WorldWideScience

Sample records for actinium 221

  1. Extraction of actinium with di-(2-ethylhexyl)phosphoric acid from hydrochloric and nitric acid solutions

    The extraction of actinium with HDEHP from Cl- and NO3- systems has been investigated. It was found that extraction of actinium from HCl solutions is much better than from HNO3 solutions. Stability constants of actinium complexes Ac(X-)+2 with Cl- and NO3- ligands were determined. Our results show that the actinium formed less stable complexes with Cl- than with NO3- ligands. 5 refs., 3 figs., 1 tab. (author)

  2. The sorption of polonium, actinium and protactinium onto geological materials

    This paper describes a combined experimental and modeling program of generic sorption studies to increase confidence in the performance assessment for a potential high-level radioactive waste repository in Japan. The sorption of polonium, actinium and protactinium onto geological materials has been investigated. Sorption of these radioelements onto bentonite, tuff and granodiorite from equilibrated de-ionized water was studied under reducing conditions at room temperature. In addition, the sorption of actinium and protactinium was investigated at 60 C. Thermodynamic chemical modeling was carried out to aid interpretation of the results

  3. Separation of Actinium 227 from the uranium minerals

    The purpose of this work was to separate Actinium 227, whose content is 18%, from the mineral carnotite found in Gomez Chihuahua mountain range in Mexico. The mineral before processing is is pre-concentrated and passed, first through anionic exchange resins, later the eluate obtained is passed through cationic resins. The resins were 20-50 MESH QOWEX and 100-200 MESH 50 X 8-20 in some cased 200-400 MESH AG 50W-X8, 1X8 in other cases. The eluates from the ionic exchange were electrodeposited on stainless steel polished disc cathode and platinum electrode as anode; under a current ODF 10mA for 2.5 to 5 hours and of 100mA for .5 of an hour. it was possible to identify the Actinium 227 by means of its descendents, TH-227 and RA-223, through alpha spectroscopy. Due to the radiochemical purity which the electro deposits were obtained the Actinium 227 was low and was not quantitatively determined. A large majority of the members of the natural radioactive series 3 were identified and even alpha energies reported in the literature with very low percentages of non-identified emissions were observed. We conclude that a more precise study is needed concerning ionic exchange and electrodeposit to obtain an Actinium 227 of radiochemical purity. (Author)

  4. Spectroscopic and computational investigation of actinium coordination chemistry.

    Ferrier, Maryline G; Batista, Enrique R; Berg, John M; Birnbaum, Eva R; Cross, Justin N; Engle, Jonathan W; La Pierre, Henry S; Kozimor, Stosh A; Lezama Pacheco, Juan S; Stein, Benjamin W; Stieber, S Chantal E; Wilson, Justin J

    2016-01-01

    Actinium-225 is a promising isotope for targeted-α therapy. Unfortunately, progress in developing chelators for medicinal applications has been hindered by a limited understanding of actinium chemistry. This knowledge gap is primarily associated with handling actinium, as it is highly radioactive and in short supply. Hence, Ac(III) reactivity is often inferred from the lanthanides and minor actinides (that is, Am, Cm), with limited success. Here we overcome these challenges and characterize actinium in HCl solutions using X-ray absorption spectroscopy and molecular dynamics density functional theory. The Ac-Cl and Ac-OH2O distances are measured to be 2.95(3) and 2.59(3) Å, respectively. The X-ray absorption spectroscopy comparisons between Ac(III) and Am(III) in HCl solutions indicate Ac(III) coordinates more inner-sphere Cl(1-) ligands (3.2±1.1) than Am(III) (0.8±0.3). These results imply diverse reactivity for the +3 actinides and highlight the unexpected and unique Ac(III) chemical behaviour. PMID:27531582

  5. Discovery of the actinium, thorium, protactinium, and uranium isotopes

    Fry, C; Thoennessen, M

    2012-01-01

    Currently, 31 actinium, 31 thorium, 28 protactinium, and 23 uranium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  6. ENG 221 Uop Material-eng221dotcom

    Sandywilliam6

    2015-01-01

    ENG 221 Entire Course (UOP) For more course tutorials visit www.eng221.com   ENG 221 Week 2 Web-Conferencing Programs Research Memo ENG 221 Week 3 Request for Proposal for Trainers ENG 221 Week 4 User manual Critique ENG 221 Week 5 Learning Team Assignment: Project (Manual) ENG 221 Week 1 DQs ENG 221 Week 2 DQs ENG 221 Week 3 DQs ENG 221 Week 4 DQs ENG 221 Week 5 DQs  

  7. ENG 221 UOP Course Tutorial / eng221dotcom

    anil14

    2015-01-01

    ENG 221 Entire Course (UOP) For more course tutorials visit www.eng221.com   ENG 221 Week 2 Web-Conferencing Programs Research Memo ENG 221 Week 3 Request for Proposal for Trainers ENG 221 Week 4 User manual Critique ENG 221 Week 5 Learning Team Assignment: Project (Manual) ENG 221 Week 1 DQs ENG 221 Week 2 DQs ENG 221 Week 3 DQs ENG 221 Week 4 DQs ENG 221 Week 5 DQs  

  8. IT 221 courses / snaptutorial

    IT 210 snaptutorial

    2015-01-01

    For more classes visit www.snaptutorial.com IT 221 Week 1 DQS part 1 of 2 IT 221 Week 1 DQS part 2 of 2 IT 221 Week 1 CheckPoint: The Phases of the System Development Process IT 221 Week 2 CheckPoint: Project Management in Everyday Life (GROUP ASSIGNMENT) IT 221 Week 2 Assignment: Final Project—Project Overview- Appendix B IT 221 Week 2 CheckPoint: Project Management in Everyday Life IT 221 Week 2 CheckPoint: Final Project—Proposal IT 221 Week 3...

  9. Production of high-purity radium-223 from legacy actinium-beryllium neutron sources.

    Soderquist, Chuck Z; McNamara, Bruce K; Fisher, Darrell R

    2012-07-01

    Radium-223 is a short-lived alpha-particle-emitting radionuclide with potential applications in cancer treatment. Research to develop new radiopharmaceuticals employing (223)Ra has been hindered by poor availability due to the small quantities of parent actinium-227 available world-wide. The purpose of this study was to develop innovative and cost-effective methods to obtain high-purity (223)Ra from (227)Ac. We obtained (227)Ac from two surplus actinium-beryllium neutron generators. We retrieved the actinium/beryllium buttons from the sources and dissolved them in a sulfuric-nitric acid solution. A crude actinium solid was recovered from the solution by coprecipitation with thorium fluoride, leaving beryllium in solution. The crude actinium was purified to provide about 40 milligrams of actinium nitrate using anion exchange in methanol-water-nitric acid solution. The purified actinium was then used to generate high-purity (223)Ra. We extracted (223)Ra using anion exchange in a methanol-water-nitric acid solution. After the radium was separated, actinium and thorium were then eluted from the column and dried for interim storage. This single-pass separation produces high purity, carrier-free (223)Ra product, and does not disturb the (227)Ac/(227)Th equilibrium. A high purity, carrier-free (227)Th was also obtained from the actinium using a similar anion exchange in nitric acid. These methods enable efficient production of (223)Ra for research and new alpha-emitter radiopharmaceutical development. PMID:22697483

  10. Radium, thorium, and actinium extraction from seawater using an improved manganese-oxide-coated fiber

    Laboratory experiments were conducted to determine the efficiency with which improved manganese-oxide-coated acrylic fibers extract radium, thorium, and actinium from seawater. Tests were made using surface seawater spiked with 227Ac, 227Th and 223Ra. For sample volumes of approximately 30 liters and flow rates up to 0.5 liters per minute, radium and actinium are removed quantitatively. Approximately 80-95% of the thorium is removed under these same conditions. (Auth.)

  11. On the ^{221}Rn \\to ^{221}Fr Decay Scheme

    Gromov, K Ya; Norseev, Yu V; Samatov, Zh K; Sergienko, V A; Fominykh, V I; Chumin, V G

    2002-01-01

    The results of investigating the ^{221}Rn beta^{-}-decay and the ^{225}Ac alpha-decay are compared. It is shown that ^{221}Fr levels at 145.9 and 393.2 keV are excited at the ^{221}Rn decay. Intensities and reduced probabilities of the beta^{-}-decay to the ^{221}Fr levels are determined. A conclusion is drawn that the parity of the ^{221}Rn ground state is positive.

  12. ENG 221 UOP course tutorial/tutorialoutlet

    NARESH 1

    2015-01-01

    For more course tutorials visit www.tutorialoutlet.com   ENG 221 Week 2 Web-Conferencing Programs Research Memo   ENG 221 Week 3 Request for Proposal for Trainers   ENG 221 Week 4 User manual Critique   ENG 221 Week 5 Learning Team Assignment: Project (Manual)   ENG 221 Week 1 DQs   ENG 221 Week 2 DQs   ENG 221 Week 3 DQs   ENG 221 Week 4 DQs   ENG 221 Week 5 DQs  

  13. ENG 221 UOP COURSE Tutorial/UOPHELP

    ddfvbnm

    2015-01-01

    For more course tutorials visit www.uophelp.com   ENG 221 Week 2 Web-Conferencing Programs Research Memo ENG 221 Week 3 Request for Proposal for Trainers ENG 221 Week 4 User manual Critique ENG 221 Week 5 Learning Team Assignment: Project (Manual) ENG 221 Week 1 DQs ENG 221 Week 2 DQs ENG 221 Week 3 DQs ENG 221 Week 4 DQs ENG 221 Week 5 DQs  

  14. Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232

    The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces ∼100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 GeV protons

  15. Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232

    Harvey, James T.; Nolen, Jerry; Vandergrift, George; Gomes, Itacil; Kroc, Tom; Horwitz, Phil; McAlister, Dan; Bowers, Del; Sullivan, Vivian; Greene, John

    2011-12-30

    The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces {approx}100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 Ge

  16. MAT 221 ASH Course Tutorial / Tutorialoutlet

    mirat

    2015-01-01

    For more course tutorials visit www.tutorialoutlet.com   MAT 221 Week 1 Assignment 1 Simplifying Expressions (Ash) MAT 221 Week 1 DQ 1 Evaluating Algebraic Expressions (Ash) MAT 221 Week 2 Assignment 2 Inequalities (Ash) MAT 221 Week 2 DQ 1 Formulas (Ash) MAT 221 Week 3 Assignment 3 Two-Variable Inequality (Ash) MAT 221 Week 3 DQ 1 Parallel and Perpendicular (Ash) MAT 221 Week 4 Assignment 4 Financial Polynomials (Ash) MAT 221 Week 4 DQ 1 Initial Investme...

  17. Neutron-Induced Fission of Actinium-227, Protactinium-231 and Neptunium-237: Mass Distribution

    Results of radiochemical studies on the mass distribution in the neutron-induced fission of actinium-227, protactinium-231 and neptunium-237 have been presented. This work has been carried out as part of a programme to determine the mass distribution in the fission of heavy elements as a function of Z and A. All irradiations have been carried out in the core of the swimming-pool type reactor APSARA with cadmium shielding wherever necessary. Relative yields of several fission product nuclides have been obtained by a method involving a comparison of the fission product activities from the respective targets with those formed from uranium-235 simultaneously irradiated. Thermal-neutron fission yields of uranium-235 have been assumed. These results indicate a predominantly asymmetric mass distribution in all the three cases, and also a distinct though small symmetric peak in the case of actinium-227. (author)

  18. A new method for the determination of low-level actinium-227 in geological samples

    We developed a new method for the determination of 227Ac in geological samples. The method uses extraction chromatographic techniques and alpha-spectrometry and is applicable for a range of natural matrices. Here we report on the procedure and results of the analysis of water (fresh and seawater) and rock samples. Water samples were acidified and rock samples underwent total dissolution via acid leaching. A DGA (N,N,N',N'-tetra-n-octyldiglycolamide) extraction chromatographic column was used for the separation of actinium. The actinium fraction was prepared for alpha spectrometric measurement via cerium fluoride micro-precipitation. Recoveries of actinium in water samples were 80 ± 8 % (number of analyses n = 14) and in rock samples 70 ± 12 % (n = 30). The minimum detectable activities (MDA) were 0.017-0.5 Bq kg-1 for both matrices. Rock sample 227Ac activities ranged from 0.17 to 8.3 Bq kg-1 and water sample activities ranged from below MDA values to 14 Bq kg-1of 227Ac. From the analysis of several standard rock and water samples with the method we found very good agreement between our results and certified values. (author)

  19. IT 221 UOP COURSE TUTORIAL/UOPHELP

    nukmu

    2015-01-01

    For more course tutorials visit www.uophelp.com   IT 221 Week 1 DQS part 1 of 2 IT 221 Week 1 DQS part 2 of 2 IT 221 Week 1 CheckPoint: The Phases of the System Development Process IT 221 Week 2 CheckPoint: Project Management in Everyday Life (GROUP ASSIGNMENT) IT 221 Week 2 Assignment: Final Project—Project Overview- Appendix B IT 221 Week 2 CheckPoint: Project Management in Everyday Life IT 221 Week 2 CheckPoint: Final Project—Proposal ...

  20. IT 221 UOP COURSE TUTORIAL/ UOPHELP

    BAGIRAVI

    2015-01-01

     For more course tutorials visit www.uophelp.com   IT 221 Week 1 DQS part 1 of 2 IT 221 Week 1 DQS part 2 of 2 IT 221 Week 1 CheckPoint: The Phases of the System Development Process IT 221 Week 2 CheckPoint: Project Management in Everyday Life (GROUP ASSIGNMENT) IT 221 Week 2 Assignment: Final Project—Project Overview- Appendix B IT 221 Week 2 CheckPoint: Project Management in Everyday Life IT 221 Week 2 CheckPoint: Final Project—Propo...

  1. Analysis of the gamma spectra of the uranium, actinium, and thorium decay series

    Momeni, M.H.

    1981-09-01

    This report describes the identification of radionuclides in the uranium, actinium, and thorium series by analysis of gamma spectra in the energy range of 40 to 1400 keV. Energies and absolute efficiencies for each gamma line were measured by means of a high-resolution germanium detector and compared with those in the literature. A gamma spectroscopy method, which utilizes an on-line computer for deconvolution of spectra, search and identification of each line, and estimation of activity for each radionuclide, was used to analyze soil and uranium tailings, and ore.

  2. Analysis of the gamma spectra of the uranium, actinium, and thorium decay series

    This report describes the identification of radionuclides in the uranium, actinium, and thorium series by analysis of gamma spectra in the energy range of 40 to 1400 keV. Energies and absolute efficiencies for each gamma line were measured by means of a high-resolution germanium detector and compared with those in the literature. A gamma spectroscopy method, which utilizes an on-line computer for deconvolution of spectra, search and identification of each line, and estimation of activity for each radionuclide, was used to analyze soil and uranium tailings, and ore

  3. 20 CFR 221.1 - Introduction.

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Introduction. 221.1 Section 221.1 Employees... DETERMINATIONS § 221.1 Introduction. This part explains the factors involved in deciding whether the Social Security Administration or the Railroad Retirement Board will pay benefits to a railroad employee, and...

  4. 14 CFR 221.160 - Adoption notice.

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Adoption notice. 221.160 Section 221.160... REGULATIONS TARIFFS Adoption Publications Required To Show Change in Carrier's Name or Transfer of Operating Control § 221.160 Adoption notice. (a) When the name of a carrier is changed or when its operating...

  5. 24 CFR 92.221 - Match credit.

    2010-04-01

    ... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Match credit. 92.221 Section 92.221... INVESTMENT PARTNERSHIPS PROGRAM Program Requirements Matching Contribution Requirement § 92.221 Match credit. (a) When credit is given. Contributions are credited on a fiscal year basis at the time...

  6. 14 CFR 221.4 - English language.

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false English language. 221.4 Section 221.4... REGULATIONS TARIFFS General § 221.4 English language. All tariffs and other documents and material filed with the Department pursuant to this part shall be in the English language....

  7. 36 CFR 2.21 - Smoking.

    2010-07-01

    ... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Smoking. 2.21 Section 2.21... PROTECTION, PUBLIC USE AND RECREATION § 2.21 Smoking. (a) The superintendent may designate a portion of a park area, or all or a portion of a building, structure or facility as closed to smoking when...

  8. 22 CFR 221.41 - Arbitration.

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Arbitration. 221.41 Section 221.41 Foreign... Administration § 221.41 Arbitration. Any controversy or claim between A.I.D. and any noteholder arising out of this Guarantee shall be settled by arbitration to be held in Washington, DC in accordance with the...

  9. 33 CFR 117.221 - Saugatuck River.

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Saugatuck River. 117.221 Section 117.221 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Connecticut § 117.221 Saugatuck River. (a)...

  10. 39 CFR 221.5 - Headquarters organization.

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Headquarters organization. 221.5 Section 221.5 Postal Service UNITED STATES POSTAL SERVICE ORGANIZATION AND ADMINISTRATION GENERAL ORGANIZATION § 221.5 Headquarters organization. (a) Postmaster General—(1) Appointment. The postmaster general (PMG), the...

  11. 14 CFR 23.221 - Spinning.

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Spinning. 23.221 Section 23.221 Aeronautics... STANDARDS: NORMAL, UTILITY, ACROBATIC, AND COMMUTER CATEGORY AIRPLANES Flight Spinning § 23.221 Spinning. (a...-turn spin or a three-second spin, whichever takes longer, in not more than one additional turn...

  12. 24 CFR 221.775 - Option period.

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Option period. 221.775 Section 221.775 Housing and Urban Development Regulations Relating to Housing and Urban Development (Continued... § 221.775 Option period. The mortgagee may exercise its option to assign within one year following...

  13. 49 CFR 221.7 - Civil penalty.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Civil penalty. 221.7 Section 221.7 Transportation... TRANSPORTATION REAR END MARKING DEVICE-PASSENGER, COMMUTER AND FREIGHT TRAINS General § 221.7 Civil penalty. Any... requirement is subject to a civil penalty of at least $650 and not more than $25,000 per violation,...

  14. 22 CFR 221.43 - Governing law.

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Governing law. 221.43 Section 221.43 Foreign... Administration § 221.43 Governing law. This Guarantee shall be governed by and construed in accordance with the laws of the United States of America governing contracts and commercial transactions of the...

  15. In-source laser spectroscopy developments at TRILIS—towards spectroscopy on actinium and scandium

    Resonance Ionization Laser Ion Sources (RILIS) have become a versatile tool for production and study of exotic nuclides at Isotope Separator On-Line (ISOL) facilities such as ISAC at TRIUMF. The recent development and addition of a grating tuned spectroscopy laser to the TRIUMF RILIS solid state laser system allows for wide range spectral scans to investigate atomic structures on short lived isotopes, e.g., those from the element actinium, produced in uranium targets at ISAC. In addition, development of new and improved laser ionization schemes for rare isotope production at ISAC is ongoing. Here spectroscopic studies on bound states, Rydberg states and autoionizing (AI) resonances on scandium using the existing off-line capabilities are reported. These results allowed to identify a suitable ionization scheme for scandium via excitation into an autoionizing state at 58,104 cm − 1 which has subsequently been used for ionization of on-line produced exotic scandium isotopes.

  16. Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL

    Raeder, S.; Bastin, B.; Block, M.; Creemers, P.; Delahaye, P.; Ferrer, R.; Fléchard, X.; Franchoo, S.; Ghys, L.; Gaffney, L. P.; Granados, C.; Heinke, R.; Hijazi, L.; Huyse, M.; Kron, T.; Kudryavtsev, Yu.; Laatiaoui, M.; Lecesne, N.; Luton, F.; Moore, I. D.; Martinez, Y.; Mogilevskiy, E.; Naubereit, P.; Piot, J.; Rothe, S.; Savajols, H.; Sels, S.; Sonnenschein, V.; Traykov, E.; Van Beveren, C.; Van den Bergh, P.; Van Duppen, P.; Wendt, K.; Zadvornaya, A.

    2016-06-01

    To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.

  17. Dicty_cDB: AFM221 [Dicty_cDB

    Full Text Available AF (Link to library) AFM221 (Link to dictyBase) - - - - AFM221P (Link to Original site) AFM221F 624 AFM...221Z 732 AFM221P 1336 - - Show AFM221 Library AF (Link to library) Clone ID AFM221 (Link... to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/AF/AFM...2-A/AFM221Q.Seq.d/ Representative seq. ID AFM221P (Link to... Original site) Representative DNA sequence >AFM221 (AFM221Q) /CSM/AF/AFM2-A/AFM221Q.Seq.d/ ACACAACAATTTATAA

  18. 24 CFR 221.501 - Eligibility requirements.

    2010-04-01

    ... LOW COST AND MODERATE INCOME MORTGAGE INSURANCE-SAVINGS CLAUSE Eligibility Requirements-Moderate... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Eligibility requirements. 221.501 Section 221.501 Housing and Urban Development Regulations Relating to Housing and Urban...

  19. 24 CFR 221.761 - Forbearance relief.

    2010-04-01

    ... DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES LOW COST AND... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Forbearance relief. 221.761 Section 221.761 Housing and Urban Development Regulations Relating to Housing and Urban Development...

  20. 24 CFR 221.255 - Assignment option.

    2010-04-01

    ... DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES LOW COST AND MODERATE INCOME MORTGAGE INSURANCE-SAVINGS CLAUSE Contract Rights and Obligations-Low Cost Homes § 221.255... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Assignment option. 221.255...

  1. 24 CFR 221.770 - Assignment option.

    2010-04-01

    ... DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES LOW COST AND... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Assignment option. 221.770 Section 221.770 Housing and Urban Development Regulations Relating to Housing and Urban Development...

  2. 40 CFR 436.221 - Specialized definitions.

    2010-07-01

    ... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Specialized definitions. 436.221 Section 436.221 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS MINERAL MINING AND PROCESSING POINT SOURCE CATEGORY Bentonite Subcategory §...

  3. 24 CFR 221.252 - Substitute mortgagors.

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Substitute mortgagors. 221.252... Cost Homes § 221.252 Substitute mortgagors. (a) Selling mortgagor. The mortgagee may effect the release... approval of a substitute mortgagor, as provided by this section. (b) Purchasing mortgagor. The...

  4. 29 CFR 1952.221 - Developmental schedule.

    2010-07-01

    ... 29 Labor 9 2010-07-01 2010-07-01 false Developmental schedule. 1952.221 Section 1952.221 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR... schedule. The Tennessee state plan is developmental. The following is the developmental schedule...

  5. 40 CFR 98.221 - Reporting threshold.

    2010-07-01

    ...) MANDATORY GREENHOUSE GAS REPORTING Nitric Acid Production § 98.221 Reporting threshold. You must report GHG emissions under this subpart if your facility contains a nitric acid train and the facility meets...

  6. DNA analysis of the genes encoding acidocin LF221 A and acidocin LF221 B, two bacteriocins produced by Lactobacillus gasseri LF221

    Majhenič, A.Č.; Venema, K.; Allison, G.E.; Matijašić, B.B.; Rogelj, I.; Klaenhammer, T.R.

    2004-01-01

    Lactobacillus gasseri LF221, an isolate from the feces of a child, produces two bacteriocins. Standard procedures for molecular techniques were used to locate, clone and sequence the fragments of LF221 chromosomal DNA carrying the acidocin LF221 A and B structural genes, respectively. Sequencing ana

  7. [2+2+1] cyclization of allenes.

    Kitagaki, S; Inagaki, F; Mukai, C

    2014-05-01

    The [2+2+1] cyclization of an alkyne, an alkene and carbon monoxide, i.e., the Pauson-Khand reaction, is one of the most powerful tools for constructing a five-membered ring. In place of the alkene or alkyne part, the use of an allene functionality has proven to make this reaction more valuable for organic synthesis. This review focuses on the origin and progress of the allenic [2+2+1] cyclocarbonylation, including the chirality transfer of the allene and its synthetic applications. PMID:24514744

  8. 24 CFR 221.1 - Savings clause.

    2010-04-01

    ... MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES LOW COST AND MODERATE INCOME MORTGAGE INSURANCE-SAVINGS CLAUSE Eligibility Requirements-Low Cost Homes-Savings Clause § 221.1...) of the National Housing Act (12 U.S.C. 1715l(d)(2)) for low cost and moderate income...

  9. 14 CFR 221.70 - Who may amend tariffs.

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Who may amend tariffs. 221.70 Section 221...) ECONOMIC REGULATIONS TARIFFS Amendment of Tariffs § 221.70 Who may amend tariffs. A tariff shall be amended only by the carrier or agent who issued the tariff (except as otherwise authorized in subparts P and Q)....

  10. 14 CFR 221.103 - Notice of tariff terms.

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Notice of tariff terms. 221.103 Section 221...) ECONOMIC REGULATIONS TARIFFS Availability of Tariff Publications for Public Inspection § 221.103 Notice of tariff terms. Each carrier shall cause to be displayed continuously in a conspicuous public place at...

  11. 14 CFR 221.210 - Suspension of tariffs.

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Suspension of tariffs. 221.210 Section 221...) ECONOMIC REGULATIONS TARIFFS Electronically Filed Tariffs § 221.210 Suspension of tariffs. (a) A fare, charge, rule or other tariff provision that is suspended by the Department pursuant to section 41509...

  12. 14 CFR 221.5 - Unauthorized air transportation.

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Unauthorized air transportation. 221.5 Section 221.5 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS TARIFFS General § 221.5 Unauthorized air transportation. Tariff...

  13. 40 CFR 86.221-94 - Hydrocarbon analyzer calibration.

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Hydrocarbon analyzer calibration. 86.221-94 Section 86.221-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... New Medium-Duty Passenger Vehicles; Cold Temperature Test Procedures § 86.221-94 Hydrocarbon...

  14. 32 CFR 724.221 - Scheduling of discharge reviews.

    2010-07-01

    ... 32 National Defense 5 2010-07-01 2010-07-01 false Scheduling of discharge reviews. 724.221 Section 724.221 National Defense Department of Defense (Continued) DEPARTMENT OF THE NAVY PERSONNEL NAVAL DISCHARGE REVIEW BOARD Authority/Policy for Departmental Discharge Review § 724.221 Scheduling of...

  15. 49 CFR 199.221 - Use following an accident.

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Use following an accident. 199.221 Section 199.221... Prevention Program § 199.221 Use following an accident. Each operator shall prohibit a covered employee who has actual knowledge of an accident in which his or her performance of covered functions has not...

  16. 46 CFR 221.93 - Collection of civil penalties.

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Collection of civil penalties. 221.93 Section 221.93... RELATED ACTIVITIES REGULATED TRANSACTIONS INVOLVING DOCUMENTED VESSELS AND OTHER MARITIME INTERESTS Civil Penalties § 221.93 Collection of civil penalties. Within 30 days after receipt of the Hearing...

  17. 10 CFR 221.11 - Natural gas and ethane.

    2010-01-01

    ... 10 Energy 3 2010-01-01 2010-01-01 false Natural gas and ethane. 221.11 Section 221.11 Energy DEPARTMENT OF ENERGY OIL PRIORITY SUPPLY OF CRUDE OIL AND PETROLEUM PRODUCTS TO THE DEPARTMENT OF DEFENSE UNDER THE DEFENSE PRODUCTION ACT Exclusions § 221.11 Natural gas and ethane. The supply of natural...

  18. 27 CFR 25.221 - Voluntary destruction of beer.

    2010-04-01

    ... beer. 25.221 Section 25.221 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS BEER Voluntary Destruction § 25.221 Voluntary destruction of beer. (a) On brewery premises. (1) A brewer may destroy, at the brewery, beer on which the tax has...

  19. Ectrodactyly and 7q22.1

    Rivera, H. [Salisbury District Hospital, Odstock (United Kingdom)

    1994-10-15

    This succinct `Letter to the Editor` was written in response to a report on a family exhibiting both a t(2;7)(q21.2;q22.1) and split hand/foot anomaly by Genuardi et al. [1993]. Pertinent sections of the article are discussed, with disagreement taken with a lack of mention to work conducted in 1991 by Rivera et al. in assigning the crucial locus to band 7q22 near to the proximal interface. 3 refs.

  20. 2.2.1 Ionizing Radiation

    Kasch, K.-U.

    This document is part of Subvolume A 'Fundamentals and Data in Radiobiology, Radiation Biophysics, Dosimetry and Medical Radiological Protection' of Volume 7 'Medical Radiological Physics' of Landolt-Börnstein - Group VIII 'Advanced Materials and Technologies'. It contains the Subsection '2.2.1 Ionizing Radiation' of the Section '2.2 Kinds of Radiation' of the Chapter '2 Radiation and Biological Effects' with the contents:

  1. Groundwater seepage from the Ranger uranium mine tailings dam: radioisotopes of radium, thorium and actinium. Supervising Scientist report 106

    Monitoring of bores near the Ranger uranium mine tailings dam has revealed deterioration in water quality in several bores since 1983. In a group of bores to the north of the dam, increases have been observed of up to 500 times for sulphate concentrations and of up to 5 times for 226Ra concentrations. Results are presented here of measurements of members of the uranium, thorium and actinium decay series in borewater samples collected between 1985 and 1993. In particular, measurements of all four naturally-occurring radium isotopes have been used in an investigation of the mechanism of radium concentration changes. For the most seepage-affected bores the major findings of the study include: 228Ra/226Ra 223Ra /226Ra and 224Ra/228Ra ratios all increased over the course of the study; barium concentrations show high seasonal variability, being lower in November than May, but strontium concentrations show a steady increase with time. Calculations show that the groundwater is probably saturated with respect to barite but not with respect to celestite or anglesite; sulphide concentrations are low in comparison with sulphate, and are higher in November than in May; and 227Ac concentrations have increased with time, but do not account for the high 223Ra/226Ra ratios. It is concluded on the basis of these observations that increases in Ra isotope concentrations observed in a number of seepage-affected bores arise from increases in salinity leading to desorption of radium from adsorption sites in the vicinity of the bore rather by direct transport of radium from the tailings. Increased salinity is also causing the observed increases in 227Ac and strontium concentrations, while formation of a barite solid phase in the groundwater is causing the removal of some radium from solution. This is the cause of the increasing radium isotope ratios noted above

  2. 24 CFR 221.256 - Interest rate increase and payment of mortgage insurance premiums on mortgages under § 221.60 and...

    2010-04-01

    ... balance of the mortgage on the first day of the month following the date on which such right first accrued... of mortgage insurance premiums on mortgages under § 221.60 and § 221.65. 221.256 Section 221.256... MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES LOW COST AND...

  3. 14 CFR 221.212 - Special tariff permission.

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Special tariff permission. 221.212 Section... PROCEEDINGS) ECONOMIC REGULATIONS TARIFFS Electronically Filed Tariffs § 221.212 Special tariff permission. (a) When a filer submits an electronic tariff or an amendment to an electronic tariff for which...

  4. 14 CFR 221.400 - Filing of paper tariffs required.

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Filing of paper tariffs required. 221.400... PROCEEDINGS) ECONOMIC REGULATIONS TARIFFS Electronically Filed Tariffs § 221.400 Filing of paper tariffs... file tariffs electronically, the filer in addition to filing electronically must continue to...

  5. 14 CFR 221.63 - Other types of governing tariffs.

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Other types of governing tariffs. 221.63... PROCEEDINGS) ECONOMIC REGULATIONS TARIFFS Governing Tariffs § 221.63 Other types of governing tariffs. Subject to approval of the Department, carriers may publish other types of governing tariffs not specified...

  6. 14 CFR 221.100 - Public notice of tariff information.

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Public notice of tariff information. 221... (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS TARIFFS Availability of Tariff Publications for Public Inspection § 221.100 Public notice of tariff information. Carriers must make tariff information available...

  7. 14 CFR 221.162 - Receiver shall file adoption notices.

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Receiver shall file adoption notices. 221... (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS TARIFFS Adoption Publications Required To Show Change in Carrier's Name or Transfer of Operating Control § 221.162 Receiver shall file adoption notices. A...

  8. 29 CFR 553.221 - Compensable hours of work.

    2010-07-01

    ... Compensable hours of work. (a) The general rules on compensable hours of work are set forth in 29 CFR part 785... 29 Labor 3 2010-07-01 2010-07-01 false Compensable hours of work. 553.221 Section 553.221 Labor... OF THE FAIR LABOR STANDARDS ACT TO EMPLOYEES OF STATE AND LOCAL GOVERNMENTS Fire Protection and...

  9. 14 CFR 417.221 - Time delay analysis.

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Time delay analysis. 417.221 Section 417... OF TRANSPORTATION LICENSING LAUNCH SAFETY Flight Safety Analysis § 417.221 Time delay analysis. (a) General. A flight safety analysis must include a time delay analysis that establishes the mean...

  10. 39 CFR 221.2 - Board of Governors.

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Board of Governors. 221.2 Section 221.2 Postal... Governors. (a) Composition. The Board of Governors consists of 11 members. Nine governors are appointed by... five governors may be adherents of the same political party. The governors are chosen to represent...

  11. 14 CFR 221.211 - Cancellation of suspended matter.

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Cancellation of suspended matter. 221.211 Section 221.211 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION... matter. When, pursuant to an order of the Department, the cancellation of rules, fares, charges, or...

  12. 24 CFR 221.790 - Debenture interest rate.

    2010-04-01

    ... LOW COST AND MODERATE INCOME MORTGAGE INSURANCE-SAVINGS CLAUSE Contract Rights and Obligations... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Debenture interest rate. 221.790 Section 221.790 Housing and Urban Development Regulations Relating to Housing and Urban...

  13. 24 CFR 221.780 - Issuance of debentures.

    2010-04-01

    ... LOW COST AND MODERATE INCOME MORTGAGE INSURANCE-SAVINGS CLAUSE Contract Rights and Obligations... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Issuance of debentures. 221.780 Section 221.780 Housing and Urban Development Regulations Relating to Housing and Urban...

  14. 24 CFR 221.275 - Method of paying insurance benefits.

    2010-04-01

    ... AUTHORITIES LOW COST AND MODERATE INCOME MORTGAGE INSURANCE-SAVINGS CLAUSE Contract Rights and Obligations-Low... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Method of paying insurance benefits. 221.275 Section 221.275 Housing and Urban Development Regulations Relating to Housing and...

  15. 24 CFR 221.251 - Cross-reference.

    2010-04-01

    ... DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES LOW COST AND MODERATE INCOME MORTGAGE INSURANCE-SAVINGS CLAUSE Contract Rights and Obligations-Low Cost Homes § 221.251... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Cross-reference. 221.251...

  16. 24 CFR 221.280 - Waived title objections.

    2010-04-01

    ... LOW COST AND MODERATE INCOME MORTGAGE INSURANCE-SAVINGS CLAUSE Contract Rights and Obligations-Low... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Waived title objections. 221.280 Section 221.280 Housing and Urban Development Regulations Relating to Housing and Urban...

  17. 24 CFR 221.305 - Condition of the multifamily structure.

    2010-04-01

    ... AUTHORITIES LOW COST AND MODERATE INCOME MORTGAGE INSURANCE-SAVINGS CLAUSE Contract Rights and Obligations-Low... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Condition of the multifamily structure. 221.305 Section 221.305 Housing and Urban Development Regulations Relating to Housing and...

  18. 24 CFR 221.751 - Cross-reference.

    2010-04-01

    ... DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES LOW COST AND... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Cross-reference. 221.751 Section 221.751 Housing and Urban Development Regulations Relating to Housing and Urban Development...

  19. 24 CFR 221.310 - Assessment of taxes.

    2010-04-01

    ... LOW COST AND MODERATE INCOME MORTGAGE INSURANCE-SAVINGS CLAUSE Contract Rights and Obligations-Low... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Assessment of taxes. 221.310 Section 221.310 Housing and Urban Development Regulations Relating to Housing and Urban...

  20. 24 CFR 221.800 - Cross-reference.

    2010-04-01

    ... DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES LOW COST AND MODERATE INCOME MORTGAGE INSURANCE-SAVINGS CLAUSE Servicing Responsibilities-Low Cost Homes § 221.800 Cross... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Cross-reference. 221.800...

  1. 24 CFR 221.320 - Certificate or statement of condition.

    2010-04-01

    ... AUTHORITIES LOW COST AND MODERATE INCOME MORTGAGE INSURANCE-SAVINGS CLAUSE Contract Rights and Obligations-Low... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Certificate or statement of condition. 221.320 Section 221.320 Housing and Urban Development Regulations Relating to Housing and...

  2. 24 CFR 221.315 - Certificate of tax assessment.

    2010-04-01

    ... AUTHORITIES LOW COST AND MODERATE INCOME MORTGAGE INSURANCE-SAVINGS CLAUSE Contract Rights and Obligations-Low... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Certificate of tax assessment. 221.315 Section 221.315 Housing and Urban Development Regulations Relating to Housing and...

  3. 14 CFR 21.221 - Class I provisional airworthiness certificates.

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Class I provisional airworthiness certificates. 21.221 Section 21.221 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF... limitations established in §§ 21.81(e) and 91.317 of this subchapter. (b) The manufacturer must hold...

  4. 12 CFR 221.104 - Federal credit unions.

    2010-01-01

    ... interpretation on Federal credit unions, see 12 CFR 220.110. ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Federal credit unions. 221.104 Section 221.104... CREDIT BY BANKS AND PERSONS OTHER THAN BROKERS OR DEALERS FOR THE PURPOSE OF PURCHASING OR...

  5. 27 CFR 41.221 - Change in trade name.

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Change in trade name. 41.221 Section 41.221 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU... Change in trade name. Where there is a change in, or an addition or discontinuance of, a trade name...

  6. 14 CFR 221.141 - Method of revoking concurrence.

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Method of revoking concurrence. 221.141... PROCEEDINGS) ECONOMIC REGULATIONS TARIFFS Giving and Revoking Concurrences to Carriers § 221.141 Method of revoking concurrence. (a) A concurrence may be revoked by filing with the Department a Notice of...

  7. Sampling and Analysis Plan for the 221-U Facility

    This sampling and analysis plan (SAP) presents the rationale and strategy for the sampling and analysis activities proposed to be conducted to support the evaluation of alternatives for the final disposition of the 221-U Facility. This SAP will describe general sample locations and the minimum number of samples required. It will also identify the specific contaminants of potential concern (COPCs) and the required analysis. This SAP does not define the exact sample locations and equipment to be used in the field due to the nature of unknowns associated with the 221-U Facility

  8. 27 CFR 555.221 - Requirements for display fireworks, pyrotechnic compositions, and explosive materials used in...

    2010-04-01

    ... fireworks, pyrotechnic compositions, and explosive materials used in assembling fireworks or articles pyrotechnic. 555.221 Section 555.221 Alcohol, Tobacco Products, and Firearms BUREAU OF ALCOHOL, TOBACCO... Requirements for display fireworks, pyrotechnic compositions, and explosive materials used in...

  9. 75 FR 52591 - Seventh Meeting: RTCA Special Committee 221: Aircraft Secondary Barriers and Alternative Flight...

    2010-08-26

    ... and Alternative Flight Deck Security Procedures AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of RTCA Special Committee 221 meeting: Aircraft Secondary Barriers and Alternative Flight... RTCA Special Committee 221: Aircraft Secondary Barriers and Alternative Flight Deck Security...

  10. 76 FR 38741 - Tenth Meeting: RTCA Special Committee 221: Aircraft Secondary Barriers and Alternative Flight...

    2011-07-01

    ... Alternative Flight Deck Security Procedures AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of RTCA Special Committee 221 meeting: Aircraft Secondary Barriers and Alternative Flight Deck... Special Committee 221: Aircraft Secondary Barriers and Alternative Flight Deck Security Procedures....

  11. 75 FR 9016 - Fifth Meeting: RTCA Special Committee 221: Aircraft Secondary Barriers and Alternative Flight...

    2010-02-26

    ... Alternative Flight Deck Security Procedures AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Notice of RTCA Special Committee 221 meeting: Aircraft Secondary Barriers and Alternative Flight Deck... Special Committee 221: Aircraft Secondary Barriers and Alternative Flight Deck Security Procedures....

  12. Theragnosis-based combined cancer therapy using doxorubicin-conjugated microRNA-221 molecular beacon.

    Lee, Jonghwan; Choi, Kyung-Ju; Moon, Sung Ung; Kim, Soonhag

    2016-01-01

    Recently, microRNA (miRNA or miR) has emerged as a new cancer biomarker because of its high expression level in various cancer types and its role in the control of tumor suppressor genes. In cancer studies, molecular imaging and treatment based on target cancer markers have been combined to facilitate simultaneous cancer diagnosis and therapy. In this study, for combined therapy with diagnosis of cancer, we developed a doxorubicin-conjugated miR-221 molecular beacon (miR-221 DOXO MB) in a single platform composed of three different nucleotides: miR-221 binding sequence, black hole quencher 1 (BHQ1), and doxorubicin binding site. Imaging of endogenous miR-221 was achieved by specific hybridization between miR-221 and the miR-221 binding site in miR-221 DOXO MB. The presence of miR-221 triggered detachment of the quencher oligo and subsequent activation of a fluorescent signal of miR-221 DOXO MB. Simultaneous cancer therapy in C6 astrocytoma cells and nude mice was achieved by inhibition of miRNA-221 function that downregulates tumor suppressor genes. The detection of miR-221 expression and inhibition of miR-221 function by miR-221 DOXO MB provide the feasibility as a cancer theragnostic probe. Furthermore, a cytotoxic effect was induced by unloading of doxorubicin intercalated into miR-221 DOXO MB inside cells. Loss of miR-221 function and cytotoxicity induced by the miR-221 DOXO MB provides combined therapeutic efficacy against cancers. This method could be used as a new theragnostic probe with enhanced therapy to detect and inhibit many cancer-related miRNAs. PMID:26454049

  13. 14 CFR 221.300 - Discontinuation of electronic tariff system.

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Discontinuation of electronic tariff system... (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS TARIFFS Electronically Filed Tariffs § 221.300 Discontinuation of electronic tariff system. In the event that the electronic tariff system is discontinued, or...

  14. 14 CFR 221.20 - Specifications applicable to tariff publications.

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Specifications applicable to tariff... (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS TARIFFS Specifications of Tariff Publications § 221.20 Specifications applicable to tariff publications. (a) Numerical order. All items in a tariff shall be arranged...

  15. Draft Genome Sequence of Avibacterium paragallinarum Strain 221

    Xu, Fuzhou; Miao, Deyuan; Du, Yu; CHEN, XIAOLING; Zhang, Peijun; Sun, Huiling

    2013-01-01

    Avibacterium paragallinarum is the causative agent of infectious coryza. Here we report the draft genome sequence of reference strain 221 of A. paragallinarum serovar A. The genome is composed of 135 contigs for 2,685,568 bp with a 41% G+C content.

  16. 24 CFR 221.254 - Mortgage insurance premiums.

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Mortgage insurance premiums. 221... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES LOW COST AND MODERATE INCOME MORTGAGE INSURANCE-SAVINGS CLAUSE Contract Rights and...

  17. 20 CFR 725.221 - Determination of dependency; child.

    2010-04-01

    ... Security Act, such disability must have begun before the child attained age 22, or in the case of a student... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Determination of dependency; child. 725.221... Determination of dependency; child. For the purposes of determining whether a child was dependent upon...

  18. 14 CFR 221.202 - The filing of tariffs and amendments to tariffs.

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false The filing of tariffs and amendments to tariffs. 221.202 Section 221.202 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS TARIFFS Electronically Filed Tariffs § 221.202...

  19. 14 CFR 221.180 - Requirements for electronic filing of tariffs.

    2010-01-01

    ... tariffs. 221.180 Section 221.180 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS TARIFFS Electronically Filed Tariffs § 221.180 Requirements for electronic filing of tariffs. (a) No carrier or filing agent shall file an electronic...

  20. 36 CFR 221.3 - Disposal of national forest timber according to management plans.

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Disposal of national forest timber according to management plans. 221.3 Section 221.3 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE TIMBER MANAGEMENT PLANNING § 221.3 Disposal of national forest...

