, -202, -203, -223, and -243 Airplanes; Airbus...

    2011-01-05

    ... October 1, 2010 (75 FR 60655). That NPRM proposed to correct an unsafe condition for the specified...'' under the DOT Regulatory Policies and Procedures (44 FR 11034, February 26, 1979); and 3. Will not have... definition review against explosion hazards. * * * * * Failure of the auxiliary power unit (APU) bleed...

  12. Amplification of chromosome 2:Lq22.3 harboring trefoil factor family genes in liver fluke related cholangiocarcinoma is associated with poor prognosis

    Kanuengnuch Muenphon; Temduang Limpaiboon; Patcharee Jearanaikoon; Chawalit Pairojkul; Banchob Sripa; Vajarabhongsa Bhudhisawasdi

    2006-01-01

    AIM: To determine allelic imbalance on chromosomal region 21q22-qter including trefoil factor family genes (TFF) in cholangiocarcinoma (CCA) patients and analyze the correlation between allelic imbalances and clinicopathological parameters.METHODS: Quantitative PCR amplification was performed on four microsatellite markers and trefoil factor family genes (TFF1, TFF2, and TFF3) using a standard curve and SYBR Green Ⅰ dye method. The relative copy number was determined by DNA copy number of tested locus to reference locus. The relative copy number was interpreted as deletion or amplification by comparison with normal reference range. Associations between allelic imbalance and clinicopathological parameters of CCA patients were evaluated by x2-tests.Kaplan-Meier method was used to analyze survival.RESULTS: The frequencies of amplification at D21S1890,D21S1893, and TFF3 were 32.5%, 30.0%, and 28.7%,respectively. Patients who had amplification at regions covering D21S1893, D21S1890, and TFF showed poor prognosis, whereas patients who had deletion showed favorable prognosis (mean: 51.7 wk vs 124.82 wk,P = 0.012). Multivariate Cox regression analysis revealed that amplification of D21S1893, D21S1890 and TFF,blood vessel invasion, and staging were associated with poor prognosis.CONCLUSION: D21S1893-D21S1890 region may harbor candidate genes especially TFF and serine protease family, which might be involved in tumor invasion and metastasis contributing to poor survival. The amplification in this region may be used as a prognostic marker in the treatment of CCA patients.

  13. Treatment of Bone Metastases with Radium-223 in Patients with Castration Resistant Prostate Cancer (CRPC): Alternative or Complementary to Innovative Molecular Therapies?

    The skeletal metastatic disease is a real clinical problem. Approximately 70% of patients with prostate or breast cancer and 35% of those with advanced lung, thyroid, and kidney cancers will develop skeletal metastases, which cause considerable morbidity. Several options are available for treatment, to be used either alone or in various combinations: hormones in case of hormone-sensitive tumours, chemotherapy, biphosphonates, external beam radiation therapy, surgery (in pathologic or impending fracture), bone-seeking radiopharmceuticals, and also molecular therapies. Focusing our attention to patients with prostate cancer, 50% of patients with bone metastases develop skeletal related events (SREs) such as: severe pain, pathologic fractures, spinal compression syndrome, malignant hypercalcemia, bone marrow suppression. All these SREs require adequate therapy since generally determine several functional impairments and worsen the prognosis. It is well known that skeletal complications reduce the quality of life affecting different aspects, physical, functional end emotional. SREs are associated also with lower survival

  14. Tourette syndrome in a pedigree with a 7;18 translocation: Identification of a YAC spanning the translocation breakpoint at 18q22.3

    Boghosian-Sell, L.; Overhauser, J. [Thomas Jefferson Univ., Philadelphia, PA (United States); Comings, D.E. [City of Hope Medical Center, Duarte, CA (United States)

    1996-11-01

    Tourette syndrome is a neuropsychiatric disorder characterized by the presence of multiple, involuntary motor and vocal tics. Associated pathologies include attention deficit disorder and obsessive-compulsive disorder (OCD). Extensive linkage analysis based on an autosomal dominant mode of transmission with reduced penetrance has failed to show linkage with polymorphic markers, suggesting either locus heterogeneity or a polygenic origin for Tourette syndrome. An individual diagnosed with Tourette syndrome has been described carrying a constitutional chromosome translocation. Other family members carrying the translocation exhibit features seen in Tourette syndrome including motor tics, vocal tics, and OCD. Since the disruption of specific genes by a chromosomal rearrangement can elicit a particular phenotype, we have undertaken the physical mapping of the 7;18 translocation such that genes mapping at the site of the breakpoint can be identified and evaluated for a possible involvement in Tourette syndrome. Using somatic cell hybrids retaining either the der(7) or the der(18), a more precise localization of the breakpoints on chromosomes 7 and 18 have been determined. Furthermore, physical mapping has identified two YAC clones that span the translocation breakpoint on chromosome 18 as determined by FISH. These YAC clones will be useful for the eventual identification of genes that map to chromosomes 7 and 18 at the site of the translocation. 41 refs., 3 figs., 1 tab.

  15. 76 FR 24832 - Airworthiness Directives; Airbus Model A330-201, -202, -203, -223, and -243 Airplanes, A330-300...

    2011-05-03

    ... Procedures (44 FR 11034, February 26, 1979); and 3. Will not have a significant economic impact, positive or... include vacuum loss and elasticity laminate checker inspections for damage including de-bonding between... exist or develop on other products of the same type design. Differences Between This AD and the MCAI...

  16. 2-[2-(3-Methoxyphenyl-2-oxoethyl]-1,2-benzisothiazol-3(2H-one 1,1-dioxide

    Masood Parvez

    2010-03-01

    Full Text Available In the title compound, C16H13NO5S, the benzothiazole unit is essentially planar [maximum deviation = 0.0501 (10 Å for the S atom] and is oriented at a dihedral angle of 67.85 (5° with respect to the methoxy-substituted benzene ring. The mean plane of the methoxy group is oriented at 14.3 (3° with respect to the benzene ring to which it is attached. In the crystal structure, weak C—H...O hydrogen bonds form macrocyclic rings with R22(10 and R22(12 motifs.

  17. 24,4,8-Trioxa-21-aza-1,3,6(1,2-tribenzena-2(2,3-bicyclo[3.3.0]octanacyclooctaphane

    P. R. Seshadri

    2009-04-01

    Full Text Available The crystal structure of the title compound, C26H25NO3, was determined as part of an investigation of host–guest and electron donor–acceptor complexes. The oxazole and the pyrrole rings both adopt envelope conformations. The dihedral angle between the two benzene rings directly linked to the oxazole ring is 49.5 (1°. The crystal structure is stabilized by a C—H...π interaction.

  18. Photometric and spectroscopic study of Shakhbazian compact galaxy groups ShCG 104, ShCG 120, ShCG 223, and ShCG 245

    Tovmassian, Hrant M.; H. Tiersch; Tovmassian, Gaghik H.; V. H. Chavushyan; Neizvestny, S.; Pramskij, A. G.; J. P. Torres-Papaqui; M Rozas

    2007-01-01

    Los grupos compactos de galaxias Shakhbazian son las configuraciones más densas que se conocen. Hace algunos años iniciamos un estudio fotométrico y espectroscópico de estos grupos. En este artículo presentamos los resultados de la investigación en los grupos ShCG 104, ShCG 120, ShCG 243 y ShCG 245. Presentamos los corrimientos al rojo de las galaxias miembro, los resultados de la fotometría R, las curvas de brillo superficial-radio efectivo, las masas estimadas, las luminosida...

  19. 223 orzeczenia z Wikipedią. Wykorzystanie internetowej encyklopedii Wikipedia w uzasadnieniach wyroków sądów polskich

    Dąbrowski, Karol; Grabarczuk, Szymon

    2012-01-01

    Autorzy zamierzali sprawdzić, czy użycie słowa „Wikipedia” było przypadkowe, czy zamierzone, a jeśli tak, to w jaki sposób sądy i strony postępowania wykorzystały informacje pochodzące z internetowej encyklopedii Wikipedia. Dążono do sprawdzenia, czy Wikipedia stała się naturalnym źródłem wykorzystywanym przy wykładni językowej (czego autorzy się spodziewali). Przy okazji autorzy chcieli się dowiedzieć, czy używanie jej jest „tajemnicą poliszynela”, biorąc pod uwagę stereotypowe i krytyczne s...

  20. The TAL1 complex targets the FBXW7 tumor suppressor by activating miR-223 in human T cell acute lymphoblastic leukemia

    Mansour, Marc R.; Sanda, Takaomi; Lawton, Lee N.; Li, Xiaoyu; Kreslavsky, Taras; Novina, Carl D.; Brand, Marjorie; Gutierrez, Alejandro; Kelliher, Michelle A.; Jamieson, Catriona H.M.; von Boehmer, Harald; Young, Richard A.; Look, A. Thomas

    2012-01-01

    The oncogenic transcription factor TAL1/SCL is aberrantly expressed in 60% of cases of human T cell acute lymphoblastic leukemia (T-ALL) and initiates T-ALL in mouse models. By performing global microRNA (miRNA) expression profiling after depletion of TAL1, together with genome-wide analysis of TAL1 occupancy by chromatin immunoprecipitation coupled to massively parallel DNA sequencing, we identified the miRNA genes directly controlled by TAL1 and its regulatory partners HEB, E2A, LMO1/2, GAT...

  1. The TAL1 complex targets the FBXW7 tumor suppressor by activating miR-223 in human T cell acute lymphoblastic leukemia

    Mansour, Marc R.; Sanda, Takaomi; Lawton, Lee N.; Li, Xiaoyu; Kreslavsky, Taras; Novina, Carl D.; Brand, Marjorie; Gutierrez, Alejandro; Kelliher, Michelle A.; Jamieson, Catriona H.M.; von Boehmer, Harald; Young, Richard A.; Look, A. Thomas

    2013-01-01

    The oncogenic transcription factor TAL1/SCL is aberrantly expressed in 60% of cases of human T cell acute lymphoblastic leukemia (T-ALL) and initiates T-ALL in mouse models. By performing global microRNA (miRNA) expression profiling after depletion of TAL1, together with genome-wide analysis of TAL1 occupancy by chromatin immunoprecipitation coupled to massively parallel DNA sequencing, we identified the miRNA genes directly controlled by TAL1 and its regulatory partners HEB, E2A, LMO1/2, GAT...

  2. AlGaAs guided-wave second-harmonic generation at 2.23  μm from a quantum cascade laser.

    Ozanam, C; Savanier, M; Lemaître, A; Almuneau, G; Carras, M; Favero, I; Ducci, S; Leo, G

    2014-09-01

    We demonstrate the frequency doubling of a quantum cascade laser in a multilayered, partially oxidized GaAs/AlOx waveguide. Using the waveguide width to fulfill the phase-matching condition, the second harmonic is generated in the wavelength range between 2.2 and 2.4 μm, where not many semiconductor sources are commercially available to date. We discuss the impact of a few fabrication and experimental parameters on the conversion efficiency, an essential step toward the improvement and practical implementation of this proof-of-principle semiconductor microsystem. PMID:25321354

  3. SU-E-J-223: A BOLD Contrast Imaging Sequence to Evaluate Oxygenation Changes Due to Breath Holding for Breast Radiotherapy: A Pilot Study

    Adamson, J; Chang, Z; Cai, J; Palta, M; Horton, J; Yin, F; Blitzblau, R [Duke University Medical Center, Durham, NC (United States)

    2015-06-15

    Purpose: To develop a robust MRI sequence to measure BOLD breath hold induced contrast in context of breast radiotherapy. Methods: Two sequences were selected from prior studies as candidates to measure BOLD contrast attributable to breath holding within the breast: (1) T2* based Gradient Echo EPI (TR/TE = 500/41ms, flip angle = 60°), and (2) T2 based Single Shot Fast Spin Echo (SSFSE) (TR/TE = 3000/60ms). We enrolled ten women post-lumpectomy for breast cancer who were undergoing treatment planning for whole breast radiotherapy. Each session utilized a 1.5T GE MRI and 4 channel breast coil with the subject immobilized prone on a custom board. For each sequence, 1–3 planes of the lumpectomy breast were imaged continuously during a background measurement (1min) and intermittent breath holds (20–40s per breath hold, 3–5 holds per sequence). BOLD contrast was quantified as correlation of changes in per-pixel intensity with the breath hold schedule convolved with a hemodynamic response function. Subtle motion was corrected using a deformable registration algorithm. Correlation with breath-holding was considered significant if p<0.001. Results: The percentage of the breast ROI with positive BOLD contrast measured by the two sequences were in agreement with a correlation coefficient of R=0.72 (p=0.02). While both sequences demonstrated areas with strong BOLD response, the response was more systematic throughout the breast for the SSFSE (T2) sequence (% breast with response in the same direction: 51.2%±0.7% for T2* vs. 68.1%±16% for T2). In addition, the T2 sequence was less prone to magnetic susceptibility artifacts, especially in presence of seroma, and provided a more robust image with little distortion or artifacts. Conclusion: A T2 SSFSE sequence shows promise for measuring BOLD contrast in the context of breast radiotherapy utilizing a breath hold technique. Further study in a larger patient cohort is warranted to better refine this novel technique.

  4. Multidrug resistant 2009 a/h1n1 influenza clinical isolate with a neuraminidase i223r mutation retains its virulence and transmissibility in ferrets

    E. van der Vries (Erhard); E.J.B.V. Kroeze; K.J. Stittelaar (Koert); M. Linster (Martin); A. van der Linden; E.J.A. Schrauwen (Eefje); L.M.E. Leijten (Lonneke); G. van Amerongen (Geert); M. Schutten (Martin); T. Kuiken (Thijs); A.D.M.E. Osterhaus (Albert); R.A.M. Fouchier (Ron); C.A.B. Boucher (Charles); S. Herfst (Sander)

    2011-01-01

    textabstractOnly two classes of antiviral drugs, neuraminidase inhibitors and adamantanes, are approved for prophylaxis and therapy against influenza virus infections. A major concern is that influenza virus becomes resistant to these antiviral drugs and spreads in the human population. The 2009 pan

  5. Review of Andrés Solimano, International Migration in the Age of Crisis and Globalisation. Historical and Recent Experiences, Cambridge University Press, 2010. 223 Pp.

    Dirina Claudiu – Ciprian

    2015-12-01

    Full Text Available “International Migration in the Age of Crisis and Globalization. Historical and Recent Experiences” represents a work of major interest in the field of migration and globalization. Apparently two concepts that relate one to another, on a background of major population dynamics, the two notions are the two important pillars in what might perfectly be described as a complex analysis of migration, starting from the elements that have initiated it, and culminating with a fine comparison of positive and negative aspects of this phenomenon.

  6. Konfektionierung und Individualisierung im Fernstudium (Ready-Made and Individualized Systems in Distance Study). Bericht zum ZIFF-Projekt 2.23. ZIFF Papiere-58.

    Lehner, H.; Weingartz, M.

    The typical traits of a ready-made system as well as those of an individualized system are constituent characteristics of distance education. Within the framework set by these qualities and the extent to which they differ from one another, one seeks to achieve the fundamental educational aim of distance students' autonomy. The way institutions see…

  7. 68Ga-PSMA-11 PET Represents the Tumoricidal Effect of 223Ra in a Patient With Castrate-Resistant Metastatic Prostate Cancer.

    Ahmadzadehfar, Hojjat; Schlenkhoff, Carl Diedrich; Rogenhofer, Sebastian; Yordanova, Anna; Essler, Markus

    2016-09-01

    A 64-year-old man with prostate cancer and an increasing prostate-specific antigen (PSA) level under therapy with abiraterone acetate underwent a therapy with Ra. Before the first therapy and 4 weeks after the last cycle, the patient underwent Ga-PSMA PET, which showed a clear response of bone metastases. PMID:27405025

  8. Safety Evaluation Report related to the renewal of the operating license for the training and research reactor at the University of Lowell (Docket No. 50-223)

    This Safety Evaluation Report for the application filed by the University of Lowell (UL) for renewal of operating license number R-125 to continue to operate its research reactor has been prepared by the Office of Nuclear Reactor Regulation of the US Nuclear Regulatory Commission. The facility is located on the North Campus of the University of Lowell in Lowell, Massachusetts. The staff concludes that the reactor can continue to be operated by the University of Lowell without endangering the health and safety of the public

  9. SU-E-J-223: A BOLD Contrast Imaging Sequence to Evaluate Oxygenation Changes Due to Breath Holding for Breast Radiotherapy: A Pilot Study

    Purpose: To develop a robust MRI sequence to measure BOLD breath hold induced contrast in context of breast radiotherapy. Methods: Two sequences were selected from prior studies as candidates to measure BOLD contrast attributable to breath holding within the breast: (1) T2* based Gradient Echo EPI (TR/TE = 500/41ms, flip angle = 60°), and (2) T2 based Single Shot Fast Spin Echo (SSFSE) (TR/TE = 3000/60ms). We enrolled ten women post-lumpectomy for breast cancer who were undergoing treatment planning for whole breast radiotherapy. Each session utilized a 1.5T GE MRI and 4 channel breast coil with the subject immobilized prone on a custom board. For each sequence, 1–3 planes of the lumpectomy breast were imaged continuously during a background measurement (1min) and intermittent breath holds (20–40s per breath hold, 3–5 holds per sequence). BOLD contrast was quantified as correlation of changes in per-pixel intensity with the breath hold schedule convolved with a hemodynamic response function. Subtle motion was corrected using a deformable registration algorithm. Correlation with breath-holding was considered significant if p<0.001. Results: The percentage of the breast ROI with positive BOLD contrast measured by the two sequences were in agreement with a correlation coefficient of R=0.72 (p=0.02). While both sequences demonstrated areas with strong BOLD response, the response was more systematic throughout the breast for the SSFSE (T2) sequence (% breast with response in the same direction: 51.2%±0.7% for T2* vs. 68.1%±16% for T2). In addition, the T2 sequence was less prone to magnetic susceptibility artifacts, especially in presence of seroma, and provided a more robust image with little distortion or artifacts. Conclusion: A T2 SSFSE sequence shows promise for measuring BOLD contrast in the context of breast radiotherapy utilizing a breath hold technique. Further study in a larger patient cohort is warranted to better refine this novel technique

  10. C/EBPa-Mediated Activation of MicroRNAs 34a and 223 Inhibits Lef1 Expression To Achieve Efficient Reprogramming into Macrophages

    Rodriguez-Ubreva, Javier; Ciudad, Laura; van Oevelen, Chris; Parra, Maribel; Graf, Thomas; Ballestar, Esteban

    2014-01-01

    MicroRNAs (miRNAs) exert negative effects on gene expression and influence cell lineage choice during hematopoiesis. C/EBPa-induced pre-B cell-to-macrophage transdifferentiation provides an excellent model to investigate the contribution of miRNAs to hematopoietic cell identity, especially because the two cell types involved fall into separate lymphoid and myeloid branches. In this process, efficient repression of the B cell-specific program is essential to ensure transdifferentation and macr...

  11. 43 CFR 2.23 - How will a bureau handle a request for commercial or financial information that it has obtained...

    2010-10-01

    ... bureau will presume that the submitter has no objection to disclosure of the information. (g) If the... determines that the information is exempt from disclosure; (2) The information has been lawfully published or... has made the information public; (3) Disclosure of the information is required by statute (other...