  1. 12 CFR 221.109 - Loan to open-end investment company.

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Loan to open-end investment company. 221.109 Section 221.109 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED) BOARD OF GOVERNORS OF THE FEDERAL... CARRYING MARGIN STOCK (REGULATION U) Interpretations § 221.109 Loan to open-end investment company....

  2. Data Quality Objectives Summary Report for the 221-U Canyon Disposition Alternatives

    The 221-U Canyon Disposition Alternatives Data Quality Objective (DQO) Process identifies the sampling and analytical requirements necessary to support future detailed evaluation of alternatives via the CERCLA process, for final disposition of the 221-U Canyon Facility. Viable alternatives for the disposition of the 221-U Facility have been identified in a CERCLA Phase I Feasibility Study (FS) (DOE-RL 1997) for the Canyon Disposition Initiative (CDI). The scope of this DQO Process is limited to the 221-U Process Canyon Building and equipment contained within the facility. Associated stacks, filters, solvent handling, vaults, and storage facilities external to the 221-U Building are not addressed in this DQO. This DQO focuses on the 221-U Building because it provides the greatest potential source of contaminant volumes and concentrations and the physical structure poses the greatest challenge for disposition decisions

  3. Dicty_cDB: VFI221 [Dicty_cDB

    Full Text Available AAAACAACTTTAACAATCTTTAAAAAATTTT ATATTTTTCAACTTTATAACTTNATTATATTCAAAACCAATTTNAATAATTNAANAAAAA AATTT Length of 3' end seq. 785 Connect...ed seq. ID - Connected seq. - Length of connected seq. - Full length Seq ID - Full length Seq. - Length of full length seq. - ... ... falciparum 3D7 chromosome 10 section 2 of 7 of the complete sequence. 34 0.12 8 AX348619 |AX348619.1 Sequen...olderia sp. 383 chromosome 3... 136 9e-31 CP000633_73( CP000633 |pid:none) Agrobacterium vitis...VF (Link to library) VFI221 (Link to dictyBase) - - - Contig-U09577-1 - (Link to Or

  4. 14 CFR 221.123 - Re-use of Special Tariff Permission when tariff is rejected.

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Re-use of Special Tariff Permission when tariff is rejected. 221.123 Section 221.123 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS TARIFFS Special Tariff Permission To File on Less...

  5. 14 CFR 221.102 - Accessibility of tariffs to the public.

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Accessibility of tariffs to the public. 221... (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS TARIFFS Availability of Tariff Publications for Public Inspection § 221.102 Accessibility of tariffs to the public. Each file of tariffs shall be kept in...

  6. 14 CFR 221.94 - Explanation and data supporting tariff changes and new matter in tariffs.

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Explanation and data supporting tariff changes and new matter in tariffs. 221.94 Section 221.94 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS TARIFFS Filing Tariff...

  7. 24 CFR 221.300 - Changes in the plan of apartment ownership.

    2010-04-01

    ... AUTHORITIES LOW COST AND MODERATE INCOME MORTGAGE INSURANCE-SAVINGS CLAUSE Contract Rights and Obligations-Low... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Changes in the plan of apartment ownership. 221.300 Section 221.300 Housing and Urban Development Regulations Relating to Housing and...

  8. 14 CFR 221.205 - Justification and explanation for certain fares.

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Justification and explanation for certain fares. 221.205 Section 221.205 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF... Justification and explanation for certain fares. Any carrier or its agent must provide, as to any new...

  9. Dependence of the half-life of 221Fr on the implantation environment

    Olaizola, B.; Fraile, L.M.; Riisager, Karsten; Correia, J.G.; Fynbo, Hans Otto Uldall; Jeppesen, Henrik; Johnston, K.; Kirsebom, Oliver Sølund; Skovbo, Katrine; Thomsen, Lotte Ansgaard

    The possible dependence of the half-life of 221Fr on the solid-state environment has been investigated by the simultaneous measurement of implanted 221Fr ions in an insulator (Si) and a metallic substrate (Au) at the ISOLDE facility at CERN. Our results indicate that, if existing, the difference ...

  10. Phase I feasibility study for the Canyon disposition initiative (221-U facility)

    The objective of the Phase I Feasibility Study (FS) presented in this document is to provide decision makers sufficient information on the remedial alternatives specific to the disposition of the 221-U Canyon Building (221-U Facility) located at the Hanford Site, and to determine which alternatives are viable for further detailed analysis

  11. 14 CFR 221.151 - Method of revoking power of attorney.

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Method of revoking power of attorney. 221... (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS TARIFFS Giving and Revoking Powers of Attorney to Agents § 221.151 Method of revoking power of attorney. (a) A power of attorney may be revoked only by filing...

  12. 12 CFR 221.120 - Allocation of stock collateral to purpose and nonpurpose credits to same customer.

    2010-01-01

    ... nonpurpose credits to same customer. 221.120 Section 221.120 Banks and Banking FEDERAL RESERVE SYSTEM... § 221.120 Allocation of stock collateral to purpose and nonpurpose credits to same customer. (a) A bank proposes to extend two credits (Credits A and B) to its customer. Although the two credits are proposed...

  13. MiR-221 influences effector functions and actin cytoskeleton in mast cells.

    Ramon J Mayoral

    Full Text Available Mast cells have essential effector and immunoregulatory functions in IgE-associated allergic disorders and certain innate and adaptive immune responses, but the role of miRNAs in regulating mast cell functions is almost completely unexplored. To examine the role of the activation-induced miRNA miR-221 in mouse mast cells, we developed robust lentiviral systems for miRNA overexpression and depletion. While miR-221 favored mast cell adhesion and migration towards SCF or antigen in trans-well migration assays, as well as cytokine production and degranulation in response to IgE-antigen complexes, neither miR-221 overexpression, nor its ablation, interfered with mast cell differentiation. Transcriptional profiling of miR-221-overexpressing mast cells revealed modulation of many transcripts, including several associated with the cytoskeleton; indeed, miR-221 overexpression was associated with reproducible increases in cortical actin in mast cells, and with altered cellular shape and cell cycle in murine fibroblasts. Our bioinformatics analysis showed that this effect was likely mediated by the composite effect of miR-221 on many primary and secondary targets in resting cells. Indeed, miR-221-induced cellular alterations could not be recapitulated by knockdown of one of the major targets of miR-221. We propose a model in which miR-221 has two different roles in mast cells: in resting cells, basal levels of miR-221 contribute to the regulation of the cell cycle and cytoskeleton, a general mechanism probably common to other miR-221-expressing cell types, such as fibroblasts. Vice versa, upon induction in response to mast cell stimulation, miR-221 effects are mast cell-specific and activation-dependent, contributing to the regulation of degranulation, cytokine production and cell adherence. Our studies provide new insights into the roles of miR-221 in mast cell biology, and identify novel mechanisms that may contribute to mast cell-related pathological

  14. Level structure of 217Rn and 221Ra investigated in the alpha-decay 225Th → 221Ra → 217Rn

    The nuclei 221Ra and 217Rn have been investigated in the α-decay chain 225Th → 221Ra → 217Rn through γ-ray and conversion-electron studies. The short-lived 225Th nuclei (T1/2=8 min) were produced in the 226Ra(α, 5n) reaction, and γ-rays and conversion electrons were measured - between the irradiation periods - in coincidence with α-particles. In 221Ra the five lowest levels are interpreted as members of a K=5/2 parity-doublet with ΔEπ=104 keV. These levels, as well as a higher-lying Kπ=3/2+ band, are consistent with an octupole deformation of 221Ra, as expected from theoretical considerations. In 217Rn only three excited levels are observed, with a favoured α-decay to a 5/2+ excited level thus establishing positive parity for the ground state of 221Ra. (orig.)

  15. 50 CFR 221.34 - What is the law governing ex parte communications?

    2010-10-01

    ... procedural requirements, unless the inquiry involves an area of controversy in the hearing process. ... LICENSES Hearing Process General Provisions Related to Hearings § 221.34 What is the law governing ex...

  16. 14 CFR 221.204 - Adoption of provisions of one carrier by another carrier.

    2010-01-01

    ... TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS TARIFFS Electronically Filed Tariffs § 221.204... carrier, the effective and prospective fares of the adopted carrier shall be changed to reflect the...

  17. Fire modeling for Building 221-T - T Plant Canyon Deck and Railroad Tunnel

    This report was prepared by Hughes Associates, Inc. to document the results of fire models for building 221-T Canyon Deck and Railroad Tunnel. Backup data is contained in document No. WHC-SD-CP-ANAL-010, Rev. 0

  18. Human miR-221/222 in Physiological and Atherosclerotic Vascular Remodeling

    Dmitry A. Chistiakov

    2015-01-01

    Full Text Available A cluster of miR-221/222 is a key player in vascular biology through exhibiting its effects on vascular smooth muscle cells (VSMCs and endothelial cells (ECs. These miRNAs contribute to vascular remodeling, an adaptive process involving phenotypic and behavioral changes in vascular cells in response to vascular injury. In proliferative vascular diseases such as atherosclerosis, pathological vascular remodeling plays a prominent role. The miR-221/222 cluster controls development and differentiation of ECs but inhibits their proangiogenic activation, proliferation, and migration. miR-221/222 are primarily implicated in maintaining endothelial integrity and supporting quiescent EC phenotype. Vascular expression of miR-221/222 is upregulated in initial atherogenic stages causing inhibition of angiogenic recruitment of ECs and increasing endothelial dysfunction and EC apoptosis. In contrast, these miRNAs stimulate VSMCs and switching from the VSMC “contractile” phenotype to the “synthetic” phenotype associated with induction of proliferation and motility. In atherosclerotic vessels, miR-221/222 drive neointima formation. Both miRNAs contribute to atherogenic calcification of VSMCs. In advanced plaques, chronic inflammation downregulates miR-221/222 expression in ECs that in turn could activate intralesion neoangiogenesis. In addition, both miRNAs could contribute to cardiovascular pathology through their effects on fat and glucose metabolism in nonvascular tissues such as adipose tissue, liver, and skeletal muscles.

  19. MiR-221 Promotes Capan-2 Pancreatic Ductal Adenocarcinoma Cells Proliferation by Targeting PTEN-Akt

    Wenzhuo Yang

    2016-05-01

    Full Text Available Background/Aims: MicroRNAs (miRNAs, miRs have emerged as critical regulators of cancer cell proliferation. The effect of miR-221 on cancer cell growth could be significantly changeable in different cell lines. Although miR-221 was reported to promote the cell growth of pancreatic ductal adenocarcinoma (PDAC cells, its role in Capan-2 cell line is largely unknown. Methods: Capan-2 cells were transfected with miR-221 mimics, inhibitors, or negative controls. Cell Counting Kit-8 was used to determine cell viability. EdU staining and cell cycle analysis were used to measure cell proliferation. Western blotting was used to detect the expression levels of PTEN and phospho-Akt. The PI3K-Akt pathway activator SC-79 and inhibitor LY294002 were used to perform the rescue experiment in determining cell proliferation. Results: Overexpressing miR-221 significantly increased cell vitality and promoted cell proliferation and G1-to-S phase transition of the cell cycle in Capan-2 cells, while inhibition of miR-221 decreased that. The protein level of PTEN in Capan-2 cells was downregulated by overexpressing miR-221, while upregulated by inhibiting miR-221. Consistently, enhanced phosphorylation of AktSer473 was observed in miR-221 overexpressed Capan-2 cells, and the opposite result was found in miR-221 inhibited cells. LY294002 restored the pro-proliferation effect of miR-221 on Capan-2 cells, while SC-79 had no additional effect on cell proliferation in Capan-2 cells transfected with miR-221 mimics. Conclusion: Our study indicates that miR-221 is an oncogenic miRNA which promotes Capan-2 cells proliferation by targeting PTEN-Akt pathway.

  20. Knock-down of miR-221 and miR-222 in the radiosensitization of breast cancer cells

    Objective: To investigate the radiosensitizing effect of knock-down of miR-221 miR-222 on MCF-7 human breast cancer cells and explore the possible mechanism. Methods: Antisense oligonucleotides of miR-221 and miR-222 (AS-miR-221 and AS-miR-222), mediated by lipofectamine, were transfected to MCF-7 cells to knock down miR-221 and miR-222, Northern blotting was conducted to detect the expression of miR-221 and miR-222 in transfected cells. The cell apoptosis was detected by flow cytometry and Caspase-3 and Caspase-7 activity assay. Clonogenic assay was used to measure the sensitizing enhancement ratio. Target genes of miR-221 and miR-222 relevant to radio-sensitivity were searched using bioinformatics analysis. The targeted protein expression was determined by Western blot analysis. Results: The expression of miR-221 and miR-222 in the AS-miR-221/222 cells determined by Northern blotting was significantly reduced. Compared with the control group, the cell apoptosis and mitotic cell death after the radiation were significantly higher in AS-miR-221/222 cells. The sensitizing enhancement ratio was 1.87. Based on bioinformatics analysis, PTEN was a target gene of miR-221 and miR-222 which could enhance the radiosensitivity of MCF-7 cells. In AS-miR-221/222 cells, the expression of PTEN was up-regulated while pAkt down-regulated. Conclusions: AS-miR-221 and AS-miR-222 may enhance the radiosensitivity of MCF-7 breast cancer cells by up-regulating the expression of PTEN. (authors)

  1. MicroRNA-221 and microRNA-222 regulate gastric carcinoma cell proliferation and radioresistance by targeting PTEN

    MicroRNAs (miRNAs) can function as either oncogenes or tumor suppressor genes via regulation of cell proliferation and/or apoptosis. MiR-221 and miR-222 were discovered to induce cell growth and cell cycle progression via direct targeting of p27 and p57 in various human malignancies. However, the roles of miR-221 and miR-222 have not been reported in human gastric cancer. In this study, we examined the impact of miR-221 and miR-222 on human gastric cancer cells, and identified target genes for miR-221 and miR-222 that might mediate their biology. The human gastric cancer cell line SGC7901 was transfected with AS-miR-221/222 or transduced with pMSCV-miR-221/222 to knockdown or restore expression of miR-221 and miR-222, respectively. The effects of miR-221 and miR-222 were then assessed by cell viability, cell cycle analysis, apoptosis, transwell, and clonogenic assay. Potential target genes were identified by Western blot and luciferase reporter assay. Upregulation of miR-221 and miR-222 induced the malignant phenotype of SGC7901 cells, whereas knockdown of miR-221 and miR-222 reversed this phenotype via induction of PTEN expression. In addition, knockdonwn of miR-221 and miR-222 inhibited cell growth and invasion and increased the radiosensitivity of SGC7901 cells. Notably, the seed sequence of miR-221 and miR-222 matched the 3'UTR of PTEN, and introducing a PTEN cDNA without the 3'UTR into SGC7901 cells abrogated the miR-221 and miR-222-induced malignant phenotype. PTEN-3'UTR luciferase reporter assay confirmed PTEN as a direct target of miR-221 and miR-222. These results demonstrate that miR-221 and miR-222 regulate radiosensitivity, and cell growth and invasion of SGC7901 cells, possibly via direct modulation of PTEN expression. Our study suggests that inhibition of miR-221 and miR-222 might form a novel therapeutic strategy for human gastric cancer

  2. miR-221/222 Target the DNA Methyltransferase MGMT in Glioma Cells

    Roscigno, Giuseppina; Romano, Giulia; Diaz-Lagares, Angel; Iaboni, Margherita; Donnarumma, Elvira; Fiore, Danilo; De Marinis, Pasqualino; Soini, Ylermi; Esteller, Manel; Condorelli, Gerolama

    2013-01-01

    Glioblastoma multiforme (GBM) is one of the most deadly types of cancer. To date, the best clinical approach for treatment is based on administration of temozolomide (TMZ) in combination with radiotherapy. Much evidence suggests that the intracellular level of the alkylating enzyme O6-methylguanine–DNA methyltransferase (MGMT) impacts response to TMZ in GBM patients. MGMT expression is regulated by the methylation of its promoter. However, evidence indicates that this is not the only regulatory mechanism present. Here, we describe a hitherto unknown microRNA-mediated mechanism of MGMT expression regulation. We show that miR-221 and miR-222 are upregulated in GMB patients and that these paralogues target MGMT mRNA, inducing greater TMZ-mediated cell death. However, miR-221/miR-222 also increase DNA damage and, thus, chromosomal rearrangements. Indeed, miR-221 overexpression in glioma cells led to an increase in markers of DNA damage, an effect rescued by re-expression of MGMT. Thus, chronic miR-221/222-mediated MGMT downregulation may render cells unable to repair genetic damage. This, associated also to miR-221/222 oncogenic potential, may poor GBM prognosis. PMID:24147153

  3. MiR-221/222 target the DNA methyltransferase MGMT in glioma cells.

    Cristina Quintavalle

    Full Text Available Glioblastoma multiforme (GBM is one of the most deadly types of cancer. To date, the best clinical approach for treatment is based on administration of temozolomide (TMZ in combination with radiotherapy. Much evidence suggests that the intracellular level of the alkylating enzyme O(6-methylguanine-DNA methyltransferase (MGMT impacts response to TMZ in GBM patients. MGMT expression is regulated by the methylation of its promoter. However, evidence indicates that this is not the only regulatory mechanism present. Here, we describe a hitherto unknown microRNA-mediated mechanism of MGMT expression regulation. We show that miR-221 and miR-222 are upregulated in GMB patients and that these paralogues target MGMT mRNA, inducing greater TMZ-mediated cell death. However, miR-221/miR-222 also increase DNA damage and, thus, chromosomal rearrangements. Indeed, miR-221 overexpression in glioma cells led to an increase in markers of DNA damage, an effect rescued by re-expression of MGMT. Thus, chronic miR-221/222-mediated MGMT downregulation may render cells unable to repair genetic damage. This, associated also to miR-221/222 oncogenic potential, may poor GBM prognosis.

  4. 221-U Facility concrete and reinforcing steel evaluations specification for the canyon disposition initiative (CDI)

    This describes a test program to establish the in-situ material properties of the reinforced concrete in Building 221-U for comparison to the original design specifications. Field sampling and laboratory testing of concrete and reinforcing steel structural materials in Building 221-U for design verification will be undertaken. Forty seven samples are to be taken from radiologically clean exterior walls of the canyon. Laboratory testing program includes unconfined compressive strength of concrete cores, tensile strength of reinforcing steel, and petrographic examinations of concrete cores taken from walls below existing grade

  5. 14 CFR 221.105 - Special notice of limited liability for death or injury under the Warsaw Convention.

    2010-01-01

    ... death or injury under the Warsaw Convention. 221.105 Section 221.105 Aeronautics and Space OFFICE OF THE... injury under the Warsaw Convention. (a)(1) In addition to the other requirements of this subpart, each... to passengers provided by the Warsaw Convention, shall, at the time of delivery of the...

  6. Pharmacokinetics and Pharmacodynamics of a 13-mer LNA-inhibitor-miR-221 in Mice and Non-human Primates.

    Gallo Cantafio, Maria Eugenia; Nielsen, Boye Schnack; Mignogna, Chiara; Arbitrio, Mariamena; Botta, Cirino; Frandsen, Niels M; Rolfo, Christian; Tagliaferri, Pierosandro; Tassone, Pierfrancesco; Di Martino, Maria Teresa

    2016-01-01

    Locked nucleic acid (LNA) oligonucleotides have been successfully used to efficiently inhibit endogenous small noncoding RNAs in vitro and in vivo. We previously demonstrated that the direct miR-221 inhibition by the novel 13-mer LNA-i-miR-221 induces significant antimyeloma activity and upregulates canonical miR-221 targets in vitro and in vivo. To evaluate the LNA-i-miR-221 pharmacokinetics and pharmacodynamics, novel assays for oligonucleotides quantification in NOD.SCID mice and Cynomolgus monkeys (Macaca fascicularis) plasma, urine and tissues were developed. To this aim, a liquid chromatography/mass spectrometry method, after solid-phase extraction, was used for the detection of LNA-i-miR-221 in plasma and urine, while a specific in situ hybridization assay for tissue uptake analysis was designed. Our analysis revealed short half-life, optimal tissue biovailability and minimal urine excretion of LNA-i-miR-221 in mice and monkeys. Up to 3 weeks, LNA-i-miR-221 was still detectable in mice vital organs and in xenografted tumors, together with p27 target upregulation. Importantly, no toxicity in the pilot monkey study was observed. Overall, our findings indicate the suitability of LNA-i-miR-221 for clinical use and we provide here pilot data for safety analysis and further development of LNA-miRNA-based therapeutics for human cancer. PMID:27327137

  7. 12 CFR 221.116 - Bank loans to replenish working capital used to purchase mutual fund shares.

    2010-01-01

    ... purchase mutual fund shares. 221.116 Section 221.116 Banks and Banking FEDERAL RESERVE SYSTEM (CONTINUED... Bank loans to replenish working capital used to purchase mutual fund shares. (a) In a situation considered by the Board of Governors, a business concern (X) proposed to purchase mutual fund shares,...

  8. 5 CFR 591.221 - How does OPM compute the consumer expenditure weights it uses to combine price indexes?

    2010-01-01

    ... expenditure weights it uses to combine price indexes? 591.221 Section 591.221 Administrative Personnel OFFICE... the consumer expenditure weights it uses to combine price indexes? OPM uses the following ten-step... aggregation. (f) Step 6. OPM computes a set of ratios by dividing each expenditure share of the...

  9. 14 CFR 221.60 - When reference to governing tariffs permitted.

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false When reference to governing tariffs... (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS TARIFFS Governing Tariffs § 221.60 When reference to governing tariffs permitted. (a) Reference to other tariffs prohibited except as authorized. A tariff shall...

  10. 14 CFR 221.72 - Reinstating canceled or expired tariff provisions.

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Reinstating canceled or expired tariff... (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS TARIFFS Amendment of Tariffs § 221.72 Reinstating canceled or expired tariff provisions. Any fares, rules, or other tariff provisions which have been canceled or...

  11. 14 CFR 221.500 - Transmission of electronic tariffs to subscribers.

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Transmission of electronic tariffs to... TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS TARIFFS Electronically Filed Tariffs § 221.500 Transmission of electronic tariffs to subscribers. (a) Each filer that files an electronic tariff under...

  12. 14 CFR 221.130 - Applications for waiver of tariff regulations.

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Applications for waiver of tariff... TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS TARIFFS Waiver of Tariff Regulations § 221.130 Applications for waiver of tariff regulations. Applications for waiver or modification of any of...

  13. 50 CFR 221.74 - Has OMB approved the information collection provisions of this subpart?

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Has OMB approved the information... PRESCRIPTIONS IN FERC HYDROPOWER LICENSES Alternatives Process § 221.74 Has OMB approved the information... it displays a currently valid OMB control number that indicates OMB approval. OMB has reviewed...

  14. 14 CFR 91.221 - Traffic alert and collision avoidance system equipment and use.

    2010-01-01

    ... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Traffic alert and collision avoidance... RULES Equipment, Instrument, and Certificate Requirements § 91.221 Traffic alert and collision avoidance system equipment and use. (a) All airspace: U.S.-registered civil aircraft. Any traffic alert...

  15. 26 CFR 1.381(c)(22)-1 - Successor life insurance company.

    2010-04-01

    ... 26 Internal Revenue 4 2010-04-01 2010-04-01 false Successor life insurance company. 1.381(c)(22)-1... company. (a) Carryover requirement. If in a taxable year beginning after December 31, 1957, a distributor or transferor corporation which is an insurance company is acquired by a corporation which is...

  16. Tetrasomy 21 pter {yields} q22.1 and Down syndrome: Molecular definition of the region

    Daumer-Haas, C.; Schuffenhauer, S.; Walther, J.U. [Universitaet Muenchen (Germany); Portsmann, T. [Humboldt Universitaet, Berlin (Germany); Korenberg, J.R.; Schipper, R.D. [Univ. of California, Los Angeles, CA (United States)

    1994-12-01

    Down syndrome is usually caused by complete trisomy 21. Rarely, it is due to partial trisomy of the segment 21q22. We report on a 33-month-old girl with tetrasomy 21 pter {yields} q22.1 resulting from an extra chromosome idic(21)(q22.1). She has craniofacial traits typical of Down syndrome, including brachycephaly, third fontanel, upward slanting palpebral fissures, round face, and protruding tongue. Speech development is quite delayed whereas motor development is only mildly retarded. The molecular content of the extra isodicentric chromosome was defined by molecular genetic investigations using 13 single copy probes unique to chromosome 21, and SOD1 expression studies. The child was found to have 4 copies of the region defined by D21S16 (21cen) through D21S93 on 21q22.1 and two copies of the remaining region defined by SOD1 {yields} D21S55 {yields} D21S123. In view of the recent assignment of Down syndrome facial characters to the 21q22 region, defined in part by D21S55, it is significant that this child shows a subset of Down syndrome facial manifestations, without duplication of this region. These results suggest that genes contributing to the facial and some of the hand manifestations of Down syndrome also exist in the chromosomal region proximal to D21S55 in band 21q22.1. 34 refs., 6 figs., 3 tabs.

  17. 49 CFR 173.221 - Polymeric beads, expandable and Plastic molding compound.

    2010-10-01

    ... Than Class 1 and Class 7 § 173.221 Polymeric beads, expandable and Plastic molding compound. (a) Non... molding compound in dough, sheet or extruded rope form, evolving flammable vapor must be packed in: wooden... flammable vapor or Plastic molding compounds in dough, sheet or extruded rope, evolving flammable vapor...

  18. 42 CFR 22.1 - Duty at a station of the Service devoted to the care of Hansen's disease patients; additional pay.

    2010-10-01

    ... care of Hansen's disease patients; additional pay. 22.1 Section 22.1 Public Health PUBLIC HEALTH... Hansen's Disease Duty by Personnel Other Than Commissioned Officers § 22.1 Duty at a station of the Service devoted to the care of Hansen's disease patients; additional pay. (a) Non-commissioned...

  19. DME-221 thoria fuel: fabrication, irradiation testing, and post-irradiation examination

    Corbett, S.; Floyd, M.R.; Hamilton, H.; Livingstone, S.; Harrison, N.F. [Atomic Energy of Canada Limited, Chalk River, Ontario (Canada)

    2013-07-01

    Thoria (ThO{sub 2}) has several advantages over Urania (UO{sub 2}) as a nuclear fuel; its higher thermal conductivity results in lower operating temperatures, and its higher melting point and chemical inertness promise better stability under postulated accident conditions. Thorium is a 'fertile' material, breeding mainly fissile {sup 233}U as it is irradiated, making it more proliferation resistant. Thorium is also abundant as a natural resource, and is therefore an attractive future energy source. Past irradiation tests have shown that pellet microstructure greatly influences the irradiation performance of thoria fuels (e.g., fission-gas release is strongly influenced by the as-fabricated fuel microstructure). The “DME-221” test, conducted at AECL’s Chalk River Laboratories, was designed to demonstrate the superior irradiation performance of thoria fuels characterized by homogeneous, high-density microstructures. Eighteen DME-221 fuel elements were irradiated in the National Research Universal (NRU) loops in a 36-element demountable bundle. Six of the elements had pellets comprised of natural thoria (ThO{sub 2}), and twelve comprised of thoria blended with 1.0 wt.% or 1.5 wt% {sup 235}U in (Th, U)O{sub 2}. Various power histories were achieved as a result of the varied initial fissile concentration. To date, DME-221 thoria fuel has demonstrated excellent performance to burnups up to ∼930 MWh/kgHE (39 GWd/tHE); fission-gas release is substantially lower than that expected from UO{sub 2} fuels experiencing similar operating histories. This paper highlights the fabrication, irradiation testing and post-irradiation examination of twelve DME-221 fuel elements. The remaining six DME-221 elements are currently planned for irradiation in NRU to burnups up to 1500 MWh/kgHE (42-63 GWd/tHE). (author)

  20. Increased MiR-221 expression in hepatocellular carcinoma tissues and its role in enhancing cell growth and inhibiting apoptosis in vitro

    MiR-221 is over-expressed in human hepatocellular carcinoma (HCC), but its clinical significance and function in HCC remains uncertain. The aim of the study was to investigate the relationship between miR-221 overexpression and clinicopathological parameters in HCC formalin-fixed paraffin-embedded (FFPE) tissues, and the effect of miR-221 inhibitor and mimic on different HCC cell lines in vitro. MiR-221 expression was detected using real time RT-qPCR in FFPE HCC and the adjacent noncancerous liver tissues. The relationship between miR-221 level and clinicopathological features was also analyzed. Furthermore, miR-221 inhibitor and mimic were transfected into HCC cell lines HepB3, HepG2 and SNU449. The effects of miR-221 on cell growth, cell cycle, caspase activity and apoptosis were also investigated by spectrophotometry, fluorimetry, fluorescence microscopy and flow cytometry, respectively. The relative expression of miR-221 in clinical TNM stages III and IV was significantly higher than that in the stages I and II. The miR-221 level was also upregulated in the metastatic group compared to the nonmetastatic group. Furthermore, miR-221 over-expression was related to the status of tumor capsular infiltration in HCC clinical samples. Functionally, cell growth was inhibited, cell cycle was arrested in G1/S-phase and apoptosis was increased by miR-221 inhibitor in vitro. Likewise, miR-221 mimic accelerated the cell growth. Expression of miR-221 in FFPE tissues could provide predictive significance for prognosis of HCC patients. Moreover, miR-221 inhibitor could be useful to suppress proliferation and induce apoptosis in HCC cells. Thus miR-221 might be a critical targeted therapy strategy for HCC

  1. The Inhibition of the Highly Expressed Mir-221 and Mir-222 Impairs the Growth of Prostate Carcinoma Xenografts in Mice

    Mercatelli, Neri; Coppola, Valeria; Bonci, Desirée; Miele, Francesca; Costantini, Arianna; Guadagnoli, Marco; Bonanno, Elena; Muto, Giovanni; Frajese, Giovanni Vanni; De Maria, Ruggero; Spagnoli, Luigi Giusto; Farace, Maria Giulia; Ciafrè, Silvia Anna

    2008-01-01

    Background MiR-221 and miR-222 are two highly homologous microRNAs whose upregulation has been recently described in several types of human tumors, for some of which their oncogenic role was explained by the discovery of their target p27, a key cell cycle regulator. We previously showed this regulatory relationship in prostate carcinoma cell lines in vitro, underlying the role of miR-221/222 as inducers of proliferation and tumorigenicity. Methodology/Principal Findings Here we describe a number of in vivo approaches confirming our previous data. The ectopic overexpression of miR-221 is able, per se, to confer a high growth advantage to LNCaP-derived tumors in SCID mice. Consistently, the anti-miR-221/222 antagomir treatment of established subcutaneous tumors derived from the highly aggressive PC3 cell line, naturally expressing high levels of miR-221/222, reduces tumor growth by increasing intratumoral p27 amount; this effect is long lasting, as it is detectable as long as 25 days after the treatment. Furthermore, we provide evidence in favour of a clinical relevance of the role of miR-221/222 in prostate carcinoma, by showing their general upregulation in patient-derived primary cell lines, where we find a significant inverse correlation with p27 expression. Conclusions/Significance These findings suggest that modulating miR-221/222 levels may have a therapeutic potential in prostate carcinoma. PMID:19107213

  2. Preparation and Electrooxidative SO-Extrusion of Halogenated 7-Thiabicyclo[2.2.1]heptene 7-Oxides

    Thiemann, Thies; Melo, M. Luísa Sá e; Neves, André S. Campos; Li, Yuanqiang; Mataka, Shuntaro; Tashiro, Masashi; Geißler, Uwe; Walton, David

    1998-01-01

    Halogenated thiophenes have been cycloadded oxidatively to maleimides to give halogenated thiabicyclo[2.2.1]heptene S-oxides which have been subjected to an electrochemical extrusion of SO to give various halogeno-substituted phthalimides.

  3. The denitrification characteristics of Pseudomonas stutzeri SC221-M and its application to water quality control in grass carp aquaculture.

    Bin Deng

    Full Text Available To reduce ammonium and nitrite in aquaculture water, an isolate of the denitrifying bacterium Pseudomonas stutzeri, SC221-M, was obtained. The effects of various nitrogen and carbon sources, the ratio of carbon to nitrogen and temperature on bacterial growth, denitrification rates and the expression levels of nirS and nosZ in SC221-M were studied. The following conditions were determined to be optimal for growth and denitrification in SC221-M: NaNO2 as the nitrogen source, sodium citrate as the carbon source, a carbon to nitrogen ratio range of 4-8, and a temperature range of 20-35°C. Subsequently, SC221-M and the Bacillus cereus BSC24 strain were selected to generate microbial preparations. The results showed that addition of the microbial preparations decreased various hydrochemical parameters, including total dissolved solids, ammonium, nitrite, total nitrogen and the chemical oxygen demand. Nitrogen removal rates were highest on day 9; the removal rates of BSC24, SC221-M, a mixed preparation and a 3× mixed preparation were 24.5%, 26.6%, 53.9% and 53.4%, respectively. The mixed preparation (SC221-M+BSC24 was more effective at removing nitrogen than either the SC221-M or BSC24 preparation. Roche 454 pyrosequencing and subsequent analysis indicated that the control and other groups formed separate clusters, and the microbial community structure in the water changed significantly after the addition of microbial preparations. These results indicate that the addition of microbial preparations can improve both the water quality and microbial community structure in an experimental aquaculture system. P. stutzeri strain SC221-M and its related microbial preparations are potential candidates for the regulation of water quality in commercial aquaculture systems.

  4. 77 FR 64564 - Implementation of Regulatory Guide 1.221 on Design-Basis Hurricane and Hurricane Missiles

    2012-10-22

    ...The U.S Nuclear Regulatory Commission (NRC or the Commission) staff is soliciting public comment on its proposed Interim Staff Guidance (ISG) DC/COL-ISG-024, ``Implementation of Regulatory Guide 1.221 on Design-Basis Hurricane and Hurricane Missiles.'' The purpose of this ISG is to supplement the guidance regarding the application of Regulatory Guide 1.221, ``Design-Basis Hurricane and......

  5. A=225 implantation for $^{221}$Fr source for TRIUMF atom trap

    The FrPNC Collaboration is mounting an atom trap for parity violation experiments and precision spectroscopy on francium atoms at TRIUMF's ISAC facility. We would like to use ISOLDE's capability of simultaneously implanting A=225 (while another experiment runs online) to make a long-lived source feeding $^{221}$Fr for tests of the trap. $^{225}$Ra $\\beta$-decays to $^{225}$Ac, which then $\\alpha$-decays, producing 100 keV $^{221}$Fr t$_{1/2}$= 4.8 minute recoils. The implanted A=225 source would be shipped to TRIUMF, where it would be held for several minutes at a time a few mm from the same yttrium foil that normally receives the ISAC beam. SRIM calculations imply that 20% of the $^{221}$Fr will be implanted in a 1 cm diameter spot on the yttrium. Then the yttrium foil is moved to the trap and heated to release the Fr atoms, just as in normal ISAC online operation. A test implantation will be done at 10$^{7}$/sec production for 1 day, testing whether carbon cracking on the implantation foil in the mass separ...

  6. Targeted delivery of chemically modified anti-miR-221 to hepatocellular carcinoma with negatively charged liposomes

    Zhang W

    2015-07-01

    Full Text Available Wendian Zhang,1 Fangqi Peng,1 Taotao Zhou,1 Yifei Huang,2 Li Zhang,3 Peng Ye,4 Miao Lu,1 Guang Yang,5 Yongkang Gai,1 Tan Yang,1 Xiang Ma,1 Guangya Xiang1 1School of Pharmacy, Tongji Medical College, 2Department of Pharmacy, 3Department of Ultrasound, Union Hospital, Tongji Medical College, Huazhong University of Science and Technology, 4Department of Pharmacy, Wuhan University, Renmin Hospital, 5School of Medicine, Jianghan University, Wuhan, People’s Republic of China Abstract: Hepatocellular carcinoma (HCC is one of the leading causes of cancer-related death. Gene therapy was established as a new strategy for treating HCC. To explore the potential delivery system to support the gene therapy of HCC, negatively charged liposomal delivery system was used to deliver miR-221 antisense oligonucleotide (anti-miR-221 to the transferrin (Tf receptor over expressed HepG2 cells. The liposome exhibited a mean particle size of 122.5 nm, zeta potential of -15.74 mV, anti-miR-221 encapsulation efficiency of 70%, and excellent colloidal stability at 4°C. Anti-miR-221-encapsulated Tf-targeted liposome demonstrated a 15-fold higher delivery efficiency compared to nontargeted liposome in HepG2 cells in vitro. Anti-miR-221 Tf-targeted liposome effectively delivered anti-miR-221 to HepG2 cells, upregulated miR-221 target genes PTEN, P27kip1, and TIMP3, and exhibited greater silencing efficiency over nontargeted anti-miR-221 liposome. After intravenous injection into HepG2 tumor-bearing xenografted mice with Cy3-labeled anti-miR-221 Tf-targeted liposome, Cy3-anti-miR-221 was successfully delivered to the tumor site and increased the expressions of PTEN, P27kip1, and TIMP3. Our results demonstrate that the Tf-targeted negatively charged liposome could be a potential therapeutic modality in the gene therapy of human HCC. Keywords: transferrin, gene, HCC, target delivery system, anionic liposome 

  7. Advance research on microRNA-221,microRNA-222 and malignant tumor%microRNA-221和microRNA-222与恶性肿瘤的研究进展

    张春智; 康春生; 浦佩玉

    2009-01-01

    It has become clear that particular microRNAs(miRNAs) function either as tumor suppres-sors or oncogenes, whose loss or overexpression, respectively, has diagnostic and prognostic significance.Mi-croRNA-221 and microRNA-222 are a cluster microRNAs of oncogenes.They are overexpressed in some malig-nant tumors, including glioblstoma, prostate carcinoma, papillary thyroid carcinoma, and so on.By regulating particular target mRNAs, microRNA-221 and microRNA-222 perform pro- oneogenie role.p27kip1 and p57kip2 are target genes of microRNA-221 and mieroRNA-222.MicroRNA-221 and microRNA-222 promote oncogensis and tumor grow by down-regulating p27kip1 and p57kip2 expression.%微RNA(micmRNA)-221和microRNA-222是成簇的microRNA,在恶性肿瘤中起促癌作用,在胶质母细胞瘤、前列腺癌、乳头状甲状腺癌等恶性肿瘤中高表达.microRNA-221和microRNA-222通过调控其特定的靶基因行使促癌作用.在所有预测的靶基因中,p27kip1和p57kip2是已被验证的靶基因,microRNA-221和microRNA-222通过下调p27kip1和p57kip2的表达来促进肿瘤的形成和生长.

  8. Slug-upregulated miR-221 promotes breast cancer progression through suppressing E-cadherin expression.

    Pan, Yi; Li, Jing; Zhang, Yaqin; Wang, Nan; Liang, Hongwei; Liu, Yuan; Zhang, Chen-Yu; Zen, Ke; Gu, Hongwei

    2016-01-01

    It is generally regarded that E-cadherin is downregulated during tumorigenesis via Snail/Slug-mediated E-cadherin transcriptional reduction. However, this transcriptional suppressive mechanism cannot explain the failure of producing E-cadherin protein in metastatic breast cancer cells after overexpressing E-cadherin mRNA. Here we reveal a novel mechanism that E-cadherin is post-transcriptionally regulated by Slug-promoted miR-221, which serves as an additional blocker for E-cadherin expression in metastatic tumor cells. Profiling the predicted E-cadherin-targeting miRNAs in breast cancer tissues and cells showed that miR-221 was abundantly expressed in breast tumor and metastatic MDA-MB-231 cells and its level was significantly higher in breast tumor or MDA-MB-231 cells than in distal non-tumor tissue and low-metastatic MCF-7 cells, respectively. MiR-221, which level inversely correlated with E-cadherin level in breast cancer cells, targeted E-cadherin mRNA open reading frame (ORF) and suppressed E-cadherin protein expression. Depleting or increasing miR-221 level in breast cancer cells induced or decreased E-cadherin protein level, leading to suppressing or promoting tumor cell progression, respectively. Moreover, miR-221 was specifically upregulated by Slug but not Snail. TGF-β treatment enhanced Slug activity and thus increased miR-221 level in MCF-7 cells. In summary, our results provide the first evidence that Slug-upregulated miR-221 promotes breast cancer progression via reducing E-cadherin expression. PMID:27174021

  9. In vitro and in vivo activity of a novel locked nucleic acid (LNA-inhibitor-miR-221 against multiple myeloma cells.

    Maria Teresa Di Martino

    Full Text Available BACKGROUND & AIM: The miR-221/222 cluster is upregulated in malignant plasma cells from multiple myeloma (MM patients harboring the t(4;14 translocation. We previously reported that silencing of miR-221/222 by an antisense oligonucleotide induces anti-MM activity and upregulates canonical miR-221/222 targets. The in vivo anti-tumor activity occurred when miR-221/222 inhibitors were delivered directly into MM xenografts. The aim of the present study was to evaluate the anti-MM activity of a novel phosphorothioate modified backbone 13-mer locked nucleic acid (LNA-Inhibitor-miR-221 (LNA-i-miR-221 specifically designed for systemic delivery. METHODS: In vitro anti-MM activity of LNA-i-miR-221 was evaluated by cell proliferation and BrdU uptake assays. In vivo studies were performed with non-obese diabetic/severe combined immunodeficient (NOD.SCID mice bearing t(4;14 MM xenografts, which were intraperitoneally or intravenously treated with naked LNA-i-miR-221. RNA extracts from retrieved tumors were analyzed for miR-221 levels and modulation of canonical targets expression. H&E staining and immunohistochemistry were performed on retrieved tumors and mouse vital organs. RESULTS: In vitro, LNA-i-miR-221 exerted strong antagonistic activity against miR-221 and induced upregulation of the endogenous target p27Kip1. It had a marked anti-proliferative effect on t(4;14-translocated MM cells but not on MM cells not carrying the translocation and not overexpressing miR-221. In vivo, systemic treatment with LNA-i-miR-221 triggered significant anti-tumor activity against t(4;14 MM xenografts; it also induced miR-221 downregulation, upregulated p27Kip1 and reduced Ki-67. No behavioral changes or organ-related toxicity were observed in mice as a consequence of treatments. CONCLUSIONS: LNA-i-miR-221 is a highly stable, effective agent against t(4;14 MM cells, and is suitable for systemic use. These data provide the rationale for the clinical development of LNA

  10. Increased expression of microRNA-221 inhibits PAK1 in endothelial progenitor cells and impairs its function via c-Raf/MEK/ERK pathway

    Highlights: ► MicroRNA-221 is upregulated in the endothelial progenitor cells of atherosclerosis patients. ► PAK1 is a direct target of microRNA-221. ► MicroRNA-221 inhibits EPCs proliferation through c-Raf/MEK/ERK pathway. -- Abstract: Coronary artery disease (CAD) is associated with high mortality and occurs via endothelial injury. Endothelial progenitor cells (EPCs) restore the integrity of the endothelium and protect it from atherosclerosis. In this study, we compared the expression of microRNAs (miRNAs) in EPCs in atherosclerosis patients and normal controls. We found that miR-221 expression was significantly up-regulated in patients compared with controls. We predicted and identified p21/Cdc42/Rac1-activated kinase 1 (PAK1) as a novel target of miR-221 in EPCs. We also demonstrated that miR-221 targeted a putative binding site in the 3′UTR of PAK1, and absence of this site was inversely associated with miR-221 expression in EPCs. We confirmed this relationship using a luciferase reporter assay. Furthermore, overexpression of miR-221 in EPCs significantly decreased EPC proliferation, in accordance with the inhibitory effects induced by decreased PAK1. Overall, these findings demonstrate that miR-221 affects the MEK/ERK pathway by targeting PAK1 to inhibit the proliferation of EPCs

  11. Functional synergy of anti-mir221 and nanohydroxyapatite scaffold in bone tissue engineering of rat skull.

    Sadeghi, Mahya; Bakhshandeh, Behnaz; Dehghan, Mohammad Mehdi; Mehrnia, Mohammad Reza; Khojasteh, Arash

    2016-08-01

    An appropriate cell source, effective cell modification, and proper supportive matrices are the main bases of tissue engineering. The effectiveness of anti-mir221 or hydroxyapatite (HA) in improving the osteogenic differentiation of mesenchymal stem cells (MSCs) has been reported previously. Herein, simultaneous application of these osteogenic inducers was investigated in vivo. The Poly-caprolactone (PCL)/HA nanofibers were characterized using contact angle measurement, tensile test, Fourier transform infrared spectroscopy, and electron microscopy. Rat MSCs were isolated, characterized and transfected with anti-mir221. The rats were divided into 4 groups and an 8 mm defect were created in the mid-calvaria of each rat by trephine bur. Group 1 received (PCL)/HA nanofibers, group 2 received (PCL)/HA nanofibers plus autologous MSCs, group 3 received (PCL)/HA nanofibers plus MSCs transfected with anti-mir221, and group 4 rats were left empty as an additional control group. Histomorphometric and radiomorphometric evaluation after 4 and 8 weeks revealed more new bone formation in the cell-treated groups compared to the scaffold alone group. There was evidence for a combination of increased osteoclasts and osteoblast vascular lake containing red blood cells in the anti-mir221 transfected group. New bone penetration into the scaffolds empirically demonstrated the capability of this combination for efficient osteointegration. Altogether, the co-application of HA and anti-mir221 transfected cells can enhance bone healing of the rat skull. PMID:27412651

  12. Attachments for fire modeling for Building 221-T, T Plant canyon deck and railroad tunnel

    Oar, D.L. [Westinghouse Hanford Co., Richland, WA (United States)

    1995-01-23

    The purpose of this attachment is to provide historical information and documentation for Document No. WHC-SD-CP-ANAL-008 Rev 0, ``Fire Modeling for Building 221-T--T Plant Canyon Deck and Railroad Tunnel``, dated September 29, 1994. This data compilation contains the following: Resumes of the Technical Director, Senior Engineer and Junior Engineer; Review and Comment Record; Software Files; CFAST Input and Output Files; Calculation Control Sheets; and Estimating Sprinkler Actuation Time in the Canyon and Railroad Tunnel. The T Plant was originally a fuel reprocessing facility. It was modified later to decontaminate and repair PuRex process equipment.

  13. Report on sampling and analysis of exhaust air at the 221-T and 2706-T buildings

    Stauffer, M.

    1997-09-22

    This report presents analytical results from exhaust air samples collected at stacks 221-T and 2706-T of the T-Plant. The samples were collected with SUMMA canisters over a 24 hour interval and were analyzed by gas chromatography-mass spectrometry using a modified EPA TO-14 procedure. The data suggest that the buildings had generally low concentrations of volatile organic compounds (< 40 ppbv). However, samples from building 2706-T did have significant amounts of non-target higher-boiling hydrocarbons, probably from a petroleum destination fraction.

  14. Attachments for fire modeling for Building 221-T, T Plant canyon deck and railroad tunnel

    The purpose of this attachment is to provide historical information and documentation for Document No. WHC-SD-CP-ANAL-008 Rev 0, ''Fire Modeling for Building 221-T--T Plant Canyon Deck and Railroad Tunnel'', dated September 29, 1994. This data compilation contains the following: Resumes of the Technical Director, Senior Engineer and Junior Engineer; Review and Comment Record; Software Files; CFAST Input and Output Files; Calculation Control Sheets; and Estimating Sprinkler Actuation Time in the Canyon and Railroad Tunnel. The T Plant was originally a fuel reprocessing facility. It was modified later to decontaminate and repair PuRex process equipment

  15. Dual Selectivity Expressed in [2+2+1] Dynamic Clipping of Unsymmetrical [2]Catenanes

    Liu, Yi

    2010-06-11

    A {pi}-templated dynamic [2+2+1] clipping protocol is established for the synthesis of [2]catenanes from two parts dialdehyde, two parts diamine and one part tetracationic cyclophane. It is further diversified for the selective formation of an unsymmetrical [2]catenane showing great translational selectivity by employing two different dialdehydes in a one-pot reaction. The dual selectivity and the dynamic nature are verified by {sup 1}H NMR spectroscopy, X-ray single crystal structural studies and exchange experiments.

  16. A family with an inverted tandem duplication 5q22.1q23.2.

    Schmidt, T; Bartels, I; Liehr, T; Burfeind, P; Zoll, B; Shoukier, M

    2013-01-01

    Here, we report a 3-year-old boy with short stature, developmental delay and mild facial dysmorphic signs. Karyotype analysis and array-CGH revealed a pure duplication 5q22.1q23.2 with a length of 14.25 Mb. As demonstrated by multicolor-fluorescence in situ hybridization, the duplicated segment was orientated in an inverted tandem manner. One of the 2 older half-brothers of the index patient was intellectually disabled and showed short stature as well. The mother of the siblings was only 149 cm in height. The affected half-brother as well as the mother of the siblings were tested positive for the same duplication. Duplications of the long arm of chromosome 5 are rare. There are 16 reported cases of different 5q segments with a pure duplication and no additional chromosomal imbalance. In order to refine the 5q-duplication phenotype, reported cases were recently classified in 3 groups on the basis of clinical findings and the involved chromosome segments. However, our case does not fit in any of these groups but is placed in the interjacent chromosomal area between 2 of these groups. Overall, this is the second reported family with a duplication of 5q22.1q23.2 and both families share phenotypic features like short stature, facial dysmorphic signs and speech delay. The reported family provides further information for delineating phenotype-genotype correlations of pure duplications of the 5q region. PMID:23051634

  17. New Short-Lived Isotope ^{221}U and the Mass Surface Near N=126.

    Khuyagbaatar, J; Yakushev, A; Düllmann, Ch E; Ackermann, D; Andersson, L-L; Block, M; Brand, H; Cox, D M; Even, J; Forsberg, U; Golubev, P; Hartmann, W; Herzberg, R-D; Heßberger, F P; Hoffmann, J; Hübner, A; Jäger, E; Jeppsson, J; Kindler, B; Kratz, J V; Krier, J; Kurz, N; Lommel, B; Maiti, M; Minami, S; Mistry, A K; Mrosek, Ch M; Pysmenetska, I; Rudolph, D; Sarmiento, L G; Schaffner, H; Schädel, M; Schausten, B; Steiner, J; De Heidenreich, T Torres; Uusitalo, J; Wegrzecki, M; Wiehl, N; Yakusheva, V

    2015-12-11

    Two short-lived isotopes ^{221}U and ^{222}U were produced as evaporation residues in the fusion reaction ^{50}Ti+^{176}Yb at the gas-filled recoil separator TASCA. An α decay with an energy of E_{α}=9.31(5)  MeV and half-life T_{1/2}=4.7(7)  μs was attributed to ^{222}U. The new isotope ^{221}U was identified in α-decay chains starting with E_{α}=9.71(5)  MeV and T_{1/2}=0.66(14)  μs leading to known daughters. Synthesis and detection of these unstable heavy nuclei and their descendants were achieved thanks to a fast data readout system. The evolution of the N=126 shell closure and its influence on the stability of uranium isotopes are discussed within the framework of α-decay reduced width. PMID:26705628

  18. Preparation and Photo-thermal Isomerization of Azo [2.2.1]-and Azo[2.2.3]metacyclophane Tweezers

    Sawada, Tsuyoshi; Thiemann, Thies; Mataka, Shuntaro

    1999-01-01

    Azo[2.2.1]metacyclophane (MCP) tweezer 11 and azo[2.2.3]MCP tweezer 12 were prepared from [2.2.1]MCP 1a and [2.2.3]MCP 8, respectively, by ipso-nitration followed by reductive coupling using LiAlH_4. The photochemical and thermal isomerization of azo[2.2.n]MCP tweezers were studied by UV spectroscopy. The activation parameter (E_a) of the thermal cis-trans isomerization of 11 and 12 was determined as 81.7 kJmol^ and 90.9 kJmol^, respectively.

  19. The Inhibition of the Highly Expressed Mir-221 and Mir-222 Impairs the Growth of Prostate Carcinoma Xenografts in Mice

    Neri Mercatelli; Valeria Coppola; Desirée Bonci; Francesca Miele; Arianna Costantini; Marco Guadagnoli; Elena Bonanno; Giovanni Muto; Giovanni Vanni Frajese; Ruggero De Maria; Luigi Giusto Spagnoli; Maria Giulia Farace; Silvia Anna Ciafrè

    2008-01-01

    BACKGROUND: MiR-221 and miR-222 are two highly homologous microRNAs whose upregulation has been recently described in several types of human tumors, for some of which their oncogenic role was explained by the discovery of their target p27, a key cell cycle regulator. We previously showed this regulatory relationship in prostate carcinoma cell lines in vitro, underlying the role of miR-221/222 as inducers of proliferation and tumorigenicity. METHODOLOGY/PRINCIPAL FINDINGS: Here we describe a n...

  20. Elevation of miR-221 and -222 in the internal mammary arteries of diabetic subjects and normalization with metformin.

    Coleman, Chasity B; Lightell, Daniel J; Moss, Stephanie C; Bates, Michael; Parrino, Patrick E; Woods, T Cooper

    2013-07-15

    Diabetes is a major risk factor for cardiovascular disease and is associated with increased intimal thickening and accelerated vascular smooth muscle cell (VSMC) proliferation. We measured the expression of two microRNAs that promote intimal thickening, miR-221/222, and mRNA encoding a downstream target, p27(Kip1), in internal mammary artery (IMA) segments collected from 37 subjects undergoing coronary artery bypass grafting. The segments were stratified into three groups: non-diabetic subjects (ND), diabetic subjects not on metformin (DMMet-), and diabetic subjects on metformin (DMMet+). The DMMet- group exhibited a significant increase in miR-221/222 and decrease in p27(Kip1) mRNA compared to both the ND and DMMet+ groups. miR-221/222 levels inversely correlated with metformin dose. VSMCs isolated from the IMAs of the DMMet- group proliferate at a faster rate than those of the ND and DMMet+ groups. Further studies into the importance of miR-221/222 in the increased intimal thickening observed in diabetic subjects is warranted. PMID:23648338

  1. 12 CFR 221.114 - Bank loans to purchase stock of American Telephone and Telegraph Company under Employees' Stock...

    2010-01-01

    ... proposed to receive such stock as collateral for a “living expenses” loan that will be advanced to the... period would be substantially greater than the maximum loan value of the collateral as prescribed in § 221.7 (the Supplement). (d) In the opinion of the Board of Governors, a loan of the kind...

  2. A novel Xq22.1 deletion in a male with multiple congenital abnormalities and respiratory failure.

    Cao, Yang; Aypar, Umut

    2016-05-01

    Here we report the first male case of a novel Xq22.1 deletion. An 8-week-old boy with multiple congenital abnormalities and respiratory failure was referred to the Mayo Clinic Cytogenetics laboratory for testing. Chromosomal microarray analysis identified a novel 1.1 Mb deletion at Xq22.1. A similar deletion has only been described once in the literature in a female patient and her mother; both have intellectual disability and dysmorphic facial features. In addition, the mother had a son who died at 15 days due to breathing failure. Recently, a mouse model revealed that a 0.35 Mb sub-region, containing 4 genes, is sufficient to cause majority of the Xq22.1 deletion phenotypes. The deleted intervals in our male patient and the female patients contain 15 common genes, including the four described in the 0.35 Mb sub-region. Male mice with deletion of the 0.35 Mb sub-region died perinatally from respiratory failure due to pulmonary hypoplasia, consistent with the breathing problem and potential neonatal fatality in male patients. The phenotypes of the mouse models and the patients are strikingly similar; therefore, the deletion of these five genes (ARMCX5, ARMCX5-GPRASP2, GPRASP1, GPRASP2, and BHLHB9) is likely responsible for the novel Xq22.1 deletion syndrome. PMID:26995686

  3. Deliverable 2.2.1 Use Scenarios in the Pilot Services

    Peterson, Carrie Beth

    2010-01-01

    Deliverable 2.2.1 - Use scenarios in the pilot services During the first phase of ISISEMD project (WP1) the user requirements analysis phase, mainly D1.1.1, has proposed a list of services organized in three groups (bundles as in Dow) and classified as mandatory or not mandatory and leading to di...... how the services look like and shall work at runtime. The integration work is now in progress and during the next months the design, workflow, GUI etc. for each service will be fully integrated, tested and evaluated in cooperation with the regions according to the project plan...... and usage scenarios of service bundles to be implemented in the ISISEMD Pilot platform in each of the four regions during the pilot. The services/sub functions are presented as workflows and also described by presenting how the Graphical User Interface will be organized and designed thus reflecting...

  4. Development of Waste Acceptance Criteria at 221-U Building: Initial Flow and Transport Scoping Calculations

    Freedman, Vicky L.; Zhang, Z. F.; Keller, Jason M.; Chen, Yousu

    2007-05-30

    This report documents numerical flow and transport simulations performed that establish initial waste acceptance criteria for the potential waste streams that may be safely sequestered in the 221-U Building and similar canyon structures. Specifically, simulations were executed to identify the maximum loading of contaminant mass (without respect to volume) that can be emplaced within the 221-U Building with no more than 1 pCi/m2 of contaminant migrating outside the structure within a 1,000 year time period. The initial scoping simulations were executed in one dimension to assess important processes, and then two dimensions to establish waste acceptance criteria. Two monolithic conditions were assessed: (1) a grouted canyon monolith; and (2) a canyon monolith filled with sand, both assuming no cracks or fissures were present to cause preferential transport. A three-staged approach was taken to account for different processes that may impact the amount of contaminant that can be safely sequestered in canyon structure. In the first stage, flow and transport simulations established waste acceptance criteria based on a linear (Kd) isotherm approach. In the second stage, impacts on thermal loading were examined and the differences in waste acceptance criteria quantified. In the third stage of modeling, precipitation/dissolution reactions were considered on the release and transport of the contaminants, and the subsequent impact on the maximum contaminant loading. The reactive transport modeling is considered a demonstration of the reactive transport capability, and shows the importance of its use for future performance predictions once site-specific data have been obtained.

  5. Circulating miR-221-3p as a novel marker for early prediction of acute myocardial infarction.

    Coskunpinar, Ender; Cakmak, Huseyin Altug; Kalkan, Ali Kemal; Tiryakioglu, Necip Ozan; Erturk, Mehmet; Ongen, Zeki

    2016-10-10

    Recent studies have reported circulating microRNAs (miRNAs) as novel biomarkers for cardiovascular diseases including acute myocardial infarction, heart failure, diabetes mellitus, stroke, and acute pulmonary embolism. The aims of this study were 1) to compare the plasma expression levels of miRNAs in patients with acute coronary syndrome (ACS) and control subjects and in ST-elevation myocardial infarction (STEMI) and non-STEMI 2) to evaluate miRNAs potential to be used as novel diagnostic biomarkers for ACS. Twenty seven consecutive patients, admitted to emergency department of a training and research hospital between January-December 2013 with acute chest pain and/or dyspnea and diagnosed with ACS, and 16 non-ACS control subjects were included in this study. miRNA profiling was performed by using real time polymerase chain reaction. Functions of dysregulated miRNAs were evaluated by computerized-pathways analysis. miR-221-3p was one of the two most dysregulated miRNAs with a fold regulation of 3.89. It was significantly positively correlated with both Troponin and GRACE and Synthax Score. Moreover, miR221-3p was found to be significantly inversely correlated with left ventricular ejection fraction. miR-221-3p was the most prominent biomarker candidate with an area under curve (AUC) level of 0.881 (95% confidence interval: 0.774-0.987; p=0.002). The present study is the first to report an increased expression levels of miR-221-3p in AMI. Since miR-221-3p has a high discriminative value and significant relations with Troponin, GRACE and Synthax score and left ventricular systolic function, it may be a potential biomarker for early prediction of AMI. PMID:27374153

  6. Down-regulation of MicroRNAs 222/221 in Acute Myelogenous Leukemia with Deranged Core-Binding Factor Subunits

    Matteo Brioschi

    2010-11-01

    Full Text Available Core-binding factor leukemia (CBFL is a subgroup of acutemyeloid leukemia (AML characterized by genetic mutations involving the subunits of the core-binding factor (CBF. The leukemogenesis model for CBFL posits that one, or more, gene mutations inducing increased cell proliferation and/or inhibition of apoptosis cooperate with CBF mutations for leukemia development. One of the most commonmutations associated with CBF mutations involves the KIT receptor. A high expression of KIT is a hallmark of a high proportion of CBFL. Previous studies indicate that microRNA (MIR 222/221 targets the 3′ untranslated region of the KIT messenger RNA and our observation that AML1 can bind the MIR-222/221 promoter, we hypothesized that MIR-222/221 represents the link between CBF and KIT. Here, we show that MIR-222/221 expression is upregulated after myeloid differentiation of normal bone marrow AC133+ stem progenitor cells. CBFL blasts with either t(8;21 or inv(16 CBF rearrangements with high expression levels of KIT (CD117 display a significantly lower level of MIR-222/221 expression than non-CBFL blasts. Consistently, we found that the t(8;21 AML1-MTG8 fusion protein binds the MIR-222/221 promoter and induces transcriptional repression of a MIR-222/221-LUC reporter. Because of the highly conserved sequence homology, we demonstrated concomitant MIR-222/221 down-regulation and KIT up-regulation in the 32D/WT1 mouse cell model carrying the AML1-MTG16 fusion protein. This study provides the first hint that CBFL-associated fusion proteins may lead to up-regulation of the KIT receptor by down-regulating MIR-222/221, thus explaining the concomitant occurrence of CBF genetic rearrangements and overexpression of wild type or mutant KIT in AML.

  7. Simultaneous detection and differentiation by multiplex real time RT-PCR of highly pathogenic avian influenza subtype H5N1 classic (clade 2.2.1 proper and escape mutant (clade 2.2.1 variant lineages in Egypt

    Arafa Abdel-Satar

    2010-10-01

    Full Text Available Abstract Background The endemic status of highly pathogenic avian influenza virus (HPAIV of subtype H5N1 in Egypt continues to devastate the local poultry industry and poses a permanent threat for human health. Several genetically and antigenically distinct H5N1 lineages co-circulate in Egypt: Strains of clade 2.2.1 proper replicate mainly in backyard birds causing the bulk of human infections, while a variant lineage within 2.2.1 (2.2.1v appears to be perpetuated mainly in commercial poultry farms in Egypt. Viruses of the 2.2.1v lineage represent drift variants escaping from conventional vaccine-induced immunity and some of these strains also escaped detection by commercial real time reverse transcriptase PCR (RT-qPCR protocols due to mismatches in the primers/probe binding sites. Results We developed therefore a versatile, sensitive and lineage-specific multiplex RT-qPCR for detection and typing of H5N1 viruses in Egypt. Analytical characterization was carried out using 50 Egyptian HPAIV H5N1 strains isolated since 2006 and 45 other avian influenza viruses (AIV. A detection limit of 400 cRNA copies per ml sample matrix was found. Higher diagnostic sensitivity of the multiplex assay in comparison to other generic H5 or M-gene based RT-qPCR assays were found by examination of 63 swab samples from experimentally infected chickens and 50 AIV-positive swab samples from different host species in the field in Egypt. Conclusions The new multiplex RT-qPCR assay could be useful for rapid high-throughput monitoring for the presence of HPAIV H5N1 in commercial poultry in Egypt. It may also aid in prospective epidemiological studies to further delineate and better control spread of HPAIV H5N1 in Egypt.

  8. De Novo Balanced Translocation t (7;16 (p22.1; p11.2 Associated with Autistic Disorder

    Nadia Bayou

    2008-01-01

    Full Text Available The high incidence of de novo chromosomal aberrations in a population of persons with autism suggests a causal relationship between certain chromosomal aberrations and the occurrence of isolated idiopathic autism. We report on the clinical and cytogenetic findings in a male patient with autism, no physical abnormalities and a de novo balanced (7;16(p22.1;p16.2 translocation. G-banded chromosomes and fluorescent in situ hybridization (FISH were used to examine the patient's karyotype as well as his parents'. FISH with specific RP11-BAC clones mapping near 7p22.1 and 16p11.2 was used to refine the location of the breakpoints. This is, in the best of our knowledge, the first report of an individual with autism and this specific chromosomal aberration.

  9. De Novo Balanced Translocation t (7;16) (p22.1; p11.2) Associated with Autistic Disorder

    Nadia Bayou; Ridha M'rad; Ahlem Belhaj; Hussein Daoud; Lamia Ben Jemaa; Ramzi Zemni; Sylvain Briault; M. Bechir Helayem; Habiba Chaabouni

    2008-01-01

    The high incidence of de novo chromosomal aberrations in a population of persons with autism suggests a causal relationship between certain chromosomal aberrations and the occurrence of isolated idiopathic autism. We report on the clinical and cytogenetic findings in a male patient with autism, no physical abnormalities and a de novo balanced (7;16)(p22.1;p16.2) translocation. G-banded chromosomes and fluorescent in situ hybridization (FISH) were used to examine the patient's karyotype as wel...

  10. NIEZAWIADOMIENIE O WYPADKU PRZY PRACY LUB CHOROBIE ZAWODOWEJ (PRZESTĘPSTWO Z ART. 221 K.K.)

    Jachimowicz, Marcin

    2003-01-01

    The crime described under Article 221 of the Criminal Code has been introduced to the Polish Criminal Law for the first time by the Criminal Code of 1997. Before that, this act was prosecuted under Article 283 § 6 section 6 of the Labor Code. This crime primarily covers failure to notify the relevant institution of a mishap at workplace or professional illness, or failure to submit appropriate documentation of such event. The paper begins with the analysis of the rights protect...

  11. Investigation of $\\alpha$-decay rates of $^{221}$Fr, $^{224}$Ra and $^{226}$Ra in different environments

    2007-01-01

    It has recently been suggested, and indicated experimentally, that $\\alpha$- decay half-lives are modified by solid state effects in the surrounding environment. We propose here to measure with high accuracy the $\\alpha$-decay half-life of $^{221}$Fr, $^{224}$Ra and $^{226}$Ra in insulators and metals. Furthermore we plan to investigate the temperature dependency of the half-life in these materials (room temperature, 4 K and 10 mK).

  12. Overexpression of miR-221 in peripheral blood lymphocytes in petrol station attendants: A population based cross-sectional study in southern China.

    Hu, Dalin; Peng, Xiaowu; Liu, Yungang; Zhang, Wenjuan; Peng, Xiaochun; Tang, Huanwen; Yuan, Jianhui; Zhu, Zhiliang; Yang, Jianping

    2016-04-01

    Benzene is a recognized environmental leukemogen, however, the mechanisms for its carcinogenesis have not been fully elucidated. Recently, miR-221, a suggested oncogene involved in a number of malignancies, has been detected with elevated expression levels in blood cells of patients with leukemia. To explore whether benzene exposure has an effect on the expression of miR-221, a population based cross-sectional study was conducted in southern China, with 97 petrol station attendants as the exposure group and 103 general residents as the control group. Plasma benzene was analyzed by using GC∖MS. miR-221 in peripheral blood lymphocytes were measured by qRT-PCR and the ΔCt value for each sample was calculated by normalizing the Ct value for miR-221 with U6 RNA (i.e., ΔCt = CtmiR-221 - CtU6). Potential confounding factors were taken into account. Pearson correlation, univariate and multivariate logistic regression were performed in statistical analysis. The results showed that the air concentrations of benzene were significantly higher in petrol stations than in control sites (P < 0.05); The levels of benzene and miR-221 in exposure group were both significantly higher than in control group (P < 0.05) and there was a significant positive correlation between the two indexes (r = 0.851, P < 0.05); An association between benzene levels and the ΔCt values for miR-221 was identified by univariate and multivariate logistic analysis (OR 0.274; 95%CI 0.117, 0.396). Our investigation indicates that benzene exposure may be related to elevated miR-221 expression in human lymphocytes. PMID:26841344

  13. INSULIN RESISTANCE AND CAROTID ATHEROSCLEROSIS IN 221 PATIENTS WITH POTENTIAL HYPERGLYCEMIA

    Bo Yang; Tian-de Li; Jin-song Wang; Guang Zhi; Wen-sheng Jin; Yong Xu

    2005-01-01

    Objective To investigate the relationship between insulin resistance and carotid atherosclerosis in patients with potential hyperglycemia.Methods A total of 221 patients were recruited among those with potential hyperglycemia. All participants underwent physical examination, medical history interview, and 75 g oral glucose tolerance test. Venous blood was sampled for measurement of insulin and cholesterol levels. The intima-media thickness (IMT) in bilateral common carotid arteries was observed by B-mode ultrasound. Insulin resistance index was calculated by homeostasis model assessment (HOMA-IR).Subjects were stratified in quintiles according to HOMA-IR values. Risk factors and atherosclerotic parameters were analyzed.Results With HOMA-IR value increase, incidence of impaired glucose tolerance, diabetes mellitus, hypertension, and coronary artery disease increased, the levels of triglyceride (TG), low density lipoprotein cholesterol (LDL-C), fasting plasma glucose, 2 hour plasma glucose, and fasting insulin increased as well, while the level of high density lipoprotein cholesterol (HDL-C) decreased. Meanwhile, all atherosclerotic parameters increased. Multivariate regression analysis showed that TG, total cholesterol, HDL-C, LDL-C levels, and In(HOMA-IR) were related to IMT, hence were risk factors for IMT increase.Conchsion Insulin resistance is implicated in atherogenesis.

  14. MiR-221-inhibited adipose tissue-derived mesenchymal stem cells bioengineered in a nano-hydroxy apatite scaffold.

    Hoseinzadeh, Saghar; Atashi, Amir; Soleimani, Masoud; Alizadeh, Effat; Zarghami, Nosratollah

    2016-04-01

    The repair of skeletal defects is the main goal of bone tissue engineering. Recent literature highlighted various regulatory roles of microRNAs in stem cell fate determination. In addition, the role of porous hydroxyapatite/polycaprolacton (nHA/PCL) as a bioactive scaffold which enhances adipose tissue-derived mesenchymal stem cells (AT-MSCs) growth and osteogenic differentiation has been proved. The aim of the present study was to investigate the synergistic potential of both down-regulating miR-221 and nHA/PCL scaffold seeding in osteogenic potential of AT-MSCs. After isolation and characterization of AT-MSCs, the transfection of anti-miR-221 was performed into the cells using lipofectamine 2000 and the transfected cells were seeded into a synthesized nHA/PCL scaffold. The DAPI staining confirmed the presence of AT-MSCs on nHA/PCL scaffold. Quantitative expression of osteoblast marker genes, Runx2, and osteocalcin of the transfected cells in the scaffold were evaluated. Interestingly, significant upregulation of transcribed Runx2 and osteocalcin genes (P PCL seeded cells. Also, alkaline phosphatase activity (ALP) was significantly higher (P PCL than those seeded on nHA/PCL or transfected with anti-miR-221, individually. The results of this combination suggest a valuable method for enhancing osteogenesis in AT-MSCs. This method could be applicable for gene-cell therapy of bone defects. PMID:26822432

  15. Establishment and characterization of a new human myxoid liposarcoma cell line (DL-221) with the FUS-DDIT3 translocation.

    de Graaff, Marieke A; Yu, Jamie S E; Beird, Hannah C; Ingram, Davis R; Nguyen, Theresa; Juehui Liu, Jeffrey; Bolshakov, Svetlana; Szuhai, Károly; Åman, Pierre; Torres, Keila E; Lev, Dina; Nielsen, Torsten O; Bovée, Judith V M G; Lazar, Alexander J; Somaiah, Neeta

    2016-08-01

    Myxoid liposarcoma has the pathognomonic fusion oncogene FUS-DDIT3 encoding a chimeric transcription factor. Metastatic risk is higher with an increased round cell component and has been linked to aberrations involving the IGFR/PI3K/AKT pathway. These molecular insights have yet to translate to targeted therapies, and the lack of experimental models is a major hindrance. We describe the initial in-depth characterization of a new cell line (DL-221) and establishment of a mouse xenograft model. The cell line DL-221 was derived from a metastatic pleural lesion showing myxoid and round cell histology. This newly established cell line was characterized for phenotypic properties and molecular cytogenetic profile, using PCR, COBRA-FISH, and western blot. Next-generation whole-exome sequencing was performed to further characterize the cell line and the parent tumor. NOD-SCID-IL2R gamma knockout mice were xenograft hosts. DL-221 cells grew an adhering monolayer and COBRA-FISH showed an aneuploid karyotype with t(12;16)(q13;p11) and several other rearrangements; RT-PCR demonstrated a FUS-DDIT3 fusion transcript type 1. Both the cell line and the original tumor harbored a TP53 compound heterozygous mutation in exon 4 and 7, and were wild-type for PIK3CA. Moreover, among the 1254 variants called by whole-exome sequencing, there was 77% concordance between the cell line and parent tumor. The recently described hotspot mutation in the TERT promoter region in myxoid liposarcomas was also found at C228T in DL-221. Xenografts suitable for additional preclinical studies were successfully established in mice after subcutaneous injection. The established DL-221 cell line is the only published available myxoid liposarcoma cell line that underwent spontaneous immortalization, without requiring SV40 transformation. The cell line and its xenograft model are unique and helpful tools to study the biology and novel potential-targeted treatment approaches for myxoid liposarcoma. PMID:27270875

  16. The inhibition of the highly expressed miR-221 and miR-222 impairs the growth of prostate carcinoma xenografts in mice.

    Neri Mercatelli

    Full Text Available BACKGROUND: MiR-221 and miR-222 are two highly homologous microRNAs whose upregulation has been recently described in several types of human tumors, for some of which their oncogenic role was explained by the discovery of their target p27, a key cell cycle regulator. We previously showed this regulatory relationship in prostate carcinoma cell lines in vitro, underlying the role of miR-221/222 as inducers of proliferation and tumorigenicity. METHODOLOGY/PRINCIPAL FINDINGS: Here we describe a number of in vivo approaches confirming our previous data. The ectopic overexpression of miR-221 is able, per se, to confer a high growth advantage to LNCaP-derived tumors in SCID mice. Consistently, the anti-miR-221/222 antagomir treatment of established subcutaneous tumors derived from the highly aggressive PC3 cell line, naturally expressing high levels of miR-221/222, reduces tumor growth by increasing intratumoral p27 amount; this effect is long lasting, as it is detectable as long as 25 days after the treatment. Furthermore, we provide evidence in favour of a clinical relevance of the role of miR-221/222 in prostate carcinoma, by showing their general upregulation in patient-derived primary cell lines, where we find a significant inverse correlation with p27 expression. CONCLUSIONS/SIGNIFICANCE: These findings suggest that modulating miR-221/222 levels may have a therapeutic potential in prostate carcinoma.

  17. Synthesis, crystal structure and reactivity of (μ3-η2-7-oxabicyclo[2.2.1]hept-5-yn-2-one) nonacarbonyldihydridotriruthenium and (μ3-η2-7-oxabicyclo[2.2.1]hept-5-yn-2-one) hexacarbonyldihydridotris(triphenylphosphine)triruthenium

    The thermal reaction of Ru3(CO)12 with 7-oxabicyclo[2.2.1]hept-2-ene systems give ruthenium complexes. Single crystal diffraction studies are reported. Preliminary studies on the reactivity of these new clusters are described

  18. Regulation of the p27Kip1 tumor suppressor by miR-221 and miR-222 promotes cancer cell proliferation

    le Sage, Carlos; Nagel, Remco; Egan, David A; Schrier, Mariette; Mesman, Elly; Mangiola, Annunziato; Anile, Corrado; Maira, Giulio; Mercatelli, Neri; Ciafrè, Silvia Anna; Farace, Maria Giulia; Agami, Reuven

    2007-01-01

    MicroRNAs (miRNAs) are potent post-transcriptional regulators of protein coding genes. Patterns of misexpression of miRNAs in cancer suggest key functions of miRNAs in tumorigenesis. However, current bioinformatics tools do not entirely support the identification and characterization of the mode of action of such miRNAs. Here, we used a novel functional genetic approach and identified miR-221 and miR-222 (miR-221&222) as potent regulators of p27Kip1, a cell cycle inhibitor and tumor suppressor. Using miRNA inhibitors, we demonstrate that certain cancer cell lines require high activity of miR-221&222 to maintain low p27Kip1 levels and continuous proliferation. Interestingly, high levels of miR-221&222 appear in glioblastomas and correlate with low levels of p27Kip1 protein. Thus, deregulated expression of miR-221&222 promotes cancerous growth by inhibiting the expression of p27Kip1. PMID:17627278

  19. Knockdown of miR-221 promotes the cisplatin-inducing apoptosis by targeting the BIM-Bax/Bak axis in breast cancer.

    Ye, Zhiqiang; Hao, Rutian; Cai, Yefeng; Wang, Xiaobo; Huang, Guanli

    2016-04-01

    Accumulating evidence shows that microRNAs (miRNAs) have a critical role in the initiation and progression of types of human cancer, including breast cancer. Recent research indicated that miRNAs are also related with the chemotherapy on cancers. In this study, the expression of miR-221 in breast cancer (BC) patients' serum and cancer tissues was found to be significantly up-regulated. The results of in vitro MTT assay indicated that although the anti-miR-221 oligonucleotide alone did not influence the viability of BC cell lines markedly, it significantly promoted the cytotoxicity of cisplatin (DDP) to BC cells. Mechanistic studies demonstrated that the gene of BIM (Bcl-2 interacting mediator of cell death), a pro-apoptotic Bcl-2 family protein, was up-regulated by the knockdown of miR-221. We found that the synergetic effect of anti-miR-221 on increasing the sensitivity of MDA-MB-231 was BIM dependant. Furthermore, results of immunoprecipitation showed the up-regulated BIM directly combined with the Bax and Bak, leading to mitochondrial dysfunction. Our results suggest the anti-miR-221 could promote the cisplatin-inducing apoptosis by targeting the Bim-Bax/Bak axis in breast cancer. PMID:26503209

  20. Towards the Secrecy Capacity of the Gaussian MIMO Wire-tap Channel: The 2-2-1 Channel

    Shafiee, Shabnam; Ulukus, Sennur

    2007-01-01

    We find the secrecy capacity of the 2-2-1 Gaussian MIMO wire-tap channel, which consists of a transmitter and a receiver with two antennas each, and an eavesdropper with a single antenna. We determine the secrecy capacity of this channel by proposing an achievable scheme and then developing a tight upper bound that meets the proposed achievable secrecy rate. We show that, for this channel, Gaussian signalling in the form of beam-forming is optimal, and no pre-processing of information is necessary.

  1. Immunomodulatory effect of halophilic lactic acid bacterium Tetragenococcus halophilus Th221 from soy sauce moromi grown in high-salt medium.

    Masuda, Susumu; Yamaguchi, Hitomi; Kurokawa, Toshiko; Shirakami, Tomoyuki; Tsuji, Ryohei F; Nishimura, Ikuko

    2008-02-10

    A halophilic lactic acid bacterium, Tetragenococcus halophilus, was found to possess an immunomodulatory activity that promotes T helper type 1 (Th1) immunity in addition to its important roles in soy sauce brewing. Strain Th221 was selected from 151 strains isolated from soy sauce (shoyu) moromi, since it induced strong interleukin (IL)-12 production by mouse peritoneal macrophages in vitro. The relationship between the salt concentration in the medium and the IL-12 production-inducing activity of this strain was investigated, and the activity was found to be strong when the bacteria were grown in medium containing > or =10% (w/v) salt. The Th1-promoting activity was also manifested in an in vivo mouse study, since Th1-dependant contact sensitivity was augmented and Th2 immunity, as evaluated by specific immunoglobulin E production, was suppressed following oral ingestion of Th221. Based on these findings, Th221 administration may be useful for improving allergic symptoms. PMID:18061297

  2. MiR-221 promotes the development of androgen independence in prostate cancer cells via downregulation of HECTD2 and RAB1A

    Sun, T; Wang, X; He, HH; Sweeney, CJ; Liu, SX; Brown, M.; Balk, S.; Lee, G-SM; Kantoff, PW

    2013-01-01

    Hormone-sensitive prostate cancer typically progresses to castration resistant prostate cancer (CRPC) after the androgen deprivation therapy. We investigated the impact of microRNAs (miRs) in the transition of prostate cancer to CRPC. MiR-221/-222 was highly expressed in bone metastatic CRPC tumor specimens. We previously demonstrated that transient overexpression of miR-221/-222 in LNCaP promoted the development of the CRPC phenotype. In current study, we show that stably overexpressing miR-...

  3. miR-221/222 targets adiponectin receptor 1 to promote the epithelial-to-mesenchymal transition in breast cancer.

    Michael S Hwang

    Full Text Available The epithelial-to-mesenchymal transition (EMT is a highly conserved physiological program involved in development and tissue repair; however, its aberrant activation has been implicated in accelerating the progression of a variety of cancers. In breast cancer, the microRNAs (miRNAs miR-221 and miR-222 (miR-221/222 are differentially expressed in the clinically more aggressive basal-like subtype compared to luminal subtype of breast cancer and upregulation of miR-221/222 induces the EMT by targeting the 3' untranslated region (3'UTR of the GATA family transcriptional repressor TRPS1 (tricho-rhino-phalangeal syndrome type 1. The complete mechanism through which miR-221/222 promotes the EMT, however, is not fully understood. We identified adiponectin receptor 1 (ADIPOR1, a receptor for the adipocytokine adiponectin, as a direct target of miR-221/222. ADIPOR1 is expressed at higher levels in the luminal compared to the basal-like subtype of breast cancer cell lines, which can be reduced by miR-221/222 targeting of its 3'UTR. In addition, miR-221/222 were negatively correlated with ADIPOR1 expression across breast cancer cell lines and tumors. ADIPOR1 depletion by siRNA in MCF10A cells induced the EMT and increased cell invasion. Depletion of ADIPOR1 by siRNA induced activation of the canonical nuclear factor-kappaB (NF-κB and subsequent phosphorylation of signal transducer and activator of transcription 3 (STAT3 in an interleukin 6 (IL6-dependent manner. Finally, overexpression of ADIPOR1 in the basal-like cell line, MDA-MB-231, attenuated cell invasion and promoted the mesenchymal-to-epithelial transition (MET. We conclude that ADIPOR1 negatively regulates EMT in breast cancer and provides an additional node by which miR-221/222 induces the EMT. These results suggest that ADIPOR1 may play an important role in breast cancer progression and metastasis, and could potentially offer an alternative therapeutic strategy for basal-like breast cancer

  4. Regulation of the p27Kip1 tumor suppressor by miR-221 and miR-222 promotes cancer cell proliferation

    le Sage, Carlos; Nagel, Remco; Egan, David A.; Schrier, Mariette; Mesman, Elly; Mangiola, Annunziato; Anile, Corrado; Maira, Giulio; Mercatelli, Neri; Ciafrè, Silvia Anna; Farace, Maria Giulia; Agami, Reuven

    2007-01-01

    MicroRNAs (miRNAs) are potent post-transcriptional regulators of protein coding genes. Patterns of misexpression of miRNAs in cancer suggest key functions of miRNAs in tumorigenesis. However, current bioinformatics tools do not entirely support the identification and characterization of the mode of action of such miRNAs. Here, we used a novel functional genetic approach and identified miR-221 and miR-222 (miR-221&222) as potent regulators of p27Kip1, a cell cycle inhibitor and tumor suppresso...

  5. Up-regulation of miRNA-221 inhibits hypoxia/reoxygenation-induced autophagy through the DDIT4/mTORC1 and Tp53inp1/p62 pathways.

    Chen, Qiying; Zhou, Yue; Richards, A Mark; Wang, Peipei

    2016-05-20

    Timely reperfusion in acute myocardial infarction has improved clinical outcomes but the benefits are partially offset by ischemia-reperfusion injury (I/R). MiRNA regulates mRNA of multiple effectors within injury and survival cell signaling pathways. We have previously reported the protective effects of miRNA-221 in I/R injury. The purpose of this study was to explore the mechanisms underlying cardioprotection of miR-221. Myoblast H9c2 and neonatal rat ventricular myocytes (NRVM) were subjected to 0.2% O2 hypoxia followed by 2 h of re-oxygenation (H/R). In gain-and-loss function studies through transfections of miR-221 mimic (miR-221) and inhibitor (miR-221-i), the protective effects of miR-221 were confirmed as assessed by increased cell metabolic activity (WST-1) and decreased LDH release. Autophagy was assessed by GFP-LC3 labeling of autophagosome formation, LC3 and p62 measurements. Co-immuno-precipitation and specific gene cloning and function were used to identify the pathways underpinning miR-221 effects. MiR-221 significantly reduced H/R injury in association with inhibition of autophagy. Underlying mechanisms include (1) down-regulation of Ddit4 (disinhibiting the mTORC1/p-4EBP1 pathway) which inhibits autophagosome formation (2) down-regulation of Tp53inp1 (with reduced Tp53inp1/p62 complex formation) which inhibits autophagosome degradation. In conclusion, miRNA-221 exerts cytoprotective effects in hypoxia-reoxygenation injury in association with alterations in autophagic cell injury. Mir-221 may constitute is a novel therapeutic target in the treatment of cardiac I/R injury. PMID:27105917

  6. MiR-221 and -222-based therapeutic approach in melanoma and GIST (Gastrointestinal Stromal Tumor): in vitro and in vivo preclinical studies

    Micro RNAs (miRs) are small (∼22 nucleotides) non coding RNAs involved in gene expression, as negative regulators of specific mRNA targets. Growing evidences indicated miR functional roles in all the main biological processes, including cancer where they can act as oncogenes as well as tumor suppressor genes. Several studies reported the involvement of miR- 221 and -222 in the induction and/or progression of different neoplasias. We have analyzed miR-221/-222 functional role in a panel of differently staged melanoma cell lines and primary bioptic samples, showing their capabilities to regulate two distinct, but functionally convergent pathways of melanocyte transformation through the cell cycle inhibitor p27Kip and c-kit receptor. We also demonstrated the lack of the tumor suppressor gene PLZF as a direct cause of miR-221/-222 up regulation in melanoma cells. In vitro and, more important, in vivo studies confirmed that suppression of miR-221/-222 strongly reduced melanoma growth and dissemination

  7. A map of nuclear matrix attachment regions within the breast cancer loss-of-heterozygosity region on human chromosome 16q22.1

    Shaposhnikov, Sergey A.; Akopov, Sergey B.; Chernov, Igor P.;

    2007-01-01

    There is abundant evidence that the DNA in eukaryotic cells is organized into loop domains that represent basic structural and functional units of chromatin packaging. To explore the DNA domain organization of the breast cancer loss-of-heterozygosity region on human chromosome 16q22.1, we have id...

  8. Role of gga-miR-221 and gga-miR-222 during Tumour Formation in Chickens Infected by Subgroup J Avian Leukosis Virus

    Zhenkai Dai

    2015-12-01

    Full Text Available Subgroup J avian leukosis virus (ALV-J causes a neoplastic disease in infected chickens. Differential expression patterns of microRNAs (miRNAs are closely related to the formation and growth of tumors. (1 Background: This study was undertaken to understand how miRNAs might be related to tumor growth during ALV-J infection. We chose to characterize the effects of miR-221 and miR-222 on cell proliferation, migration, and apoptosis based on previous microarray data. (2 Methods: In vivo, the expression levels of miR-221 and miR-222 were significantly increased in the liver of ALV-J infected chickens (p < 0.01. Over-expression of gga-miR-221 and gga-miR-222 promoted the proliferation, migration, and growth of DF-1 cells, and decreased the expression of BCL-2 modifying factor (BMF making cells more resistant to apoptosis. (3 Results: Our results suggest that gga-miR-221 and gga-miR-222 may be tumour formation relevant gene in chicken that promote proliferation, migration, and growth of cancer cells, and inhibit apoptosis. BMF expression was significantly reduced in vivo 70 days after ALV-J infection. They may also play a pivotal role in tumorigenesis during ALV-J infection.