  12. Localization of the gene encoding the putative human HLA class II associated protein (PHAPI) to chromosome 15q22.3-q23 by fluorescence in situ hybridization

    Fink, T.M.; Lichter, P. [Deutsches Krebsforschungszentrum Abt. Organisation komplexer Genome, Heidelberg (Germany); Vaesen, M. [Max-Planck-Institut fuer experimentelle Medizin Abt. Immunchemie, Goettingen (Germany)] [and others

    1995-09-01

    The putative HLA class II associated proteins PHAPI and PHAPII were purified and cloned on the basis of their ability to bind to the cytoplasmatic domain of the HLA Dr{alpha}-chain. They might be components of the transmembrane signaling pathway that is activated after extracellular binding of ligands during the immune response. Both proteins share extended stretches of highly acidic amino acids in their C-terminal regions that also indicate a nuclear localization. Indeed, PHAPI is likely to be the human homologue of the rat {open_quotes}leucine-rich acidic nuclear protein{close_quotes} (LANP) (83.6% amino acid identity), which was shown to be localized in the nuclei of Purkinje cells. Comparison of the cDNA sequences with entries in the EMBL data library revealed that PHAPII is identical to a protein named SET. The SET gene is located on chromosome 9q34 and was found to be fused to the putative oncogene CAN in one patient with acute undifferentiated leukemia (AUL). 9 refs., 1 fig.

  13. Palliation of Extensive Metastatic Bone Disease With 223Ra-Dichloride α-Particle Therapy in a Patient With Malignant Hereditary Paraganglioma-Pheochromocytoma Syndrome With SDHB Mutation.

    Makis, William; McCann, Karey; McEwan, Alexander J B; Sawyer, Michael B

    2016-02-01

    A 26-year-old woman with a 5-year history of metastatic paraganglioma due to hereditary paraganglioma-pheochromocytoma syndrome with SDHB mutation, who had failed multiple treatment regimens and had transfusion dependent pancytopenia, presented with progressive liver and bone metastases. She was unable to sleep due to painful skull metastases and had severe weakness in her extremities that limited her mobility and daily activities. She was treated with 2 doses of Ra-dichloride (Xofigo, Ra) and had a dramatic improvement in pain control, mobility, and overall quality of life for 8 weeks, before passing away from pulmonary hemorrhage. PMID:26359562

  14. I. The metabolic properties of plutonium and allied materials

    Hamilton, J.G.

    1948-05-24

    This report on the metabolic properties of plutonium and related radioactive materials presents experimental information in the following areas: radioautographic studies; tracer studies (with tables of accumulation in tissues) of actinium, radio-zirconium, technetium, radio-rubidium, radio-germanium, beryllium, and cadmium; decontamination and bone metabolism studies; and radio-chemical isolation.

  15. 77 FR 3787 - Notice of Submission of Proposed Information Collection to OMB; Office of Hospital Facilities...

    2012-01-25

    ... Facilities Transactional Forms for FHA Programs 242, 241, 223(f), 223(a)(7) AGENCY: Office of the Chief...: Office of Hospital Facilities Transactional Forms for FHA Programs 242, 241, 223(f), 223(a)(7). OMB..., HUD-92464-OHF, HUD- 92441-OHF, 2466-GP, 41901, 92403, 92450-CA-OHF, 92422, 92451, 92452-A- OHF,...

  16. New production in the South China Sea

    CAI; Pinghe

    2002-01-01

    [1]Dugdale, R. C., Goering, J. J., Uptake of new and regenerated nitrogen in primary productivity, Limnology and Oceanog-raphy, 1967, 12: 196-206.[2]Eppley, R. W., Peterson, B. J., Particulate organic matter flux and planktonic new production in the deep ocean, Nature, 1979, 282: 677-680.[3]Allen, C. B., Kanda, J., Laws, E. A., New production and photosynthetic rates within and outside a cyclonic mesoscale eddy in the North Pacific Subtropical gyre, Deep-Sea Research Ⅱ, 1996, 43(6): 917-936.[4]Jenkins, W. J., Tritium-helium dating in the Sargasso Sea: A measurement of oxygen utilization rates, Nature, 1977, 196: 291-292.[5]Spitzer, W. S., Jenkins, W. J., Rates of vertical mixing, gas exchange and new production: Estimates from seasonal gas cy-cle in the upper ocean near Bermuda, Journal of Marine Research, 1989, 47: 169-196.[6]Sarmiento, J. L., Thiele, G., Key, R. M. et al., Oxygen and nitrate new production and remineralization in the North At-lantic Subtropical Gyre, Journal of Geophysical Research, 1990, 95: 18303-18315.[7]Ku, T. L., Luo, S., Kusakabe, M. et al., 228Ra-derived nutrient budgets in upper equatorial Pacific and the role of "new" silicate in limiting productivity, Deep-Sea Research II, 1995, 42(2/3): 479-497.[8]Wheeler, P. A., Rates of nitrate assimilation at the equator during the US-JGOFS spring time series: Estimates of new pro-duction, EOS, Transactions, American Geophysical Union, 1992, 73: 281.[9]Huang, Y., Xie, Y., Chen, M. et al., Distribution feature of 228Ra in surface seawater of the Nansha sea area, in Isotopes Marine Chemistry of Nansha Islands Waters (in Chinese), Beijing: Ocean Press, 1996, 70-78.[10]Reid, D. F., Key, R. M., Schink, D., Radium, thorium and actinium extraction from seawater using an improved manga-nese-oxide-coated fiber, Earth and Planetary Science Letters, 1979, 43: 223-226.[11]Shi, W., Qiu, X., Huang, Y., Distribution of dissolved 226Ra in the Jiulongjiang-Xiamen bay

  17. Sorption studies of radioelements on geological materials

    Batch sorption experiments have been carried out to study the sorption of uranium, technetium, curium, neptunium, actinium, protactinium, polonium, americium and plutonium onto bentonite, granodiorite and tuff. Mathematical modelling using the HARPHRQ program and the HATCHES database was carried out to predict the speciation of uranium and technetium in the equilibrated seawater, and neptunium, americium and plutonium in the rock equilibrated water. Review of the literature for thermodynamic data for curium, actinium, protactinium and polonium was carried out. Where sufficient data were available, predictions of the speciation and solubility were made. This report is a summary report of the experimental work conducted by AEA Technology during April 1991-March 1998, and the main results have been presented at Material Research Society Symposium Proceedings and published as proceedings of them. (author)

  18. Investigation for determining the retention properties of rock over the ASSE II mine for dissolved radionuclides

    For a model consideration of groundwater movement and the associated transport of dissolved substance in deep groundwater, the retention properties of the ASSE II mine for radionuclides dissolved in water were determined. A series of properties of rocks were examined and described for this purpose. Apart from the chemical, mineralogical and petrophysical characteristics of the rocks, the retention was determined by 3 different methods and stated in the form of distribution coefficients for specific elements. A comparison of the results of vibration and diffusion experiments gave good agreement, while the results in through column experiments only reached the same order of magnitude after an expensive determination with the aid of a place concentration distribution. The distribution coefficients for the elements carbon, selenium, strontium, technetium, iodine, caesium, lead, radium, actinium, proto-actinium, uranium, neptunium, plutonium, americium and curium are listed and collected for model rock packages. (orig./HP)

  19. Sorption studies of radioelements on geological materials

    Berry, J. A; 油井 三和; 北村 暁

    2007-01-01

    Batch sorption experiments have been carried out to study the sorption of uranium, technetium, curium, neptunium, actinium, protactinium, polonium, americium and plutonium onto bentonite, granodiorite and tuff. Mathematical modelling using the HARPHRQ program and the HATCHES database was carried out to predict the speciation of uranium and technetium in the equilibrated seawater, and neptunium, americium and plutonium in the rock equilibrated water. Review of the literature for thermodynamic ...

  20. Purification of cerium, neodymium and gadolinium for low background experiments

    Boiko R.S.; Barabash A.S.; Belli P.; Bernabei R.; Cappella F.; Cerulli R.; Danevich F.A.; Incicchitti A.; Laubenstein M.; Mokina V.M.; Nisi S.; Poda D.V.; Polischuk O.G.; Tretyak V.I.

    2014-01-01

    Cerium, neodymium and gadolinium contain double beta active isotopes. The most interesting are 150Nd and 160Gd (promising for 0ν2β search), 136Ce (2β+ candidate with one of the highest Q2β). The main problem of compounds containing lanthanide elements is their high radioactive contamination by uranium, radium, actinium and thorium. The new generation 2β experiments require development of methods for a deep purification of lanthanides from the radioactive elements. A combination of physical an...

  1. LASL experience in decontamination of the environment

    This discussion represents one part of a major effort in soil decontamination at the Los Alamos site. A contaminated industrial waste line in the Los Alamos townsite was removed, and a plutonium incineration facility, and a filter building contaminated with actinium-227 were dismantled. The former plutonium handling facility has been decontaminated, and canyons and an old firing site contaminated with strontium-90 have been surveyed

  2. Study of the origin of elements of the uranium-235 family observed in excess in the vicinity of the experimental nuclear EL4 reactor under dismantling. Lessons got at this day and conclusions; Etude de l'origine des elements de la famille de l'uranium-235 observes en exces dans les environs du reacteur nucleaire experimental EL4 en cours de demantelement. Enseignements retires a ce jour et conclusion

    NONE

    2007-07-01

    This study resumes the discovery of an excess of actinium 227 found around by EL4 nuclear reactor actually in dismantling. The search for the origin of this excess revealed a real inquiry of investigation during three years. Because a nuclear reactor existed in this area a particular attention will have concerned this region. The doubt became the line of conduct to find the answer to the human or natural origin of this excess. Finally and against any evidence, it appears that the origin of this phenomenon was natural, consequence of the particular local geology. The detail of the different investigations is given: search of a possible correlation with the composition of elevations constituent of lanes, search (and underlining) of new sites in the surroundings of the Rusquec pond and the Plouenez station, study of the atmospheric deposits under winds of the nuclear power plant and in the east direction, search of a possible relationship with the gaseous effluents of the nuclear power plant in the past, historical study of radioactive effluents releases in the fifty last years by the analysis of the sedimentary deposits in the Saint-Herbiot reservoir, search of a possible correlation between the excess of actinium 227 and the nuclear power plant activity; search of a possible correlation with a human activity without any relationship with the nuclear activities, search of a correlation with the underground waters, search of a correlation with the geological context, collect of information on the possible transfers in direction of the food chain, determination of the radiological composition of the underground waters ( not perturbed by human activity), search of the cause of an excess of actinium 227 in the old channel of liquid effluents release of the nuclear power plant. The results are given and discussed. And contrary to all expectations the origin of the excess of actinium 227 is completely natural. (N.C.)

  3. The discoveries of uranium 237 and symmetric fission — From the archival papers of Nishina and Kimura

    IKEDA, Nagao

    2011-01-01

    Shortly before the Second World War time, Nishina reported on a series of prominent nuclear physical and radiochemical studies in collaboration with Kimura. They artificially produced 231Th, a member of the natural actinium series of nuclides, by bombarding thorium with fast neutrons. This resulted in the discovery of 237U, a new isotope of uranium, by bombarding uranium with fast neutrons, and confirmed that 237U disintegrates into element 93 with a mass number of 237. They also identified t...

  4. History of the unraveling of the natural decay series

    Milestones in the subject of radioactivity, which were important to the unraveling of natural decay series, have been identified and described. The interplay between all these issues is very complex, and some aspects of the development of the uranium series is discussed as an example, the thorium and actinium series evolved in a similar way from research by many of the same people. All three series as understood in 1913 are compared with their present-day representation. (orig.)

  5. History of the unraveling of the natural decay series

    Milestones in the subject of radioactivity, which were important to the unraveling of natural decay series, have been identified and described. The interplay between all these issues is very complex, and some aspects of the development of the uranium series is discussed as an example, the thorium and actinium series evolved in a similar way from research by many of the same people. All three series as understood in 1913 are compared with their present-day representation. (author)

  6. System for recovery of daughter isotopes from a source material

    Tranter, Troy J [Idaho Falls, ID; Todd, Terry A [Aberdeen, ID; Lewis, Leroy C [Idaho Falls, ID; Henscheid, Joseph P [Idaho Falls, ID

    2009-08-04

    A method of separating isotopes from a mixture containing at least two isotopes in a solution is disclosed. A first isotope is precipitated and is collected from the solution. A daughter isotope is generated and collected from the first isotope. The invention includes a method of producing an actinium-225/bismuth-213 product from a material containing thorium-229 and thorium-232. A solution is formed containing nitric acid and the material containing thorium-229 and thorium-232, and iodate is added to form a thorium iodate precipitate. A supernatant is separated from the thorium iodate precipitate and a second volume of nitric acid is added to the thorium iodate precipitate. The thorium iodate precipitate is stored and a decay product comprising actinium-225 and bismuth-213 is generated in the second volume of nitric acid, which is then separated from the thorium iodate precipitate, filtered, and treated using at least one chromatographic procedure. A system for producing an actinium-225/bismuth-213 product is also disclosed.

  7. Behaviour of uranium series radionuclides in surface water (Crouzille, Limousin). Geochemical implications

    Understanding natural radionuclides behaviour in surface water is a required step to achieve uranium mine rehabilitation and preserve water quality. The first objective of this thesis is to determine which are the radionuclides sources in a drinking water reservoir. The second objective is to improve the knowledge about the behaviour of uranium series radionuclides, especially actinium. The investigated site is a brook (Sagnes, Limousin, France) which floods a peat bog contaminated by a former uranium mine and which empties into the Crouzille lake. It allows studying radionuclides transport in surface water and radionuclides retention through organic substance or water reservoir. Radionuclides distribution in particulate, colloidal and dissolved phases is determined thanks to ultra-filtrations. Gamma spectrometry allows measuring almost all natural radionuclides with only two counting stages. However, low activities of 235U series radionuclides impose the use of very low background well-type Ge detectors, such as those of the Underground Laboratory of Modane (France). Firstly, this study shows that no or few radionuclides are released by the Sagnes peat bog, although its radioactivity is important. Secondly, it provides details on the behaviour of uranium series radionuclides in surface water. More specifically, it provides the first indications of actinium solubility in surface water. Actinium's behaviour is very close to uranium's even if it is a little less soluble. (author)

  8. Hb Chad or alpha 223(B4)Glu----Lys beta 2 observed in members of a Surinam family in association with alpha-thalassemia-2 and with Hb S.

    Codrington, J F; Codrington, F A; Wisse, J H; Wilson, J B; Webber, B B; Wong, S C; Huisman, T H

    1989-01-01

    Three different hemoglobinopathies, i.e. Hb S, Hb Chad [alpha 23 (B4)Glu----Lys], and alpha-thalassemia-2 (-3.7) have been observed in eight members of a family from Surinam. The proposita had all three abnormalities, while her mother and four of her half-brothers had Hb Chad together with an alpha-thalassemia-2 heterozygosity or homozygosity. Gene mapping and dot-blot analysis of amplified DNA identified a G----A mutation in codon 23 of the alpha 2 alpha 1 hybrid gene resulting in the Glu----Lys substitution. The quantity of the alpha-Chad chain averaged 31.5% in its carriers with an additional alpha-thalassemia-2 heterozygosity [-alpha Chad(-3.7 kb)/alpha alpha], and 43% in the two carriers with an additional alpha-thalassemia-2 homozygosity [-alpha Chad (-3.7 kb)/-alpha (3.7 kb)]. These quantities are considerably higher than those reported for families from Chad, China, and Japan; the low levels of 14.5-24% Hb Chad in members of previously reported cases suggest a mutation on a chromosome with two alpha-globin genes [alpha alpha Chad/alpha alpha or alpha Chad alpha/alpha alpha]. PMID:2606723

  9. Alterations in candidate genes PHF2, FANCC, PTCH1 and XPA at chromosomal 9q22.3 region: Pathological significance in early- and late-onset breast carcinoma

    Roychoudhury Susanta

    2008-11-01

    Full Text Available Abstract Introduction Younger women with breast carcinoma (BC exhibits more aggressive pathologic features compared to older women; young age could be an independent predictor of adverse prognosis. To find any existing differences in the molecular pathogenesis of BC in both younger and older women, alterations at chromosomal (chr. 9q22.32-22.33 region were studied owing to its association in wide variety of tumors. Present work focuses on comparative analysis of alterations of four candidate genes; PHF2, FANCC, PTCH1 and XPA located within 4.4 Mb region of the afore-said locus in two age groups of BC, as well as the interrelation and prognostic significance of alterations of these genes. Methods Deletion analysis of PHF2, FANCC, PTCH1 and XPA were examined in a subset of 47 early-onset (group-A: ≤ 40 years and 59 late-onset (group-B: > 40 years breast carcinomas using both microsatellite and exonic markers. Methylation Sensitive Restriction analysis (MSRA was done to check for promoter methylation. Quantitative real-time polymerase chain reaction (Q-PCR and immunohistochemisty (IHC was done in some genes to see their relative mRNA and protein expressions respectively. Clinico-pathological correlation of different parameters as well as patient survival was calculated using different statistical softwares like EpiInfo 6.04b, SPSS 10.0 etc. Results Either age group exhibited high frequency of overall alterations in PHF2, FANCC and PTCH1 compared to XPA. Samples with alteration (deletion/methylation in these genes showed reduced level of mRNA expression as seen by Q-PCR. Immunohistochemical analysis of FANCC and PTCH1 also supported this observation. Poor patient survival was noted in both age groups having alterations in FANCC. Similar result was also seen with PTCH1 and XPA alterations in group-A and PHF2 alterations in group-B. This reflected their roles as prognostic tools in the respective groups in which they were altered. Conclusion Overall alterations of PHF2, FANCC and PTCH1 were comparatively higher than XPA. Differential association of alterations in FANCC and PTCH1 with that of PHF2, XPA and two breast cancer susceptibility genes (BRCA1/BRCA2 in the two age groups suggests differences in their molecular pathogenesis and dysregulation of multiple DNA repair pathways as well as hedgehog dependent stem cell renewal pathway.

  10. Heat capacity, entropy, and Gibbs energy of technetium hexafluoride between 2.23 and 350 K; magnetic anomaly at 3.12 K; mean β energy of 99Tc

    The heat capacity of solid and liquid technetium hexafluoride has been measured between 2.3 and 350 K. The standard entropy, S0, the enthalpy increment, (H0-H00), and the Gibbs energy function, (G0-H00)/T, have been calculated. At T=298.15 K, the thermodynamic functions have the following values: C0/sub p/=157.84 J K-1xmol-1, S0=253.52 +- 0.25 J K-1xmol-1, (H0-H00) =38331 +- 38 J mol-1, and (G0-H00)/T=-124.95 +- 0.12 J K-1xmol-1. TcF6 has a solid--solid transition at 268.335 K associated with an enthalpy change ΔH0/sub tr/=8024.9 +- 5.0 J mol-1. It melts at 311.14 +- 0.05 K and has an enthalpy of fusion of ΔH0/sub f/=4618.86 +- 1.60 J mol-1. TcF6 has a lambda-shaped anomaly in the heat capacity with a peak at 3.12 K, probably caused by a transition to a ferromagnetic state. A similar lambda-shaped transition was observed for rhenium hexafluoride at 1.30 +- 0.05 K. The magnetic entropy of TcF6 is estimated to be 5.823 J K-1xmol-1. The third law value for the standard entropy of TcF6 vapor at 320 K was calculated to be S0 (TcF6, g) =371.278 +- 0.750 J K-1xmol-1. Molecular data for TcF6 lead to a lower value of S0 (TcF6, g, 320 K) = 367.53 J K-1xmol-1. The entropy from molecular data can be made to agree with the calorimetric value if the frequency for the inactive vibrational mode ν6 is lowered to 131 cm-1 from the reported value of 145 cm-1. The average energy of the β decay of 99Tc was evaluated from the radioactive self-heating of the sample and was found to be 97.2 +- 1.2 keV. This number exceeds the literature value but agrees with a more recent integration of the β spectrum

  11. Bukhara- The Eastern Dome of Islam. Urban Development, Urban Space, Architecture and Population. Stuttgart / London, Edition Axel Menges, 2004, 223 p., ill. (photos, cartes et plans), bibliographie, index.

    Kervran, Monik

    2007-01-01

    L’ouvrage commence par une interrogation sur les origines de la ville sogdienne et du plan des villes de l’est iranien, Herat, Bam et Zaranj par exemple, dont l’enceinte est quadrangulaire et les rues parallèles aux murs de cette enceinte. Des quatre hypothèses envisagées : origine gréco-romaine, chinoise, indienne ou autochtone, les auteurs inclineraient plutôt vers les deux dernières. Puis commence l’étude de Boukhara entre les 10e et 19e siècles. Utilisant des données archéologiques et top...