  9. Role of gga-miR-221 and gga-miR-222 during Tumour Formation in Chickens Infected by Subgroup J Avian Leukosis Virus.

    Dai, Zhenkai; Ji, Jun; Yan, Yiming; Lin, Wencheng; Li, Hongxin; Chen, Feng; Liu, Yang; Chen, Weiguo; Bi, Yingzuo; Xie, Qingmei

    2015-12-01

    Subgroup J avian leukosis virus (ALV-J) causes a neoplastic disease in infected chickens. Differential expression patterns of microRNAs (miRNAs) are closely related to the formation and growth of tumors. (1) BACKGROUND: This study was undertaken to understand how miRNAs might be related to tumor growth during ALV-J infection. We chose to characterize the effects of miR-221 and miR-222 on cell proliferation, migration, and apoptosis based on previous microarray data. (2) METHODS: In vivo, the expression levels of miR-221 and miR-222 were significantly increased in the liver of ALV-J infected chickens (p < 0.01). Over-expression of gga-miR-221 and gga-miR-222 promoted the proliferation, migration, and growth of DF-1 cells, and decreased the expression of BCL-2 modifying factor (BMF) making cells more resistant to apoptosis. (3) RESULTS: Our results suggest that gga-miR-221 and gga-miR-222 may be tumour formation relevant gene in chicken that promote proliferation, migration, and growth of cancer cells, and inhibit apoptosis. BMF expression was significantly reduced in vivo 70 days after ALV-J infection. They may also play a pivotal role in tumorigenesis during ALV-J infection. PMID:26690468

  10. Optimisation of cheese whey enzymatic hydrolysis and further continuous production of antimicrobial extracts by Lactobacillus plantarum CECT-221.

    Rodríguez-Pazo, Noelia; da Silva Sabo, Sabrina; Salgado-Seara, José Manuel; Arni, Saleh Al; de Souza Oliveira, Ricardo Pinheiro; Domínguez, José Manuel

    2016-08-01

    The enzymatic hydrolysis of cheese whey was optimised using the enzymes iZyme, Alcalase or Flavourzyme under different conditions. Hydrolysates supplemented with commercial nutrients were evaluated as fermentation broths to produce DL-3-Phenyllactic acid (PLA) from phenylalanine (Phe) by Lactobacillus plantarum CECT-221. Optimised hydrolysates were obtained using Flavourzyme at 50 °C and 100 rpm during 12 h, and assayed in 250 ml Erlenemyer flasks using different proportions of vinasses as economic nutrient. The process was then scaled up using a 2 litres Bioreactor working under the continuous modality. Under the intermediate dilution rate of 0·0207 h-1 0·81 ± 0·026 mM of PLA and 38·8 ± 3·253 g/l of lactic acid were produced. A final evaluation revealed that lactic acid, and bacteriocins exerted the highest inhibitory effect among the extracted components of cell-free supernatants. PMID:27600978

  11. Simulation of Microstructure Evolution of Ni75A12.9V22.1 Alloy with Progressive Aging Mechanisms

    Yongsheng LI; Zheng CHEN; Qingbo LAI; Yongxin WANG

    2008-01-01

    The interrupted aging mechanisms were applied to Ni75Al2.9V22.1 alloy by using the microscopic phase-field simulation method. For the single phase region existing at high temperature, the low content alloy was used as the study object. With the progressive aging mechanisms, the metastable phase γ' of high temperature can be obtained from the low temperature two phase regions, and the quantity of γ' phase reduces with increasing temperature. The θ single phase morphology at high temperature regions will turn to be the γ'+θ two phase morphology at low temperature with the interrupted aging method. Despite of the different precipitation paths of γ' phase, the precipitation mechanisms are the same for the low temperature aging and high temperature interrupted aging.

  12. Cardiomyocyte protection by GATA-4 gene engineered mesenchymal stem cells is partially mediated by translocation of miR-221 in microvesicles.

    Bin Yu

    Full Text Available INTRODUCTION: microRNAs (miRs, a novel class of small non-coding RNAs, are involved in cell proliferation, differentiation, development, and death. In this study, we found that miR-221 translocation by microvesicles (MVs plays an important role in cardioprotection mediated by GATA-4 overexpressed mesenchymal stem cells (MSC. METHODS AND RESULTS: Adult rat bone marrow MSC and neonatal rat ventricle cardiomyocytes (CM were harvested as primary cultures. MSC were transduced with GATA-4 (MSC(GATA-4 using the murine stem cell virus (pMSCV retroviral expression system. Empty vector transfection was used as a control (MSC(Null. The expression of miRs was assessed by real-time PCR and localized using in situ hybridization (ISH. MVs collected from MSC cultures were characterized by expression of CD9, CD63, and HSP70, and photographed with electron microscopy. Cardioprotection during hypoxia afforded by conditioned medium (CdM from MSC cultures was evaluated by lactate dehydrogenase (LDH release, MTS uptake by CM, and caspase 3/7 activity. Expression of miR-221/222 was significantly higher in MSC than in CM and miR-221 was upregulated in MSC(GATA-4. MSC overexpression of miR-221 significantly enhanced cardioprotection by reducing the expression of p53 upregulated modulator of apoptosis (PUMA. Moreover, expression of PUMA was significantly decreased in CM co-cultured with MSC. MVs derived from MSC expressed high levels of miR-221, and were internalized quickly by CM as documented in images obtained from a Time-Lapse Imaging System. CONCLUSIONS: Our results demonstrate that cardioprotection by MSC(GATA-4 may be regulated in part by a transfer of anti-apoptotic miRs contained within MVs.

  13. HIV-1逆转录酶H221Y突变对Y181C突变株复制能力影响研究%Impact of HIV-1 reverse transcriptase H221Y mutation on replication capacity of Y181C mutant viral strain

    殷丽丽; 韩晓旭; 赵彬; 张旻; 安明晖; 吉阳涛; 欧阳金鸣; 尚红

    2013-01-01

    Objective To explore the development of Y181C and H221Y mutations among HIV-1 infected patients upon antiretroviral therapy in China and to investigate the impact of H221Y mutation on replication capacity of Y181C mutant.Methods Three HIV-1 subtype B' infected patients with Y181C and H221Y mutations upon highly active antiretroviral therapy from Henan province were enrolled in this study.Follow-up blood samples collected every six months from the patients after therapy between 2004 to 2006 were detected for viral load evaluation.Fragments of pol gene were amplified by nested PCR.The purified PCR products were ligated into pMD18-T vector to construct recombinant plasmids,which were further sequenced and compared with the HIV reference strain from Stanford HIVDB for analyzing the development of Y181C and H221Y mutations.Plasmids containing Y181C mutation alone and plasmids containing Y181C and H221Y double mutations were constructed and cotransfected respectively with envelope-expression plasmid pVSV-G into HEK 293T cells to obtain HIV-1 pseudotyped viruses.Replication capacity of each pseudotyped virus was analyzed after a single-cycle infection in TZM-bl cells.Results A total of 57 TA cloned sequences from six follow-up blood samples of three patients were obtained.Y181C mutation alone was found in 46 clones and Y181C and H221Y mutations were found in 35 clones.Moreover,H221Y mutation was only found in clones in which Y181C mutation had already developed.Between two pairs of pseudotyped virus from two patients,replication capacity of those viruses containing Y181C and H221Y mutations were 1.42 and 1.62 fold higher than the viruses containing Y181C mutation alone,respectively.Conclusion H221Y mutation might be a compensatory mutation of Y181C mutation occurred to improve the replication capacity of viral strains with Y181C mutant in HIV-1 subtype B' infected patients upon antiretroviral therapy.The finding suggests that it's significantly important to further

  14. AP2α controls the dynamic balance between miR-126&126* and miR-221&222 during melanoma progression

    Felli, N; Errico, M C; Pedini, F; Petrini, M; Puglisi, R; Bellenghi, M; Boe, A; Felicetti, F; Mattia, G; De Feo, A; Bottero, L; Tripodo, C; Carè, A

    2016-01-01

    Accumulating evidences have shown the association between aberrantly expressed microRNAs (miRs) and cancer, where these small regulatory RNAs appear to dictate the cell fate by regulating all the main biological processes. We demonstrated the responsibility of the circuitry connecting the oncomiR-221&222 with the tumor suppressors miR-126&126* in melanoma development and progression. According to the inverse correlation between endogenous miR-221&222 and miR-126&126*, respectively increasing or decreasing with malignancy, their enforced expression or silencing was sufficient for a reciprocal regulation. In line with the opposite roles of these miRs, protein analyses confirmed the reverse expression pattern of miR-126&126*-targeted genes that were induced by miR-221&222. Looking for a central player in this complex network, we revealed the dual regulation of AP2α, on one side directly targeted by miR-221&222 and on the other a transcriptional activator of miR-126&126*. We showed the chance of restoring miR-126&126* expression in metastatic melanoma to reduce the amount of mature intracellular heparin-binding EGF like growth factor, thus preventing promyelocytic leukemia zinc finger delocalization and maintaining its repression on miR-221&222 promoter. Thus, the low-residual quantity of these two miRs assures the release of AP2α expression, which in turn binds to and induces miR-126&126* transcription. All together these results point to an unbalanced ratio functional to melanoma malignancy between these two couples of miRs. During progression this balance gradually moves from miR-126&126* toward miR-221&222. This circuitry, besides confirming the central role of AP2α in orchestrating melanoma development and/or progression, further displays the significance of these miRs in cancer and the option of utilizing them for novel therapeutics. PMID:26434590

  15. Induction of resistance to rice tungro virus disease in rice cultivar Pusa 2-21 through irradiation

    The dry seeds of Pusa 2-21, a moderately resistant rice cultivar, were subjected to 10, 15 and 20 Krad (dose rate 12.3 Krad/min) radiation dosages of gamma rays to induce resistance against rice tungro virus disease. The height of M1 seedling was significantly reduced in 15 and 20 Krad treatments. However, there was no effect of gamma irradiation on seed germination. A limited population of M2 and M3 generation was screened at the rate of 3 viruliferous leafhoppers/seedling using single plant caging technique. In M2 generation 22.0, 17.6 and 25.0 percent seedlings exhibited green colour (symptomless) representing resistant reaction to the disease in 10, 15 and 20 Krad treatments, respectively. Out of 1470 seedlings in M3 generation, 2.7 percent seedlings showing no symptoms of tungro could be isolated indicating the possibility of inducing higher degree of resistance than that of the parent to RTV through irradiation for the first time. (auth.)

  16. The effects of CO2 and O3 singly and in-combination on Malaysia rice cultivar (MR 221)

    The continuous burning of fossil fuel and rapid development of industrialization have increase the atmospheric Carbon dioxide (CO2) and tropospheric Ozone (03). The profound effects of the rising CO, and 03 in the tropospheric environment on the plants have been acknowledged due to the combination effects of CO, and 03 on plants. The seedling rice (Oryza sativa) of Malaysian cultivar (MR221) were exposed to four types of treatments namely 350 ppm C02 and 10 ppb 03 conditions, 660 ppm C02 and 10 ppb 03, and 350 ppm CO, and 33 ppb 03. The seedlings were exposed to these conditions 6 hours per day from 0900 to 1500 hours for 5 days per week for more than three months. The objectives of this study was to determine the direct effects of elevated CO, and 03 enhancement on physiological aspects and growth performances of rice. The results indicated that there was a progressive stimulation in photosynthesis of seedlings exposed to elevated C02 indicates by doubling of Pmax. Results of the growth performances showed that there were no consistent effects of ozone on plant height and tillering which differ from other related studies. (Author)

  17. Acceptable Knowledge Summary Report for Waste Stream: SR-T001-221F-HET/Drums

    Lunsford, G.F.

    1998-10-26

    Since beginning operations in 1954, the Savannah River Site FB-Line produced Weapons Grade Plutonium for the United States National Defense Program. The facility mission was mainly to process dilute plutonium solution received from the 221-F Canyon into highly purified plutonium metal. As a result of various activities (maintenance, repair, clean up, etc.) in support of the mission, the facility generated a transuranic heterogeneous debris waste stream. Prior to January 25, 1990, the waste stream was considered suspect mixed transuranic waste (based on potential for inclusion of F-Listed solvent rags/wipes) and is not included in this characterization. Beginning January 25, 1990, Savannah River Site began segregation of rags and wipes containing F-Listed solvents thus creating a mixed transuranic waste stream and a non-mixed transuranic waste stream. This characterization addresses the non-mixed transuranic waste stream packaged in 55-gallon drums after January 25, 1990.Characterization of the waste stream was achieved using knowledge of process operations, facility safety basis documentation, facility specific waste management procedures and storage / disposal records. The report is fully responsive to the requirements of Section 4.0 "Acceptable Knowledge" from the WIPP Transuranic Waste Characterization Quality Assurance Plan, CAO-94-1010, and provides a sound, (and auditable) characterization that satisfies the WIPP criteria for Acceptable Knowledge.

  18. Localization of a human homolog of the mouse Tiam-1 gene to chromosome 21q22.1

    Haiming Chen; Antonarakis, S.E. [Univ. of Geneva Medical School (Switzerland)

    1995-11-01

    Exon trapping was applied to genomic DNA from a chromosome 21-specific cosmid library (LL21NC02-Q) to clone portions of genes from this chromosome. Among a large number of trapped exons, three showed striking homology to different regions of the cDNA for the mouse T-lymphoma invasion and metastasis gene (Tiam-1) at both nucleotide and predicted amino acid sequence levels, suggesting that these three exons are part of a human homolog of the mouse Tiam-1 gene. We mapped this presumed human TIAM1 gene to chromosome 21 by using appropriate somatic cell hybrids, YACs, and cosmids. The TIAM1 gene localizes to YAC 760H5 of the I. Chumakov et al. YAC contig between markers D21S298 and D21S404 in band 21q22.1. This human gene (which is a member of the group of guanine nucleotide-dissociation stimulators that modulate the activity of Rho-like proteins) may be important in the development or metastasis of malignancies that are associated with abnormalities on chromosome 21, including the various forms of leukemia frequent in trisomy 21. 25 refs., 2 figs.

  19. The investigation of the decay of the deformed 167Yb, 164Tm, 225Ac, 221Fr nuclei. Beta-spectrograph with positional-sensitive detector

    The decay of the deformed 167Yb, 164Tm, 225Ac,221Fr nuclei is investigated in this work. For 167Yb and 164Tm decays the specters of the conversion electrons were measured. 32 γ-transitions were found for 167 Yb decay, 6 of which were found for the first time. The multipolarities for 9 γ-transitions were found. For 164Tm decay 23 new γ-transitions were found. The theoretical investigations of the collective states in the nucleus were carried out. Octupole-rotatory line with k=1- was found in the measurement of conversion electrons specters of the short-life nuclei. Device' nonlinearity was 0,04%. Resolution was Δβρ/βρ 0,11%. Effective light yield was 1-2 %. The decay of 225Ac and 221Fr nuclei were investigated. The investigations of α-γ -coincidence, α-γ - rays were carried out. 24 new γ -transitions for 225Ac and 13 ones for 221Fr were found. The new levels and their intensities were defined more precisely. Intensity balance calculations were carried out and the full populations of the nuclear levels were calculated. (author). 3 tabs.; 10 figs

  20. A Pumilio-induced RNA structure switch in p27-3' UTR controls miR-221 and miR-222 accessibility.

    Kedde, Martijn; van Kouwenhove, Marieke; Zwart, Wilbert; Oude Vrielink, Joachim A F; Elkon, Ran; Agami, Reuven

    2010-10-01

    Key regulators of 3' untranslated regions (3' UTRs) are microRNAs and RNA-binding proteins (RBPs). The p27 tumour suppressor is highly expressed in quiescent cells, and its downregulation is required for cell cycle entry after growth factor stimulation. Intriguingly, p27 accumulates in quiescent cells despite high levels of its inhibitors miR-221 and miR-222 (Refs 5, 6). Here we show that miR-221 and miR-222 are underactive towards p27-3' UTR in quiescent cells, as a result of target site hindrance. Pumilio-1 (PUM1) is a ubiquitously expressed RBP that was shown to interact with p27-3' UTR. In response to growth factor stimulation, PUM1 is upregulated and phosphorylated for optimal induction of its RNA-binding activity towards the p27-3' UTR. PUM1 binding induces a local change in RNA structure that favours association with miR-221 and miR-222, efficient suppression of p27 expression, and rapid entry to the cell cycle. We have therefore uncovered a novel RBP-induced structural switch modulating microRNA-mediated gene expression regulation. PMID:20818387

  1. 南宁地区221株淋球菌对青霉素、壮观霉素的敏感性测定%Sensitivity test of 221 Neisseria gonorrhoeae strains in Nanning to penicillin and spectinomycin

    李伟; 赵秀梅; 覃善列; 唐桂林

    2001-01-01

    目的:了解南宁地区淋球菌对青霉素、壮观霉素的敏感性。方法:我们于1996年至1999年对221株淋球菌临床分离株以琼脂稀释法测定青霉素、壮观霉素的最小抑菌浓度(MIC)。结果:7株(3.17%)为产青霉素酶淋球菌(PPNG)。青霉素MIC范围为0.008~16mg/L;2.71%菌株对青霉素敏感,36.20%为低敏,61.09%为耐药。其中1996至1999年各年耐药率分别为23.92%、37.10%、89.16%、90.00%。壮观霉素MIC范围2~>128mg/L;92.76%菌株对壮观霉素敏感,7.24%菌株为耐药;1999年未发现耐壮观霉素菌株。结论:南宁地区淋球菌对青霉素耐药比率较高,且呈逐年上升趋势。出现了耐壮观霉素的菌株。持续性监测青霉素、壮观霉素对临床合理用药十分重要。%Objective: To measure the susceptibility of Neisseria gonorrhoeae to penicillin and spetinomycin in Nan ning. Methods:221 clinical isolates of Neisseria gonokrrhoeae abtained from patients with gonorrhea in Nanning were tesed for their susceptiblities to penicillin and spectinomycin in vitro. The mininum inhibitory concentrations (MIC) of penicillin and spectinomycin were determined by agar dilution method. Rusults: 7 strains (3.17%) were penicilinase producers (PPNG). The MIC ranges were from 0.008mg/L to 16mg/L for Penicillin. 2.71% of the isolates were susceptible to penicillin,36.20% were less sensitive; 61.09% exhibited resistance to penicillin. The prevalence of resistant gonococci every year was 23.92%, 37.1%, 89.16%, 90% respectively in 1996~1999. The MIC ranges were from 2mg/L to>128mg/L for spectinomycin.92.76% of the isolates were susceptible to spectinomycin, 7.24% exhibited resistance to spectinomycin. None of the isolates were detected to be resistant of spectinomycin in 1999. Conclusion: A high proportion of goncoccal isolates remain resistant to penicillin, with the emergence of spectinomycin resistance strains in Nanning. For the

  2. Early-Onset Multiple Sclerosis in Isfahan, Iran: Report of the Demographic and Clinical Features of 221 Patients.

    Etemadifar, Masoud; Nourian, Sayed-Mohammadamin; Nourian, Niloofaralsadat; Abtahi, Seyed-Hossein; Sayahi, Farnaz; Saraf, Zahra; Fereidan-Esfahani, Mahboobeh

    2016-06-01

    It is estimated that early-onset multiple sclerosis multiple sclerosis (early-onset multiple sclerosis) approximately incorporates 3-5% of the multiple sclerosis population. In this report on early-onset multiple sclerosis, the authors aimed to define demographic, clinical and imaging features in a case-series of true-childhood multiple sclerosis and to compare its characteristics with juvenile multiple sclerosis. The authors inspected the records of multiple sclerosis patients who were registered by Isfahan MS Society. Clinical and demographic data of children with less than 16 years of age were reviewed retrospectively. Out of 4536 multiple sclerosis patients referred to the authors' center, 221 patients (4.8%) had multiple sclerosis starting at the age of 16 or less (11 true-childhood multiple sclerosis vs 210 juvenile-onset multiple sclerosis); the female to male ratio was 4.81:1. In the mean follow-up period of 6.2 years, 22 patients (10.5%) had positive family history of multiple sclerosis, 196 (88.6%) patients were classified as relapsing-remitting multiple sclerosis, the mean (± SD Expanded Disability Status Scale) was 1.5 ± 1.1 at the last evaluation. The most common initial presentation was optic nerve involvement (36.1%) and cerebellar sign and symptoms (14.6%). In all, 13 patients (5.8%) had experienced seizure in the course of multiple sclerosis. This study indicated that early-onset multiple sclerosis is not rare condition and overwhelmingly affects girls even at prepubertal onset. Physicians should consider multiple sclerosis in suspicious pediatric cases. PMID:26979097

  3. Influence on the interaction by functional groups in some series of bicyclo (2,2,1) heptane derivatives

    In connection with investigations involving the interactions of substituted groups in the bicyclo (2,2,1) heptane molecules, the chemical reactivity and some physical properties of polyfunctional compounds have been studied. A new method for preparation of β-fenchylic derivatives is presented, the first described terpenic nitroxide radical have been prepared from oxazolidinic compounds. The stereochemistry of the base induced elimination reaction of 6-exo tosyl and 6-endo tosyl oxy epi-camphor is dependent of the geometry of these compounds. On the other hand, the results indicate that the most important part of the structure is the position of the carbonyl group. Tricyclenic and camphenic derivatives are obtained with different rates. An explanation for these results involve several possible basic abstractions of acid protons, and the competition between these different reactions. The oxazolidinic compounds are obtained by reacting 2-amino 2-methyl 1-propanol with norcamphor and norbornane-2,5 dione. The geometrical configuration of the different stereoisomers is deduced from the measured dipolar interaction parameter D. The cotton effects of the γ-diketones do not show any interaction between the two carbonyl groups, in the fenchylic and bornylic series. The two carbonyl bond angles of the substituted α-diketones do not seem to be sensitive to any substitution of an alkoxy group. So, a new quadrant rule is proposed; compatible results are obtained, except for a methyl group in the α position. At least, PMR studies of terpenic polyfunctional compounds demonstrate the influence of the substitution on the geometry of the carbon skeleton. A new coupling constant 4JHH is examined. (author)

  4. Isolation and characterization of a novel cold-adapted esterase, MtEst45, from Microbulbifer thermotolerans DAU221

    Yong-Suk eLee

    2016-03-01

    Full Text Available A novel esterase, MtEst45, was isolated from a fosmid genomic library of Microbulbifer thermotolerans DAU221. The encoding gene is predicted to have a mass of 45,564 Da and encodes 495 amino acids, excluding a 21 amino acid signal peptide. MtEst45 showed a low amino acid identity (approximately 23–24% compared with other lipolytic enzymes belonging to Family III, a closely related bacterial lipolytic enzyme family. MtEst45 also showed a conserved GXSXG motif, G131IS133YG135, which was reported as active site of known lipolytic enzymes, and the putative catalytic triad composed of D237 and H265. Because these mutants of MtEst45, which was S133A, D237N, and H265L, had no activity, these catalytic triad essential for the enzyme catalysis. MtEst45 was overexpressed in Escherichia coli BL21 (DE3 and purified via His-tag affinity chromatography. The optimal pH and temperature of MtEst45 were estimated to be 8.17 and 46.27°C by response surface methodology, respectively. Additionally, MtEst45 was also active between 1–15°C. The optimal hydrolysis substrate for MtEst45 among p-nitrophenyl esters (C2–C18 was p-nitrophenyl butyrate, and the Km and Vmax values were 0.0998 mM and 550 μmol/min/mg of protein, respectively. MtEst45 was strongly inhibited by Hg2+, Zn2+, and Cu2+ ions; by phenylmethanesulfonyl fluoride; and by β-mercaptoethanol. Ca2+ did not affect the enzyme’s activity. These biochemical properties, sequence identity, and phylogenetic analysis suggest that MtEst45 represents a novel and valuable bacterial lipolytic enzyme family and is useful for biotechnological applications.

  5. Rocky or Not, Here We Come: Revealing the Internal Structures of K2-21b+c Through Transit Timing

    Stevenson, Kevin; Bean, Jacob; Dragomir, Diana; Fabrycky, Daniel; Kreidberg, Laura; Mills, Sean; Petigura, Erik

    2015-10-01

    The provenance of planets 1.5 -- 2 times the size of the Earth is one of the biggest unresolved mysteries from the Kepler mission. Determining the nature and origins of these exoplanets relies not only on measuring their radii, but also requires knowledge about their masses, atmospheric compositions, and interior structures. With this information, we can more confidently estimate planet mass distributions from measured radii, distinguish between rocky and non-rocky compositions, and better constrain the occurrence rate of Earth-like planets. Co-I Petigura recently announced the discovery of a two-transiting-planet system, K2-21, with bodies of 1.6 and 1.9 Earth-radii. The latter is expected to have a volatile-rich atmosphere, but the former lies squarely on the rocky/non-rocky composition boundary. These exoplanets orbit their relatively bright, nearby M dwarf parent star in a near 5:3 resonance and likely exhibit transit timing variations (TTVs) that can be resolved by Spitzer. Knowledge about their TTVs, in turn, will reveal constraints on the planets' masses, which is important because significant stellar activity makes RV mass measurements impractical. We propose to measure precise transit times of K2-21b and K2-21c with Spitzer and combine that information with existing K2 timing constraints to determine their masses. Understanding the planets' masses is a critical, first step to ultimately determining their atmospheric compositions and internal structures. These planets will provide an excellent test to current statistical arguments that suggest there is a turning point in composition from rocky, true-to-name super-Earths to volatile-rich sub-Neptunes in the range of 1.5 -- 2 Earth-radii.

  6. Rocky or Not, Here We Come: Further Revealing the Internal Structures of K2-21b+c Through Transit Timing

    Stevenson, Kevin; Bean, Jacob; Dragomir, Diana; Fabrycky, Daniel; Kreidberg, Laura; Mills, Sean; Petigura, Erik

    2016-08-01

    The provenance of planets 1.5 - 2 times the size of the Earth is one of the biggest unresolved mysteries from the Kepler mission. Determining the nature and origins of these exoplanets relies not only on measuring their radii, but also requires knowledge about their masses, atmospheric compositions, and interior structures. With this information, we can more confidently estimate planet mass distributions from measured radii, distinguish between rocky and non-rocky compositions, and better constrain the occurrence rate of Earth-like planets. Last year, Co-I Petigura announced the discovery of a two-transiting-planet system, K2-21, with bodies of 1.6 and 1.9 Earth-radii. The latter is expected to have a volatile-rich atmosphere, but the former lies squarely on the rocky/non-rocky composition boundary. These exoplanets orbit their relatively bright, nearby M dwarf parent star in a near 5:3 resonance and, based on our successful Spitzer observations, exhibit measurable transit timing variations (TTVs). Complete knowledge about their interactions will reveal constraints on the planets' masses, which is important because significant stellar activity makes RV mass measurements impractical. We propose to continue measuring precise transit times of K2-21b and K2-21c with Spitzer and combine that information with existing K2 timing constraints to determine their masses. Understanding the planets' masses is a critical, first step to ultimately determining their atmospheric compositions and internal structures. These planets will provide an excellent test to current statistical arguments that suggest there is a turning point in composition from rocky, true-to-name super-Earths to volatile-rich sub-Neptunes in the range of 1.5 - 2 Earth-radii.

  7. NF-kB and c-Jun induce the expression of the oncogenic miR-221 and miR-222 in prostate carcinoma and glioblastoma cells

    Galardi, Silvia; Mercatelli, Neri; Farace, Maria G.; Ciafrè, Silvia A.

    2011-01-01

    MicroRNAs (miRNAs) are potent negative regulators of gene expression involved in all aspects of cell biology. They finely modulate virtually all physiological pathways in metazoans, and are deeply implicated in all main pathologies, among which cancer. Mir-221 and miR-222, two closely related miRNAs encoded in cluster from a genomic region on chromosome X, are strongly upregulated in several forms of human tumours. In this work, we report that the ectopic modulation of NF-kB modifies miR-221/222 expression in prostate carcinoma and glioblastoma cell lines, where we had previously shown their oncogenic activity. We identify two separate distal regions upstream of miR-221/222 promoter which are bound by the NF-kB subunit p65 and drive efficient transcription in luciferase reporter assays; consistently, the site-directed mutagenesis disrupting p65 binding sites or the ectopical inhibition of NF-kB activity significantly reduce luciferase activity. In the most distal enhancer region, we also define a binding site for c-Jun, and we show that the binding of this factor cooperates with that of p65, fully accounting for the observed upregulation of miR-221/222. Thus our work uncovers an additional mechanism through which NF-kB and c-Jun, two transcription factors deeply involved in cancer onset and progression, contribute to oncogenesis, by inducing miR-221/222 transcription. PMID:21245048

  8. NF-kB and c-Jun induce the expression of the oncogenic miR-221 and miR-222 in prostate carcinoma and glioblastoma cells.

    Galardi, Silvia; Mercatelli, Neri; Farace, Maria G; Ciafrè, Silvia A

    2011-05-01

    MicroRNAs (miRNAs) are potent negative regulators of gene expression involved in all aspects of cell biology. They finely modulate virtually all physiological pathways in metazoans, and are deeply implicated in all main pathologies, among which cancer. Mir-221 and miR-222, two closely related miRNAs encoded in cluster from a genomic region on chromosome X, are strongly upregulated in several forms of human tumours. In this work, we report that the ectopic modulation of NF-kB modifies miR-221/222 expression in prostate carcinoma and glioblastoma cell lines, where we had previously shown their oncogenic activity. We identify two separate distal regions upstream of miR-221/222 promoter which are bound by the NF-kB subunit p65 and drive efficient transcription in luciferase reporter assays; consistently, the site-directed mutagenesis disrupting p65 binding sites or the ectopical inhibition of NF-kB activity significantly reduce luciferase activity. In the most distal enhancer region, we also define a binding site for c-Jun, and we show that the binding of this factor cooperates with that of p65, fully accounting for the observed upregulation of miR-221/222. Thus our work uncovers an additional mechanism through which NF-kB and c-Jun, two transcription factors deeply involved in cancer onset and progression, contribute to oncogenesis, by inducing miR-221/222 transcription. PMID:21245048

  9. A ±6 ms-Accuracy, 0.68 mm2, and 2.21 μW QRS Detection ASIC

    Sheng-Chieh Huang; Hui-Min Wang; Wei-Yu Chen

    2012-01-01

    Healthcare issues arose from population aging. Meanwhile, electrocardiogram (ECG) is a powerful measurement tool. The first step of ECG is to detect QRS complexes. A state-of-the-art QRS detection algorithm was modified and implemented to an application-specific integrated circuit (ASIC). By the dedicated architecture design, the novel ASIC is proposed with 0.68 mm2 core area and 2.21 μW power consumption. It is the smallest QRS detection ASIC based on 0.18 μm technology. In addition, the sen...

  10. Role of gga-miR-221 and gga-miR-222 during Tumour Formation in Chickens Infected by Subgroup J Avian Leukosis Virus

    Zhenkai Dai; Jun Ji; Yiming Yan; Wencheng Lin; Hongxin Li; Feng Chen; Yang Liu; Weiguo Chen; Yingzuo Bi; Qingmei Xie

    2015-01-01

    Subgroup J avian leukosis virus (ALV-J) causes a neoplastic disease in infected chickens. Differential expression patterns of microRNAs (miRNAs) are closely related to the formation and growth of tumors. (1) Background: This study was undertaken to understand how miRNAs might be related to tumor growth during ALV-J infection. We chose to characterize the effects of miR-221 and miR-222 on cell proliferation, migration, and apoptosis based on previous microarray data. (2) Methods: In vivo, the ...

  11. Down regulation of NLK by MIR-221/222 modulates chemosensitivity to glucocorticoids in pediatric normal karyotype b-cell precursor acute lymphoblastic leukemia. La downregolazione di nemo-like kinase indotta dai MIR-221/222 modula chemiosensibilità ai glucocorticoidi nella pediatrico b-cell precursor leucemia linfattica acuta

    Koh,

    2012-01-01

    Normal karyotype pediatric B-cell precursor ALL patients are heterogeneous with respect to chemotherapy response, relapse rates and prognosis and the reason is unknown. These patients are treated with a standard protocol, and stratified using MRD methodology that shows they have variable responses and predicted outcomes. This study aims to determine the reasons behind such heterogeneity. This study shows that through miRNA profiling, miR-221/222 are differentially expressed in normal karyotyp...

  12. A map of nuclear matrix attachment regions within the breast cancer loss-of-heterozygosity region on human chromosome 16q22.1.

    Shaposhnikov, Sergey A; Akopov, Sergey B; Chernov, Igor P; Thomsen, Preben D; Joergensen, Claus; Collins, Andrew R; Frengen, Eirik; Nikolaev, Lev G

    2007-03-01

    There is abundant evidence that the DNA in eukaryotic cells is organized into loop domains that represent basic structural and functional units of chromatin packaging. To explore the DNA domain organization of the breast cancer loss-of-heterozygosity region on human chromosome 16q22.1, we have identified a significant portion of the scaffold/matrix attachment regions (S/MARs) within this region. Forty independent putative S/MAR elements were assigned within the 16q22.1 locus. More than 90% of these S/MARs are AT rich, with GC contents as low as 27% in 2 cases. Thirty-nine (98%) of the S/MARs are located within genes and 36 (90%) in gene introns, of which 15 are in first introns of different genes. The clear tendency of S/MARs from this region to be located within the introns suggests their regulatory role. The S/MAR resource constructed may contribute to an understanding of how the genes in the region are regulated and of how the structural architecture and functional organization of the DNA are related. PMID:17188460

  13. NF-kB and c-Jun induce the expression of the oncogenic miR-221 and miR-222 in prostate carcinoma and glioblastoma cells

    Galardi, Silvia; Mercatelli, Neri; Farace, Maria G.; Ciafrè, Silvia A.

    2011-01-01

    MicroRNAs (miRNAs) are potent negative regulators of gene expression involved in all aspects of cell biology. They finely modulate virtually all physiological pathways in metazoans, and are deeply implicated in all main pathologies, among which cancer. Mir-221 and miR-222, two closely related miRNAs encoded in cluster from a genomic region on chromosome X, are strongly upregulated in several forms of human tumours. In this work, we report that the ectopic modulation of NF-kB modifies miR-221/...

  14. A new hemoglobin variant: Hb Meylan [β73(E17)Asp → Phe; HBB: c.220G>T; c.221A>T] with a double base mutation at the same codon.

    Renoux, Céline; Feray, Cécile; Joly, Philippe; Zanella-Cleon, Isabelle; Garcia, Caroline; Lacan, Philippe; Couprie, Nicole; Francina, Alain

    2015-01-01

    We report a new β-globin chain variant: Hb Meylan [β73(E17)Asp → Phe; HBB: c.220G>T; c.221A>T]. The new variant results from a double nucleotide mutation at the same codon. The possible molecular mechanisms are discussed. PMID:25476778

  15. A Rare Interstitial Duplication of 8q22.1–8q24.3 Associated with Syndromic Bilateral Cleft Lip/Palate

    Regina Ferreira Rezek

    2014-01-01

    Full Text Available We present a rare case of 8q interstitial duplication derived from maternal balanced translocations in a patient with bilateral cleft lip and palate in syndromic form associated with other congenital malformations. G-banding cytogenetic analysis revealed a chromosomal abnormality in the form of the karyotype 46,XX der(22t(8;22(q22.1;p11.1mat. Chromosome microarray analysis evidenced a 49 Mb duplicated segment of chromosome 8q with no pathogenic imbalances on chromosome 22. Two siblings also carry the balanced translocation. We have compared this case with other “pure” trisomies of 8q patients reported in the literature and with genome wide association studies recently published. This work highlights the involvement of chromosome 8q in orofacial clefts.

  16. A ±6 ms-Accuracy, 0.68 mm2, and 2.21 μW QRS Detection ASIC

    Sheng-Chieh Huang

    2012-01-01

    Full Text Available Healthcare issues arose from population aging. Meanwhile, electrocardiogram (ECG is a powerful measurement tool. The first step of ECG is to detect QRS complexes. A state-of-the-art QRS detection algorithm was modified and implemented to an application-specific integrated circuit (ASIC. By the dedicated architecture design, the novel ASIC is proposed with 0.68 mm2 core area and 2.21 μW power consumption. It is the smallest QRS detection ASIC based on 0.18 μm technology. In addition, the sensitivity is 95.65% and the positive prediction of the ASIC is 99.36% based on the MIT/BIH arrhythmia database certification.

  17. Isolation of the human MOX2 homeobox gene and localization to chromosome 7p22.1-p21.3.

    Grigoriou, M; Kastrinaki, M C; Modi, W S; Theodorakis, K; Mankoo, B; Pachnis, V; Karagogeos, D

    1995-04-10

    We have isolated and characterized cDNA clones encoding a novel human homeobox gene, MOX2, the homologue of the murine mox-2 gene. The MOX2 protein contains all of the characteristic features of Mox-2 proteins of other vertebrate species, namely the homeobox, the polyhistidine stretch, and a number of potential serine/threonine phosphorylation sites. The homeodomain of MOX2 protein is identical to all other vertebrate species reported so far (rodents and amphibians). Outside the homeodomain, Mox-2 proteins share a high degree of identity, except for a few amino acid differences encountered between the human and the rodent polypeptides. A polyhistidine stretch of 12 amino acids in the N terminal region of the protein is also conserved among humans, rodents, and (only partly) amphibians. The chromosomal position of MOX2 was assigned to 7p22.1-p21.3. PMID:7607679

  18. Isolation of the human MOX2 homeobox gene and localization to chromosome 7p22.1-p21.3

    Grigoriou, M.; Theodorakis, K. [Institute of Molecular Biology and Biotechnology, Crete (Greece); Mankoo, B. [National Institute for Medical Research, London (United Kingdom)] [and others

    1995-04-10

    We have isolated and characterized cDNA clones encoding a novel human homeobox gene, MOX2, the homologue of the murine mox-2 gene. The MOX2 protein contains all of the characteristic features of Mox-2 proteins of other vertebrate species, namely the homeobox, the polyhistidine stretch, and a number of potential serine/threonine phosphorylation sites. The homeodomain of MOX2 protein is identical to all other vertebrate species reported so far (rodents and amphibians). Outside the homeodomain, Mox-2 proteins share a high degree of identity, except for a few amino acid differences encountered between the human and the rodent polypeptides. A polyhistidine stretch of 12 amino acids in the N terminal region of the protein is also conserved among humans, rodents, and (only partly) amphibians. The chromosomal position of MOX2 was assigned to 7p22.1-p21.3. 31 refs., 3 figs.

  19. Catalytic formal [2+2+1] synthesis of pyrroles from alkynes and diazenes via TiII/TiIV redox catalysis

    Gilbert, Zachary W.; Hue, Ryan J.; Tonks, Ian A.

    2016-01-01

    Pyrroles are structurally important heterocycles. However, the synthesis of polysubstituted pyrroles is often challenging. Here, we report a multicomponent, Ti-catalysed formal [2+2+1] reaction of alkynes and diazenes for the oxidative synthesis of penta- and trisubstituted pyrroles: a nitrenoid analogue to classical Pauson-Khand-type syntheses of cyclopentenones. Given the scarcity of early transition-metal redox catalysis, preliminary mechanistic studies are presented. Initial stoichiometric and kinetic studies indicate that the mechanism of this reaction proceeds through a formally TiII/TiIV redox catalytic cycle, in which an azatitanacyclobutene intermediate, resulting from [2+2] alkyne + Ti imido coupling, undergoes a second alkyne insertion followed by reductive elimination to yield pyrrole and a TiII species. The key component for catalytic turnover is the reoxidation of the TiII species to a TiIV imido via the disproportionation of an η2-diazene-TiII complex.

  20. Synthesis, crystal structures, and properties of lanthanoid(III) complexes with 7-oxa-bicyclo[2.2.1]heptane-2,3-dicarboxylic acid

    The synthesis of coordination compounds [ML(HL)(H2O)] with M=La3+, Ce3+, Pr3+, Nd3+ and H2L=7-Oxa-bicyclo[2.2.1]heptane-2-exo,3-cis-dicarboxylic acid (1) has been described. Results of IR spectroscopy and thermal decomposition are given. As a result of X-ray analyses, the four investigated lanthanoid(III) complexes are isotypic. Their stereochemistry approximates to the tri-capped trigonal prism with nine O atoms coordinating the metal atom. The bicyclic ligand acts as a tridentate chelating monoanion HL- as well as a pentadentate dianion L2-with both chelating and bridging function. One coordination place at the metal atom is occupied by a water molecule. (orig.)

  1. Pressure dependence of the stereoselectivity in the photodenitrogenation of diazabicyclo[2.2.1]hept-2-ene in supercritical fluids: evidence for the diazenyl diradical

    Adam, Waldemar; Diedering, Manfred; Trofimov, Alexei V.

    2001-12-01

    The present study shows that the preference for the stereoselective inversion upon the photolytic nitrogen extrusion from the stereolabeled DBH derivative exo-d 2-diazabicyclo[2.2.1]heptene ( 1) in supercritical media (sc-CO 2, sc-C 2H 6) depends on pressure. The increase of pressure up to 200 bar leads to ca. 2.3-fold decrease of the stereoselectivity ( kinv/ kret ratio) in sc-CO 2 and sc-C 2H 6. Analysis of the observed pressure dependence in terms of collisional (self-diffusion coefficient) and frictional (viscosity) effects discloses that frictional impositions by the fluid media account best for the experimental observations reported herein. This pressure-dependent viscosity effect is consistent with a stepwise denitrogenation mechanism for the photolysis of DBH in the supercritical phase, which proceeds through an unsymmetrical, nitrogen-containing transient, namely the singlet diazenyl diradical.

  2. miR-21, miR-221 and miR-222 expression and prostate cancer recurrence among obese and non-obese cases

    Ernest K Amankwah; Evelyn Anegbe; Hyun Park; Julio Pow-Sang; Ardeshir Hakam; Jong Y Park

    2013-01-01

    Recent evidence shows that certain microRNAs (miRNAs) play a role in both obesity and prostate cancer recurrence,but the association between the expression of these miRNAs and obesity in prostate cancer recurrence is unknown.In this study,we examined the effect of the interaction between obesity and miR-21,miR-221 or miR-222 expression on prostate cancer recurrence among 28 recurrent and 37 non-recurrent prostate cancer cases,miRNA expression was determined using quantitative real-time polymerase chain reaction.Cox proportional hazard models adjusting for age at diagnosis,clinical stage and Gleason score were used to estimate hazard ratios (HR) and 95% confidence intervals (95% CI) for recurrence free survival.A significantly (P=0.014) higher proportion of recurrent cases (78.6%) than non-recurrent cases (48.6%) had a low expression of miR-21 and the difference was more prominent in obese than non-obese patients.Multivariate analysis showed that the expression of miR-21 was an independent risk factor for recurrence in obese (HR=6.15,95% CI=1.04-36.48,P=0.045),but not in non-obese (HR=1.28,95% CI=0.30-5.49,P=0.74) cases.A significant association with recurrence was not observed for the expression of miR-221 and miR-222.In summary,our findings show that miR-21 is associated with prostate cancer recurrence after radical prostatectomy and suggest that the differential expression of miR-21 is more prominent in obese than in non-obese cases.Future larger studies are warranted to confirm these initial findings and to elucidate the mechanisms involved.