  12. Gestire l’errore e l’uso della lingua madre nella classe di lingua.DOI: 10.5007/2175-7968.2011v1n27p223

    Paolo Torresan

    2011-11-01

    Full Text Available L’uso della lingua madre e la correzione dell’errore sono state questioni rimaste a lungo in ombra nella storia della didattica delle lingue. È stato come se nella pratica docente, negli ultimi anni in cui è invalso l’approccio comunicativo, la questione si risolvesse in due assiomi: la lingua madre va limitata il più possibile, in quanto l’uso rallenterebbe -se non addirittura impedirebbe- la crescita del parlante in lingua straniera e, poiché all’accuratezza va preferita la fluenza, è opportuno l’errore sia corretto soprattutto – se non addirittura solamente – quando rende difficile la comunicazione. In questo saggio, la rassegna delle posizioni assunte da vari esperti di educazione linguistica, alcune delle quali si collocano ai margini dell’approccio comunicativo, dimostra come in realtà la questione è tutt’altro che semplice e numerose sono le scelte metodologiche di cui l’insegnante può disporre. The issues of mother tongue usage and error correction have long remained poorly elucidated in the history of language teaching. In recent years, during which the communicative approach has become established, the issue has appeared to resolve according to two precepts: mother tongue should be limited as far as possible, given that its usage is thought to slow – or even hinder – the student’s progress in the foreign language and, since fluency is preferred over accuracy, errors should above all – or indeed only – be corrected when they impede communication. This discussion compiles the stances taken by a number of language education experts, some of whom position themselves on the margins of the communicative approach, demonstrating that, in reality, the issue is far from simple and there are a wide array of methodological choices available for teachers.

  13. PERTIMBANGAN HAKIM DALAM MENJATUHKAN PUTUSAN TERHADAP PELAKU DALAM PERKARA TINDAK PIDANA PEMBUNUHAN ANAK DI PENGADILAN NEGERI BANTUL (STUDI KASUS PERKARA NOMOR 223/PID.B/2014/PN.BTL)

    RIZKI AURIANTI, MISKE

    2015-01-01

    The tittle of this study is “Judge Considerations In sentencing the offender of infanticide In District Court of Bantul”. The background is regarding the role of the judge in determining the truth through judicial proceeding in the case of infanticide, where the main actor is the mother. Therefore, this case is different from others judge actions because generally, it has elements different from other case. The purpose of this study was to know the consideration in decisions of the judges in ...

  14. Pelizaeus-Merzbacher disease: Detection of mutations Thr[sup 181][yields]Pro and Leu[sup 223][yields]Pro in the proteolipid protein gene, and prenatal diagnosis

    Strautnieks, S.; Rutland, P.; Malcolm, S.; Baraitser, M. (Institute of Child Health, London (United Kingdom)); Winter, R.M. (Northwick Park Hospital, Middlesex (United Kingdom))

    1992-10-01

    A family with an apparent history of X-linked Pelizaeus-Merzbacher disease presented for genetic counseling, requesting carrier detection and prenatal diagnosis. RFLP analysis using the proteolipid protein (PLP) gene probe was uninformative in this family. A prenatal diagnosis on a chorionic villus sample (CVS) was carried out using single-strand conformation polymorphism (SSC) analysis of a variant in exon 4 of the PLP gene. The fetus was predicted to be unaffected. Sequencing of the exon from the CVS, the predicted-carrier mother, and the obligate-carrier grandmother revealed an A-to-C change at nucleotide 541 in the two women but not in the fetus. As this change results in a Thr-to-Pro change at amino acid 181 in a region of the gene predicted to be part of a transmembrane segment, it was concluded that this was the mutation causing the disease in this family. In addition, in a second family, an exon 5 variant band pattern on SSCP analysis was shown by sequencing to be due to a T-to-C change at nucleotide 668. This results in a Leu-to-Pro change in a carrier mother and in her two affected sons. These results provide further examples of mutations in PLP that cause Pelizaeus-Merzbacher disease and illustrate the value of SSCP in genetic analysis. 17 refs., 6 figs., 1 tab.

  15. DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS

    P. Bernot

    2005-07-13

    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this activity is to predict dissolved concentrations or solubility limits for elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) relevant to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are provided in the form of tabulated functions with pH and log fCO{sub 2} as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. Even though selection of an appropriate set of radionuclides documented in Radionuclide Screening (BSC 2002 [DIRS 160059]) includes actinium, transport of Ac is not modeled in the total system performance assessment for the license application (TSPA-LA) model because of its extremely short half-life. Actinium dose is calculated in the TSPA-LA by assuming secular equilibrium with {sup 231}Pa (Section 6.10); therefore, Ac is not analyzed in this report. The output data from this report are fundamental inputs for TSPA-LA used to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for the actinides discussed in this report. These models cover broad ranges of environmental conditions so they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or

  16. DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS

    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this activity is to predict dissolved concentrations or solubility limits for elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) relevant to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are provided in the form of tabulated functions with pH and log fCO2 as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. Even though selection of an appropriate set of radionuclides documented in Radionuclide Screening (BSC 2002 [DIRS 160059]) includes actinium, transport of Ac is not modeled in the total system performance assessment for the license application (TSPA-LA) model because of its extremely short half-life. Actinium dose is calculated in the TSPA-LA by assuming secular equilibrium with 231Pa (Section 6.10); therefore, Ac is not analyzed in this report. The output data from this report are fundamental inputs for TSPA-LA used to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for the actinides discussed in this report. These models cover broad ranges of environmental conditions so they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or otherwise

  17. Detection of rare earth elements in Powder River Basin sub-bituminous coal ash using laser-induced breakdown spectroscopy (LIBS)

    Tran, Phuoc [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State; Mcintyre, Dustin [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State

    2015-10-01

    We reported our preliminary results on the use of laser-induced breakdown spectroscopy to analyze the rare earth elements contained in ash samples from Powder River Basin sub-bituminous coal (PRB-coal). We have identified many elements in the lanthanide series (cerium, europium, holmium, lanthanum, lutetium, praseodymium, promethium, samarium, terbium, ytterbium) and some elements in the actinide series (actinium, thorium, uranium, plutonium, berkelium, californium) in the ash samples. In addition, various metals were also seen to present in the ash samples

  18. The identification of soil radionuclides in the area of Puspiptek and surrounding

    The area of PUSPIPTEK and the surrounding are potentially exposed by radionuclides, because the operation of the nuclear research plant. The PPTN Serpong was operated long than 10 years, therefore soil radioactivity need to evaluate. The determination of radioactivity in the soil samples which be taken from research location using gamma spectrometry on June-August. The result of the research identified natural radionuclides K-40; Thorium decay series Ac-228, Bi-212, Pb-212, Tl-208, Ra-224 and Rn-220; Uranium decay series Bi-214, Pa-234, Pb-214 and Actinium decay series Bi-211, Po-211. There are no identification radionuclides produce from the activation of PPTN Serpong

  19. An aerial radiological survey of the Sandia National Laboratories and surrounding area

    A team from the Remote Sensing Laboratory conducted an aerial radiological survey of the area surrounding the Sandia National Laboratories and Kirtland Air Force Base in Albuquerque, New Mexico, during March and April 1993. The survey team measured the terrestrial gamma radiation at the site to determine the levels of natural and man-made radiation. This survey includes the areas covered by a previous survey in 1981. The results of the aerial survey show a background exposure rate which varies between 5 and 18 μR/h plus an approximate 6 μR/h contribution from cosmic rays. The major radioactive isotopes found in this survey were: potassium-40, thallium-208, bismuth-214, and actinium-228, which are all naturally-occurring isotopes, and cobalt-60, cesium-137, and excess amounts of thallium-208 and actinium-228, which are due to human actions in the survey area. In regions away from man-made activity, the exposure rates inferred from this survey's gamma ray measurements agree almost exactly with the exposure rates inferred from the 1981 survey. In addition to the aerial measurements, another survey team conducted in situ and soil sample radiation measurements at three sites within the survey perimeter. These ground-based measurements agree with the aerial measurements within ± 5%

  20. Mixed valency of the RE and Ac ions in solid states

    Full text: This review is devoted to consideration of the methods and results of the theoretical and experimental investigations of the electronic state of the rare earths and actinium ions in the separate compound. The methods of the high resolution X ray spectroscopy were used for our consideration. Energy of the X ray lines of the rare earths and actinium ions in free state and solid states was study carefully. Valency shifts of X Ray lines under change of electronic state of nf - ions in different oxide, fluoride and chloride compounds were determined for K -, L- and M - lines for these ions with accuracy near 10 -100 MeV. We studied the electronic state of nf- ions which is changed from '+2' to '+4' and determined the concentration of ions in different electronic state. Relative error for theoretical energy of the most lines for HFP - approach in comparison with experiment is less than 0.5%, and deviation for concentration is less than 5%

  1. A study of uranium and thorium migration at the Koongarra uranium deposit with application to actinide transport from nuclear waste repositories

    One way to gain confidence in modelling possible radionuclide releases is to study natural systems which are similar to components of the multibarrier waste repository. Several such analogues are currently under study and these provide useful data about radionuclide behaviour in the natural environment. One such system is the Koongarra uranium deposit in the Northern Territory. In this dissertation, the migration of actinides, primarily uranium and thorium, has been studied as an analogue for the behaviour of transuranics in the far-field of a waste repository. The major findings of this study are: 1. the main process retarding uranium migration in the dispersion fan at Koongarra is sorption, which suppresses dissolved uranium concentrations well below solubility limits, with ferrihydrite being a major sorbing phase; 2. thorium is extremely immobile, with very low dissolved concentrations and corresponding high distribution ratios for 230Th. Overall, it is estimated that colloids are relatively unimportant in Koongarra groundwater. Uranium migrates mostly as dissolved species, whereas thorium and actinium are mostly adsorbed to larger, relatively immobile particles and the stationary phase. However, of the small amount of 230Th that passes through a 1μm filter, a significant proportion is associated with colloidal particles. Actinium appears to be slightly more mobile than thorium and is associated with colloids to a greater extent, although generally present in low concentrations. These results support the possibility of colloidal transport of trivalent and tetravalent actinides in the vicinity of a nuclear waste repository. 112 refs., 23 tabs., 32 figs

  2. Purification of cerium, neodymium and gadolinium for low background experiments

    Boiko R.S.

    2014-01-01

    Full Text Available Cerium, neodymium and gadolinium contain double beta active isotopes. The most interesting are 150Nd and 160Gd (promising for 0ν2β search, 136Ce (2β+ candidate with one of the highest Q2β. The main problem of compounds containing lanthanide elements is their high radioactive contamination by uranium, radium, actinium and thorium. The new generation 2β experiments require development of methods for a deep purification of lanthanides from the radioactive elements. A combination of physical and chemical methods was applied to purify cerium, neodymium and gadolinium. Liquid-liquid extraction technique was used to remove traces of Th and U from neodymium, gadolinium and for purification of cerium from Th, U, Ra and K. Co-precipitation and recrystallization methods were utilized for further reduction of the impurities. The radioactive contamination of the samples before and after the purification was tested by using ultra-low-background HPGe gamma spectrometry. As a result of the purification procedure the radioactive contamination of gadolinium oxide (a similar purification efficiency was reached also with cerium and neodymium oxides was decreased from 0.12 Bq/kg to 0.007 Bq/kg in 228Th, from 0.04 Bq/kg to <0.006 Bq/kg in 226Ra, and from 0.9 Bq/kg to 0.04 Bq/kg in 40K. The purification methods are much less efficient for chemically very similar radioactive elements like actinium, lanthanum and lutetium.

  3. The Technological Enhancement of Normally Occurring Radioactive Materials in Red Mud due to the Production of Alumina

    Maurice O. Miller

    2016-01-01

    Full Text Available This study investigates the level of technological enhancement of normally occurring radioactive materials (TENORM in the red mud waste due to the production of alumina in Jamaica. Technological enhancements factors (TEF were determined for the uranium, thorium, actinium series, their progenies, and the nonseries potassium-40 using gamma spectrometry. The study concluded that bauxite production technologically enhances the uranium progenies Th-234, Pb-214, Bi-214, and Pa-234 and the thorium-232 progenies Ac-228, Pb-212, and Bi-212 in red mud. The actinium series was technologically enhanced, but K-40 and the thorium daughter, Tl-208, were reduced. The spectrometric comparison of Tl-208 (at 510 keV was unexpected since its other photopeaks at 583 keV, 934 keV, and 968 keV were markedly different. An explanation for this anomaly is discussed. An explanation regarding the process of accumulation and fractionation of organically derived phosphate deposits and potassium-feldspar is offered to explain the spectrometric differences between the alumina product and its waste material, red mud.

  4. Low background counting of 222Rn, 220Rn and 219Rn with electrostatic counters

    Mong, Brian; EXO-200 Collaboration; nEXO Collaboration

    2014-09-01

    The radon counting technique based on electrostatic precipitation of progenies in gas followed by alpha spectroscopy has been applied to support the material selection programs of low background, neutrino and dark matter experiments with emphasis on EXO. An array of 8 counters operated by Laurentian University at SNOLAB and the Waste Isolation Pilot Plant have reached the sensitivity of 10 atoms/day in the uranium, thorium and actinium chains. Hardware improvements are underway to further increase the capacity and sensitivity in support of nEXO. The radon counting technique based on electrostatic precipitation of progenies in gas followed by alpha spectroscopy has been applied to support the material selection programs of low background, neutrino and dark matter experiments with emphasis on EXO. An array of 8 counters operated by Laurentian University at SNOLAB and the Waste Isolation Pilot Plant have reached the sensitivity of 10 atoms/day in the uranium, thorium and actinium chains. Hardware improvements are underway to further increase the capacity and sensitivity in support of nEXO. Supported by NSERC Project Grants ``Search for Double Beta Decay with EXO.''

  5. Purification of cerium, neodymium and gadolinium for low background experiments

    Boiko, R. S.; Barabash, A. S.; Belli, P.; Bernabei, R.; Cappella, F.; Cerulli, R.; Danevich, F. A.; Incicchitti, A.; Laubenstein, M.; Mokina, V. M.; Nisi, S.; Poda, D. V.; Polischuk, O. G.; Tretyak, V. I.

    2014-01-01

    Cerium, neodymium and gadolinium contain double beta active isotopes. The most interesting are 150Nd and 160Gd (promising for 0ν2β search), 136Ce (2β+ candidate with one of the highest Q2β). The main problem of compounds containing lanthanide elements is their high radioactive contamination by uranium, radium, actinium and thorium. The new generation 2β experiments require development of methods for a deep purification of lanthanides from the radioactive elements. A combination of physical and chemical methods was applied to purify cerium, neodymium and gadolinium. Liquid-liquid extraction technique was used to remove traces of Th and U from neodymium, gadolinium and for purification of cerium from Th, U, Ra and K. Co-precipitation and recrystallization methods were utilized for further reduction of the impurities. The radioactive contamination of the samples before and after the purification was tested by using ultra-low-background HPGe gamma spectrometry. As a result of the purification procedure the radioactive contamination of gadolinium oxide (a similar purification efficiency was reached also with cerium and neodymium oxides) was decreased from 0.12 Bq/kg to 0.007 Bq/kg in 228Th, from 0.04 Bq/kg to <0.006 Bq/kg in 226Ra, and from 0.9 Bq/kg to 0.04 Bq/kg in 40K. The purification methods are much less efficient for chemically very similar radioactive elements like actinium, lanthanum and lutetium.

  6. AcEST: DK958494 [AcEST

    Full Text Available TST39A01NGRL0002_C12 671 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0002_C12. 5' end seq ... AVLTKVRHRHLVTLLGYCLDGNEKLLVY 663 Query: 194 EFMPRRACSR ... 223 E+MP+ SR Sbjct: 664 EYMPQGTLSR 673 >sp|Q06548| ... QTIGSIHHINLVRLIGFCAEKSQRLLVYEHM 363 Query: 203 PRRACSR ... 223 P+ + R Sbjct: 364 PKGSLDR 370 >tr|Q0JR93|Q0JR9 ... QTIGSIHHINLVRLIGFCAEKSQRLLVYEHM 984 Query: 203 PRRACSR ... 223 P+ + R Sbjct: 985 PKGSLDR 991 Score = 44.7 bit ... Query: 92 QFKAEVAAIGCVSHVNLVSLKGFCMEKNARLLVFEFMPRRACSR ... 223 +F EVA IG + H N+V L GFC E R LV+E MP + + Sbjct: ...

  7. meso-4,4'-Dimethoxy-2,2'-{[(3aR,7aS)- 2,3,3a,4,5,6,7,7a-octahydro-1H-benzimidazole- 1,3-diyl]bis(methylene)}- diphenol

    Rivera, A.; Quiroga, D.; Ríos-Motta, J.; Kučeráková, Monika; Dušek, Michal

    2013-01-01

    Roč. 69, č. 7 (2013), o1057-o1058. ISSN 1600-5368 Grant ostatní: AV ČR(CZ) Praemium Academiae Institutional support: RVO:68378271 Keywords : single-crystal X-ray study * T = 120 K * mean sigma(C–C) = 0.003 A * R factor = 0.031 * wR factor = 0.080 * data -to-parameter ratio = 13.0 Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.347, year: 2011

  8. University Students Are Unaware of the Role of Academic Librarians. A Review of: Bickley, R. & Corral, S. (2011. Student perceptions of staff in the information commons: A survey at the University of Sheffield. Reference Services Review, 39(2, 223-243. doi:10.1108/00907321111135466

    Kirsty Thomson

    2012-06-01

    Full Text Available Objective – To discover students’ perceptionsof information commons staff, and todetermine how these perceptions influence theuse of library resources.Design – Post-experience survey with onefollow-up interview.Setting – The University of Sheffield, a postsecondaryinstitution in England.Subjects – All undergraduate andpostgraduate students were invited to takepart. Just over 1% of the student population, or250 students, completed the survey.Methods – Information about the survey wassent to students’ institutional email addresses.One follow up interview was carried out viaemail using the critical incident technique.Main Results – Students do not understandthe academic roles of librarians. They areunlikely to approach library staff for academicsupport, preferring to turn to instructors, otherstudents, friends, and family. Most studentshad positive opinions about assistancereceived in the Information Commons, but asmall number reflected on previous badexperiences with staff, or on a fear of beingmade to feel foolish. The vast majority ofstudents who did not seek help in theInformation Commons stated that this wasbecause they did not require assistance. Most students do not perceive a difference between Information Commons staff and library staff.Conclusion – Students have positive views of Information Commons staff at the University of Sheffield, but have low awareness of the roles of professional librarians. Librarians need to develop partnerships with academic staff and strengthen their presence in both physical and online learning environments to promote their academic roles.

  9. Training May Affect Primary Care Staff Access to the Biomedical Electronic Evidence Base. A review of: Doney, Liz, Helen Barlow, and Joe West. “Use of Libraries and Electronic Information Resources by Primary Care Staff: Outcomes from a Survey.” Health Information and Libraries Journal 22.3 (September 2005: 182-188.