  3. Enantioselective Resolution of N-(tert-Butoxycarbonyl)- 2-azabicyclo[2.2.1]hept-5-en-3-one%N-(叔丁氧羰基)-2-氮杂双环[2.2.1]庚-5-烯-3-酮的手性拆分

    李普瑞; 胡建建; 王晓川; 张玲玲; 王晓钟

    2015-01-01

    (-)-(1R,4S)-N-(叔丁氧羰基)-2-氮杂双环[2.2.1]庚-5-烯-3-酮是抗艾滋病药物阿巴卡韦的重要中间体。今以2-氮杂双环[2.2.1]庚-5-烯-3-酮为原料,先与(Boc)2O反应生成外消旋体(±)-N-(叔丁氧羰基)-2-氮杂双环[2.2.1]庚-5-烯-3-酮,再以固定化脂肪酶作为拆分试剂选择性拆分制得。试验中分别使用了三种酶,三种酶均表现出较好的反应活性和较高的反应收率,其中固定化酶Lipozyme RM IM的反应活性最高,对其催化的酶促反应进行了优化,得到最佳的反应条件:以异丙醚为反应溶剂,酶与底物质量投料比为1.5/2.0,反应温度为30℃,收率46.5%,对映体过量大于99%。结构经1H-NMR确证。该方法成本低,酶的选择性、催化活性和反应收率高。%(−)-(1R,4S)-N-(tert-Butoxycarbonyl)-2-azabicyclo[2.2.1]hept-5-en-3-one is an important intermediate of abacavir which is widely used in AIDS treatment. This chemical was prepared with 2-azabicyclo-[2.2.1]hept-5-en-3-one(2) as the starting material in this study. The starting material(2) was first reacted with (Boc)2O to give the raceme (±)-N-(tert-Butoxycarbonyl)-2-azabicyclo[2.2.1]hept-5-en-3-one(3) via amidation. The key intermediate was preparedvia a prominent turnover from the raceme(3) with immobilized lipases, and its structure was identified by1H-NMR. The optimum conditions of the enzymatic reaction were as follows: Lipozyme RM IM andisopropyl elther were used as the enzyme reaction catalyst, and reaction solvent separatively, the mass ratio of enzyme: substrate 1.5/2.0 and the reaction temperature of 30℃. The yield can reach to 46.5% under these optimal conditions with enantiomeric excess up to 99%. This synthetic process is suitable for large-scale manufacture due to the cheap available material and higher catalytic activity and selectivity of the lipase.

  4. Principy a ekonomické vyčíslení škod z porušování průmyslových práv dle zákona č. 221/2006 Sb.

    Holub, Michal

    2008-01-01

    This diploma thesis examines evaluation of damages according to the law Nr. 221/2006. Industrial rights, whose damages are enforced according to the law Nr. 221/2006, are described. Analysis of laws and judicial decisions in relation to the enforcement of damages and analysis of the law Nr. 221/2006 are made. The thesis examines sequences, important problems and aspects in relation to each method of the evaluation of damages. At the end of the thesis a study of a hypotetical case is carried o...

  5. miR-29b, miR-205 and miR-221 enhance chemosensitivity to gemcitabine in HuH28 human cholangiocarcinoma cells.

    Kinya Okamoto

    Full Text Available BACKGROUND AND AIMS: Cholangiocarcinoma (CCA is highly resistant to chemotherapy, including gemcitabine (Gem treatment. MicroRNAs (miRNAs are endogenous, non-coding, short RNAs that can regulate multiple genes expression. Some miRNAs play important roles in the chemosensitivity of tumors. Here, we examined the relationship between miRNA expression and the sensitivity of CCA cells to Gem. METHODS: Microarray analysis was used to determine the miRNA expression profiles of two CCA cell lines, HuH28 and HuCCT1. To determine the effect of candidate miRNAs on Gem sensitivity, expression of each candidate miRNA was modified via either transfection of a miRNA mimic or transfection of an anti-oligonucleotide. Ontology-based programs were used to identify potential target genes of candidate miRNAs that were confirmed to affect the Gem sensitivity of CCA cells. RESULTS: HuCCT1 cells were more sensitive to Gem than were HuH28 cells, and 18 miRNAs were differentially expressed whose ratios over ± 2log2 between HuH28 and HuCCT1. Among these 18 miRNAs, ectopic overexpression of each of three downregulated miRNAs in HuH28 (miR-29b, miR-205, miR-221 restored Gem sensitivity to HuH28. Suppression of one upregulated miRNA in HuH28, miR-125a-5p, inhibited HuH28 cell proliferation independently to Gem treatment. Selective siRNA-mediated downregulation of either of two software-predicted targets, PIK3R1 (target of miR-29b and miR-221 or MMP-2 (target of miR-29b, also conferred Gem sensitivity to HuH28. CONCLUSIONS: miRNA expression profiling was used to identify key miRNAs that regulate Gem sensitivity in CCA cells, and software that predicts miRNA targets was used to identify promising target genes for anti-tumor therapies.

  6. Differential cross-section measurements for inelastic scattering of 22.1 keV photons by elements with 4<=Z<=69

    Kumar, A; Puri, S; Mehta, D; Singh, N

    2002-01-01

    Inelastic scattering differential cross-sections for the 22.1 keV photons have been measured in Be, C, Mg, Al, S, Ti, Fe, Cu, Zn, As, Se, Y, Zr, Ag, In, Sn, Te, Gd, Dy, Ho and Tm elements at an angle of 133 deg. . The measurements were performed under vacuum using an annular source of sup 1 sup 0 sup 9 Cd radioisotope as photon source and a planar HPGe detector. The measured inelastic scattering cross-sections are compared with those calculated using the Klein-Nishina cross-section for Compton scattering by stationary free electrons and the non-relativistic Hartree-Fock incoherent-scattering function. A good agreement is found for all the elements under investigation except for sub 3 sub 9 Y (B sub K =17.038 keV) and sub 4 sub 0 Zr (B sub K =17.998 keV) elements, where the measured cross-sections are approx 25% lower than the calculated ones; B sub K is the K-shell binding energy of the element.

  7. Stereochemistry and mechanism of the reduction of some bicyclo (2-2-1-) heptane-2-ones by metals dissolved in liquid ammonia

    A systematic experimental study of the reduction of four bicyclo(2-2-1)hepta n-2-ones by dissolved alkaline and alkaline-earth metals in liquid ammonia is reported. Chapter one: models of metal-ammonia solutions and mechanisms of the reduction of ketones by these solutions are rapidly recalled. Chapter two: results obtained in the thermodynamic equilibration of three pairs of epimeric alcohols which formally derive from three of the starting ketones are presented. Chapter three: deals with the results obtained in the reduction of the ketones in the absence or the presence of a proton source. A new interpretation of these results is given and is based upon two different effects: - the torsional interaction created by the bridgehead substituent on the C-O bond which favours the formation of the endo alcohol; - the difference of steric hindrance between the two sides (exo and endo) defined by the plane of the carbonyl group of the starting molecule, which favours the attack of the metal cation from one side or the other, and therefore the formation of the exo or the endo epimer. This mechanism is generalised in a model which is tested by means of some examples published in the literature. It then appears able to construe correctly the obtained results. (author)

  8. CHARACTERIZATION AND THERMAL STABILITY OF PMR POLYIMIDES USING 7-OXA-BICYCLO[2,2,1]HEPT-5-ENE-2, 3-DICARBOXYLIC ANHYDRIDE AS END CAPS

    Chen-liang Gong; Yan-feng Li; Hai-xia Yang; Xiao-long Wang; Shu-jiang Zhang; Shi-yong Yanga

    2011-01-01

    An anhydride monomer containing ether oxide bridge,7-oxa-bicyclo[2,2,1]hept-5-ene-2,3-dicarboxylic anhydride (ONA),was successfully synthesized by Diels-Alder reaction of furan and maleic anhydride.The ONA was also studied as an end-cap for the polymerization of monomer reactant (PMR) type polyimides.Three molecular weight levels of the ONA end-capped PMR resins were evaluated.The effects of process conditions of these novel PMR resins on thermal and mechanical properties were investigated.It was demonstrated that the imidized prepolymers using the end-cap have good processability,and the cured polyimide specimens exhibited good thermal stability.The initial decomposition temperature,Td (ca.580℃) and glass transition temperature,Tg (330℃) of the novel resin (PI-20),prepared under optimum process conditions,compare favorably with the Td (ca.620℃) and Tg (ca.348℃) of the state-of-the-art resin (PI'-20),respectively.

  9. Potentiometric stripping analysis of bismuth based on carbon paste electrode modified with cryptand [2.2.1] and multiwalled carbon nanotubes

    An electrochemical method based on potentiometric stripping analysis (PSA) employing a cryptand [2.2.1] (CRY) and carbon nanotube (CNT) modified paste electrode (CRY-CNT-PE) has been proposed for the subnanomolar determination of bismuth. The characterization of the electrode surface has been carried out by means of scanning electron microscopy (SEM), cyclic voltammetry (CV), electrochemical impedance spectroscopy (EIS) and chronocoulometry (CC). It was observed that by employing CRY-CNT-PE, a 9-fold enhancement in the PSA signal (dt/dE) was observed as compared to plain carbon paste electrode (PCPE). Under the optimized conditions, dt/dE (s/V) was proportional to the Bi(III) concentration in the range of 5.55 x 10-8 to 9.79 x 10-11 M (r = 0.9990) with the detection limit (S/N = 3) of 3.17 x 10-11 M. The practical analytical utilities of the modified electrode were demonstrated by the determination of bismuth in pharmaceutical formulations, human hair, sea water, urine and blood serum samples. The prepared modified electrode showed several advantages, such as a simple preparation method, high sensitivity, very low detection limits and excellent reproducibility. Moreover, the results obtained for bismuth analysis in commercial and real samples using CRY-CNT-PE and those obtained by atomic absorption spectroscopy (AAS) are in agreement at the 95% confidence level.

  10. Synthesis and spectroscopic characterization of some lanthanide(III nitrate complexes of ethyl 2-[2-(1-acetyl-2-oxopropylazo]-4,5-dimethyl-3-thiophenecarboxyate

    CHEMPAKAM JANARDHANAN ATHIRA

    2011-02-01

    Full Text Available Ethyl 2-[2-(1-acetyl-2-oxopropylazo]-4,5-dimethyl-3-thiophenecarboxyate was synthesized by coupling diazotized ethyl 2-amino-4,5-dimethylthiophene-3-carboxylate with acetylacetone. Based on various spectral studies and elemental analysis, an intramolecularly hydrogen-bonded azo-enol structural form was assigned for the ligand. This ligand is versatile in forming a series of lanthanide(III complexes, viz., lanthanum(III, cerium(III, praseodymium(III, neodymium(III, samarium(III and gadolinium(III, which were characterized through various spectral studies, elemental analysis, magnetic susceptibility measurements, molar conductance and thermal analysis. The spectral data revealed that the ligand acted as a neutral tridentate, coordinating to the metal ion through one of the azo nitrogen atoms, the ester carbonyl and the enolic oxygen of the acetylacetone moiety, without deprotonation. Molar conductance values adequately supported their non-electrolytic nature. The ligand and lanthanum(III complex were subjected to X-ray diffraction studies. In addition, the lanthanum(III complex underwent a facile transesterification reaction on refluxing with methanol for a long period. The thermal behaviour of the lanthanum(III complex was also examined

  11. Synthesis, crystal structures, and properties of lanthanoid(III) complexes with 7-oxa-bicyclo[2.2.1]heptane-2,3-dicarboxylic acid; Synthese, Kristallstrukturen und Eigenschaften von Lanthanoid(III)-Komplexen mit 7-Oxa-bicyclo[2.2.1]heptan-2,3-dicarbonsaeure

    Schuechner, G. [Halle-Wittenberg Univ., Halle (Germany). Inst. fuer Anorganische Chemie und Allgemeine Chemie; Fechtel, G. [Halle-Wittenberg Univ., Halle (Germany). Inst. fuer Anorganische Chemie und Allgemeine Chemie; Baumeister, U. [Halle-Wittenberg Univ., Halle (Germany). Inst. fuer Physikalische Chemie; Hartung, H. [Halle-Wittenberg Univ., Halle (Germany). Inst. fuer Physikalische Chemie

    1996-08-01

    The synthesis of coordination compounds [ML(HL)(H{sub 2}O)] with M=La{sup 3+}, Ce{sup 3+}, Pr{sup 3+}, Nd{sup 3+} and H{sub 2}L=7-Oxa-bicyclo[2.2.1]heptane-2-exo,3-cis-dicarboxylic acid (1) has been described. Results of IR spectroscopy and thermal decomposition are given. As a result of X-ray analyses, the four investigated lanthanoid(III) complexes are isotypic. Their stereochemistry approximates to the tri-capped trigonal prism with nine O atoms coordinating the metal atom. The bicyclic ligand acts as a tridentate chelating monoanion HL{sup -} as well as a pentadentate dianion L{sup 2-} with both chelating and bridging function. One coordination place at the metal atom is occupied by a water molecule. (orig.)

  12. Synthesis of 2-Azabicyclo[2,2,1]hept-5-en-3-one as an Intermediate for Abacavir%阿巴卡韦中间体2-杂氮双环[2,2,1]庚-5-烯-3-酮的合成

    陈灿; 郭莉娜; 李宏伟; 侯仲轲

    2006-01-01

    采用一步法由对甲基苯亚磺酸钠与氯化氰及1,3-环戊二烯合成目标物2-杂氮双环[2,2,1]庚-5-烯-3-酮.反应条件为:n(对甲基苯亚磺酸钠):n(氯化氰):n(1,3-环戊二烯)=0.48:1.05:1,反应温度控制在15℃,反应7h,反应中控制pH=5,可得纯度为95%的产品,收率由文献报道的64%提高到78%.

  13. Metformin Causes G1-Phase Arrest via Down-Regulation of MiR-221 and Enhances TRAIL Sensitivity through DR5 Up-Regulation in Pancreatic Cancer Cells.

    Tanaka, Ryoichi; Tomosugi, Mitsuhiro; Horinaka, Mano; Sowa, Yoshihiro; Sakai, Toshiyuki

    2015-01-01

    Although many chemotherapeutic strategies against cancer have been developed, pancreatic cancer is one of the most aggressive and intractable types of malignancies. Therefore, new strategies and anti-cancer agents are necessary to treat this disease. Metformin is a widely used drug for type-2 diabetes, and is also known as a promising candidate anti-cancer agent from recent studies in vitro and in vivo. However, the mechanisms of metformin's anti-cancer effects have not been elucidated. We demonstrated that metformin suppressed the expression of miR-221, one of the most well-known oncogenic microRNAs, in human pancreatic cancer PANC-1 cells. Moreover, we showed that the down-regulation of miR-221 by metformin caused G1-phase arrest via the up-regulation of p27, one of the direct targets of miR-221. Tumor necrosis factor-related apoptosis-inducing ligand (TRAIL) is also a promising agent for cancer treatment. While recent studies showed that treatment with only TRAIL was not effective against pancreatic cancer cells, the present data showed that metformin sensitized p53-mutated pancreatic cancer cells to TRAIL. Metformin induced the expressions of death receptor 5 (DR5), a receptor for TRAIL, and Bim with a pro-apoptotic function in the downstream of TRAIL-DR5 pathway. We suggest that the up-regulation of these proteins may contribute to sensitization of TRAIL-induced apoptosis. The combination therapy of metformin and TRAIL could therefore be effective in the treatment of pancreatic cancer. PMID:25955843

  14. A genome-wide association study identifies pancreatic cancer susceptibility loci on chromosomes 13q22.1, 1q32.1 and 5p15.33

    Petersen, Gloria M.; Amundadottir, Laufey; Fuchs, Charles S; Kraft, Peter; Stolzenberg-Solomon, Rachael Z; Jacobs, Kevin B.; Arslan, Alan A.; Bueno-de-Mesquita, H Bas; Gallinger, Steven; Gross, Myron; Helzlsouer, Kathy; Holly, Elizabeth A.; Jacobs, Eric J.; Klein, Alison P; LaCroix, Andrea

    2010-01-01

    We conducted a genome-wide association study (GWAS) of pancreatic cancer in 3,851 cases and 3,934 controls drawn from twelve prospective cohort studies and eight case-control studies. Based on a logistic regression model for genotype trend effect that was adjusted for study, age, sex, self-described ancestry and five principal components, we identified eight SNPs that map to three loci on chromosomes 13q22.1, 1q32.1 and 5p15.33. Two correlated SNPs, rs9543325 (P=3.27×10−11; per allele odds ra...

  15. Cytogenetic and clinical studies in gonadal dysgenesis with 46,X,Xt(qter leads to p221::p223 leads to qter) karyotype: review and phenotype/karyotype correlations.

    M. Ferraro; de Capoa, A.; Mostacci, C; Pelliccia, F; Zulli, P; Baldini, M A; Di Nisio, Q

    1980-01-01

    Chromosome analysis by Q, R, and C banding was performed in a case diagnosed clinically as gonadal dysgenesis and the karyotype was shown to be 46,X,Xt(qter leads to p221::p223 leads to qter). Localisation of the breakpoints in the fused X chromosomes and replication studies have led to a hypothesis on the origin of the translocation. A comparison of clinical and cytogenetical findings in this and other published cases has also been made in an attempt to detect some phenotype/karyotype correl...

  16. A genome-wide association study identifies pancreatic cancer susceptibility loci on chromosomes 13q22.1, 1q32.1 and 5p15.33

    Petersen, Gloria M.; Amundadottir, Laufey; Fuchs, Charles S.; Kraft, Peter; Stolzenberg-Solomon, Rachael Z.; Jacobs, Kevin B.; Arslan, Alan A.; Bueno-de-Mesquita, H. Bas; Gallinger, Steven; Gross, Myron; Helzlsouer, Kathy; Holly, Elizabeth A.; Jacobs, Eric J.; Klein, Alison P.; LaCroix, Andrea; Li, Donghui; Mandelson, Margaret T.; Olson, Sara H.; Risch, Harvey A.; Zheng, Wei; Albanes, Demetrius; Bamlet, William R.; Berg, Christine D.; Boutron-Ruault, Marie-Christine; Buring, Julie E.; Bracci, Paige M.; Canzian, Federico; Clipp, Sandra; Cotterchio, Michelle; de Andrade, Mariza; Duell, Eric J.; Gaziano, J. Michael; Giovannucci, Edward L.; Goggins, Michael; Hallmans, Göran; Hankinson, Susan E.; Hassan, Manal; Howard, Barbara; Hunter, David J.; Hutchinson, Amy; Jenab, Mazda; Kaaks, Rudolf; Kooperberg, Charles; Krogh, Vittorio; Kurtz, Robert C.; Lynch, Shannon M.; McWilliams, Robert R.; Mendelsohn, Julie B.; Michaud, Dominique S.; Parikh, Hemang; Patel, Alpa V.; Peeters, Petra H.M.; Rajkovic, Aleksandar; Riboli, Elio; Rodriguez, Laudina; Seminara, Daniela; Shu, Xiao-Ou; Thomas, Gilles; Tjønneland, Anne; Tobias, Geoffrey S.; Trichopoulos, Dimitrios; Van Den Eeden, Stephen K.; Virtamo, Jarmo; Wactawski-Wende, Jean; Wang, Zhaoming; Wolpin, Brian M.; Yu, Herbert; Yu, Kai; Zeleniuch-Jacquotte, Anne; Fraumeni, Joseph F.; Hoover, Robert N.; Hartge, Patricia; Chanock, Stephen J.

    2010-01-01

    We conducted a genome-wide association study (GWAS) of pancreatic cancer in 3,851 cases and 3,934 controls drawn from twelve prospective cohort studies and eight case-control studies. Based on a logistic regression model for genotype trend effect that was adjusted for study, age, sex, self-described ancestry and five principal components, we identified eight SNPs that map to three loci on chromosomes 13q22.1, 1q32.1 and 5p15.33. Two correlated SNPs, rs9543325 (P=3.27×10−11; per allele odds ratio, OR 1.26, 95% CI=1.18-1.35) and rs9564966 (P=5.86×10−8; per allele OR 1.21, 95% CI=1.13-1.30) map to a non-genic region on chromosome 13q22.1. Five SNPs on 1q32.1 map to NR5A2; the strongest signal was rs3790844 (P=2.45×10−10; per allele OR 0.77, 95% CI=0.71-0.84). A single SNP, rs401681 (P=3.66×10−7; per allele OR 1.19, 95% CI=1.11-1.27) maps to the CLPTM1L-TERT locus on 5p15.33, associated with multiple cancers. Our study has identified common susceptibility loci for pancreatic cancer that warrant follow-up studies. PMID:20101243

  17. Synthesis, structure, photoluminescence and antitumour activity of zinc complex based on 2-(2-(1H-benzo-[d]imidazol-2-yl)benzyl)-1H-benzo-[d]imidazole

    Che, Zhijian; Wang, Shaoxiang; Liu, Shenggui; Li, Guobi; Wu, Qiting; Lin, Chunyu; Kong, Linglang; Wang, Sheng

    2015-01-01

    A new complex [Zn(bbb)Cl2]·DMF, where bbb is 2-(2-(1H-benzo[d]imidazol-2-yl)benzyl)-1H-benzo[d]imidazole, was synthesized and characterized by element analysis, 1H NMR and X-ray single crystal structure analyses. For complex: crystal system, triclinic, space group, P-1, a = 9.4661(13), b = 10.3534(14), c = 13.0025(18) Å, α = 73.477(2), β = 80.743(2), γ = 88.658(2)°, V = 1205.5(3) Å3, Z = 2. In this complex, the Zn2+ distorted tetrahedron geometry is coordinated by two nitrogen atoms from 2-(2-(1H-benzo[d]imidazol-2-yl)benzyl)-1H-benzo[d]imidazole and two Cl-. The complex emits yellow green luminescence with the maximal emission peak at 550 nm in DMF solution. The complex exhibits inhibition on the growth of Eca109 cancer cell with IC50 value of 8.9 ± 1.1 μM, which was lower than that of cisplatin (14.3 ± 1.4 μM). This complex has potential application in treatment of esophageal cancer.

  18. Crystal structures of nitrato-(2-[2-(1-pyridine-2-ylethylidene)hydrazine]-1,3-benzothiazolo) aquacopper and chloro-(2-[2-phenyl(pyridine-2-ylethylidene)hydrazine]-1,3-benzothiazolo) copper

    Chumakov, Yu. M. [Academy of Sciences of Moldova, Institute of Applied Physics (Moldova, Republic of); Paholnitcaia, A. Yu. [State University of Moldova (Moldova, Republic of); Petrenko, P. A. [Academy of Sciences of Moldova, Institute of Applied Physics (Moldova, Republic of); Tsapkov, V. I., E-mail: vtsapkov@gmail.com [State University of Moldova (Moldova, Republic of); Poirier, D. [Centre Hospitalier Universitaire de Quebec (Canada); Gulea, A. P. [State University of Moldova (Moldova, Republic of)

    2015-01-15

    Two crystal modifications of nitrato-(2-[2-(1-pyridine-2-ylethylidene)hydrazine]-1,3-benzothiazolo) aquacopper (I and II) and two modifications of chloro-(2-[2-phenyl(pyridine-2-ylethylidene)hydrazine]-1,3-benzothiazolo) copper (III and IV) have been synthesized and studied by X-ray diffraction. In structures I and II, the copper atoms coordinate a monodeprotonated molecule of the organic ligand, nitrate ions, and a water molecule. In crystals of I, the complexes are monomeric, whereas complexes II are linked via nitrate ions to form polymeric chains. In both structures the coordination polyhedron of the copper atom can be described as a distorted tetragonal bipyramid—(4 + 1 + 1) in I and (4 + 2) in II. These coordination polyherdra have different compositions. In structures III and IV, the metal atoms coordinate a monodeprotonated (2-[2-phenyl(pyridine-2-ylethylidene)hydrazine]-1,3-benzothiazole molecule and chloride ions. In III the complex-forming ion has square-planar coordination geometry, whereas structure IV consists of centrosymmetric dimers with two bridging chlorine atoms. It was found that nitrato-(2-[2-(1-pyridine-2-ylethylidene)hydrazine]-1,3-benzothiazolo) aquacopper possesses antitumor activity.

  19. 北京市东城区221名1~12岁健康儿童肺炎链球菌携带状况研究%Carriage of Streptococcus pneumoniae in 221 healthy children aged 1 - 12 years in Dongcheng district, Beijing

    邸明芝; 吴疆; 黄辉; 吕敏; 张玉萍; 周云; 李侠; 闫威; 翟力军; 孙宏莉

    2012-01-01

    Objective To investigate the nasopharyngeal carriage status of Streptococcus pneumoniae in healthy children aged 1-12 years and the serotype and the antibiotic resistance of the isolated strains. Methods From October 2010 to June 2011 ,nasopharyngeal swabs were collected every two months from randomly selected 221 healthy children aged 1-12 years in Dongcheng district to isolate Streptococcus pneumoniae and identify the serotypes and test antibiotic resistance of the isolates. Results A total of 220 strains of Streptococcus pneumoniae in 32 serotypes were isolated, the cumulative carriage rate of Streptococcus pneumoniae in the healthy children was 57. 47% . The serotype coverage rate of pneumococcal 7-valent conjugate vaccine was 36. 82% and the serotype coverage rate of polysaccharide polyvalent pneumococcal vaccine was 64.55%. The antibiotic resistant strains accounted for 3.64%. Conclusion Healthy children aged 1-12 years are at high risk of Streptococcus pneumoniae infection. It is necessary to establish effective surveillance system and develop Streptococcus pneumoniae vaccine which is suitable to use in China.%目的 了解1 ~12岁健康儿童鼻咽部肺炎链球菌携带情况,及该菌血清型、耐药情况,为制定防治策略提供参考依据.方法 2010年10月至2011年6月,选取北京市东城区221名1~12岁健康儿童,每2个月采集鼻咽拭子标本1次,进行肺炎链球菌培养、血清分型及耐药性检测.结果 1 ~12岁健康儿童肺炎链球菌累计携带率为57.47%;分离到32个血清型共220株肺炎链球菌,7价肺炎球菌结合疫苗的血清型覆盖率为36.82%,23价肺炎链球菌荚膜多糖疫苗的血清型覆盖率为64.55%;耐药菌株占3.64%.结论 1~ 12岁健康儿童存在着较高肺炎链球菌疾病的风险,有必要建立科学的监测体系,研制出适合国情的肺炎链球菌疫苗.

  20. New ab initio adiabatic potential energy surfaces and bound state calculations for the singlet ground X˜ 1A1 and excited C˜ 1B2(21A') states of SO2

    Kłos, Jacek; Alexander, Millard H.; Kumar, Praveen; Poirier, Bill; Jiang, Bin; Guo, Hua

    2016-05-01

    We report new and more accurate adiabatic potential energy surfaces (PESs) for the ground X˜ 1A1 and electronically excited C˜ 1B2(21A') states of the SO2 molecule. Ab initio points are calculated using the explicitly correlated internally contracted multi-reference configuration interaction (icMRCI-F12) method. A second less accurate PES for the ground X ˜ state is also calculated using an explicitly correlated single-reference coupled-cluster method with single, double, and non-iterative triple excitations [CCSD(T)-F12]. With these new three-dimensional PESs, we determine energies of the vibrational bound states and compare these values to existing literature data and experiment.

  1. Molecular and cytogenetic characterization of a recurrent unbalanced translocation (4;21) (p16.3;q22.1): Relevance to the Wolf-Hirschhorn and Down syndrome critical regions

    Sebastio, G.; Perone, L.; Guzzetta, V. [Universita Federico II, Naples (Italy)] [and others

    1996-05-17

    We report on an aneuploidy syndrome due to the unbalanced segregation of a familial translocation (4;21)(p16.3;q22.1) causing a partial 4p monosomy and a partial 21q trisomy. The three affected children presented with severe failure to thrive, short stature, microcephaly, profound hypotonia, and mental retardation. The face, very similar in the three children, is characterized by frontal bossing, upslanting of the palpebral fissures, short nose, and deep set ears, giving the overall appearance of the Down syndrome. The molecular study has defined the aneuploid segment on both 4p and 21q. Most of the Down syndrome critical region was found to be trisomic, while only part of the candidate Wolf-Hirschhorn syndrome critical region was deleted, suggesting that this region is not critical for the major malformations characteristic for WHS. 15 refs., 5 figs., 1 tab.

  2. Reflection asymmetry in odd-A and odd-odd actinium nuclei

    Theoretical calculations and measurements indicate that octupole correlations are at a maximum in the ground states of the odd-proton nuclei Ac and Pa. It has been expected that odd-odd nuclei should have even larger amount of octupole-octupole correlations. We have recently made measurements on the structure of 224Ac. Although spin and parity assignments could not be made, two bands starting at 354.1 and 360.0 keV have properties characteristic of reflection asymmetric shape. These two bands have very similar rotational constants and also similar alpha decay rates, which suggest similarity between the wavefunctions of these bands. These signatures provide evidence for octupole correlations in these nuclides

  3. Bestimmung der Ionisationsenergie von Actinium und Ultraspurenanalyse von Plutonium mit resonanter Ionisationsmassenspektrometrie (RIMS)

    Waldek, Achim Marcus

    2001-01-01

    ZusammenfassungDie Resonanzionisationsmassenspektrometrie (RIMS) verbindet hohe Elementselektivität mit guter Nachweiseffizienz. Aufgrund dieser Eigenschaften ist die Methode für Ultraspurenanalyse und Untersuchungen an seltenen oder schwer handhabbaren Elementen gut geeignet. Für RIMS werden neutrale Atome mit monochromatischem Laserlicht ein- oder mehrfach resonant auf energetisch hoch liegende Niveaus angeregt und anschließend durch einen weiteren Laserstrahl oder durch ein elektrisches Fe...

  4. Radium-228 analysis of natural waters by Cherenkov counting of Actinium-228

    The activities of 228Ra in natural waters were determined by the Cherenkov counting of the daughter nuclide 228Ac. The radium was pre-concentrated on MnO2 and the radium purified via ion exchange and, after a 2-day period of incubation to allow for secular equilibrium between the parent-daughter 228Ra(228Ac), the daughter nuclide 228Ac was isolated by ion exchange according to the method of Nour et al. [2004. Radium-228 determination of natural waters via concentration on manganese dioxide and separation using Diphonix ion exchange resin. Appl. Radiat. Isot. 61, 1173-1178]. The Cherenkov photons produced by 228Ac were counted directly without the addition of any scintillation reagents. The optimum Cherenkov counting window, sample volume, and vial type were determined experimentally to achieve optimum Cherenkov photon detection efficiency and lowest background count rates. An optimum detection efficiency of 10.9±0.1% was measured for 228Ac by Cherenkov counting with a very low Cherenkov photon background of 0.317±0.013 cpm. The addition of sodium salicylate into the sample counting vial at a concentration of 0.1 g/mL yielded a more than 3-fold increase in the Cherenkov detection efficiency of 228Ac to 38%. Tests of the Cherenkov counting technique were conducted with several water standards of known activity and the results obtained compared closely with a conventional liquid scintillation counting technique. The advantages and disadvantages of Cherenkov counting compared to liquid scintillation counting methods are discussed. Advantages include much lower Cherenkov background count rates and consequently lower minimal detectable activities for 228Ra and no need for expensive environmentally unfriendly liquid scintillation cocktails. The disadvantages of the Cherenkov counting method include the need to measure 228Ac Cherenkov photon detection efficiency and optimum Cherenkov counting volume, which are not at all required when liquid scintillation analysis is used

  5. Linear free energy relationship applied to trivalent cations with lanthanum and actinium oxide and hydroxide structure

    Linear free energy relationships for trivalent cations with crystalline M2O3 and, M(OH)3 phases of lanthanides and actinides were developed from known thermodynamic properties of the aqueous trivalent cations, modifying the Sverjensky and Molling equation. The linear free energy relationship for trivalent cations is as ΔGf,MvX0=aMvXΔGn,M3+0+bMvX+βMvXrM3+, where the coefficients aMvX, bMvX, and βMvX characterize a particular structural family of MvX, rM3+ is the ionic radius of M3+ cation, ΔGf,MvX0 is the standard Gibbs free energy of formation of MvX and ΔGn,M3+0 is the standard non-solvation free energy of the cation. The coefficients for the oxide family are: aMvX=0.2705, bMvX=-1984.75 (kJ/mol), and βMvX=197.24 (kJ/molnm). The coefficients for the hydroxide family are: aMvX=0.1587, bMvX=-1474.09 (kJ/mol), and βMvX=791.70 (kJ/molnm).

  6. Actinium: A RESTful Runtime Container for Scriptable Internet of Things Applications

    Kovatsch, Matthias; Lanter, Martin; Duquennoy, Simon

    2012-01-01

    Programming Internet of Things (IoT) applications is challenging because developers have to be knowledgeable in various technical domains, from low-power networking, over embedded operating systems, to distributed algorithms. Hence, it will be challenging to find enough experts to provide software for the vast number of expected devices, which must also be scalable and particularly safe due to the connection to the physical world. To remedy this situation, we propose an architecture that pr...

  7. New method for large scale production of medically applicable Actinium-225 and Radium-223

    Alpha-emitters (211At, 212Bi, 213Bi, 223Ra, 225Ac) are promising for targeted radiotherapy of cancer. Only two alpha decays near a cell membrane result in 50% death of cancer cell and only a single decay inside the cell is required for this. 225Ac may be used either directly or as a mother radionuclide in 213Bi isotope generator. Production of 225Ac is provided by three main suppliers - Institute for Transuranium Elements in Germany, Oak Ridge National Laboratory in USA and Institute of Physics and Power Engineering in Obninsk, Russia. The current worldwide production of 225Ac is approximately 1.7 Ci per year that corresponds to only 100-200 patients that could be treated annually. The common approach for 225Ac production is separation from mother 229Th or irradiation of 226Ra with protons in a cyclotron. Both the methods have some practical limitations to be applied routinely. 225Ac can be also produced by irradiation of natural thorium with medium energy protons . Cumulative cross sections of 225Ac, 227Ac, 227Th, 228Th formations have been obtained recently. Thorium targets (1-9 g) were irradiated by 114-91 MeV proton beam (1-50 μA) at INR linear accelerator. After dissolution in 8 M HNO3 + 0.004 M HF thorium was removed by double LLX by HDEHP in toluene (1:1). Ac and REE were pre-concentrated and separated from Ra and most fission products by DGA-Resin (Triskem). After washing out by 0.01 M HNO3 Ac was separated from REE by TRU Resin (Triskem) in 3 M HNO3 media. About 6 mCi 225Ac were separated in hot cell with chemical yield 85%. The method may be upscaled for production of Ci amounts of the radionuclide. The main impurity is 227Ac (0.1% at the EOB) but it does not hinder 225Ac from being used for medical 225Ac/213Bi generators. (author)

  8. Synthesis of chelating agents for actinium 225 complexation and its application in radioimmunotherapy

    Immunotherapy with radiolabeled antibodies should allow fairly specific targeting of certain cancers. However, iodine 131 may not be the best isotope for tumor therapy because of its limited specific activity, low beta-energy, relatively long half life and strong gamma emission. Another approach to improve therapeutic efficacy is the use of replacement isotopes with better physical properties. Chelator that can hold radio-metals with high stability under physiological conditions are essential to avoid excessive damage to non-target cells; Moreover, the development of new bifunctional chelating agents is essential for this purpose. Accordingly, our efforts have been directed, for several years, to the synthesis of original chelating agents likely to form stable complexes in vivo with the numerous potential candidates for such applications. Therefore, we have developed a new simple and efficient synthesis pathway of 2-(4-iso-thio-cyanate-benzyl)-1,4,7,10,13,16- hexa-aza-cyclo-hexadecane- 1,4,7,10,13,16-hexa-acetic acid, though functionalized on the cycle by a termination allowed coupling to an antibody or any other biological substance such as a hapten. (author)

  9. Purification of selenium from thorium, uranium, radium, actinium and potassium impurities for low background measurements

    A technique of selenium purification from 232Th, 238U, 226,228Ra, 227Ac and 40K was developed. This technique is simple to perform and employs a minimum number of highly pure reagents (bidistilled water, nitric acid). Operations carried out during purification (elution, evaporation) practically exclude losses of the target product (chemical yields of Se > 99%). A test purification of 100 g of selenium was carried out using this technique. The efficiency of this technique was confirmed by low background gamma spectrometry of the purified selenium sample. Distribution coefficients of Th, U, Ra and Ac on DOWEX 50W- x 8 cation-exchange resin at different concentrations of selenium and nitric acid were experimentally determinated. Instrumental neutron activation analysis of bidistilled water, deionized water and nitric acid was performed. (orig.)

  10. Purification of selenium from thorium, uranium, radium, actinium and potassium impurities for low background measurements

    Rakhimov, A.V. [Joint Institute for Nuclear Research (JINR), Dubna (Russian Federation); Uzbek Academy of Sciences, Tashkent (Uzbekistan). Inst. of Nuclear Physics (INP AS RUz); Warot, G. [CEA-CNRS, Modane (France). Laboratoire Souterrain de Modane (LSM); Karaivanov, D.V. [Joint Institute for Nuclear Research (JINR), Dubna (Russian Federation); Institute for Nuclear Research and Nuclear Energy (INRNE), Sofia (Bulgaria); Kochetov, O.I.; Lebedev, N.A.; Filosofov, D.V. [Joint Institute for Nuclear Research (JINR), Dubna (Russian Federation); Mukhamedshina, N.M.; Sadikov, I.I. [Uzbek Academy of Sciences, Tashkent (Uzbekistan). Inst. of Nuclear Physics (INP AS RUz)

    2013-07-01

    A technique of selenium purification from {sup 232}Th, {sup 238}U, {sup 226,228}Ra, {sup 227}Ac and {sup 40}K was developed. This technique is simple to perform and employs a minimum number of highly pure reagents (bidistilled water, nitric acid). Operations carried out during purification (elution, evaporation) practically exclude losses of the target product (chemical yields of Se > 99%). A test purification of 100 g of selenium was carried out using this technique. The efficiency of this technique was confirmed by low background gamma spectrometry of the purified selenium sample. Distribution coefficients of Th, U, Ra and Ac on DOWEX 50W- x 8 cation-exchange resin at different concentrations of selenium and nitric acid were experimentally determinated. Instrumental neutron activation analysis of bidistilled water, deionized water and nitric acid was performed. (orig.)

  11. Protective Efficacy of Recombinant Turkey Herpes Virus (rHVT-H5) and Inactivated H5N1 Vaccines in Commercial Mulard Ducks against the Highly Pathogenic Avian Influenza (HPAI) H5N1 Clade 2.2.1 Virus

    Kilany, Walid H.; Safwat, Marwa; Mohammed, Samy M.; Salim, Abdullah; Fasina, Folorunso Oludayo; Fasanmi, Olubunmi G.; Shalaby, Azhar G.; Dauphin, Gwenaelle; Hassan, Mohammed K.; Lubroth, Juan; Jobre, Yilma M.

    2016-01-01

    In Egypt, ducks kept for commercial purposes constitute the second highest poultry population, at 150 million ducks/year. Hence, ducks play an important role in the introduction and transmission of avian influenza (AI) in the Egyptian poultry population. Attempts to control outbreaks include the use of vaccines, which have varying levels of efficacy and failure. To date, the effects of vaccine efficacy has rarely been determined in ducks. In this study, we evaluated the protective efficacy of a live recombinant vector vaccine based on a turkey Herpes Virus (HVT) expressing the H5 gene from a clade 2.2 H5N1 HPAIV strain (A/Swan/Hungary/499/2006) (rHVT-H5) and a bivalent inactivated H5N1 vaccine prepared from clade 2.2.1 and 2.2.1.1 H5N1 seeds in Mulard ducks. A 0.3ml/dose subcutaneous injection of rHVT-H5 vaccine was administered to one-day-old ducklings (D1) and another 0.5ml/dose subcutaneous injection of the inactivated MEFLUVAC was administered at 7 days (D7). Four separate challenge experiments were conducted at Days 21, 28, 35 and 42, in which all the vaccinated ducks were challenged with 106EID50/duck of H5N1 HPAI virus (A/chicken/Egypt/128s/2012(H5N1) (clade 2.2.1) via intranasal inoculation. Maternal-derived antibody regression and post-vaccination antibody immune responses were monitored weekly. Ducks vaccinated at 21, 28, 35 and 42 days with the rHVT-H5 and MEFLUVAC vaccines were protected against mortality (80%, 80%, 90% and 90%) and (50%, 70%, 80% and 90%) respectively, against challenges with the H5N1 HPAI virus. The amount of viral shedding and shedding rates were lower in the rHVT-H5 vaccine groups than in the MEFLUVAC groups only in the first two challenge experiments. However, the non-vaccinated groups shed significantly more of the virus than the vaccinated groups. Both rHVT-H5 and MEFLUVAC provide early protection, and rHVT-H5 vaccine in particular provides protection against HPAI challenge. PMID:27304069

  12. Efficient transport of Am(III) from nitric acid medium using a new conformationally constrained (N,N,N',N'-tetra-2-ethylhexyl)7-oxabicyclo[2.2.1]heptane-2,3-dicarboxamide across a supported liquid membrane.

    Sharma, S; Panja, S; Ghosh, S K; Dhami, P S; Gandhi, P M

    2016-03-15

    Am(III) is one of the most hazardous radionuclide present in nuclear fuel cycle. A new conformationally constrained diamide, (N,N,N',N'-tetra-2-ethylhexyl)7-oxabicyclo[2.2.1]heptane-2,3-dicarboxamide (OBDA) was studied for Am(III) transport from HNO3 medium across a Supported Liquid Membrane. Transport rate was observed to be significantly fast with ∼95% transport of Am(III) within 1h using 0.1M OBDA in the presence of 15% isodecyl alcohol (IDA)/n-dodecane as carrier. The mechanism of transport was investigated by studying various parameters like feed HNO3/NaNO3 concentration, OBDA concentration in the membrane, membrane pore size, membrane thickness etc. From these studies, the mechanism of transport was found to be diffusion controlled with diffusion co-efficient value of 5.1×10(-6)cm(2)/s. The membrane was found to be highly selective for tri- and tetra-valent actinides, and trivalent lanthanides. OBDA based membrane was found to be stable for at least for ten consecutive cycles of operation. PMID:26685064

  13. A Massive Molecular Gas Reservoir in the z=2.221 Type-2 Quasar Host Galaxy SMM J0939+8315 Lensed by the Radio Galaxy 3C220.3

    Leung, T K Daisy

    2016-01-01

    We report the detection of CO(J=3-2) line emission in the strongly-lensed submillimeter galaxy (SMG) SMM J0939+8315 at z=2.221, using the Combined Array for Research in Millimeter-wave Astronomy. SMM J0939+8315 hosts a type-2 quasar, and is gravitationally lensed by the radio galaxy 3C220.3 and its companion galaxy at z=0.685. The 104 GHz continuum emission underlying the CO line is detected toward 3C220.3 with an integrated flux density of S_cont = 7.4 +/- 1.4 mJy. Using the CO(J=3-2) line intensity of I_(CO(3-2)) = (12.6 +/- 2.0) Jy km s^-1, we derive a lensing- and excitation-corrected CO line luminosity of L'(CO(3-2)) = (3.4 +/- 0.7) x 10^10 (10.1/mu_L) K km s^-1 pc^2 for the SMG, where mu_L is the lensing magnification factor inferred from our lens modeling. This translates to a molecular gas mass of M_gas = (2.7 +/- 0.6) x 10^10 (10.1/mu_L) Msun. Fitting spectral energy distribution models to the (sub)-millimeter data of this SMG yields a dust temperature of T = 63.1^{+1.1}_{-1.3} K, a dust mass of M_du...

  14. Cloning of the cDNA for the human ATP synthase OSCP subunit (ATP5O) by exon trapping and mapping to chromosome 21q22.1-q22.2

    Chen, Haiming [Geneva Univ. Medical School (Switzerland); Morris, M.A.; Rossier, C. [Cantonal Hospital, Geneva (Switzerland)] [and others

    1995-08-10

    Exon trapping was used to clone portions of potential genes from human chromosome 21. One trapped sequence showed striking homology with the bovine and rat ATP synthase OSCP (oligomycin sensitivity conferring protein) subunit. We subsequently cloned the full-length human ATP synthase OSCP cDNA (GDB/HGMW approved name ATP50) from infant brain and muscle libraries and determined its nucleotide and deduced amino acid sequence (EMBL/GenBank Accession No. X83218). The encoded polypeptide contains 213 amino acids, with more than 80% identity to bovine and murine ATPase OSCP subunits and over 35% identity to Saccharomyces cerevisiae and sweet potato sequences. The human ATP5O gene is located at 21q22.1-q22.2, just proximal to D21S17, in YACs 860G11 and 838C7 of the Chumakov et al. YAC contig. The gene is expressed in all human tissues examined, most strongly in muscle and heart. This ATP5O subunit is a key structural component of the stalk of the mitochondrial respiratory chain F{sub 1}F{sub 0}-ATP synthase and as such may contribute in a gene dosage-dependent manner to the phenotype of Down syndrome (trisomy 21). 39 refs., 5 figs.

  15. A rare mosaic interstitial deletion of 7q, 46,XX/46,XX,del(7)(q22.1q31.33), results in a mild clinical phenotype

    Shapira, S.K.; Kochanek, S.; Shaffer, L.G. [Baylor College of Medicine, Houston, TX (United States)

    1994-09-01

    Constitutional mosaic structural rearrangements, including deletions, are extremely rare in the population. We present a case of mosaicism for a deletion of chromosome 7q. The patient`s phenotype is much milder than that of non-mosaic patients with a similar deletion of 7q. A 6 and 9/12-year-old Caucasian girl was evaluated because of attention deficit disorder and speech delay. She was born at 38 weeks gestation to her 37 year old G2P2 mother. Her birth weight was 2.2 kg (3rd centile), length was 47 cm (10th-25th centile), and OFC was 30.5 cm (<10th centile). Her motor development was normal. Her speech development was profoundly delayed with her first words spoken at 3 years, and 2-3 word sentences spoken at 5-6 years. At 6 and 9/12 years, she manifested mild mental retardation and profound speech delay, but only mildly dysmorphic features (protuberant ears with under-developed antihelices, flattened forehead, moderate micro-retrognathia). Height, weight, and OFC were at the 10th centile. Chromosomal analysis showed the presence of two cell lines, with 66% of the lymphocytes having a 46,XX pattern and 33% having a 46,XX,del(7)(q22.1q31.33) karyotype. Less than 20 cases of interstitial 7q deletions extending from bands 7q21 or 7q22 to 7q31 or 7q32 have been reported. Our patient represents the first documented case with a mosaic interstitial deletion of chromosome 7q. Furthermore, the deletion resulted in a relatively mild phenotype when compared to reported non-mosaic interstitial 7q deletions, and thus expands the range of clinical heterogeneity that can be anticipated in interstitial deletion patients.

  16. Inquiry of the electron density transfers in chemical reactions: a complete reaction path for the denitrogenation process of 2,3-diazabicyclo[2.2.1]hept-2-ene derivatives.

    Safont, Vicent S; González-Navarrete, Patricio; Oliva, Mónica; Andrés, Juan

    2015-12-28

    A detailed study on all stages associated with the reaction mechanisms for the denitrogenation of 2,3-diazabicyclo[2.2.1]hept-2-ene derivatives (DBX, with X substituents at the methano-bridge carbon atom, X = H and OH) is presented. In particular, we have characterized the processes leading to cycloalkene derivatives through migration-type mechanisms as well as the processes leading to cyclopentil-1,3-diradical species along concerted or stepwise pathways. The reaction mechanisms have been further analysed within the bonding evolution theory framework at B3LYP and M05-2X/6-311+G(2d,p) levels of theory. Analysis of the results allows us to obtain the intimate electronic mechanism for the studied processes, providing a new topological picture of processes underlying the correlation between the experimental measurements obtained by few-optical-cycle visible pulse radiation and the quantum topological analysis of the electron localization function (ELF) in terms of breaking/forming processes along this chemical rearrangement. The evolution of the population of the disynaptic basin V(N1,N2) can be related to the experimental observation associated with the N=N stretching mode evolution, relative to the N2 release, along the reaction process. This result allows us to determine why the N2 release is easier for the DBH case via a concerted mechanism compared to the stepwise mechanism found in the DBOH system. This holds the key to unprecedented insight into the mapping of the electrons making/breaking the bonds while the bonds change. PMID:26584857

  17. 46 CFR 221.83 - Witnesses.

    2010-10-01

    ... Witnesses. A Party may present the testimony of any witness either through a personal appearance or through... personal appearance of a witness. The request must be in writing and state the reasons why a written statement would be inadequate, the issue or issues to which the testimony would be relevant, and...

  18. 14 CFR 221.3 - Definitions.

    2010-01-01

    ...) related element associated with that tariff price or charge. SFFL means the Standard Foreign Fare Level as..., including the Territorial waters and the overlying air space thereof. Warsaw Convention means the...

  19. 39 CFR 221.6 - Field organization.

    2010-07-01

    ... functional units responsible for finance, human resources, marketing, and operations support. (2) Reporting... support, finance, human resources, information technology, administrative support, and marketing. (2... assigned, Headquarters field units are responsible for legal services, corporate relations, human...

  20. 49 CFR 107.221 - Determination.

    2010-10-01

    ... considering the application and other relevant information received or obtained during the proceeding, the...) The determination includes a written statement setting forth relevant facts and legal bases and... achieves its stated purpose. (4) Whether there is need for uniformity with regard to the subject...

  1. 44 CFR 206.221 - Definitions.

    2010-10-01

    ... public, and such facilities on Indian reservations. Further definition is as follows: (1) Educational... support, which are used to provide institutional care for persons who require close supervision and...

  2. Sentencia no. c-221/94

    Constitucional, Corte

    2010-01-01

    Drogradicción. Comportamiento personal. Dentro de un sistema penal liberal y democrático, como el que tiene que desprenderse de una Constitución del mismo sello, debe estar proscrito el peligrosismo, tan caro al positivismo penal, hoy por ventura ausente de todos los pueblos civilizados. Porque a una persona no pueden castigarla por lo que posiblemente hará, sino por lo que efectivamente hace. A menos que el ser drogadicto se considere en sí mismo punible, así ese comportamiento no trascienda...

  3. 46 CFR 221.63 - Investigation.

    2010-10-01

    ... investigate the matter and decide whether there is sufficient evidence to establish a prima facie case that a violation occurred. (b) If that Officer decides there is a prima facie case, then that Officer may...

  4. QTL Information Table: 221 [Q-TARO

    Full Text Available qALSRL-9 Resistance or Tolerance Other soil stress tolerance stress root length Mixture C)Interv ... g of genes controlling aluminum tolerance in rice: comparison ... of different genetic backgrounds. Mol Genet Genomi ...

  5. 22 CFR 221.01 - Definitions.

    2010-04-01

    ... Government. (l) Guarantee payment date means a Business Day not more than three (3) Business Days after the... Eligible Notes required to be maintained by the Fiscal Agent. (d) Borrower means the Government of Israel... government or any agency or political subdivision thereof....

  6. Purification of radium-226 for the manufacturing of actinium-225 in a cyclotron for alpha-immunotherapy; Radium-Aufreinigung zur Herstellung von Actinium-225 am Zyklotron fuer die Alpha-Immuntherapie

    Marx, Sebastian Markus

    2014-09-23

    The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.

  7. Renal uptake of bismuth-213 and its contribution to kidney radiation dose following administration of actinium-225-labeled antibody

    Schwartz, J; O' Donoghue, J A; Humm, J L [Department of Medical Physics, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); Jaggi, J S [Bristol-Myers Squibb, Plainsboro, NJ (United States); Ruan, S; Larson, S M [Nuclear Medicine Service Department of Radiology, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); McDevitt, M; Scheinberg, D A, E-mail: schwarj1@mskcc.org [Molecular Pharmacology and Chemistry, Sloan-Kettering Institute, 1275 York Avenue, New York, NY 10065 (United States)

    2011-02-07

    Clinical therapeutic studies using {sup 225}Ac-labeled antibodies have begun. Of major concern is renal toxicity that may result from the three alpha-emitting progeny generated following the decay of {sup 225}Ac. The purpose of this study was to determine the amount of {sup 225}Ac and non-equilibrium progeny in the mouse kidney after the injection of {sup 225}Ac-huM195 antibody and examine the dosimetric consequences. Groups of mice were sacrificed at 24, 96 and 144 h after injection with {sup 225}Ac-huM195 antibody and kidneys excised. One kidney was used for gamma ray spectroscopic measurements by a high-purity germanium (HPGe) detector. The second kidney was used to generate frozen tissue sections which were examined by digital autoradiography (DAR). Two measurements were performed on each kidney specimen: (1) immediately post-resection and (2) after sufficient time for any non-equilibrium excess {sup 213}Bi to decay completely. Comparison of these measurements enabled estimation of the amount of excess {sup 213}Bi reaching the kidney ({gamma}-ray spectroscopy) and its sub-regional distribution (DAR). The average absorbed dose to whole kidney, determined by spectroscopy, was 0.77 (SD 0.21) Gy kBq{sup -1}, of which 0.46 (SD 0.16) Gy kBq{sup -1} (i.e. 60%) was due to non-equilibrium excess {sup 213}Bi. The relative contributions to renal cortex and medulla were determined by DAR. The estimated dose to the cortex from non-equilibrium excess {sup 213}Bi (0.31 (SD 0.11) Gy kBq{sup -1}) represented {approx}46% of the total. For the medulla the dose contribution from excess {sup 213}Bi (0.81 (SD 0.28) Gy kBq{sup -1}) was {approx}80% of the total. Based on these estimates, for human patients we project a kidney-absorbed dose of 0.28 Gy MBq{sup -1} following administration of {sup 225}Ac-huM195 with non-equilibrium excess {sup 213}Bi responsible for approximately 60% of the total. Methods to reduce renal accumulation of radioactive progeny appear to be necessary for the success of {sup 225}Ac radioimmunotherapy.

  8. Purification of radium-226 for the manufacturing of actinium-225 in a cyclotron for alpha-immunotherapy

    The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.

  9. Distribution of trace elements in land plants and botanical taxonomy with special reference to rare earth elements and actinium

    Distribution profiles of trace elements in land plants were studied by neutron activation analysis and radioactivity measurements without activation. Number of botanical samples analyzed were more than three thousand in which more than three hundred botanical species were included. New accumulator plants of Co, Cr, Zn, Cd, rare earth elements, Ac, U, etc., were found. Capabilities of accumulating trace elements can be related to the botanical taxonomy. Discussions are given from view points of inorganic chemistry as well as from botanical physiology

  10. 49 CFR 571.221 - Standard No. 221; School bus body joint strength.

    2010-10-01

    ... homogeneous material or from a single piece of composite material such as plywood. Body panel means a body... component, including but not limited to floor panels, and body panels made of composite materials such as... that encloses the bus occupant space, including the floor, but excluding the bumpers and chassis...

  11. Identification of 2-(2-(1-naphthoyl)-8-fluoro-3,4-dihydro-1H-pyrido[4,3-b]indol-5(2H)-yl)acetic acid (setipiprant/ACT-129968), a potent, selective, and orally bioavailable chemoattractant receptor-homologous molecule expressed on Th2 cells (CRTH2) antagonist.

    Fretz, Heinz; Valdenaire, Anja; Pothier, Julien; Hilpert, Kurt; Gnerre, Carmela; Peter, Oliver; Leroy, Xavier; Riederer, Markus A

    2013-06-27

    Herein we describe the discovery of the novel CRTh2 antagonist 2-(2-(1-naphthoyl)-8-fluoro-3,4-dihydro-1H-pyrido[4,3-b]indol-5(2H)-yl)acetic acid 28 (setipiprant/ACT-129968), a clinical development candidate for the treatment of asthma and seasonal allergic rhinitis. A lead optimization program was started based on the discovery of the recently disclosed CRTh2 antagonist 2-(2-benzoyl-3,4-dihydro-1H-pyrido[4,3-b]indol-5(2H)-yl)acetic acid 5. An already favorable and druglike profile could be assessed for lead compound 5. Therefore, the lead optimization program mainly focused on the improvement in potency and oral bioavailability. Data of newly synthesized analogs were collected from in vitro pharmacological, physicochemical, in vitro ADME, and in vivo pharmacokinetic studies in the rat and the dog. The data were then analyzed using a traffic light selection tool as a visualization device in order to evaluate and prioritize candidates displaying a balanced overall profile. This data-driven process and the excellent results of the PK study in the rat (F = 44%) and the dog (F = 55%) facilitated the identification of 28 as a potent (IC50 = 6 nM), selective, and orally available CRTh2 antagonist. PMID:23721423

  12. 24 CFR 221.325 - Cancellation of hazard insurance.

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Cancellation of hazard insurance... Cancellation of hazard insurance. The provisions of § 203.382 of this chapter are incorporated by reference and shall apply to hazard insurance policies carried solely for the family unit....

  13. 24 CFR 884.221 - Continued family participation.

    2010-04-01

    ... Continued family participation. A Family must continue to occupy its approved unit to remain eligible for participation in the Housing Assistance Payments Program except that if the Family (a) wishes to vacate its unit... unit, the Family should give reasonable notice of the circumstances to HUD or to the PHA,...

  14. Safety evaluation for packaging (onsite) 221 T sodium tanks

    This safety evaluation for packaging (SEP) allows the transport of approximately 820 kg (1800 lb) of solid sodium between the 200 W Area and the 337 Building in the 300 Area of Hanford to be processed for disposal. This SEP authorizes a one-time shipment

  15. Dicty_cDB: SHG221 [Dicty_cDB

    Full Text Available CO) mRNA, complete cds. 66 1e-33 6 AY250116 |AY250116.1 Lycopersicon pennellii aconitase mRNA, partial cds. ...60 7e-26 5 AY250115 |AY250115.1 Lycopersicon pennellii aconitase mRNA, partial cds. 60 2e-21 5 D29629 |D2962...925204.1 EST545093 tomato flower, buds 0-3 mm Lycopersicon esculentum cDNA clone cTOA25H12 5' end, mRNA sequ...ence. 58 8e-19 3 BI930520 |BI930520.1 EST550409 tomato flower, 8 mm to preanthesis buds Lycopersicon esculen...ame C: f*fi*itlllkddnk*si**skgcikitrsnl*fl*sfktsrpkn*kitilh*nsfgiss s*l**l*strkrc*kylklgkhck*s*nsfqtsksiitrfywctssc*scsner

  16. Dicty_cDB: VFH221 [Dicty_cDB

    Full Text Available 2001. 6. 1 Translated Amino Acid sequence *TTMGKEKTHINIVVIGHVDAGKSTTT... 240 4e-63 VFO873 (VFO873Q) /CSM/VF/VFO8-D/VFO873Q.Seq.d/ 240 4e-63 own update 2002.12.17 Homology vs DNA Score E Sequences produci...; Short... 77 1e-13 FB784589_1( FB784589 |pid:none) Sequence 3862 from Patent WO200803... 77 1e-13 FB784751_...1( FB784751 |pid:none) Sequence 4024 from Patent WO200803... 77 1e-13 BT070606_1( BT070606 |pid:none) Picea sitchen...sis clone WS02736_O15... 77 1e-13 FB784741_1( FB784741 |pid:none) Sequence 4014 from Patent WO200803...

  17. 7 CFR 1280.221 - Prohibition on use of funds.

    2010-01-01

    ... PROMOTION, RESEARCH, AND INFORMATION ORDER Lamb Promotion, Research, and Information Order Assessments... to undertake any action for the purpose of influencing legislation or governmental action or...

  18. 24 CFR 221.753 - Termination of mortgage insurance.

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Termination of mortgage insurance... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES LOW COST AND MODERATE INCOME MORTGAGE INSURANCE-SAVINGS CLAUSE Contract Rights and...

  19. 22 CFR 22.1 - Schedule of fees.

    2010-04-01

    ... site (22 CFR 51.56(b)) (not applicable abroad) 60 4. Exemptions: The following applicants are exempted... for A, G, C-3, NATO and diplomatic visas as defined in 22 CFR 41.26 No fee. (b) Applicants for J visas... by an order of Federal court on behalf of an indigent party No fee. (Items nos. 54 through 60...

  20. 40 CFR 94.221 - Application of good engineering judgment.

    2010-07-01

    ... judgment in making all decisions called for under this part, including but not limited to selections... was not made in good faith, or that the decision was not made with a rational basis, the Administrator... Administrator may reject any such decision by a manufacturer if it is not based on good engineering judgment...

  1. Dicty_cDB: CHG221 [Dicty_cDB

    Full Text Available vreelscritgl*vyltk**paatirwimaerl*vrihsrnanqml*svnvvg nirllvgdhfql*ti*liavtlqfpsg...stlnhminrcytavsfrllwwvakf*fissfrstlrl*ttik*trccklp ssvqlrgveafplvlkmancckccktkdscncckdscscpkeqqieckcsscscent...qgt*agfrps*drlvlpyccqlf a***hdlvreelscritgl*vyltk**paatirwimaerl*vrihsrnanqml*svnvvg nirllvgdhfql*ti*liavtlq...nrm*mlfmlm*khm*q nmwmdkkcvqn Frame B: camknrss*waifgkqnwrcglnqilg*dv*hslidttkgvsslrqqdgghgsryplrsv *qltcqmdx...OGRESS ***, 13 unordered pieces. 248 0.0 9 AL158197 |AL158197.26 Human DNA sequence *** SEQUENCING IN PROGRE

  2. Dicty_cDB: VHB221 [Dicty_cDB

    Full Text Available ykisyigyvvyfcvwvdfiiylf*ssflfviyfifitqnthkththknthshin kytiikeerkwrkerv...xlq*ink*i Frame C: f**qsnirflildtwctfvfgwillfiyfnhhfyl*yisflshkthtkhtltkththt*i ntq**kkkengekkeyifck***r*yii...il*tsngri *tkdrttlitrclysrgssrq**tttnstsir**yw*ikeieiitq*ke*rylfdstlsr *itiscrtitisktic*iirtk*feinrnqtilynlq...lvn*rn*nyysikrieisl*fnvism nyhlvpnyynikdnllnypnkvvrn*pkpdntiqptiplkirkhf*kmnsqfsiqfnpni a*lclqqiiknyslnqwik...yflqmivkiihhqei*vvlqnvvqlhqvrlqmhvkesyhk*lml nrnrnikkllnf*lqvvilehvfqvyhhlikllvawlgqsllqmlmltliy

  3. 34 CFR 685.221 - Income-based repayment plan.

    2010-07-01

    ... poverty guideline for the borrower's family size; or (ii) For a married borrower who files a joint Federal... for the borrower's family size. (5) Poverty guideline refers to the income categorized by State and family size in the poverty guidelines published annually by the United States Department of Health...

  4. 47 CFR 1.221 - Notice of hearing; appearances.

    2010-10-01

    ... resubmitted with the FRN within ten (10) business days of the date of notification. (g) In comparative... specified at a later date.) (4) A statement as to the legal authority and jurisdiction under which...

  5. 14 CFR 93.221 - Transfer of slots.

    2010-01-01

    ..., Office of the Chief Counsel, Federal Aviation Administration, 800 Independence Ave., SW., Washington, DC... of this paragraph (e), notice to ATC shall be submitted in writing to: Director, Air Traffic System Management, ATM-1, Federal Aviation Administration, 800 Independence Avenue SW., Washington, DC 20591....

  6. 1935 15' Quad #221 Aerial Photo Mosaic Index

    Earth Data Analysis Center, University of New Mexico — Aerial Photo Reference Mosaics contain aerial photographs that are retrievable on a frame by frame basis. The inventory contains imagery from various sources that...

  7. 29 CFR 778.221 - “Call-back” pay.

    2010-07-01

    ... any employee called back to work outside his scheduled hours. The employees covered by the agreement, who are entitled to overtime pay after 40 hours a week, normally work 8 hours each day, Monday through... which an employee receives on infrequent and sporadic occasions when, after his scheduled hours of...

  8. Dicty_cDB: VHF221 [Dicty_cDB

    Full Text Available --- ---*inclpxylrtnllsrnycprkrywwylictqss*rycyw*rtsyrfpiiicqssft sirixrfhr*ftfphcrssfptmclrslg...9) RecName: Full=Elongation factor 2; Short=EF-2;... 228 2e-58 DQ357217_1( DQ357217 |pid:none) Leishmania brazili...ensis elongation... 227 5e-58 AM494972_26( AM494972 |pid:none) Leishmania brazili...*ificitslrnakgrqitswlyftrifnqsyrfprsr*fq frsnccppcy*wcfsryrlrrrclrtnrncitssrr*tyqtslirqqsrsflir...7e-58 CT005272_19( CT005272 |pid:none) Leishmania major strain Friedlin,... 226 7e-58 protein update 2009. 7

  9. Study on laser atomic spectroscopy

    Laser atomic spectroscopic study on actinium element has been performed in many areas of spectroscopy. The study on characteristic of atomic vapor has been proceeded for copper atom and the spatial density distribution of copper vapor is measured. This experimental data has been compared with the theoretically calculated data. In spectroscopic experiment, the first and second excited states for actinium element are identified and the most efficient ionization scheme for actinium element is identified. In addition, the corrosion problem for filament material due to the heating of the actinium element has been studied. (Author)

  10. Removal of actinium from europium for the determination of specific radioactivity of ultra low-level Eu-152 in a sample exposed to atomic-bomb neutrons in Nagasaki

    Measurements of specific radioactivities of residual neutron-induced radionuclides such as 152Eu and 60Co have been carried out to check the validity of a series of computer calculations employed for the atomic-bomb neutron dosimetry in Hiroshima (exposed to uranium bomb) and Nagasaki (exposed to plutonium bomb). The use of these nuclides for atomic-bomb neutron dosimetry, however, has been limited by the following difficulties: (1) today, these radionuclides are found only at extremely low concentrations in materials exposed to the atomic-bomb and (2) the neutrons that induced these radionuclides were thermal and epithermal, while the neutron dose received in Hiroshima and Nagasaki is attributable to fast neutrons. In order to overcome the first difficulty, we established a chemical procedure to extract Eu and Co from materials exposed to the atomic-bomb, and the chemical procedure has been successful for the materials exposed to atomic-bomb within 1400 m in slant distance from the explosion point. As for Nagasaki, materials exposed in the distances farther than 1200 m have never been subjected to the measurement of residual neutron-induced radionuclides. In this work, determination of specific radioactivity of 152Eu (half-life: 13.542 y) in a sample exposed to Nagasaki atomic-bomb at a distant place from the explosion point was undertaken. But, because of radioactive decay during this ∝60 years since 1945 and long distance from the explosion point, the present specific radioactivity of 152Eu in the sample is extremely low (estimated to be ∝3 x 10-4 Bq-152Eu/mg-Eu), and a serious problem is interferences from daughters of 227Ac (half-life: 21.8 y) in the measurement of ultra low-level radioactivity of 152Eu. Hence, our chemical procedure to obtain Eu-enriched counting source should be improved, and much attention is being denoted to removal of Ac from Eu. (orig.)

  11. 49 CFR 375.221 - May I use a charge or credit card plan for payments?

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false May I use a charge or credit card plan for... card plan for payments? (a) You may provide in your tariff for the acceptance of charge or credit cards for the payment of freight charges. Accepting charge or credit card payments is different...

  12. 49 CFR Appendix B to Part 221 - Approved Rear End Marking Devices

    2010-10-01

    .... 06460. FRA identification Nos. FRA-ATK-TL-3895-1, FRA-ATK-TL-4491-2, FRA-ATK-TL-4491-3, and FRA-ATK-TL... Parkway, Plano, Tex. 75074. FRA identification No. FRA-ATK-LUM-0101890-001. Manufacturer: (c) Whelen Engineering Co., Inc., Deep River, Conn. 06417. FRA identification No. FRA-ATK-WHE-WERT-12....

  13. SU-E-T-221: Investigation of Lower Energy (< 6 MV) Photon Beams for Cancer Radiotherapy

    Zhang, Y; Ming, X [Tianjin University, Tianjin (China); New Haven Hospital, New Haven, CT (United States); Feng, Y [Tianjin University, Tianjin (China); East Carolina University, Rockville, MD (United States); Zhou, L [New Haven Hospital, New Haven, CT (United States); West China Hospital, Sichuan University, Chengdu, Sichuan (China); Ahmad, M; Deng, J [New Haven Hospital, New Haven, CT (United States); Nguyen, K; Griffin, M [William Backus Hospital, Norwich, CT (United States)

    2014-06-01

    Purpose: To study the potential applications of the lower energy (< 6MV) photon beams in the radiotherapeutic management of pediatric cancer and lung cancer patients. Methods: Photon beams of 2, 3, 4, 5 and 6MV were first simulated with EGS4/BEAM and then used for Monte-Carlo dose calculations. For four pediatric patients with abdominal and brain lesions, six 3D-conformal radiotherapy (3DCRT) plans were generated using single photon energy (2 to 6MV) or mixed energies (3 and 6MV). Furthermore, a virtual machine of 3 and 6MV was commissioned in a treatment planning system (TPS) based on Monte-Carlo simulated data. Three IMRT plans of a lung cancer patient were generated on this virtual machine. All plans were normalized to D95% of target dose for 6MV plan and then compared in terms of integral dose and OAR sparing. Results: For the four pediatric patients, the integral dose for the 2, 3, 4 and 5MV plans increased by 9%, 5%, 3.5%, 1.7%, respectively as compared to 6MV. Almost all OARs in the 2MV plan received more than 10% more doses than 6MV. Mixed energy 3DCRT plans were of the same quality as 6MV plans. For the lung IMRT plans, both the 3MV plan and the mixed beam plan showed better OAR sparing in comparison to 6MV plan. Specifically, the maximum and mean doses to the spinal cord in the mixed energy plan were lower by 21% and 16%, respectively. Conclusion: Single lower energy photon beam was found to be inferior to 6MV in the radiotherapy of pediatric patients and lung cancer patients when the integral doses and the doses to the OARs were considered. However, mixed energy plans combining low with high energy beams showed significant OAR sparing while maintaining the same PTV coverage. Investigation with more patient data is ongoing for further confirmation.

  14. Textural parameters distribution in sediments surface of the Uruguay river background between km 221 and 254

    The aim of this paper is to analyze the distribution of textural statistical parameters and spatial variation in the morphology of the sediment areas. The geology of the area comprises alluvial and alluvial deposits of variable thicknesses overlying deposits of Fray Bent os, Salto and Guichon formations that occasionally emerge in the river bed

  15. 37 CFR 1.221 - Voluntary publication or republication of patent application publication.

    2010-07-01

    ... STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE GENERAL RULES OF PRACTICE IN PATENT CASES... published under § 1.211, must include a copy of the application in compliance with the Office electronic... or the copy of the application does not comply with the Office electronic filing system...

  16. NOAA Climate Data Record (CDR) of Monthly Outgoing Longwave Radiation (OLR), Version 2.2-1

    National Oceanic and Atmospheric Administration, Department of Commerce — This Climate Data Record (CDR) of monthly mean High Resolution Infrared Radiation Sounder (HIRS) Outgoing Longwave Radiation (OLR) flux at the top of the atmosphere...

  17. 49 CFR 1544.221 - Carriage of prisoners under the control of armed law enforcement officers.

    2010-10-01

    .... (3) This section does not apply to the escort of non-violent detainees of the Immigration and... enforcement agency, and charged with, or convicted of, a violent crime. (2) “Low risk prisoner” means...

  18. SU-E-T-221: Investigation of Lower Energy (< 6 MV) Photon Beams for Cancer Radiotherapy

    Purpose: To study the potential applications of the lower energy (< 6MV) photon beams in the radiotherapeutic management of pediatric cancer and lung cancer patients. Methods: Photon beams of 2, 3, 4, 5 and 6MV were first simulated with EGS4/BEAM and then used for Monte-Carlo dose calculations. For four pediatric patients with abdominal and brain lesions, six 3D-conformal radiotherapy (3DCRT) plans were generated using single photon energy (2 to 6MV) or mixed energies (3 and 6MV). Furthermore, a virtual machine of 3 and 6MV was commissioned in a treatment planning system (TPS) based on Monte-Carlo simulated data. Three IMRT plans of a lung cancer patient were generated on this virtual machine. All plans were normalized to D95% of target dose for 6MV plan and then compared in terms of integral dose and OAR sparing. Results: For the four pediatric patients, the integral dose for the 2, 3, 4 and 5MV plans increased by 9%, 5%, 3.5%, 1.7%, respectively as compared to 6MV. Almost all OARs in the 2MV plan received more than 10% more doses than 6MV. Mixed energy 3DCRT plans were of the same quality as 6MV plans. For the lung IMRT plans, both the 3MV plan and the mixed beam plan showed better OAR sparing in comparison to 6MV plan. Specifically, the maximum and mean doses to the spinal cord in the mixed energy plan were lower by 21% and 16%, respectively. Conclusion: Single lower energy photon beam was found to be inferior to 6MV in the radiotherapy of pediatric patients and lung cancer patients when the integral doses and the doses to the OARs were considered. However, mixed energy plans combining low with high energy beams showed significant OAR sparing while maintaining the same PTV coverage. Investigation with more patient data is ongoing for further confirmation

  19. The Chemical Adventures of Sherlock Holmes: The Death Puzzle at 221B Baker Street

    Rybolt, Thomas R.; Waddell, Thomas G.

    1999-04-01

    This story describes a chemical mystery with an emphasis on medicinal chemistry and qualitative analysis. It is the tenth article in a series presenting a scientific problem in mystery format in the context of the popular and beloved characters Sherlock Holmes and Dr. Watson. There is a break in the story where the reader (students and teachers) can ponder and solve the mystery. Sherlock Holmes then provides his solution.

  20. 7 CFR 2.21 - Under Secretary for Research, Education, and Economics.

    2010-01-01

    ..., exercise the functions delegated to the Secretary by Executive Order 12580, 3 CFR, 1987 Comp., p. 193... pollution control standards and section 1-601 of Executive Order 12088, 3 CFR, 1978 Comp., p. 243, to enter... 7 Agriculture 1 2010-01-01 2010-01-01 false Under Secretary for Research, Education, and...

  1. 12 CFR 221.124 - Purchase of debt securities to finance corporate takeovers.

    2010-01-01

    ... securities to finance corporate takeovers. (a) Petitions have been filed with the Board raising questions as... margin stock. See Federal Reserve Regulatory Service 5-917.12. (See 12 CFR 261.10(f) for information on... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Purchase of debt securities to...

  2. People and things. CERN Courier, January-February 1982, v. 22(1)

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events. The project to build a large electron- positron storage ring, LEP, at CERN already had the backing of the twelve CERN Member States, but three votes remained subject to conditions. At a CERN Council meeting in December this 'ad referendum' was lifted by the Netherlands, Norway and Sweden. The LEP project thus has the unconditional support of all Member States.New members of the IUPAP International Commission on Particles and Fields have been elected. The International Committee for Future Accelerators (ICFA) held its sixth meeting at Protvino, USSR, on the occasion of the ICFA Workshop on very high field (10 Tesla) superconducting magnets

  3. 50 CFR 221.71 - How do I propose an alternative?

    2010-10-01

    ... project works for electricity production; (4) An explanation of how the alternative will affect: (i..., including any assumptions you are making (e.g., regarding the cost of energy or the rate of inflation)....

  4. 24 CFR 221.795 - Displacement-below market interest rate mortgages.

    2010-04-01

    ... amended (URA) (42 U.S.C. 4201-4655) and implementing regulations at 49 CFR part 24. A “displaced person... property for a project is subject to the URA and the requirements described in 49 CFR part 24, subpart B... assurance of compliance as required by 49 CFR part 24) that the Owner will comply with the URA,...

  5. 12 CFR 221.118 - Bank arranging for extension of credit by corporation.

    2010-01-01

    ... corporation of an “unsecured” bank loan to exercise an option to purchase stock of the corporation is an... of their options through an unsecured bank loan guaranteed by the company, thereby facilitating the... exercise his option could obtain a loan for the purchase price of the stock by executing an unsecured...

  6. 12 CFR 221.112 - Loans by bank in capacity as trustee.

    2010-01-01

    ... Regulations which was published at page 874 of the 1946 Federal Reserve Bulletin (See 12 CFR 261.10(f) for... loan, the purpose being to avoid cumbersome procedures. (c) Loans are secured by the credit balance of... urged that loans under the plan are not subject to this part because a loan should not be considered...

  7. tert-Butyl 3-oxo-2-oxa-5-azabicyclo[2.2.1]heptane-5-carboxylate

    Claude Didierjean

    2008-10-01

    Full Text Available The title compound, C10H15NO4, also known as N-tert-butyloxycarbonyl-allohydroxy-l-proline lactone, is quite similar to N-acetyl-allohydroxy-l-proline lactone [Lenstra, Petit & Geise (1979. Cryst. Struct. Commun. 8, 1023–1029], whereby both carbonyl groups point roughly in the same direction because of the trans conformation of the peptide bond.

  8. 5 CFR 532.221 - Industries included in regular nonappropriated fund surveys.

    2010-01-01

    ... American Industry Classification System (NAICS) codes in all regular nonappropriated fund wage surveys: 2007 NAICS codes 2007 NAICS industry titles 42312 Motor vehicle supplies and new parts merchant... Apparel, piece goods, and notions merchant wholesalers. 42445 Confectionery merchant wholesalers....

  9. Jesus, Maria, Joseph and the Fourteen Holy Helpers. Cat. No. III.2.21

    Vácha, Štěpán

    Praha : Národní galerie, 2006 - (Niedzielenko, A.; Vlnas, V.), s. 344-347 ISBN 80-7035-334-1 Institutional research plan: CEZ:AV0Z80330511 Keywords : Fourteen Holy Helpers * Michal Leopold Willmann * Silesia Subject RIV: AL - Art, Architecture, Cultural Heritage

  10. Autophosphorylation of JAK2 on tyrosines 221 and 570 regulates its activity

    Argetsinger, Lawrence S; Kouadio, Jean-Louis K; Steen, Hanno; Stensballe, Allan; Jensen, Ole N; Carter-Su, Christin

    2004-01-01

    The tyrosine kinase JAK2 is a key signaling protein for at least 20 receptors in the cytokine/hematopoietin receptor superfamily and is a component of signaling by insulin receptor and several G-protein-coupled receptors. However, there is only limited knowledge of the physical structure of JAK2 ...

  11. 14 CFR 221.120 - Grounds for approving or denying Special Tariff Permission applications.

    2010-01-01

    ..., DEPARTMENT OF TRANSPORTATION (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS TARIFFS Special Tariff Permission To... forth in § 399.35 of this chapter. (5) Lowered fares and charges. The prospective lowering of fares...

  12. Yeast Interacting Proteins Database: YNL189W, YGL221C [Yeast Interacting Proteins Database

    Full Text Available urified mitochondria in high-throughput studies Rows with this prey as prey (2) Rows with this prey as bait ...a factor (rpoD gene product); the authentic, non-tagged protein is detected in highly purified mitochondria in high-throughput studie

  13. Yeast Interacting Proteins Database: YML064C, YGL221C [Yeast Interacting Proteins Database

    Full Text Available highly purified mitochondria in high-throughput studies Rows with this prey as prey (2) Rows with this prey...ied mitochondria in high-throughput studies Rows with this prey as prey Rows with this prey as prey (2) Rows

  14. 75 FR 221 - Airworthiness Directives; Fire Fighting Enterprises Limited Portable Halon 1211 Fire...

    2010-01-05

    ... Regulatory Policies and Procedures (44 FR 11034, February 26, 1979); and 3. Will not have a significant...). The Boeing Company Transport Airplane. Empresa Brasileira de Aeronautica S.A. Transport...

  15. Sistem Pengolahan Limbah Cair Rumah Sakit Menggunakan Bakteri Inola 221 Dan EM 4

    Akita, Amalia

    2012-01-01

    The activity of a hospital produces a lot of waste potentially. one of the waste produced by the activity of hospital is the waste water. Water waste can bring out the hazard environment if well,such polutions in surface water and ground water.therefore, a hospital must have an unite of waste water treatment or waste water treatment instalation and control, monitor, and take note of waste water prodiced. The prupose of this reseach is to know the description of waste water treatment system...

  16. Household and Context Determinants of Child Labor in 221 Districts of 18 Developing Countries

    Webbink, Ellen; Smits, Jeroen; de Jong, Eelke

    2013-01-01

    We develop a new theoretical framework that explains the engagement in child labor of children in developing countries. This framework distinguishes three levels (household, district and nation) and three groups of explanatory variables: Resources, Structure and Culture. Each of the three groups refers to another strand of the literature;…

  17. miR-221/222 Target the DNA Methyltransferase MGMT in Glioma Cells

    Cristina Quintavalle; Davide Mangani; Giuseppina Roscigno; Giulia Romano; Angel Diaz-Lagares; Margherita Iaboni; Elvira Donnarumma; Danilo Fiore; Pasqualino De Marinis; Ylermi Soini; Manel Esteller; Gerolama Condorelli

    2013-01-01

    Glioblastoma multiforme (GBM) is one of the most deadly types of cancer. To date, the best clinical approach for treatment is based on administration of temozolomide (TMZ) in combination with radiotherapy. Much evidence suggests that the intracellular level of the alkylating enzyme O(6)-methylguanine-DNA methyltransferase (MGMT) impacts response to TMZ in GBM patients. MGMT expression is regulated by the methylation of its promoter. However, evidence indicates that this is not the only regula...

  18. Generator method of 225Ac production without a carrier for nuclear medicine

    The two-steps isotope generator scheme of 225Ac production from 229Th has been developed. The first step is used for separation of thorium, actinium, radium and daughter decay products (DDP), and removals of parent radionuclide. The second step provides additional separation of actinium from traces of radium and DDP, and conversion of actinium in the nitrate form. The chosen solutions provide optimal conditions for carry out of process. The yield of the 225Ac was 99.9% at minimal losses of parent 229Th (less than 0.1%)

  19. HTGT-Turbotech II. Subproject 1.221: aerodynamic excitation of transonic turbine stages. Final report; HTGT-Turbotech II. Teilprojekt 1.221: Aerodynamische Anregung von transsonisch durchstroemten Turbinenstufen. Abschlussbericht

    Stetter, H.; Urban, B.; Bauer, H.

    1999-12-01

    For experimental investigations on shock-induced flutter in a linear transonic turbine cascade an elastic suspension system has been developed so that only aerodynamic coupling occurs in the system. The test facility uses super-heated steam as working fluid and enables Mach and Reynolds numbers to vary independently. The investigated cascade consists of seven prismatic blades. The profiles are taken from the tip section of a transonic low pressure steam turbine blade. Each blade is suspended by an elastic spring system which allows the respective blade to vibrate in a mode similar to the real blade's first bending mode. The examination mainly deals with the oscillatory behavior of the blades with respect to a variation in the isentropic outlet Mach number. In addition, the complex shock-boundary-layer interactions on the blades' suction sides are described. Flow computations are run by a finite volume Navier-Stokes solver that accounts for moving boundaries. A volume grid generator is integrated into the flow solver producing combined O- and H-type grids. Turbulence is modeled by a k-{epsilon} turbulence model using wall functions because of performance reasons. Some acceleration techniques for unsteady flow computations are investigated. Shock oscillations which occur on a DCA profile are simulated. For the simulation of the experimental setup the blade motions are prescribed. (orig.) [German] Fuer ein Spitzenschnittprofil einer ND-Endstufenschaufel sowie eine Gasturbinenschaufel wurden lineare Gitter bestehend aus jeweils sieben elastisch aufgehaengten Schaufeln entwickelt. Die Konstruktion der Aufhaengung gewaehrleistet, dass die Schaufeln lediglich durch aerodynamische Effekte zu freien Schwingungen angeregt werden koennen und in ihrem Schwingungsverhalten der ersten Biegeschwingung ihrer Originalschaufeln entsprechen. Ein gestimmtes und ungestimmtes ebenes Gitter wurde in einem Dampfversuchsstand mit Heissdampf durchstroemt, wobei das Flatterverhalten der Schaufeln von Dehnungsmessstreifen auf den Schaufeltraegern und die auftretenden Stossoszillationen mit Hilfe einer Hoch-Geschwindigkeits-Schlierenoptik, einer Laserschranke, applizierten Foliensensoren und instationaeren Drucksensoren erfasst wurde. Im transsonischen Bereich tritt beim ND-Spitzenschnittprofil ein hohes Anregungspotential durch Stossbewegungen auf. Beim Gasturbinengitter sind die Schwingungsamplituden auf Grund einer hohen Daempfung der elastischen Schaufelhalter geringer. Ein Rechenprogramm zur Simulation der transsonischen, reibungsbehafteten Stroemung durch axiale Turbomaschinen wurde auf die Behandlung bewegter Profile angepasst und fuer instationaere Stroemungssimulationen beschleunigt. Ein k-{epsilon}-Turbulenzmodell mit Wandfunktionen wurde implementiert und ein elliptisches 3D-Gittergenerierungsverfahren in den Stroemungsloeser integriert. An einem Doppelkreisbogenprofil wurden Stossoszillationen nachgerechnet. Die experimentell ermittelten Messdaten dienen als Validierungsgrundlage fuer die numerische Simulation der instationaeren Stroemung durch Schaufelreihen mit schwingenden Profilen. (orig.)

  20. Genome-wide association study of migraine implicates a common susceptibility variant on 8q22.1

    Anttila, Verneri; Stefansson, Hreinn; Kallela, Mikko; Todt, Unda; Terwindt, Gisela M; Calafato, M Stella; Nyholt, Dale R; Dimas, Antigone S; Freilinger, Tobias; Müller-Myhsok, Bertram; Artto, Ville; Inouye, Michael; Alakurtti, Kirsi; Kaunisto, Mari A; Hämäläinen, Eija; de Vries, Boukje; Stam, Anine H; Weller, Claudia M; Heinze, Axel; Heinze-Kuhn, Katja; Goebel, Ingrid; Borck, Guntram; Göbel, Hartmut; Steinberg, Stacy; Wolf, Christiane; Björnsson, Asgeir; Gudmundsson, Gretar; Kirchmann, Malene; Hauge, Anne; Werge, Thomas; Schoenen, Jean; Eriksson, Johan G; Hagen, Knut; Stovner, Lars; Wichmann, H-Erich; Meitinger, Thomas; Alexander, Michael; Moebus, Susanne; Schreiber, Stefan; Aulchenko, Yurii S; Breteler, Monique M B; Uitterlinden, Andre G; Hofman, Albert; van Duijn, Cornelia M; Tikka-Kleemola, Päivi; Vepsäläinen, Salli; Lucae, Susanne; Tozzi, Federica; Muglia, Pierandrea; Barrett, Jeffrey; Kaprio, Jaakko; Färkkilä, Markus; Peltonen, Leena; Stefansson, Kari; Zwart, John-Anker; Ferrari, Michel D; Olesen, Jes; Daly, Mark; Wessman, Maija; van den Maagdenberg, Arn M J M; Dichgans, Martin; Kubisch, Christian; Dermitzakis, Emmanouil T; Frants, Rune R; Palotie, Aarno

    2010-01-01

    Migraine is a common episodic neurological disorder, typically presenting with recurrent attacks of severe headache and autonomic dysfunction. Apart from rare monogenic subtypes, no genetic or molecular markers for migraine have been convincingly established. We identified the minor allele of rs1...... lymphoblastoid cell lines, transcript levels of the MTDH were found to have a significant correlation to rs1835740 (P = 3.96 × 10⁻⁵, permuted threshold for genome-wide significance 7.7 × 10⁻⁵. To our knowledge, our data establish rs1835740 as the first genetic risk factor for migraine....