    Marcy L. Brown

    2006-03-01

    Full Text Available Objective – To assess use of existing local libraries, the Internet, and biomedical databases by primary care staff prior to implementation of the Primary Care Knowledge Management Projects. Additionally, to assess the need to train primary care staff to use the Internet and biomedical databases. Design – Cross‐sectional postal questionnaire survey. Setting – Nottingham and Rotherham, two cities in the Trent region of the UK. Subjects – Questionnaires were analyzed from 243 general practitioners, practice nurses, and practice managers in four Nottingham primary care trusts as well as practices in the Rotherham Health Authority area. Methods – Questionnaires and cover letters were sent between May 2001 and February 2002. To encourage response, a postage‐paid envelope was enclosed. A total of 709 questionnaires were sent in Nottingham, and 169 were returned for a response rate of 24%. In Rotherham, 179 questionnaires were sent and 61 returned, for a 34% response rate. Thirteen responses from a May 2001 pilot in Rotherham were also included in the data analysis. Survey questions included a variety of formats, including tick boxes and open‐ended questions. Data was entered into an Access database and analysis was performed using Stata software. Main results – Reported use of libraries was low overall, with only 30% of respondents claiming to have used library facilities. However, there was significant variation among professional groups. Practice nurses (PNs had significantly higher usage of libraries than general practitioners (GPs and practice managers (P Conclusion – Based on the results of this admittedly small study, additional training is needed – and desired – by primary care staff in both Nottingham and Rotherham. Developing and offering training in Internet searching and evaluation as well as use of the biomedical databases is one important way in which libraries can build partnerships with primary care practitioners. This will also enable added numbers of primary care staff to access and use the clinical evidence knowledge base. Additional studies are needed to identify and overcome barriers to training.

  10. Who's afraid of reduced-rank parameterizations of multivariate models? Theory and example

    Gilbert, S.; Zemčík, Petr

    -, č. 223 (2004), s. 1-32. ISSN 1211-3298 R&D Projects: GA AV ČR KSK8002119 Institutional research plan: CEZ:AV0Z7085904 Keywords : reduced-rank parameterizations * multivariate models Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp223.pdf

  11. 48 CFR 923.7003 - Contract clauses.

    2010-10-01

    ... contractor and subcontractor employees at such facility, the clause at 952.223-71, Integration of Environment... services; and (3) The facility is government-owned, or leased by or for the account of the government. (c... clause found at 952.223-71, Integration of Environment, Safety, and Health into Work Planning...

  12. EST Table: BP121860 [KAIKOcDNA[Archive

    Full Text Available BP121860 ceN-5495 10/09/28 94 %/223 aa ref|NP_001036916.1| G protein alpha subunit Go isoform 1 ... 8 82 %/223 aa C26C6.2#CE05311#WBGene00001648#locus:goa -1#guanine nucleotide-binding protein#status:Confir ...

  13. 78 FR 57673 - RTCA Program Management Committee; Meeting

    2013-09-19

    ...-228--Minimum Performance Standards for Unmanned Aircraft Systems--Discussion--Revised Terms of... Airport Communications System (AeroMACS) Profile, RTCA Paper No. 199-13/PMC- 1125, prepared by SC-223... Airport Communication System (AeroMACS), RTCA Paper No. 200-13/PMC-1126, prepared by SC-223. Final...

  14. Carbon-nitrogen cycling in northern Indian Ocean

    Naqvi, S.W.A.

    stream_size 20 stream_content_type text/plain stream_name IGBP_India_2000_223.pdf.txt stream_source_info IGBP_India_2000_223.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  15. Insights on recombinations processes in Lu.sub.2./sub.SiO.sub.5./sub..

    Vedda, A.; Fasoli, M.; Moretti, F.; Cammi, D.; Nikl, Martin; Mihóková, Eva; Ren, G.; Stanek, C.R.; Blair, M.W.; Tornga, S.

    Ann Arbor, Michigan : Omnipress, 2011 - (Rand, S.). WeP223/1-WeP223/2 [International conference on luminescence and optical spectroscopy of condensed matter /16./ (ICL 2011). 27.06.2011-01.07.2011, Ann Arbor, MI] Institutional research plan: CEZ:AV0Z10100521 Keywords : scintillators * complex oxides * thermoluminescence Subject RIV: BM - Solid Matter Physics ; Magnetism

  16. 7 CFR 1.412 - Institution of proceedings.

    2010-01-01

    ... a sourcing area application by the Office of Administrative Law Judges, pursuant to 36 CFR 223.190... to 36 CFR 223.191(e), based on the written request. If no agreement is reached in the informal review... review process, within 5 working days of the meeting convened during the informal review (36 CFR...

  17. 78 FR 62911 - Self-Regulatory Organizations; NYSE Arca, Inc.; Notice of Filing and Immediate Effectiveness of...

    2013-10-22

    ... Examination.\\16\\ \\16\\ See, e.g., Securities Exchange Act Release No. 70163 (August 12, 2013), 78 FR 50120... Proposed Rule Change Amending Rule 2.23 to Specify Applicable Continuing Education Requirements, Amending... Rule Change The Exchange proposes to amend Rule 2.23 to specify applicable continuing education...

  18. 49 CFR 212.217 - Car inspector.

    2010-10-01

    ... (ii) The Freight Car Safety Standards (49 CFR part 215), Safety Glazing Standards (49 CFR part 223), Safety Appliance Standards (49 CFR part 231) and Power Brake Standards (49 CFR part 232); (3) The... Safety Standards (49 CFR part 215), Safety Glazing Standards (49 CFR part 223), Safety...

  19. Spatial confinement can lead to increased stability of amorphous indomethacin

    Nielsen, Line Hagner; Keller, Stephan Sylvest; Gordon, Keith C.; Boisen, Anja; Rades, Thomas; Müllertz, Anette

    2012-01-01

    crystallised in the 223μm microcontainers. Both these values were significantly different from that observed in the amorphous bulk indomethacin, where 51.0% crystallised to the γ-form after 30days. Comparing the 174 and 223μm microcontainers also revealed a significantly greater stabilising effect of the 174μm...

  20. 19 CFR 113.37 - Corporate sureties.

    2010-04-01

    ... Government Financial Operations Regulations (31 CFR 223.11). (b) Name of corporation on the bond. The name of... Operations Regulations (31 CFR 223.11). Each corporate surety shall limit its liability to a definite... on the bond. (d) Social security number of agent or attorney on the bond. In the appropriate place...

  1. Listing Triangles

    Björklund, Andreas; Pagh, Rasmus; Vassilevska Williams, Virginia;

    2014-01-01

    DOI added. Bibliographic info: Automata, Languages, and Programming Lecture Notes in Computer Science Volume 8572, 2014, pp 223-234 /PFOR 06-01-2015......DOI added. Bibliographic info: Automata, Languages, and Programming Lecture Notes in Computer Science Volume 8572, 2014, pp 223-234 /PFOR 06-01-2015...

  2. 50 CFR 660.712 - Longline fishery.

    2010-10-01

    ... vessels registered for use of longline gear are subject to the provisions at 50 CFR part 223 prohibiting... Longline fishery. (a) Gear and fishing restrictions. (1) Owners and operators of vessels registered for use... consistent with 50 CFR 223.206(d)(1), as appropriate. (c) Longline Seabird mitigation measures. (1)...

  3. Pharmacological characterisation of α6β4* nicotinic acetylcholine receptors assembled from three different α6/α3 subunit chimeras in tsA201 cells

    Jensen, Anne Bjørnskov; Hoestgaard-Jensen, Kirsten; Jensen, Anders A.

    2014-01-01

    on these results should be made keeping the molecular modifications in the α6 surrogate subunits in mind, this study sheds light on the pharmacological properties of α6β4⁎ nicotinic acetylcholine receptors and demonstrates the applicability of the C6F223L and C16F223L chimeras for studies of these...

  4. A product of three projections

    Kopecká, E.; Müller, Vladimír

    2014-01-01

    Roč. 223, č. 2 (2014), s. 175-186. ISSN 0039-3223 R&D Projects: GA ČR(CZ) GA14-07880S Institutional support: RVO:67985840 Keywords : Hilbert space * projection * extension Subject RIV: BA - General Mathematics Impact factor: 0.610, year: 2014 http://journals.impan.pl/cgi-bin/doi?sm223-2-4

  5. EST Table: FS852098 [KAIKOcDNA[Archive

    Full Text Available FS852098 E_FL_fner_42J11_F_0 10/09/28 75 %/223 aa ref|XP_970542.1| PREDICTED: similar to brix...B12626-PA 10/09/10 75 %/223 aa gi|91090402|ref|XP_970542.1| PREDICTED: similar to brix domain-containing protein 2 [Tribolium castaneum] FS911686 fner ...

  6. Molluscicidal activity of some Moroccan medicinal plants.

    Hmamouchi, M; Lahlou, M; Agoumi, A

    2000-06-01

    Among 14 plants of Moroccan folk medicine tested for molluscicidal activity, ethyl acetate extract from Origanum compactum and hexane extracts from both Chenopodium ambrosioides and Ruta chalepensis were the most active (LC(90)=2.00, 2.23 and 2.23 mg l(-1), respectively) against the schistosomiasis-transmitting snail Bulinus truncatus. PMID:10844169

  7. Deprese v dětství a její vztah k problémům chování

    Čermák, Ivo; Klimusová, Helena; Vízdalová, H.

    2005-01-01

    Roč. 49, 223-236 (2005), s. 223-236. ISSN 0009-062X Institutional research plan: CEZ:AV0Z70250504 Keywords : child´s depression * behavior disorders * CBCL * CDI Subject RIV: AN - Psychology Impact factor: 0.241, year: 2005

  8. GETDB: 103841 [GETDB

    Full Text Available l Institute of Genetics. FM7c Link to clone table - 1 223 Link to cluster table 223 1 Request - dorsal epi, good driver... Num of clusters 1 Stock Request Request - Embryonic Expression dorsal epi, good driver Larval GFP - Larval

  9. 50 CFR Figures 14a and 14b to Part... - Maximum Angle of Deflector Bars With Straight Bars Attached to the Bottom of the Frame and...

    2010-10-01

    ... Straight Bars Attached to the Bottom of the Frame and Maximum Angle of Deflector Bars With Bent Bars Attached to the Bottom of the Frame 14a Figures 14a and 14b to Part 223 Wildlife and Fisheries NATIONAL... 223—Maximum Angle of Deflector Bars With Straight Bars Attached to the Bottom of the Frame and...

  10. 76 FR 21944 - Petition for Waiver of Compliance

    2011-04-19

    ... Federal Railroad Administration Petition for Waiver of Compliance In accordance with Part 211 of Title 49...) has received a request for a waiver of compliance from certain requirements of its safety standards... relief from 49 CFR part 223, Safety Glazing Standards (Sec. 223.9 Requirements for new or...