  1. AB221. Effects of adult male circumcision on premature ejaculation: results from a prospective study in China

    Gao, Jingjing; Xu, Chuan; Zhang, Xiansheng

    2016-01-01

    Objective The purpose of this study is to investigate the effects of adult male circumcision on premature ejaculation (PE). Methods Therefore, between December 2009 and March 2014, a total of 575 circumcised men and 623 uncircumcised men (control group) were evaluated. Detailed evaluations (including circumcision and control groups) on PE were conducted before circumcision and at the 3-, 6-, 9-, and 12-month follow-up visits after circumcision. Self-estimated intravaginal ejaculatory latency time (IELT), patient-reported outcome measures, and 5-item version of the International Index of Erectile Function were used to measure the ejaculatory and erectile function for all subjects. Results The results showed that, during the 1 year follow-up, men after circumcision experienced higher IELT and better scores of control over ejaculation, satisfaction with sexual intercourse, and severity of PE than men before circumcision (Pejaculation, and satisfaction with sexual intercourse (P<0.001 for all). These findings suggested that circumcision might have positive effects on IELT, ejaculatory control, sexual satisfaction, and PE severity. Conclusions In addition, circumcision was significantly associated with the development of PE.

  2. AB221. Effects of adult male circumcision on premature ejaculation: results from a prospective study in China

    Gao, Jingjing; Xu, Chuan; Zhang, Xiansheng

    2016-01-01

    Objective The purpose of this study is to investigate the effects of adult male circumcision on premature ejaculation (PE). Methods Therefore, between December 2009 and March 2014, a total of 575 circumcised men and 623 uncircumcised men (control group) were evaluated. Detailed evaluations (including circumcision and control groups) on PE were conducted before circumcision and at the 3-, 6-, 9-, and 12-month follow-up visits after circumcision. Self-estimated intravaginal ejaculatory latency ...

  3. Morphology of the human internal vertebral venous plexus : a cadaver study after intravenous Araldite CY 221 injection

    Groen, R J; Groenewegen, H J; van Alphen, H A; Hoogland, P V

    1997-01-01

    Reviewing the literature on the vascular anatomy of the spinal epidural space, it appeared that the knowledge of the internal vertebral venous plexus is limited. Injection studies of the entire internal vertebral venous plexus after application of modern techniques, to the best of our knowledge, hav

  4. 12 CFR 335.221 - Forms for registration of securities; optional forms for small business issuers; and...

    2010-01-01

    .... Industry Guide 3, Statistical Disclosure by Bank Holding Companies, is codified at 17 CFR 229.802. (c) A... applicable forms for registration of securities and similar matters are codified in subpart C of 17 CFR part... Regulation S-X (17 CFR part 210). Banks may also refer to the instructions for FFIEC Reports of Income...

  5. Abrahamova vjera kao izvor nevjere? Post 22,1 -19 u perspektivi novog ateizma i moralne teologije (l. dio)

    Polgar, Nenad

    2013-01-01

    Članak detektira ulogu Post 22,1-19 kao omiljene teme unutar diskursa novih ateista, usprkos činjenici da je spomenuti tekst zasigurno bitna orijentacijska točka triju monoteističkih religija. Okvirni razlog te situacije, iz koje proizlaze potpuno oprečne interpretacije tog teksta, autor pronalazi u polemičkoj naravi odnosa nove religioznosti i novog ateizma te, odbijajući korisnost takvog pristupa, poseže za, čini se, u ovom kontekstu zaboravljenom važnošću dijaloga i hermeneutike velikodušn...

  6. The microwave spectrum, structure and dipole moment of cyclobutene ozonide (2,3,7-trioxabicyclo[2.2.1]heptane)

    Borseth, Donald G.; Lorenčak, Primož; Badawi, Hassan M.; Hillig, Kurt W.; Kuczkowski, R. L.; Mendenhall, G. David

    1988-11-01

    Cyclobutene ozonide containing deuterium, 13C and 18O enrichment was prepared by ozonolysis of cyclobutene and via singlet molecular oxygen addition to furan. It was established that the ozonide has Cs symmetry. The structure was determined from the assignment of the microwave spectra of eight isotopic species. The peroxy bond distance of 1.492(5) Å is increased by about 0.03 Å compared with less strained monocyclic ozonides. The ring strain is also evident in several other bond distances and angles when compared with cyclopentene ozonide. The dipole moment is 2.857(2) debye.

  7. 12 CFR 221.111 - Contribution to joint venture as extension of credit when the contribution is disproportionate to...

    2010-01-01

    ... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Contribution to joint venture as extension of... joint venture as extension of credit when the contribution is disproportionate to the contributor's share in the venture's profits or losses. (a) The Board considered the question whether a joint...

  8. Acceptable Knowledge Summary Report for Waste Stream: SR-T001-221F-HET/Drums

    Lunsford, G.F.

    1999-08-23

    Since beginning operations in 1954, the Department of Energy's Savannah River Site FB-Line conducted atomic energy defense activities consistent with the listing in Section 10101(3) of the Nuclear Waste Policy Act of 1982. The facility mission was to process and convert dilute plutonium solution into highly purified weapons grade plutonium metal. As a result of various activities conducted in support of the mission (e.g., operation, maintenance, repair, clean up, and facility modifications), the facility generated transuranic waste. This document, along with referenced supporting documents, provides a defensible and auditable record of acceptable knowledge for one of the waste streams from the FB-Line. The waste was packaged in 55-gallon drums, then shipped to the transuranic waste storage facility in ''E'' area of the Savannah River Site. This acceptable knowledge report includes information relating to the facility's history, configuration,equipment, process operations, and waste management practices.

  9. Acceptable Knowledge Summary Report for Waste Stream: SR-T001-221F-HET/Drums

    Lunsford, G.F.

    1999-06-14

    This report is fully responsive to the requirements of Section 4.0 Acceptable Knowledge from the WIPP Transuranic Waste Characterization Quality Assurance Plan, CAO-94-1010, and provides a sound, (and auditable) characterization that satisfies the WIPP criteria for Acceptable Knowledge.

  10. Interdisciplinarity in work process at a Psychosocial Attention Center - doi:10.5020/18061230.2010.p221

    Maria Salete Bessa Jorge

    2012-01-01

    Full Text Available Objective: To analyze the work process of mental health professionals from a Psychosocial Attention Center (CAPS, from the knowledge and the practices applied in the production of care and its interface with user’s demands and the service offering. Methods: A case study with qualitative approach. Twenty-eight subjects joined in and were divided into three groups: I (eleven mental health workers, II (eleven users e III (six family members. The semistructured interview was used besides systematic observation, in the search for data about the work process of the professionals of the Psychosocial Attention Center, the relationship between team and user, offering and demand, access, technologies of care, knowledge and practices and interdisciplinarity. The investigation was based upon critical content analysis and was oriented by the flowchart analyzer. Results: The service organization and its work process are directed to the immediate supply of the population’s demands, which depicts a care based on prescriptive practices. Thus, the flow of assistance and the service offering complement each other in the need of a procedure and in its exhaustive offering by the service, dissolving interdisciplinary conductions of intervention shared with the user. Conclusion: Mental health care is still surrounded by biomedical hegemony centered in procedures directed to pharmacological prescription. Despite this reality, the work centered on the user and the utilization of soft technologies – communication, link, welcoming – begin to take part of the daily CAPS service offering, although it is only present in specific activities of certain procedures.

  11. Moessbauer study of fired Lishan clay and terra-cotta warriors and horses of Qin Dynasty (221 B.C.)

    The sherds of terracotta warriors and horses and Lishan clay were characterized by Moessbauer spectroscopy, XRD, XRF, NAA, thermal and chemical analyses. Lishan clay was testified as the original material of terracotta warriors and horses, the kilning of these warriors and horses was first carried out in an oxidizing atmosphere, and then changed to a predominantly reducing atmosphere. With refiring experiments, the temperatures of Q3 and Q4 samples were determined to be 830 ± 50 and 980 ± 50degC respectively. Transformations of Lishan clay were determined by firing in oxidizing and reducing atmospheres. The Moessbauer parameters of Lishan clay, which was taken after 2-24h firing, were changing up to 12h. (orig.)

  12. 26 CFR 1.221-1 - Deduction for interest paid on qualified education loans after December 31, 2001.

    2010-04-01

    ... part of the internship program, the non-profit organization makes an interest payment on behalf of... institution that conducts an internship or residency program leading to a degree or certificate awarded by an... double benefit. No deduction is allowed under this section for any amount for which a deduction...

  13. 26 CFR 1.221-2 - Deduction for interest due and paid on qualified education loans before January 1, 2002.

    2010-04-01

    ... C's loan is in deferment and Student C makes no interest payments. As part of the internship program... conducts an internship or residency program leading to a degree or certificate awarded by an institution, a... education expenses, the loan is not a qualified education loan. (g) Denial of double benefit. No...

  14. Waste management in three public hospitals of Mato Grosso do Sul, Brazil - doi:10.5020/18061230.2010.p221

    Keila Tivirolli

    2012-01-01

    Full Text Available Objectives: To assess the management of health service waste generated in three public hospitals of Mato Grosso do Sul (Brazil, including qualitative and quantitative parameters. Methods: This was an observational and descriptive study. We assessed the waste management in two large public hospitals (HG1, 240 hospital beds and HG2, 343 beds and in a small sized one (HP, 35 hospital beds. The data were collected in situ, by direct observation of the procedures for waste management and by quantifying the mass of waste generated by working sector in the three hospitals. Results: The study revealed that the internal management of waste generated in the three health care unities was not adequate, and that their workers were not trained on the proper management of waste and the use of personal protective equipment. The average rates of waste generation determined in HG1, HG2 and HP were, respectively, 4.7, 4.8 and 2.4 Kg.hospital bed-1.day-1, that fit the range of values reported in the literature. Conclusion: The detected inadequacies directly put at risk the health of workers and others who attend the three assessed hospitals and the outside comunity, which may be exposed to pathogens or toxic agents present in such waste.

  15. 40 CFR 180.221 - O-Ethyl S-phenyl ethylphos-phonodithioate; tolerances for residues.

    2010-07-01

    .... Beet, sugar, tops 0.1 Do. Corn, field, forage 0.1 Do. Corn, field, grain 0.1 Do. Corn, field, stover 0.1 Do. Corn, pop, grain 0.1 Do. Corn, pop, stover 0.1 Do. Corn, sweet, forage 0.1 Do. Corn, sweet, kernel plus cob with husks removed 0.1 Do. Corn, sweet, stover 0.1 Do. Peanut 0.1 Do. Peanut, hay 0.1...

  16. Acceptable Knowledge Summary Report for Waste Stream: SR-T001-221F-HET/Drums

    This report is fully responsive to the requirements of Section 4.0 ''Acceptable Knowledge'' from the WIPP Transuranic Waste Characterization Quality Assurance Plan, CAO-94-1010, and provides a sound, (and auditable) characterization that satisfies the WIPP criteria for Acceptable Knowledge

  17. Thermal decomposition of norbornane (bicyclo[2.2.1]heptane) dissolved in benzene. Experimental study and mechanism investigation

    Herbinet, Olivier; Battin-Leclerc, Fr{é}d{é}rique; Fournet, Ren{é}; Marquaire, Paul-Marie

    2007-01-01

    The thermal decomposition of norbornane (dissolved in benzene) has been studied in a jet stirred reactor at temperatures between 873 and 973 K, at residence times ranging from 1 to 4 s and at atmospheric pressure, leading to conversions from 0.04 to 22.6%. 25 reaction products were identified and quantified by gas chromatography, amongst which the main ones are hydrogen, ethylene and 1,3-cyclopentadiene. A mechanism investigation of the thermal decomposition of the norbornane - benzene binary mixture has been performed. Reactions involved in the mechanism have been reviewed: unimolecular initiations 1 by C-C bond scission of norbornane, fate of the generated diradicals, reactions of transfer and propagation of norbornyl radicals, reactions of benzene and cross-coupling reactions.

  18. Analisa Efisiensi Combined Cycle 2-2-1 dan 1-1-1 PLTGU Block 1 Sicanang Belawan

    Kurniawan, Rahmat

    2015-01-01

    In an era of increasingly require substantial electricity power, it is necessary to constantly strive to increase efficiency in everything, including the operating efficiency of power generation. Efforts to improve the efficiency of this operation is done in various ways, including by improving power plant (Open Cycle) to PLTGU (Combined Cycle). Combined cycle is a cycle that utilizes exhaust heat from the go turbine to water in a Heat Recovery Steam Generator (HRSG), then steam is used to...

  19. 12 CFR 221.122 - Applicability of margin requirements to credit in connection with Insurance Premium Funding...

    2010-01-01

    ... funding program, a borrower acquires mutual fund shares for cash, or takes fund shares which he already..., the participant is required to put up mutual fund shares equivalent to 250 percent of the premium or...) Clarify an earlier 1969 Board interpretation to show that the public offering price of mutual fund...

  20. 12 CFR 250.221 - Issuance and sale of short-term debt obligations by bank holding companies.

    2010-01-01

    ... Bulletin 485, 12 CFR 218.104, 12 CFR 218.105 and 12 CFR 218.101.) (e) In reaching this conclusion, the... (17 CFR 231.4412). The reasons for such exemption, taken together with the abuses that gave rise to... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Issuance and sale of short-term...

  1. Genome-wide association study of migraine implicates a common susceptibility variant on 8q22.1

    Anttila, Verneri; Stefansson, Hreinn; Kallela, Mikko; Todt, Unda; Terwindt, Gisela M; Calafato, M Stella; Nyholt, Dale R; Dimas, Antigone S; Freilinger, Tobias; Müller-Myhsok, Bertram; Artto, Ville; Inouye, Michael; Alakurtti, Kirsi; Kaunisto, Mari A; Hämäläinen, Eija; de Vries, Boukje; Stam, Anine H; Weller, Claudia M; Heinze, Axel; Heinze-Kuhn, Katja; Goebel, Ingrid; Borck, Guntram; Göbel, Hartmut; Steinberg, Stacy; Wolf, Christiane; Björnsson, Asgeir; Gudmundsson, Gretar; Kirchmann, Malene; Hauge, Anne; Werge, Thomas; Schoenen, Jean; Eriksson, Johan G; Hagen, Knut; Stovner, Lars; Wichmann, H-Erich; Meitinger, Thomas; Alexander, Michael; Moebus, Susanne; Schreiber, Stefan; Aulchenko, Yurii S; Breteler, Monique M B; Uitterlinden, Andre G; Hofman, Albert; van Duijn, Cornelia M; Tikka-Kleemola, Päivi; Vepsäläinen, Salli; Lucae, Susanne; Tozzi, Federica; Muglia, Pierandrea; Barrett, Jeffrey; Kaprio, Jaakko; Färkkilä, Markus; Peltonen, Leena; Stefansson, Kari; Zwart, John-Anker; Ferrari, Michel D; Olesen, Jes; Daly, Mark; Wessman, Maija; van den Maagdenberg, Arn M J M; Dichgans, Martin; Kubisch, Christian; Dermitzakis, Emmanouil T; Frants, Rune R; Palotie, Aarno

    2010-01-01

    Migraine is a common episodic neurological disorder, typically presenting with recurrent attacks of severe headache and autonomic dysfunction. Apart from rare monogenic subtypes, no genetic or molecular markers for migraine have been convincingly established. We identified the minor allele of rs1...

  2. SU-E-J-221: A Novel Expansion Method for MRI Based Target Delineation in Prostate Radiotherapy

    Purpose: To compare a novel bladder/rectum carveout expansion method on MRI delineated prostate to standard CT and expansion based methods for maintaining prostate coverage while providing superior bladder and rectal sparing. Methods: Ten prostate cases were planned to include four trials: MRI vs CT delineated prostate/proximal seminal vesicles, and each image modality compared to both standard expansions (8mm 3D expansion and 5mm posterior, i.e. ∼8mm) and carveout method expansions (5mm 3D expansion, 4mm posterior for GTV-CTV excluding expansion into bladder/rectum followed by additional 5mm 3D expansion to PTV, i.e. ∼1cm). All trials were planned to total dose 7920 cGy via IMRT. Evaluation and comparison was made using the following criteria: QUANTEC constraints for bladder/rectum including analysis of low dose regions, changes in PTV volume, total control points, and maximum hot spot. Results: ∼8mm MRI expansion consistently produced the most optimal plan with lowest total control points and best bladder/rectum sparing. However, this scheme had the smallest prostate (average 22.9% reduction) and subsequent PTV volume, consistent with prior literature. ∼1cm MRI had an average PTV volume comparable to ∼8mm CT at 3.79% difference. Bladder QUANTEC constraints were on average less for the ∼1cm MRI as compared to the ∼8mm CT and observed as statistically significant with 2.64% reduction in V65. Rectal constraints appeared to follow the same trend. Case-by-case analysis showed variation in rectal V30 with MRI delineated prostate being most favorable regardless of expansion type. ∼1cm MRI and ∼8mm CT had comparable plan quality. Conclusion: MRI delineated prostate with standard expansions had the smallest PTV leading to margins that may be too tight. Bladder/rectum carveout expansion method on MRI delineated prostate was found to be superior to standard CT based methods in terms of bladder and rectal sparing while maintaining prostate coverage. Continued investigation is warranted for further validation

  3. The hydrotherapy in the treatment of patients with Chronic Obstructive Pulmonary Disease - doi:10.5020/18061230.2007.p221

    Fernanda Gadelha Severino

    2012-01-01

    Full Text Available The Chronic Obstructive Pulmonary Disease (COPD is a serious, disabling disease, presenting the pulmonary function test with abnormalities in the expiratory flow. Under this denomination, it comprises the chronic bronchitis and pulmonary emphysema. The hydrotherapy involves the physical therapy with aquatic exercises and has being used because it is a pleasant activity with positive results. The aim of this exploratory study was to compare the performance of the patients with COPD treated with hydrotherapy associated to pulmonary rehabilitation with those treated only with pulmonary rehabilitation, being held in the cardiopulmonary rehabilitation center of Messejana Hospital, in Fortaleza - Ceará. The sample consisted of 10 patients, independently of sex and age, randomly divided into two groups. The evaluation instrument was the upper limbs incremental test observing the following parameters: the cardiac frequency (FC, the respiratory frequency (f, the degree of dyspnea, the tiredness of the upper limbs, the maximum burden reached and the oxygen saturation (SatO2. The parameters FC (p=0.04, f (p=0.046 e SatO2 (p=0.008 presented an average improvement of 33.33% above those of the patients that were just in the pulmonary rehabilitation. The other evaluated parameters also presented positive results, but with p>0.05. In conclusion, the results obtained with the pulmonary rehabilitation associated to the hydrotherapy overcome those found just with the pulmonary rehabilitation treatment, allowing an increase in the physical conditioning and improvement in the functional activities; although, due to the reduced number of cases, new researches should be held to confirm this exploratory study.

  4. The hydrotherapy in the treatment of patients with Chronic Obstructive Pulmonary Disease - doi:10.5020/18061230.2007.p221

    Fernanda Gadelha Severino; Maria Tereza Aguiar Pessoa Morano; Juliana Maria de Sousa Pinto

    2012-01-01

    The Chronic Obstructive Pulmonary Disease (COPD) is a serious, disabling disease, presenting the pulmonary function test with abnormalities in the expiratory flow. Under this denomination, it comprises the chronic bronchitis and pulmonary emphysema. The hydrotherapy involves the physical therapy with aquatic exercises and has being used because it is a pleasant activity with positive results. The aim of this exploratory study was to compare the performance of the patients with COPD trea...

  5. Generalized Polarization Effect and B(E2,2+1→0+g.s.) in Neutron Rich Even Carbon Isotopes

    2008-01-01

    <正>The generalized polarization effects on electric quadrupole transitions is proposed and studied by the microscopic particle-vibration model. The static polarization effects on neutron and proton vertex are

  6. 5-[(1R,2R,4R-2-Methoxy-1,7,7-trimethylbicyclo[2.2.1]hept-2-yl]-1H-tetrazole

    Jan W. Bats

    2013-07-01

    Full Text Available The title compound, C12H20N4O, undergoes a phase transition on cooling. The room-temperature structure is tetragonal (P43212, Z′ = 1, with the methoxybornyl group being extremely disordered. Below 213 K the structure is orthorhombic (P212121, Z′ = 2, with ordered molecules. The two independent molecules (A and B have very similar conformations; significant differences only occur for the torsion angles about the Cbornyl—Ctetrazole bonds. The independent molecules are approximately related by the pseudo-symmetry relation: xB = −1/4 + yA, yB = 3/4 - xA and zB = 1/4 + zA. In the crystal, molecules are connected by N—H...N hydrogen bonds between the tetrazole groups, forming a pseudo-43 helix parallel to the c-axis direction. The crystal studied was a merohedral twin with a refined twin fraction value of 0.231 (2.

  7. 3p22.1p21.31 microdeletion identifies CCK as Asperger syndrome candidate gene and shows the way for therapeutic strategies in chromosome imbalances

    Iourov, Ivan Y; Vorsanova, Svetlana G; Voinova, Victoria Y.; Yurov, Yuri B.

    2015-01-01

    Background In contrast to other autism spectrum disorders, chromosome abnormalities are rare in Asperger syndrome (AS) or high-functioning autism. Consequently, AS was occasionally subjected to classical positional cloning. Here, we report on a case of AS associated with a deletion of the short arm of chromosome 3. Further in silico analysis has identified a candidate gene for AS and has suggested a therapeutic strategy for manifestations of the chromosome rearrangement. Results Using array c...

  8. 2.2.1. Synthesis, spectroscopic characterization and crystal structure of [ReV(O2(pyz4][ReII(NOBr4(pyz] (pyz = pyrazine

    Mario Pacheco, Alicia Cuevas, Javier González-Platas, Carlos Kremer*

    2015-03-01

    Full Text Available Abstract: A novel Re(V-Re(II nitrosyl complex, [Re(O2(pyz 4][Re(NOBr4(pyz] (pyz = pyrazine was prepared and characterized by X-ray diffraction, elemental analysis, infrared and ultraviolet-visible absorption spectra. This product is obtained in the initial steps of the reaction of (NBu4[Re(NOBr4(EtOH] with pyrazine. Both, the cation and the anion are mononuclear complexes. The Re(V atom in the cation is six-coordinate with four nitrogen atoms from pyrazine ligands, and two oxo ligands. The Re(II anion is also six-coordinate, with four bromide ligands, a linear nitrosyl group and one nitrogen from pyrazine. The spectroscopic studies are discussed and compared with those already reported separately for the cation and the anion. Supporting information: X-Ray (CIF file

  9. Acceptable Knowledge Summary Report for Mixed TRU Waste Streams: SR-W026-221F-HET-A through D

    Lunsford, G.F.

    2001-10-02

    This document, along with referenced supporting documents provides a defensible and auditable record of acceptable knowledge for the heterogeneous debris mixed transuranic waste streams generated in the FB-Line after January 25, 1990 and before March 20, 1997.

  10. Savannah River Site Waste Isolation Pilot Plant Disposal Program - Acceptable Knowledge Summary Report for Waste Stream: SR-T001-221-HET

    Lunsford, G.F.

    2001-01-24

    This document, along with referenced supporting documents provides a defensible and auditable record of acceptable knowledge for one of the waste streams from the FB-Line. This heterogeneous debris transuranic waste stream was generated after January 25, 1990 and before March 20, 1997. The waste was packaged in 55-gallon drums, then shipped to the transuranic waste storage facility in ''E'' area of the Savannah River Site. This acceptable knowledge report includes information relating to the facility's history, configuration, equipment, process operations and waste management practices. Information contained in this report was obtained from numerous sources including: facility safety basis documentation, historical document archives, generator and storage facility waste records and documents, and interviews with cognizant personnel.

  11. Using genetic loci to understand the relationship between adiposity and psychological distress: a Mendelian Randomization study in the Copenhagen General Population Study of 53,221 adults

    Lawlor, Debbie A; Harbord, Roger M; Tybjærg-Hansen, Anne;

    2011-01-01

    We used genetic variants that are robustly associated with adiposity to examine the causal association of adiposity with psychological distress.......We used genetic variants that are robustly associated with adiposity to examine the causal association of adiposity with psychological distress....

  12. Early detection of skin cancer: experience of a skin cancer prevention campaign in Piauí-Brazil - doi: 10.5020/18061230.2012.p221

    Rafael Bandeira Lages

    2012-11-01

    Full Text Available Objectives: To evaluate the correlation between the diagnoses of skin cancer and known risk factors through analysis of data from the National Skin Cancer Prevention Campaign held by Brazilian Society of Dermatology in the state of Piauí, Brazil, in recent years. Methods: Cross-sectional descriptive and analytical report using quantitative data obtained from a prevention campaign in the state of Piauí, in 2009 and 2010. Collected data was submitted to a descriptive analysis, and multivariate logistic regression, using as dependent variable the skin cancer diagnosis. Results: In 2009 and 2010, this campaign was responsible for 1141 consultations, diagnosing 122 (10.7% cases of skin cancer: 108 basal cell carcinomas (BCC, 10 squamous cell (SCC and four melanomas. Of those examined, 35.4% were male, 73.1% reported inadequate sun protection, 16.4% had a family history of skin cancer and 7.2% had personal history. Those with history of skin cancer were 5.24 times more likely to have a new diagnosis of cancer, while those presenting non-black skin were 4.91 times more likely to diagnosis. Conclusion: Personal or family history of epithelial neoplasia, non-colored black skin and the male gender were associated to higher chances of developing skin cancer. In addition, unprotected sun exposure remains routine

  13. Overcoming the Recalcitrance of Cellulosic Biomass by Value Prior to Pulping: Cooperative Research and Development Final Report, CRADA Number CRD-07-221

    Lowell, A.

    2012-04-01

    The Value Prior to Pulping (VPP) project goal was to demonstrate the technical and commercial feasibility of introducing a new value stream into existing pulp and paper mills. Essentially the intent was to transfer the energy content of extracted hemicellulose from electricity and steam generated in the recovery boiler to a liquid transportation fuel. The hemicellulose fraction was extracted prior to pulping, fractionated, or conditioned if necessary, and fermented to ethanol. Commercial adaptation of the process to wood hemicelluloses was a prerequisite for using this less currently valued component available from biomass and wood. These hemicelluloses are predominately glucurono-xylan in hardwoods and galactoglucomannan in softwoods (with a significant softwood component of an arabino-xylan) and will yield fermentation substrates different from cellulose. NREL provided its expertise in the area of fermentation host evaluation using its Zymomonas strains on the CleanTech Partner's (CTP) VPP project. The project was focused on the production of fuel ethanol and acetic acid from hemicellulose streams generated from wood chips of industrially important hardwood and softwood species. NREL was one of four partners whose ethanologen was tested on the hydrolyzed extracts. The use of commercially available enzymes to treat oligomeric sugar extracts was also investigated and coupled with fermentation. Fermentations by NREL were conducted with the Zymomonas mobilis organism with most of the work being performed with the 8b strain. The wood extracts hydrolyzed and/or fermented by NREL were those derived from maple, mixed southern hardwoods, and loblolly pine. An unhydrolyzed variant of the mixed southern hardwood extract possessed a large concentration of oligomeric sugars and enzymatic hydrolysis was performed with a number of enzymes, followed by fermentation. The fermentation of the wood extracts was carried out at bench scale in flasks or small bioreactors, with a maximum volume of 500 mL.

  14. 40 CFR 721.7160 - 2-Oxepanone, polymer with 4,4′-(1-methylethylidene)bisphenol and 2,2-[(1-methylethylidene)bis(4,1...

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false 2-Oxepanone, polymer with 4,4â²-(1-methylethylidene)bisphenol and 2,2- -bi-sox-i- rane, graft. 721.7160 Section 721.7160 Protection of Environment...-methylethylidene)bisphenol and 2,2- -bi-sox-i- rane, graft. (a) Chemical substance and significant new uses...

  15. 2-{[2-(1-Methyl-2,2-dioxo-3,4-dihydro-1H-2λ6,1-benzothiazin-4-ylidenehydrazin-1-ylidene]methyl}phenol

    Muhammad Shafiq

    2012-09-01

    Full Text Available In the title compound, C16H15N3O3S, the dihedral angle between the aromatic rings is 8.18 (11° and the C=N—N=C torsion angle is 178.59 (14°. The conformation of the thiazine ring is an envelope, with the S atom displaced by 0.8157 (18 Å from the mean plane of the other five atoms (r.m.s. deviation = 0.045 Å. An intramolecular O—H...N hydrogen bond closes an S(6 ring. In the crystal, weak C—H...O interactions link the molecules, with all three O atoms acting as acceptors.

  16. Untersuchungen zur Photofragmentierung in Edelgasmatrizen: Vergleich von tert-Butylnitrit und tert-Butylthionitrit; Untersuchung von 2,3-Diazabicyclo[2.2.1]hept-2-en

    Schaffer, Tanja Roswitha

    2005-01-01

    Untersuchungen mit Hilfe der Matrixisolationsspektroskopie ermöglichen den Nachweis instabiler oder kurzlebiger Intermediate. Es wurden drei verschiedene Substanzen mit Hilfe spektroskopischer Methoden in Edelgasmatrizen und in Lösung untersucht. Im ersten Teil der Arbeit wurden tert-Butylnitrit und tert-Butylthionitrit betrachtet. Beide Verbindungen gehen bei Belichtung eine Photofragmentierung unter Abspaltung von NO ein, bei der in Edelgasmatrizen eine cis-trans-Isomerisierung als Konkurre...

  17. Erzeugung und Folgechemie von Bicyclo[2.1.1]hex-1-ylhalogen- und Bicyclo[2.2.1]hept-1-ylhalogencarbenen

    Dorok, Sascha

    2003-01-01

    Der Zugang zu 1,4-disubstituierten Bicyclo[2.1.1]hexanen konnte verbessert werden. Ausgehend von Cyclopentan-1,3-dicarbonsäuredimethylester konnte Bicyclo[2.1.1]hexan-1,4-dicarbonsäuredimethylester mit Ausbeuten bis zu 58% synthetisiert werden. Hierbei wurde das Bis-Enolat des Diesters in einem Eintopf-Verfahren mit Diiodmethan zweifach alkyliert. Diese Methode zeigt eine hohe Empfindlichkeit gegenüber Veränderungen verschiedener Parameter. Das Verhalten von bicyclo[2.1.1]hexyl-substituierte...

  18. 33 CFR 221.1 - Investigation and supervision of hydropower projects under the Federal Power Act (ER 1140-2-4).

    2010-07-01

    ... the U.S. Government Printing Office, Washington, D.C. 20402. (3) ER 1145-2-303 (33 CFR 209.120), 2 Permits for Activities in Navigable Waters or Ocean Waters. 2 33 CFR 209.120 was removed at 42 FR 37133... full public interest review pursuant to 33 CFR part 320 and the application of the...

  19. Crystal structure of tetrabutylammonium bromide–1,2-diiodo-3,4,5,6-tetrafluorobenzene–dichloromethane (2/2/1

    Jasmine Viger-Gravel

    2015-05-01

    Full Text Available The crystallization of a 1:1 molar solution of 1,2-diiodo-3,4,5,6-tetrafluorobenzene (o-DITFB and tetrabutylammonium bromide (n-Bu4NBr from dichloromethane yielded pure white crystals of a halogen-bonded compound, C16H36N+·Br−·C6F4I2·0.5CH2Cl2 or [(n-Bu4NBr(o-DITFB]·0.5CH2Cl2. The compound may be described as a quaternary system and may be classified as a salt–cocrystal solvate. The asymmetric unit contains one molecule of solvent, two o-DITFB molecules, two cations (n-Bu4N+ and two crystallographically distinct bromide ions [θI...Br-...I = 144.18 (1 and 135.35 (1°]. The bromide ion is a bidentate halogen-bond acceptor which interacts with two covalently bonded iodines (i.e. halogen-bond donors, resulting in a one-dimensional polymeric zigzag chain network approximately along the a axis. The observed short contacts and angles are characteristic of the non-covalent interaction [dC—I...Br = 3.1593 (4–3.2590 (5 Å; θC—I...Br = 174.89 (7 and 178.16 (7°]. It is noted that iodine acts as both a halogen-bond donor and a weak CH hydrogen-bond acceptor, while the bromide ions act as acceptors for weak CH hydrogen bonds and halogen bonds.

  20. Regioselective palladium-catalyzed ring-opening reactions of C1-substituted oxabicyclo[2,2,1]hepta-2,5-diene-2,3-dicarboxylates

    Edmunds, Michael; Raheem, Mohammed Abdul; Boutin, Rebecca; Tait, Katrina

    2016-01-01

    Summary Palladium-catalyzed ring-opening reactions of C1 substituted 7-oxanorbornadiene derivatives with aryl iodides were investigated. The optimal conditions for this reaction were found to be PdCl2(PPh3)2, ZnCl2, Et3N and Zn in THF. Both steric and electronic factors played a role in the outcome of the reaction as increasing the steric bulk on the bridgehead carbon decreased the yield. These reactions were found to be highly regioselective, giving only one of the two possible regioisomers in all cases. A diverse collection of novel, highly substituted biphenyl derivatives were obtained. PMID:26977182

  1. Relaciones militares y diplomáticas de Cartago en el Mediterráneo Occidental (410 - 221 a.n.e.)

    Riera Vargas, Roger

    2016-01-01

    La tesis doctoral que se presenta a continuación tiene como propósito investigar la red diplomática y las relaciones de índole militar que se establecieron en el Mediterráneo Occidental a través de la ciudad de Cartago. El marco cronológico se enmarca entre los siglos V y III a.n.e., coincidiendo con el momento de mayor apogeo político de la ciudad. Es, por tanto, un estudio de amplio espectro cronológico y espacial, que abarca este fenómeno desde sus inicios hasta su culminación en época de ...

  2. Molecular Cytogenetic Characterization of an inv(Y)(p11.2q11.221∼q11.222) in a Syrian Family

    Al-Achkar, W; Wafa, A; Al-Ablog, A; Moassass, F; Liehr, T

    2013-01-01

    Constitutional chromosomal abnormalities are an important cause of miscarriage, infertility, congenital anomalies and mental retardation in humans. Pericentric inversions of the human Y-chromosome [inv(Y)] are rather common and show an estimated incidence of 0.6–1:1,000 in males in the general population. Most of the reported cases with inv(Y) are familial. For carriers of pericentric inversions the risk of mental retardation or multiple abortions is not apparently increased and there is no r...

  3. catena-Poly[[diaqua­manganese(II)]-μ-7-oxabicyclo­[2.2.1]heptane-2,3-dicarboxyl­ato

    Na Wang; Jie Feng; Dong-Hang Wang; Qiu-Yue Lin

    2010-01-01

    In the title polymer, [Mn(C8H8O5)(H2O)2]n, the MnII atom is in a distorted octahedral coordination mode, binding to the bridging O atom of the bicycloheptane unit, two O atoms from corresponding carboxylate groups, one carboxylate O atom from a symmetry-related bridging ligand and two water O atoms. This arrangement leads to the formation of polymeric chains propagating parallel to [001]. The crystal structure is stabilized by several O—H...O hydrogen-bonding interactions involving ...

  4. I. The metabolic properties of plutonium and allied materials

    Hamilton, J.G.

    1948-05-24

    This report on the metabolic properties of plutonium and related radioactive materials presents experimental information in the following areas: radioautographic studies; tracer studies (with tables of accumulation in tissues) of actinium, radio-zirconium, technetium, radio-rubidium, radio-germanium, beryllium, and cadmium; decontamination and bone metabolism studies; and radio-chemical isolation.

  5. Efeito da suplementação enzimática no desempenho e qualidade dos ovos de poedeiras comerciais - DOI: 10.4025/actascianimsci.v29i2.221 Effects of the enzyme complex supplementation on the performance and egg quality of laying hens - DOI: 10.4025/actascianimsci.v29i2.221

    Márcia Izumi Sakamoto

    2007-11-01

    Full Text Available O objetivo deste trabalho foi determinar o efeito da utilização de um complexo multienzimático sobre o desempenho e qualidade dos ovos de poedeiras comerciais. Foram utilizadas 336 poedeiras comerciais, HyLine W36, com 29 semanas de idade distribuídas em um delineamento inteiramente casualizado com 7 tratamentos e 6 repetições de 8 aves cada. Os tratamentos consistiram de uma dieta basal suplementada com o complexo enzimático nos níveis de 400 ou 500 ppm com valorização do nível de proteína, energia metabolizável e aminoácidos do farelo de soja em 5/5/5, 7/7/7 e 7/7/9%, respectivamente. As variáveis estudadas foram: consumo de ração (g ave-1 dia-1, conversão alimentar (kg dz-1 de ovos, peso médio dos ovos (g, produção de ovos (%, gravidade específica (g mL-1, Unidade Haugh, coloração da gema, percentuais de sólidos totais, de gema, clara e casca (%, espessura da casca (mm e composição bromatológica das excretas. A adição do complexo multienzimático apresentou resultados produtivos e de qualidade dos ovos semelhantes à dieta controle.The present study aimed to evaluate the effects of a commercial enzyme complex on the performance and egg quality of commercial laying hens. A total of 336 29-week old Hyline W36 layers were allocated to a completely randomized experimental design with seven treatments and six replications of eight birds each. The treatments consisted of the basal diet supplemented with inclusion of (500 or 400 ppm, overestimating the percentages of protein, ME and amino acids of the soybean meal by 5:5:5, 7:7:7 and 7:7:9, respectively. The studied variables were: feed intake (g bird-1 day- 1, feed:egg (kg feed-1 egg dozen-1, egg weight (g, egg laying percentage (hen day-1 specific gravity (g ml-1, Haugh Unit, color of the egg yolk, total solids percentage (%, egg yolk percentage, albumen and eggshell (%, eggshell thickness (mm and chemical composition of hen manure. The inclusion of enzyme complex in the diet resulted in similar productive performance and egg quality compared to the control diet.

  6. Sorption studies of radioelements on geological materials

    Batch sorption experiments have been carried out to study the sorption of uranium, technetium, curium, neptunium, actinium, protactinium, polonium, americium and plutonium onto bentonite, granodiorite and tuff. Mathematical modelling using the HARPHRQ program and the HATCHES database was carried out to predict the speciation of uranium and technetium in the equilibrated seawater, and neptunium, americium and plutonium in the rock equilibrated water. Review of the literature for thermodynamic data for curium, actinium, protactinium and polonium was carried out. Where sufficient data were available, predictions of the speciation and solubility were made. This report is a summary report of the experimental work conducted by AEA Technology during April 1991-March 1998, and the main results have been presented at Material Research Society Symposium Proceedings and published as proceedings of them. (author)

  7. Investigation for determining the retention properties of rock over the ASSE II mine for dissolved radionuclides

    For a model consideration of groundwater movement and the associated transport of dissolved substance in deep groundwater, the retention properties of the ASSE II mine for radionuclides dissolved in water were determined. A series of properties of rocks were examined and described for this purpose. Apart from the chemical, mineralogical and petrophysical characteristics of the rocks, the retention was determined by 3 different methods and stated in the form of distribution coefficients for specific elements. A comparison of the results of vibration and diffusion experiments gave good agreement, while the results in through column experiments only reached the same order of magnitude after an expensive determination with the aid of a place concentration distribution. The distribution coefficients for the elements carbon, selenium, strontium, technetium, iodine, caesium, lead, radium, actinium, proto-actinium, uranium, neptunium, plutonium, americium and curium are listed and collected for model rock packages. (orig./HP)

  8. Self-healing phenomena in cement-based materials state-of-the-art report of RILEM Technical Committee 221-SHC Self-Healing Phenomena in Cement-Based Materials

    Tittelboom, Kim; Belie, Nele; Schlangen, Erik

    2013-01-01

    Self-healing materials are man-made materials which have the built-in capability to repair damage. Failure in materials is often caused by the occurrence of small microcracks throughout the material. In self-healing materials phenomena are triggered to counteract these microcracks. These processes are ideally triggered by the occurrence of damage itself. Thus far, the self-healing capacity of cement-based materials has been considered as something "extra". This could be called passive self-healing, since it was not a designed feature of the material, but an inherent property of it. Centuries-old buildings have been said to have survived these centuries because of the inherent self-healing capacity of the binders used for cementing building blocks together. In this State-of-the-Art Report a closer look is taken at self-healing phenomena in cement-based materials. It is shown what options are available to design for this effect rather than have it occur as a "coincidental extra".

  9. Multibeam collection for KN221-02: Multibeam data collected aboard Knorr from 2014-07-06 to 2014-08-01, departing from Reykjavik, Iceland and returning to Reykjavik, Iceland

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  10. Multibeam collection for KN221-04: Multibeam data collected aboard Knorr from 2014-09-07 to 2014-09-28, departing from Reykjavik, Iceland and returning to Woods Hole, MA

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  11. Multibeam collection for KN221-01: Multibeam data collected aboard Knorr from 2014-06-19 to 2014-07-03, departing from Woods Hole, MA and returning to Reykjavik, Iceland

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  12. Multibeam collection for KN221-03: Multibeam data collected aboard Knorr from 2014-08-03 to 2014-09-02, departing from Reykjavik, Iceland and returning to Reykjavik, Iceland

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  13. Safety Study of AG-120 or AG-221 in Combination With Induction and Consolidation Therapy in Patients With Newly Diagnosed Acute Myeloid Leukemia With an IDH1 and/or IDH2 Mutation

    2016-04-27

    Newly Diagnosed Acute Myeloid Leukemia (AML); Untreated AML; AML Arising From Myelodysplastic Syndrome (MDS); AML Arising From Antecedent Hematologic Disorder (AHD); AML Arising After Exposure to Genotoxic Injury

  14. Identification of microRNA-221/222 and microRNA-323-3p association with rheumatoid arthritis via predictions using the human tumour necrosis factor transgenic mouse model

    Pandis, Ioannis; Ospelt, Caroline; Karagianni, Niki; Denis, Maria C.; Reczko, Martin; Camps, Carme; Artemis G Hatzigeorgiou; Ragoussis, Jiannis; Gay, Steffen; Kollias, George

    2012-01-01

    OBJECTIVE: To identify novel microRNA (miR) associations in synovial fibroblasts (SF), by performing miR expression profiling on cells isolated from the human tumour necrosis factor (TNF) transgenic mouse model (TghuTNF, Tg197) and patients biopsies.METHODS: miR expression in SF from TghuTNF and wild-type (WT) control mice were determined by miR deep sequencing (miR-seq) and the arthritic profile was established by pairwise comparisons. Quantitative PCR analysis was utilised for profile valid...

  15. http://www.seasinop.com.br/revista/index.php?journal=SEA&page=article&op=view&path%5B%5D=221&path%5B%5D=pdf_93

    J. L. Escobar; C. R. Andrighetti; E.B. Ribeiro; D. M. S. Valladão

    2016-01-01

    The bar soap is a cosmetic personal care product most consumed in the world. The incorporation of actives to these products provides greater refinement to the formulation. Oils are incorporated in order to increase the moisturize and hydration of the skin. Stability tests are conducted to demonstrate the product's behavior during its period of validity and are essential when there is development of new formulations. The objective of this work was to produce bar soaps containing pe...

  16. http://www.seasinop.com.br/revista/index.php?journal=SEA&page=article&op=view&path%5B%5D=221&path%5B%5D=pdf_93

    J. L. Escobar

    2016-05-01

    Full Text Available The bar soap is a cosmetic personal care product most consumed in the world. The incorporation of actives to these products provides greater refinement to the formulation. Oils are incorporated in order to increase the moisturize and hydration of the skin. Stability tests are conducted to demonstrate the product's behavior during its period of validity and are essential when there is development of new formulations. The objective of this work was to produce bar soaps containing pequi oil and evaluate its stability through physicochemical testing. They developed three primary formulations with different pequi oil concentrations (1, 3 and 5% w/w, which were evaluated for strength and absorption to water, durability, melting, foaming, crack formation and pH . The best results were obtained with the incorporation of 3% (w/w of oil. After determination of the optimal concentration of oil, a new formulation was developed containing 3% of pequi oil and the stability tests were remade. It was found that the soaps showed good stability. Thus, it can be shown that the pequi oil can be used for preparation of bar soaps and that they have stability within the parameters studied

  17. Juan Manuel Palacio; Magdalena Candioti (compiladores). 2007. Justicia, política y derechos en América Latina : Buenos Aires: Prometeo Libros. 221 p.