  11. 14 CFR Section 12 - Objective Classification-Operating Revenues and Expenses

    2010-01-01

    ... transportation authorized by 49 U.S.C. 41511(a) and 14 CFR part 223, as well as revenue from travel agents, cargo...) and 14 CFR part 223, as well as travel agents, cargo agents and tour conductors traveling at reduced... in the use of property and equipment provided by others. When a lease arrangement provides that...

  12. Purification system of gram-amount neptunium using anion exchange chromatography

    To develop a purification system of gram-amount neptunium using anion exchange chromatography, adsorption elution of excess amount of actinium in 6M HNO3 aqueous solution was studied using thorium and uranium tracer. The partition coefficient (Kd) of Th (IV) decreased from Kd=99.1 of tracer to Kd=44.0, 5% load. By decreasing the partition coefficient, we can wash until 30 Vs under the purification conditions of 1% load and 95% recovery. The retention volume of U (IV) was about 300 Vs, a large value. The partition coefficient of Np (IV) may be larger than it and the large amount of washable eluting solution may be obtained. Washing of impurity of 3d transition metal and actinide (VI) can be done until 20Vs. With washing of 150Vs, impurity of alkali earth metal, metals (III) and platinum group metals decreased less than 0.1%. (S.Y.)

  13. Radionuclide interactions with marine sediments

    A critical review of the literature on the subject of the interactions of radionuclides with marine sediments has been carried out. On the basis of the information available, an attempt has been made to give ranges and 'best estimates' for the distribution ratios between seawater and sediments. These estimates have been based on an understanding of the sediment seawater system and the porewater chemistry and mineralogy. Field measurements, laboratory measurements and estimates based on stable-element geochemical data are all taken into account. Laboratory measurements include distribution-ratio and diffusion-coefficient determinations. The elements reviewed are carbon, chlorine, calcium, nickel, selenium, strontium, zirconium, niobium, technetium, tin, iodine, caesium, lead, radium, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium and curium. (author)

  14. Formerly utilized MED/AEC sites Remedial Action Program. Radiological survey of the St. Louis Airport Storage Site, St. Louis, Missouri. Final report

    Results of two radiological surveys of the St. Louis-Lambert Airport property, formerly known as the Airport Storage Site, St. Louis, Missouri, are presented. Uranium- and radium-bearing waste materials were stored from the 1940's to the late 1960's in this area. The surveys included direct measurements of beta-gamma radiation; determination of uranium, actinium, and radium concentrations in soil samples and from bore holes; determination of radionuclide concentrations in groundwater and surface water; measurement of radon flux from the ground surface; and measurements of 222Rn in air near the site. Results indicate that some offsite drainage pathways are becoming contaminated, probably by runoff from the site; no migration of 222Rn from the site was observed

  15. JAEA thermodynamic database for performance assessment of geological disposal of high-level and TRU wastes. Refinement of thermodynamic data for trivalent actinoids and samarium

    Within the scope of the JAEA thermodynamic database project for performance assessment of geological disposal of high-level radioactive and TRU wastes, the refinement of the thermodynamic data for the inorganic compounds and complexes of trivalent actinoids (actinium(III), plutonium(III), americium(III) and curium(III)) and samarium(III) was carried out. Refinement of thermodynamic data for these elements was based on the thermodynamic database for americium published by the Nuclear Energy Agency in the Organisation for Economic Co-operation and Development (OECD/NEA). Based on the similarity of chemical properties among trivalent actinoids and samarium, complementary thermodynamic data for their species expected under the geological disposal conditions were selected to complete the thermodynamic data set for the performance assessment of geological disposal of radioactive wastes. (author)

  16. Theoretical Study on Properties of New Isotope 265Bh

    2006-01-01

    The properties of nuclei belonging to the newly observed α-decay chain starting from 265Bh have been studied. The axially deformed relativistic mean-field calculation with the force NL-Z2 has been performed in the blockedBCS approximation. Some ground state properties such as binding energies, deformations, spins, and parities, as well as Q-values of the α-decay for this decay chain have been calculated and compared with known experimental data. Good agreement is found. The single-particle spectrum of the nucleus 265 Bh is studied and some new magic numbers are found,while the magnitudes of the shell gaps in superheavy nuclei are much smaller than those of nuclei before the actinium region, and the Fermi surfaces are close to the continuum. Thus the superheavy nuclei are usually not stable. The The methods which give good agreement with the data are selected.

  17. Proposed training program for construction personnel involved in remedial action work at sites contaminated by naturally occurring radionuclides

    Many sites used during the early days of the US atomic energy program are contaminated with radionuclides of the primordial decay chains (uranium, thorium, and actinium series). This contamination consists of residues resulting from refining and processing uranium and thorium. Preparation of these sites for release to unrestricted private use will involve the assistance of construction workers, many of whom have limited knowledge of the hazards associated with radioactive materials. Therefore, there is a need to educate these workers in the fundamentals of radioactive material handling to minimize exposures and possible spread of contamination. This training should disseminate relevant information at an appropriate educational level and should instill a cautious, common-sense attitude toward the handling of radioactive materials. The training should emphasize basic information concerning environmental radiation within a context of relative risk. A multi-media format, including colorful visual aids, demonstration, and discussion, should be used to maximize motivation and retention. A detailed, proposed training program design is presented

  18. Origin of elements of the Uranium-235 family observed in the Ellez river near the EL-4 experimental nuclear reactor in dismantling (Monts d'Arree- Finistere department); Origine des elements de la famille de l'uranium-235 observes dans la riviere Ellez a proximite du reacteur nucleaire experimental EL4 en cours de demantelement (Mont d'Arree - departement du Finistere). Resultats et premiers constats annee 2006

    NONE

    2006-07-01

    In a previous study which concerned the catchment basin of the harbour of Brest, the A.C.R.O. put in evidence a marking by artificial radioelements around the power plant of Brennilis which can be imputed without ambiguities to the nuclear installation. It also put in evidence abnormalities concerning the natural radioactivity which justifies this new study. In the area of the Monts d'Arree, actinium 227 ({sup 227}Ac), non born by its ascendents which are {sup 235}U and {sup 231}Pa is observed. This phenomenon is characterized by mass activities superior to these ones of {sup 235}U and able to reach these ones of {sup 238}U. Its presence corresponds with the drainage of the Ellez river since the former channel of radioactive effluents releases from the nuclear power plant EL-4 up to the reservoir Saint-Herblot situated 6 km downstream. The strongest values of radioactivity are registered near the disused power plant, at this place a relationship exists between the level of actinium 227 and this one of the artificial radioactivity as it exists a relationship with the decay products of radon exhaled from the subsoil ({sup 210}Pb). But its presence is not limited to a part of the Ellez river, it is equally observed in terrestrial medium, in places in priori not influenced by the direct liquid effluents of the power plant. This place is situated at more than 4 km and without any connection with the Ellez waters. At this stage of the study, it is not possible to answer with certainty the question of the origin of this phenomenon. A new reorientation is considered indispensable to clarify definitively the origin of this unknown phenomenon in the scientific publications and the environmental monitoring. (N.C.)

  19. origin of elements of the Uranium-235 family observed in the Ellez river near the EL-4 experimental nuclear reactor in dismantling (Monts d'Arree- Finistere department)

    In a previous study which concerned the catchment basin of the harbour of Brest, the A.C.R.O. put in evidence a marking by artificial radioelements around the power plant of Brennilis which can be imputed without ambiguities to the nuclear installation. It also put in evidence abnormalities concerning the natural radioactivity which justifies this new study. In the area of the Monts d'Arree, actinium 227 (227Ac), non born by its ascendents which are 235U and 231Pa is observed. This phenomenon is characterized by mass activities superior to these ones of 235U and able to reach these ones of 238U. Its presence corresponds with the drainage of the Ellez river since the former channel of radioactive effluents releases from the nuclear power plant EL-4 up to the reservoir Saint-Herblot situated 6 km downstream. The strongest values of radioactivity are registered near the disused power plant, at this place a relationship exists between the level of actinium 227 and this one of the artificial radioactivity as it exists a relationship with the decay products of radon exhaled from the subsoil (210Pb). But its presence is not limited to a part of the Ellez river, it is equally observed in terrestrial medium, in places in priori not influenced by the direct liquid effluents of the power plant. This place is situated at more than 4 km and without any connection with the Ellez waters. At this stage of the study, it is not possible to answer with certainty the question of the origin of this phenomenon. A new reorientation is considered indispensable to clarify definitively the origin of this unknown phenomenon in the scientific publications and the environmental monitoring. (N.C.)

  20. Physical Measurements and Clinical Findings of Persons with Radium Burdens

    Results of physical measurements and some clinical findings of persons with radium burdens are reported and discussed. Ten workers of the dial painting industry, two chemists, who have been working for between 10 and 20 yr in the radium- industry, one technician, who has been- working for over 20 yr with high-emanation radium preparations and one person with high radium intake of rather unknown history were measured in a whole-body counter for evaluation of the body burdens of radium-226 and radium-228+ actinium-228. In some cases the radon concentration of expired air was also measured. For four of the measured persons the radium-226 burden is of the order of the maximum permissible amount (MPA : 10-7 c) or more. In one case the burden amounts to more than three times the MPA, (3.4 x 10-7 c), in another case to more than 100 times the MPA (160 x 10-7 c). In one case the radium-228 + actinium-228 burden exceeds the MPA (6 x 10-8 c in bone). The measured radon concentrations in the expired air were used to calculate the excretion rate of radon. The average was 67%. Clinical findings with some of the measured persons are related to the measured body burdens. The patient with the high body burden of 160 x 10-7 c radium-226 shows heavy bone changes leading to spontaneous bone fractures. The blood picture shows a decrease in the number of erythrocytes and a low haemoglobin content but puncture of the sternum indicates normal haematopoiesis. It seems that the low number of erythrocytes is caused by chronic nephropathia, the reason for which might be an additional intake of uranium because.uranium was found in the urine by gamma spectroscopy. The results are discussed with respect to the MPA of radium-226 recommended by the International Commission on Radiological Protection. (author)