    Stagnaro, Andrés

    2008-01-01

    El ejercicio propuesto por la obra que compilan Juan Manuel Palacio y Magdalena Candioti de pensar y poner en perspectiva histórica los problemas y desafíos que atañen a los sistemas de administración de justicia es una propuesta interesante que intenta dar cuenta de la centralidad que los estudios en torno a la justicia, la ley y el derecho han adquirido recientemente en las ciencias sociales como la historia, la antropología o la sociología.

  18. Stereochemistry of ring-opening/cross metathesis reactions of exo- and endo-7-oxabicyclo[2.2.1]hept-5-ene-2-carbonitriles with allyl alcohol and allyl acetate

    Piotr Wałejko

    2015-10-01

    Full Text Available The ROCM reactions of exo- and endo-2-cyano-7-oxanorbornenes with allyl alcohol or allyl acetate promoted by different ruthenium alkylidene catalysts were studied. The stereochemical outcome of the reactions was established. The issues concerning chemo- (ROCM vs ROMP, regio- (1-2- vs 1-3-product formation, and stereo- (E/Z isomerism selectivity of reactions under various conditions are discussed. Surprisingly good yields of the ROCM products were obtained under neat conditions.

  19. Aza-Quaternary Scaffolds from Selective Bond Cleavage of Bridgehead-Substituted 7-Azabicyclo[2.2.1]heptane: Total Synthesis of (+)-Cylindricines C-E and (-)-Lepadiformine A.

    Pandey, Ganesh; Janakiram, Vaitla

    2015-09-01

    A novel bridgehead-substituted aza-bicyclic framework has been designed and developed in both enantiomeric forms through an asymmetric desymmetrization reaction. Strategic exploitation of the ring strain in the aza-bicyclic framework has been utilized for the construction of the chiral aza-quaterenary scaffolds by selective bond fragmentation processes. Furthermore, a strategically designed precursor is employed for selective bond cleavage to initiate a cascade rearrangement for the total synthesis of the 1-azaspirotricyclic marine alkaloids (+)-cylindricines C, D, and E, as well as (-)-lepadiformine A. An oxidation/retro-aldol/aza-Michael sequence generated three new chiral centers with the required configuration in one pot. PMID:26220441

  20. Zpracování výsledků studentů v předmětu 6MI221 - Statistika pro manažery

    Tesařová, Šárka

    2008-01-01

    The work is described and evaluated the results in the summer semester of academic year 2007/2008 the course "Statistics for Managers". Data that we have to use, was collected Department of Information Management in Jindřichův Hradec at the Faculty of Management, University of Economics Prague. There are applied methods of descriptive statistics and appropriate statistical tests. Based on the data we have analyzed the interdependence of individual variables. Finally, work is to evaluate the s...

  1. R22(8 motifs in Aminopyrimidine sulfonate/carboxylate interactions: Crystal structures of pyrimethaminium benzenesulfonate monohydrate (2:2:1 and 2-amino-4,6-dimethylpyrimidinium sulfosalicylate dihydrate (4:2:2

    Muthiah Packianathan

    2007-11-01

    Full Text Available Abstract Background Pyrimethamine [2,4-diamino-5-(p-chlorophenyl-6-ethylpyrimidine] is an antifolate drug used in anti-malarial chemotherapy. Pyrimidine and aminopyrimidine derivatives are biologically important compounds owing to their natural occurrence as components of nucleic acids. Results In the crystal structures of two organic salts, namely pyrimethaminium benzenesulfonate monohydrate 1 and 2-amino-4, 6-dimethylpyrimidinium 3-carboxy-4-hydroxy benzenesulfonate dihydrate 2, pyrimethamine (PMN and 2-amino-4,6-dimethylpyrimidine (AMPY are protonated at one of the nitrogens in the pyrimidine rings. In both the PMN and AMPY sulfonate complexes, the protonated pyrimidine rings are hydrogen bonded to the sulfonate groups, forming a hydrogen-bonded bimolecular ring motif with graph-set notation R22(8. The sulfonate group mimics the carboxylate anion's mode of association, which is more commonly seen when binding with 2-aminopyrimidines. In compound 1, the PMN moieties are centrosymmetrically paired through a complementary DADA array of hydrogen bonds. In compound 2, two types of bimolecular cyclic hydrogen bonded R22(8 motifs (one involving the carboxylate group and the other involving sulfonate group coexist. Furthermore, this compound is stabilized by intra and intermolecular O-H...O hydrogen bonds. Conclusion The crystal structures of pyrimethaminium benzenesulfonate monohydrate and 2-amino-4,6-dimethylpyrimidinium sulfosalicylate dihydrate have been investigated in detail. In compound 1, the R22(8 motif involving the sulfonate group is present. The role the sulfonic acid group plays in mimicking the carboxylate anions is thus evident. In compound 2, two types of bimolecular cyclic hydrogen bonded R22(8 motifs (one involving the carboxylate group and the other involving sulfonate group coexist. In both the compounds base pairing also occurs. Thus homo and hetero synthons are present.

  2. (3-Benzoyl-1,7,7-trimethylbicyclo[2.2.1]heptan-2-olato-κ2O,Obis[2-(2-pyridylphenyl-κ2C1,N]iridium(III

    Kaijun Luo

    2011-11-01

    Full Text Available The title compound, [Ir(C11H8N2(C17H19O2], has an octahedral coordination geometry around the IrIII atom, retaining the cis-C,C,trans–N,N chelate disposition of the two 2-phenylpyridine ligands. The chelate rings are nearly mutually perpendicular [the interplanar angles range from 85.48 (17 to 89.17 (19°]. The two 2-(2-pyridylphenyl ligands are approximately planar, with the plane of the phenyl ring being inclined to that of the pyridine ring by 2.3 (3 and 5.1 (3° in the two ligands. The interplanar angle between the phenyl ring in 3-benzoyl-camphor and the IrO2C3 chelate ring is 35.5 (2°.

  3. 4-tert-Butyl­pyridinium chloride–4,4′-(propane-2,2-di­yl)bis­(2,6-di­methyl­phenol)–toluene (2/2/1)

    Alastair J. Nielson; Waters, Joyce M.

    2014-01-01

    In the title solvated salt, C9H14N+·Cl−·C19H24O2·0.5C7H7, two mol­ecules of 4,4′-(propane-2,2-di­yl)bis­(2,6-di­methyl­phenol) are linked via O—H⋯Cl hydrogen bonds to two chloride ions, each of which is also engaged in N—H⋯Cl hydrogen bonding to a 4-tert-butyl­pyridinium cation, giving a cyclic hydrogen-bonded entity centred at 1/2, 1/2, 1/2. The toluene solvent mol­ecule resides in the lattice and resides on an inversion centre; the disorder of the methyl group requires it to have a site-occ...

  4. 4-tert-Butyl-pyridinium chloride-4,4'-(propane-2,2-di-yl)bis-(2,6-di-methyl-phenol)-toluene (2/2/1).

    Nielson, Alastair J; Waters, Joyce M

    2014-04-01

    In the title solvated salt, C9H14N(+)·Cl(-)·C19H24O2·0.5C7H7, two mol-ecules of 4,4'-(propane-2,2-di-yl)bis-(2,6-di-methyl-phenol) are linked via O-H⋯Cl hydrogen bonds to two chloride ions, each of which is also engaged in N-H⋯Cl hydrogen bonding to a 4-tert-butyl-pyridinium cation, giving a cyclic hydrogen-bonded entity centred at 1/2, 1/2, 1/2. The toluene solvent mol-ecule resides in the lattice and resides on an inversion centre; the disorder of the methyl group requires it to have a site-occupancy factor of 0.5. No crystal packing channels are observed. PMID:24826127

  5. The earliest high-fired glazed ceramics in China: the composition of the proto-porcelain from Zhejiang during the Shang and Zhou periods (c. 1700-221 BC)

    Yin, M; Rehren, T.; Zheng, J. M.

    2011-01-01

    Bodies and glazes of 54 proto-porcelain sherds and 18 non proto-porcelain samples from Shang and Zhou periods production sites in Deqing, Zhejiang province were analysed by EPMA-WDS. The results indicate that the bodies of all samples were made from local raw material porcelain stone, with the proto-porcelain samples being made from clay of higher quality. Wood ashes, high in lime and low in potash, were intentionally applied to the proto-porcelain samples, resulting in the formation of lime-...

  6. Crystal structure of ethyl 2-(2-{1-[N-(4-bromophenyl)-2-oxo-2-phenylacetamido]-2-tert-butylamino-2-oxoethyl}-1H-pyrrol-1-yl)acetate

    Tetsuji Moriguchi; Venkataprasad Jalli; Suvratha Krishnamurthy; Akihiko Tsuge; Kenji Yoza

    2015-01-01

    In the title compound, C28H30BrN3O5, there is an intramolecular N—H...O hydrogen bond and an intramolecular C—H...O hydrogen bond, both forming S(9) ring motifs. The planes of the 4-bromophenyl ring and the phenyl ring are inclined to that of the pyrrole ring by 48.05 (12) and 77.45 (14)°, respectively, and to one another by 56.25 (12)°. In the crystal, molecules are linked via C—H...O hydrogen bonds and C—H...π interactions, forming slabs parallel to (10-1).

  7. Metformin Causes G1-Phase Arrest via Down-Regulation of MiR-221 and Enhances TRAIL Sensitivity through DR5 Up-Regulation in Pancreatic Cancer Cells

    Ryoichi Tanaka; Mitsuhiro Tomosugi; Mano Horinaka; Yoshihiro Sowa; Toshiyuki Sakai

    2015-01-01

    Although many chemotherapeutic strategies against cancer have been developed, pancreatic cancer is one of the most aggressive and intractable types of malignancies. Therefore, new strategies and anti-cancer agents are necessary to treat this disease. Metformin is a widely used drug for type-2 diabetes, and is also known as a promising candidate anti-cancer agent from recent studies in vitro and in vivo. However, the mechanisms of metformin's anti-cancer effects have not been elucidated. We de...

  8. Sorption studies of radioelements on geological materials

    Berry, J. A; 油井 三和; 北村 暁

    2007-01-01

    Batch sorption experiments have been carried out to study the sorption of uranium, technetium, curium, neptunium, actinium, protactinium, polonium, americium and plutonium onto bentonite, granodiorite and tuff. Mathematical modelling using the HARPHRQ program and the HATCHES database was carried out to predict the speciation of uranium and technetium in the equilibrated seawater, and neptunium, americium and plutonium in the rock equilibrated water. Review of the literature for thermodynamic ...

  9. Purification of cerium, neodymium and gadolinium for low background experiments

    Boiko R.S.; Barabash A.S.; Belli P.; Bernabei R.; Cappella F.; Cerulli R.; Danevich F.A.; Incicchitti A.; Laubenstein M.; Mokina V.M.; Nisi S.; Poda D.V.; Polischuk O.G.; Tretyak V.I.

    2014-01-01

    Cerium, neodymium and gadolinium contain double beta active isotopes. The most interesting are 150Nd and 160Gd (promising for 0ν2β search), 136Ce (2β+ candidate with one of the highest Q2β). The main problem of compounds containing lanthanide elements is their high radioactive contamination by uranium, radium, actinium and thorium. The new generation 2β experiments require development of methods for a deep purification of lanthanides from the radioactive elements. A combination of physical an...

  10. LASL experience in decontamination of the environment

    This discussion represents one part of a major effort in soil decontamination at the Los Alamos site. A contaminated industrial waste line in the Los Alamos townsite was removed, and a plutonium incineration facility, and a filter building contaminated with actinium-227 were dismantled. The former plutonium handling facility has been decontaminated, and canyons and an old firing site contaminated with strontium-90 have been surveyed

  11. Study of the origin of elements of the uranium-235 family observed in excess in the vicinity of the experimental nuclear EL4 reactor under dismantling. Lessons got at this day and conclusions; Etude de l'origine des elements de la famille de l'uranium-235 observes en exces dans les environs du reacteur nucleaire experimental EL4 en cours de demantelement. Enseignements retires a ce jour et conclusion

    NONE

    2007-07-01

    This study resumes the discovery of an excess of actinium 227 found around by EL4 nuclear reactor actually in dismantling. The search for the origin of this excess revealed a real inquiry of investigation during three years. Because a nuclear reactor existed in this area a particular attention will have concerned this region. The doubt became the line of conduct to find the answer to the human or natural origin of this excess. Finally and against any evidence, it appears that the origin of this phenomenon was natural, consequence of the particular local geology. The detail of the different investigations is given: search of a possible correlation with the composition of elevations constituent of lanes, search (and underlining) of new sites in the surroundings of the Rusquec pond and the Plouenez station, study of the atmospheric deposits under winds of the nuclear power plant and in the east direction, search of a possible relationship with the gaseous effluents of the nuclear power plant in the past, historical study of radioactive effluents releases in the fifty last years by the analysis of the sedimentary deposits in the Saint-Herbiot reservoir, search of a possible correlation between the excess of actinium 227 and the nuclear power plant activity; search of a possible correlation with a human activity without any relationship with the nuclear activities, search of a correlation with the underground waters, search of a correlation with the geological context, collect of information on the possible transfers in direction of the food chain, determination of the radiological composition of the underground waters ( not perturbed by human activity), search of the cause of an excess of actinium 227 in the old channel of liquid effluents release of the nuclear power plant. The results are given and discussed. And contrary to all expectations the origin of the excess of actinium 227 is completely natural. (N.C.)

  12. The discoveries of uranium 237 and symmetric fission — From the archival papers of Nishina and Kimura

    IKEDA, Nagao

    2011-01-01

    Shortly before the Second World War time, Nishina reported on a series of prominent nuclear physical and radiochemical studies in collaboration with Kimura. They artificially produced 231Th, a member of the natural actinium series of nuclides, by bombarding thorium with fast neutrons. This resulted in the discovery of 237U, a new isotope of uranium, by bombarding uranium with fast neutrons, and confirmed that 237U disintegrates into element 93 with a mass number of 237. They also identified t...

  13. History of the unraveling of the natural decay series

    Milestones in the subject of radioactivity, which were important to the unraveling of natural decay series, have been identified and described. The interplay between all these issues is very complex, and some aspects of the development of the uranium series is discussed as an example, the thorium and actinium series evolved in a similar way from research by many of the same people. All three series as understood in 1913 are compared with their present-day representation. (orig.)

  14. History of the unraveling of the natural decay series

    Milestones in the subject of radioactivity, which were important to the unraveling of natural decay series, have been identified and described. The interplay between all these issues is very complex, and some aspects of the development of the uranium series is discussed as an example, the thorium and actinium series evolved in a similar way from research by many of the same people. All three series as understood in 1913 are compared with their present-day representation. (author)

  15. System for recovery of daughter isotopes from a source material

    Tranter, Troy J [Idaho Falls, ID; Todd, Terry A [Aberdeen, ID; Lewis, Leroy C [Idaho Falls, ID; Henscheid, Joseph P [Idaho Falls, ID

    2009-08-04

    A method of separating isotopes from a mixture containing at least two isotopes in a solution is disclosed. A first isotope is precipitated and is collected from the solution. A daughter isotope is generated and collected from the first isotope. The invention includes a method of producing an actinium-225/bismuth-213 product from a material containing thorium-229 and thorium-232. A solution is formed containing nitric acid and the material containing thorium-229 and thorium-232, and iodate is added to form a thorium iodate precipitate. A supernatant is separated from the thorium iodate precipitate and a second volume of nitric acid is added to the thorium iodate precipitate. The thorium iodate precipitate is stored and a decay product comprising actinium-225 and bismuth-213 is generated in the second volume of nitric acid, which is then separated from the thorium iodate precipitate, filtered, and treated using at least one chromatographic procedure. A system for producing an actinium-225/bismuth-213 product is also disclosed.

  16. Behaviour of uranium series radionuclides in surface water (Crouzille, Limousin). Geochemical implications

    Understanding natural radionuclides behaviour in surface water is a required step to achieve uranium mine rehabilitation and preserve water quality. The first objective of this thesis is to determine which are the radionuclides sources in a drinking water reservoir. The second objective is to improve the knowledge about the behaviour of uranium series radionuclides, especially actinium. The investigated site is a brook (Sagnes, Limousin, France) which floods a peat bog contaminated by a former uranium mine and which empties into the Crouzille lake. It allows studying radionuclides transport in surface water and radionuclides retention through organic substance or water reservoir. Radionuclides distribution in particulate, colloidal and dissolved phases is determined thanks to ultra-filtrations. Gamma spectrometry allows measuring almost all natural radionuclides with only two counting stages. However, low activities of 235U series radionuclides impose the use of very low background well-type Ge detectors, such as those of the Underground Laboratory of Modane (France). Firstly, this study shows that no or few radionuclides are released by the Sagnes peat bog, although its radioactivity is important. Secondly, it provides details on the behaviour of uranium series radionuclides in surface water. More specifically, it provides the first indications of actinium solubility in surface water. Actinium's behaviour is very close to uranium's even if it is a little less soluble. (author)

  17. 14 CFR 292.22 - Effectiveness of tariffs on file.

    2010-01-01

    ... adherence to filed tariffs in 49 USC 41510 and the related provisions of 14 CFR part 221 as of November 30... well as under the provisions of 14 CFR Part 221, and they are canceled by operation of law. (b) As of... under 49 USC 41504 and the provisions of 14 CFR part 221, and are cancelled by operation of law....

  18. DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS

    P. Bernot

    2005-07-13

    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this activity is to predict dissolved concentrations or solubility limits for elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) relevant to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are provided in the form of tabulated functions with pH and log fCO{sub 2} as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. Even though selection of an appropriate set of radionuclides documented in Radionuclide Screening (BSC 2002 [DIRS 160059]) includes actinium, transport of Ac is not modeled in the total system performance assessment for the license application (TSPA-LA) model because of its extremely short half-life. Actinium dose is calculated in the TSPA-LA by assuming secular equilibrium with {sup 231}Pa (Section 6.10); therefore, Ac is not analyzed in this report. The output data from this report are fundamental inputs for TSPA-LA used to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for the actinides discussed in this report. These models cover broad ranges of environmental conditions so they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or

  19. DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS

    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this activity is to predict dissolved concentrations or solubility limits for elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) relevant to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are provided in the form of tabulated functions with pH and log fCO2 as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. Even though selection of an appropriate set of radionuclides documented in Radionuclide Screening (BSC 2002 [DIRS 160059]) includes actinium, transport of Ac is not modeled in the total system performance assessment for the license application (TSPA-LA) model because of its extremely short half-life. Actinium dose is calculated in the TSPA-LA by assuming secular equilibrium with 231Pa (Section 6.10); therefore, Ac is not analyzed in this report. The output data from this report are fundamental inputs for TSPA-LA used to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for the actinides discussed in this report. These models cover broad ranges of environmental conditions so they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or otherwise

  20. Detection of rare earth elements in Powder River Basin sub-bituminous coal ash using laser-induced breakdown spectroscopy (LIBS)

    Tran, Phuoc [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State; Mcintyre, Dustin [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State

    2015-10-01

    We reported our preliminary results on the use of laser-induced breakdown spectroscopy to analyze the rare earth elements contained in ash samples from Powder River Basin sub-bituminous coal (PRB-coal). We have identified many elements in the lanthanide series (cerium, europium, holmium, lanthanum, lutetium, praseodymium, promethium, samarium, terbium, ytterbium) and some elements in the actinide series (actinium, thorium, uranium, plutonium, berkelium, californium) in the ash samples. In addition, various metals were also seen to present in the ash samples

  1. The identification of soil radionuclides in the area of Puspiptek and surrounding

    The area of PUSPIPTEK and the surrounding are potentially exposed by radionuclides, because the operation of the nuclear research plant. The PPTN Serpong was operated long than 10 years, therefore soil radioactivity need to evaluate. The determination of radioactivity in the soil samples which be taken from research location using gamma spectrometry on June-August. The result of the research identified natural radionuclides K-40; Thorium decay series Ac-228, Bi-212, Pb-212, Tl-208, Ra-224 and Rn-220; Uranium decay series Bi-214, Pa-234, Pb-214 and Actinium decay series Bi-211, Po-211. There are no identification radionuclides produce from the activation of PPTN Serpong

  2. The promoter for a variant surface glycoprotein gene expression site in Trypanosoma brucei.

    Zomerdijk, J C; Ouellette, M; ten Asbroek, A L; Kieft, R.; Bommer, A M; Clayton, C E; Borst, P

    1990-01-01

    The variant-specific surface glycoprotein (VSG) gene 221 of Trypanosoma brucei is transcribed as part of a 60 kb expression site (ES). We have identified the promoter controlling this multigene transcription unit by the use of 221 chromosome-enriched DNA libraries and VSG gene 221 expression site specific transcripts. The start of transcription was determined by hybridization and RNase protection analysis of nascent RNA. The 5' ends of the major transcripts coming from the initiation region m...

  3. An aerial radiological survey of the Sandia National Laboratories and surrounding area

    A team from the Remote Sensing Laboratory conducted an aerial radiological survey of the area surrounding the Sandia National Laboratories and Kirtland Air Force Base in Albuquerque, New Mexico, during March and April 1993. The survey team measured the terrestrial gamma radiation at the site to determine the levels of natural and man-made radiation. This survey includes the areas covered by a previous survey in 1981. The results of the aerial survey show a background exposure rate which varies between 5 and 18 μR/h plus an approximate 6 μR/h contribution from cosmic rays. The major radioactive isotopes found in this survey were: potassium-40, thallium-208, bismuth-214, and actinium-228, which are all naturally-occurring isotopes, and cobalt-60, cesium-137, and excess amounts of thallium-208 and actinium-228, which are due to human actions in the survey area. In regions away from man-made activity, the exposure rates inferred from this survey's gamma ray measurements agree almost exactly with the exposure rates inferred from the 1981 survey. In addition to the aerial measurements, another survey team conducted in situ and soil sample radiation measurements at three sites within the survey perimeter. These ground-based measurements agree with the aerial measurements within ± 5%

  4. Mixed valency of the RE and Ac ions in solid states

    Full text: This review is devoted to consideration of the methods and results of the theoretical and experimental investigations of the electronic state of the rare earths and actinium ions in the separate compound. The methods of the high resolution X ray spectroscopy were used for our consideration. Energy of the X ray lines of the rare earths and actinium ions in free state and solid states was study carefully. Valency shifts of X Ray lines under change of electronic state of nf - ions in different oxide, fluoride and chloride compounds were determined for K -, L- and M - lines for these ions with accuracy near 10 -100 MeV. We studied the electronic state of nf- ions which is changed from '+2' to '+4' and determined the concentration of ions in different electronic state. Relative error for theoretical energy of the most lines for HFP - approach in comparison with experiment is less than 0.5%, and deviation for concentration is less than 5%

  5. A study of uranium and thorium migration at the Koongarra uranium deposit with application to actinide transport from nuclear waste repositories

    One way to gain confidence in modelling possible radionuclide releases is to study natural systems which are similar to components of the multibarrier waste repository. Several such analogues are currently under study and these provide useful data about radionuclide behaviour in the natural environment. One such system is the Koongarra uranium deposit in the Northern Territory. In this dissertation, the migration of actinides, primarily uranium and thorium, has been studied as an analogue for the behaviour of transuranics in the far-field of a waste repository. The major findings of this study are: 1. the main process retarding uranium migration in the dispersion fan at Koongarra is sorption, which suppresses dissolved uranium concentrations well below solubility limits, with ferrihydrite being a major sorbing phase; 2. thorium is extremely immobile, with very low dissolved concentrations and corresponding high distribution ratios for 230Th. Overall, it is estimated that colloids are relatively unimportant in Koongarra groundwater. Uranium migrates mostly as dissolved species, whereas thorium and actinium are mostly adsorbed to larger, relatively immobile particles and the stationary phase. However, of the small amount of 230Th that passes through a 1μm filter, a significant proportion is associated with colloidal particles. Actinium appears to be slightly more mobile than thorium and is associated with colloids to a greater extent, although generally present in low concentrations. These results support the possibility of colloidal transport of trivalent and tetravalent actinides in the vicinity of a nuclear waste repository. 112 refs., 23 tabs., 32 figs

  6. Purification of cerium, neodymium and gadolinium for low background experiments

    Boiko R.S.

    2014-01-01

    Full Text Available Cerium, neodymium and gadolinium contain double beta active isotopes. The most interesting are 150Nd and 160Gd (promising for 0ν2β search, 136Ce (2β+ candidate with one of the highest Q2β. The main problem of compounds containing lanthanide elements is their high radioactive contamination by uranium, radium, actinium and thorium. The new generation 2β experiments require development of methods for a deep purification of lanthanides from the radioactive elements. A combination of physical and chemical methods was applied to purify cerium, neodymium and gadolinium. Liquid-liquid extraction technique was used to remove traces of Th and U from neodymium, gadolinium and for purification of cerium from Th, U, Ra and K. Co-precipitation and recrystallization methods were utilized for further reduction of the impurities. The radioactive contamination of the samples before and after the purification was tested by using ultra-low-background HPGe gamma spectrometry. As a result of the purification procedure the radioactive contamination of gadolinium oxide (a similar purification efficiency was reached also with cerium and neodymium oxides was decreased from 0.12 Bq/kg to 0.007 Bq/kg in 228Th, from 0.04 Bq/kg to <0.006 Bq/kg in 226Ra, and from 0.9 Bq/kg to 0.04 Bq/kg in 40K. The purification methods are much less efficient for chemically very similar radioactive elements like actinium, lanthanum and lutetium.

  7. The Technological Enhancement of Normally Occurring Radioactive Materials in Red Mud due to the Production of Alumina

    Maurice O. Miller

    2016-01-01

    Full Text Available This study investigates the level of technological enhancement of normally occurring radioactive materials (TENORM in the red mud waste due to the production of alumina in Jamaica. Technological enhancements factors (TEF were determined for the uranium, thorium, actinium series, their progenies, and the nonseries potassium-40 using gamma spectrometry. The study concluded that bauxite production technologically enhances the uranium progenies Th-234, Pb-214, Bi-214, and Pa-234 and the thorium-232 progenies Ac-228, Pb-212, and Bi-212 in red mud. The actinium series was technologically enhanced, but K-40 and the thorium daughter, Tl-208, were reduced. The spectrometric comparison of Tl-208 (at 510 keV was unexpected since its other photopeaks at 583 keV, 934 keV, and 968 keV were markedly different. An explanation for this anomaly is discussed. An explanation regarding the process of accumulation and fractionation of organically derived phosphate deposits and potassium-feldspar is offered to explain the spectrometric differences between the alumina product and its waste material, red mud.

  8. Low background counting of 222Rn, 220Rn and 219Rn with electrostatic counters

    Mong, Brian; EXO-200 Collaboration; nEXO Collaboration

    2014-09-01

    The radon counting technique based on electrostatic precipitation of progenies in gas followed by alpha spectroscopy has been applied to support the material selection programs of low background, neutrino and dark matter experiments with emphasis on EXO. An array of 8 counters operated by Laurentian University at SNOLAB and the Waste Isolation Pilot Plant have reached the sensitivity of 10 atoms/day in the uranium, thorium and actinium chains. Hardware improvements are underway to further increase the capacity and sensitivity in support of nEXO. The radon counting technique based on electrostatic precipitation of progenies in gas followed by alpha spectroscopy has been applied to support the material selection programs of low background, neutrino and dark matter experiments with emphasis on EXO. An array of 8 counters operated by Laurentian University at SNOLAB and the Waste Isolation Pilot Plant have reached the sensitivity of 10 atoms/day in the uranium, thorium and actinium chains. Hardware improvements are underway to further increase the capacity and sensitivity in support of nEXO. Supported by NSERC Project Grants ``Search for Double Beta Decay with EXO.''

  9. Purification of cerium, neodymium and gadolinium for low background experiments

    Boiko, R. S.; Barabash, A. S.; Belli, P.; Bernabei, R.; Cappella, F.; Cerulli, R.; Danevich, F. A.; Incicchitti, A.; Laubenstein, M.; Mokina, V. M.; Nisi, S.; Poda, D. V.; Polischuk, O. G.; Tretyak, V. I.

    2014-01-01

    Cerium, neodymium and gadolinium contain double beta active isotopes. The most interesting are 150Nd and 160Gd (promising for 0ν2β search), 136Ce (2β+ candidate with one of the highest Q2β). The main problem of compounds containing lanthanide elements is their high radioactive contamination by uranium, radium, actinium and thorium. The new generation 2β experiments require development of methods for a deep purification of lanthanides from the radioactive elements. A combination of physical and chemical methods was applied to purify cerium, neodymium and gadolinium. Liquid-liquid extraction technique was used to remove traces of Th and U from neodymium, gadolinium and for purification of cerium from Th, U, Ra and K. Co-precipitation and recrystallization methods were utilized for further reduction of the impurities. The radioactive contamination of the samples before and after the purification was tested by using ultra-low-background HPGe gamma spectrometry. As a result of the purification procedure the radioactive contamination of gadolinium oxide (a similar purification efficiency was reached also with cerium and neodymium oxides) was decreased from 0.12 Bq/kg to 0.007 Bq/kg in 228Th, from 0.04 Bq/kg to <0.006 Bq/kg in 226Ra, and from 0.9 Bq/kg to 0.04 Bq/kg in 40K. The purification methods are much less efficient for chemically very similar radioactive elements like actinium, lanthanum and lutetium.

  10. Academics are Reading More Electronic Journal Articles in More Subjects, Using Varying Strategies to Find and Manage Them. A Review of: Ollé, C., & Borrego, Á. (2010). A qualitative study of the impact of electronic journals on scholarlyinformation behavior. Library & Information Science Research, 32(3), 221-228.

    Christina E. Carter

    2010-01-01

    Objective – To assess how the increase in number of electronic journals available to academic scholars has changed their information-seeking or consulting behaviour, with respect to 1) the amount and diversity of sources they read; 2) strategies they use to keep up-to-date in their fields; 3) use of personalized information services; 4) determining the value and relevance of articles; and 5) personal management of scientific information. This study is a follow-up to an earlier quantitative st...

  11. Sherlock Holmes á skjánum: Hinsegin rökvísi, samkynhneigð skelfing og nútími í tveimur þáttaröðum um íbúana á 221b Baker Street

    Bjarndís Helga Tómasdóttir 1982

    2015-01-01

    Í þessari ritgerð verður litið til kvikmynda- og sjónvarpsaðlagana á verkum Sir Arthurs Conan Doyle um sérlundaða spæjarann Sherlock Holmes og lækninn John Watson. Þeirri spurningu er velt upp hvaða þýðingu persóna Holmes hefur fyrir nútímann frá sjónarhorni hinsegin fræða. Notast er við kenningar Wolfang Iser um eyður í texta til þess að gera grein fyrir hinsegin túlkunarrými í verkum Doyles. Í framhaldi er áhersla lögð á að greina ákveðinn flótta eða afneitun á hinsegin túlkun í þeim aðlögu...

  12. Academics are Reading More Electronic Journal Articles in More Subjects, Using Varying Strategies to Find and Manage Them. A Review of: Ollé, C., & Borrego, Á. (2010. A qualitative study of the impact of electronic journals on scholarlyinformation behavior. Library & Information Science Research, 32(3, 221-228.

    Christina E. Carter

    2010-12-01

    Full Text Available Objective – To assess how the increase in number of electronic journals available to academic scholars has changed their information-seeking or consulting behaviour, with respect to 1 the amount and diversity of sources they read; 2 strategies they use to keep up-to-date in their fields; 3 use of personalized information services; 4 determining the value and relevance of articles; and 5 personal management of scientific information. This study is a follow-up to an earlier quantitative study (Borrego, Anglada, Barrios, & Comellas, 2007 in the same setting.Design – Qualitative, using an open-ended questionnaire, followed by personal interviews of a small group of the respondents.Setting – Universities that are members of the Consortium of Academic Libraries of Catalonia (CBUC, which is made up of the eight public Catalan universities and the National Library of Catalonia, Spain.Subjects – One hundred thirty-seven scholars from the member universities of diverse ages and disciplines. Eleven of these academics were selected for personal interviews.Methods – The authors used a two-staged approach to gather comments from researchers on their use of electronic journals. First, an open-ended, self-administered questionnaire (with some pre-testing donewas sent by e-mail to some 490 academics who had provided e-mail addresses in the quantitative study; 137 were returned and analyzed. Personal interviews were then conducted with 11 scholars who had given the most detailed answers in the questionnaire. Their ages ranged from 28 to 67; each was from a different discipline, and from six of the universities.Informed consent sheets (describing the study and guaranteeing anonymity were given to the 11 interviewees. Personal interviews were conducted in the subjects’ offices by one of the authors, and lasted between 45-60 minutes. In the interview stage, the authors wanted to examine: use and assessment of the library, access to electronic information, and impact of e-resources on information behaviour. Subjects were also asked to provide three suggestions on improving access to scientific information.Main Results – The amount of reading and number of electronic journals and other sources consulted among the scholars who participated in this study has increased. Three-quarters of survey respondents consult more journals and read more articles. The scholars reported that they are grateful for the increase in electronic information and its enhanced ease of access, and are not overwhelmed by it. Their reading has become more discriminatory, though, with many reporting “skimming” much of what they read to save time. Scholars keep up-to-date in three main ways: web browsing of journal issues, library database searches, and TOC e-mail alerts. More than 90% of survey respondents reported conducting database searches. Google and Google Scholar were often mentioned ahead of specific library database names. In determining value and relevance of an article, its author and abstract are key for scholars. In addition, personal information management techniques used by scholars were all over the board. The three main methods were use of print or electronic folders, reference management software, and no system. Many of the academics felt their information management systems were “rudimentary” (p. 225.The request for suggestions and comments on the questionnaire was not answered by “most of the sample” (p. 226. Those who did respond to this request asked for more library resources. The main complaint expressed by scholars concerned the difficulty and complexity of finding journal article content using the Library website (e.g., varying databases, difficulty of interpreting what journal electronic and print holdings are available. Because of this, a number of scholars used Google to find library-subscribed content.Conclusion – By having greater and easier access to e-journals, scholars accessing the CBUC read more articles from more disciplines. Scholars would prefer a simpler library interface to search for online content. Due to the complexity of finding article content, they use web search tools like Google and Google Scholar to get to what they need faster. The authors of this study believe research should be conducted on the use of the Consortium’s metasearch tool to reduce the complexity. Research should also be conducted on value-added features of search interfaces for particular disciplines.

  13. 宁夏城市居民营养素摄入量与代谢综合征相关危险因素调查及分析%Relationship between dietary patterns and metabolic syndrome among urban populations in Ningxia, China . Journal of Zhejiang University (Agric . & Life Sci .), 2013,39(2):215-221

    李宏宇; 张娜; 李琳; 陶秀娟; 杨建军; 张毓洪; 赵燚

    2013-01-01

    Summary It is well documented that the role of dietary composition in relation to the development of metabolic syndrome ( MS) remains inconclusive . Several studies on the relationship between MS and energy intake have suggested that the macronutrient composition of the diet ( proteins , fats , carbohydrates) may play an important contributing role to MS in adults . So , this study aims to investigate the possible relationship between MS and energy intake , percentage energy intake from macronutrients among urban populations in Ningxia , China . According to different economic levels from 2011 to 2012 , 2 465 subjects ( age:18‐75 years) were selected using stratified cluster random sampling in Yinchuan , Wuzhong , Zhongwei , Guyuan , and Shizuishan in Ningxia , China . Dietary intake was assessed using 24‐h food records and a validated food frequency questionnaire . Body mass , height , waist circumference , blood pressure , triglyceride ( TG ) , high‐density lipoprotein cholesterol ( HDL‐C ) , and blood glucose were measured . Logistic regression models were adjusted for age , smoking , drinking , and physical activity factors . The results showed that there were 647 MS cases in all subjects . According to the diagnosis criteria of MS , the incidence of MS was 26 .2% ( men:281 cases (25% ) ;women:366 cases ( 27 .3% ) ) , no significant difference in sex composition ( P>0 .05) . As a way of lifestyle , there was no significant difference in smoking , drinking , exercise between MS group and control group ( P>0 .05) ;significant difference was found in tertian dietary intake of protein and fat energy percentage between MS group and control group ( P0.05);MS组与对照组间吸烟、饮酒、锻炼等生活方式构成的差异无统计学意义( P>0.05);MS组与对照组间日膳食摄入蛋白质及脂肪能量百分比差异有统计学意义( P<0.05);MS组与对照组间的体质指数、腰围、收缩压、舒张压、空腹血糖、胆固醇、甘油三酯、高密度脂蛋白差异有统计学意义( P<0.05). Logistic多因素分析表明,蛋白质、脂肪及碳水化合物的能量占总摄入能量的百分比过多是城市居民代谢综合征的重要危险因素,其中高蛋白质组:相对危险程度比值比( odds ratio , OR)=1.417;高脂肪组:OR=1.647;高碳水化合物组:OR=1.810;因此,应采取膳食营养干预措施来有效预防MS .

  14. Crystal structure of cis-bis-{4-phenyl-1-[(3R)-1,7,7-tri-methyl-2-oxobi-cyclo-[2.2.1]heptan-3-ylidene]thio-semicarbazidato-κ(3) O,N (1),S}cadmium(II) with an unknown solvent mol-ecule.

    Nogueira, Vanessa Senna; Bresolin, Leandro; Näther, Christian; Jess, Inke; de Oliveira, Adriano Bof

    2015-12-01

    The reaction between the racemic mixture of the camphor-4-phenyl-thio-semicarbazone derivative and cadmium acetate dihydrate yielded the title compound, [Cd(C17H20N3OS)2]. The Cd(II) ion is six-coordinated in a distorted octa-hedral environment by two deprotonated thio-semicarbazone ligands acting as an O,N,S-donor in a tridentate chelating mode, forming five-membered chelate rings. In the crystal, the mol-ecules are connected via pairs of N-H⋯S and C-H⋯S inter-actions, building centrosymmetric dimers. One of the ligands is disordered in the campher unit over two sets of sites with site-occupancy factors of 0.7 and 0.3. The structure contains additional solvent mol-ecules, which are disordered and for which no reasonable split model was found. Therefore, the data were corrected for disordered solvent using the SQUEEZE routine [Spek (2015 ▸). Acta Cryst. C71, 9-18] in PLATON. Since the disordered solvents were removed by data processing, and the number of solvent entities was a suggestion only, they were not considered in the chemical formula and subsequent chemical or crystal information. PMID:26870441

  15. 2,4-Di-tert-butyl-6-[(R/S-1-(3,5-di-tert-butyl-2-hydroxyphenylethyl]phenyl [(1R,4S-7,7-dimethyl-2-oxobicyclo[2.2.1]heptan-1-yl]methanesulfonate

    Cheng Wang

    2012-01-01

    Full Text Available The asymmetric unit of the title compound, C40H60O5S, comprises two diastereomers related, except for the chiral camphor groups, by a pseudo-inversion centre. In both diasteromers, the camphor sulfate moiety maintained the absolute configuartion (R,S of the precursor. However, the absolute configurations at the methine C atoms are of opposite chirality. Both molecules reveal intramolecular O—H...O hydrogen bonds, whereas van der Waals interactions define the crystal packing.

  16. Crystal structure of ethyl 2-(2-{1-[N-(4-bromo­phen­yl)-2-oxo-2-phenyl­acetamido]-2-tert-butyl­amino-2-oxo­ethyl}-1H-pyrrol-1-yl)acetate

    Moriguchi, Tetsuji; Jalli, Venkataprasad; Krishnamurthy, Suvratha; Tsuge, Akihiko; Yoza, Kenji

    2015-01-01

    In the title compound, C28H30BrN3O5, there is an intra­molecular N—H⋯O hydrogen bond and an intra­molecular C—H⋯O hydrogen bond, both forming S(9) ring motifs. The planes of the 4-bromo­phenyl ring and the phenyl ring are inclined to that of the pyrrole ring by 48.05 (12) and 77.45 (14)°, respectively, and to one another by 56.25 (12)°. In the crystal, mol­ecules are linked via C—H⋯O hydrogen bonds and C—H⋯π inter­actions, forming slabs parallel to (10-1).

  17. Role of juvenile hormone in the hypermetabolic production of water revealed by the O2 consumption and thermovision images of larvae of insects fed a diet of dry food

    Sláma, Karel; Lukáš, J.

    2013-01-01

    Roč. 110, č. 2 (2013), s. 221-230. ISSN 1210-5759 Grant ostatní: Ministerstvo zemědělství(CZ) MZe0002700604 Institutional support: RVO:60077344 Keywords : Lepidoptera * Galleria mellonella * Coleoptera Subject RIV: ED - Physiology Impact factor: 1.076, year: 2013 http://www.eje.cz/pdfs/110/2/221

  18. Recent developments in generation of volatile species and in their atomization for atomic absorption spectrometry

    Dědina, Jiří; Arslan, Y.; Mester, Z.; Sturgeon, R. E.; Kratzer, Jan; Matoušek, Tomáš; Musil, Stanislav; Svoboda, Milan

    2014. s. 221-221. [Rio Symposium on Atomic Spectrometry /13./. 19.10.2014-24.10.2014, Merida, Yucatan] R&D Projects: GA AV ČR(CZ) M200311202; GA ČR GA14-23532S Institutional support: RVO:68081715 Keywords : Arsenic * speciation analysis * sapphire tube atomizer Subject RIV: CB - Analytical Chemistry, Separation

  19. Neiella marinum gen. nov., sp. nov., isolated from sea cucumber

    A novel strain, designated J221**T, was isolated from the intestine of a sea cucumber, Apostichopus japonicus, collected from earthen ponds in Qingdao, China. The strain is Gram-negative, oxidase-positive, aerobic, and rod-shaped cell. Growth of strain J221T was observed at temperatures between 10...

  20. 7 CFR 2.63 - Deputy Under Secretary for Research, Education, and Economics.

    2010-01-01

    ... Economics. 2.63 Section 2.63 Agriculture Office of the Secretary of Agriculture DELEGATIONS OF AUTHORITY BY... Under Secretary for Research, Education, and Economics § 2.63 Deputy Under Secretary for Research, Education, and Economics. Pursuant to § 2.21(a), subject to reservations in § 2.21(b), and subject to...

  1. 24 CFR 248.201 - Definitions.

    2010-04-01

    ... 24 CFR part 5. Adjusted Income. Annual income, as specified in § 251.21 of this chapter, less... Commissioner under part 221 of this chapter and bearing a below market interest rate as provided under § 221... allowable distributions. Return on Investment. The amount of allowable distributions, tax benefits,...

  2. Conformation analysis of Se and Te containing nucleoside analogues

    Poštová Slavětínská, Lenka; Rejman, Dominik; Kleinpeter, E.; Pohl, Radek

    Santiago de Compostela : -, 2013. s. 221-221. [SMASH 2013. 22.9.2013-25.9.2013, Santiago de Compostela] R&D Projects: GA ČR GA13-24880S Institutional support: RVO:61388963 Keywords : low-temperature NMR * DFT * nucleoside analogues Subject RIV: CC - Organic Chemistry

  3. Kvaalide kvainimine / Daniel C. Dennett ; tõlk. Bruno Mölder

    Dennett, Daniel C., 1942-

    1997-01-01

    Järgneb Akadeemia 1998, nr. 1, lk. 189-221. Lk. 209-221 järelsõna: B. Mölder. Dennett ja kvaalid. Sisald. bibliogr. Tõlke allikas: Quining Qualia. In: Conciousness in Contemporary Science. - Oxford, 1988, lk. 42-77

  4. Continuous Glucose Monitoring Can Uncover Mistakes in Self-Treatment of Hypoglycemia in Patients with Type I Diabetes Mellitus

    Brož, J.; Urbanová, J.; Janíčková Žďárská, D.; Doničová, V.; Brabec, Marek

    2014-01-01

    Roč. 63, Supplement 1 (2014), A221-A221. ISSN 0012-1797. [American Diabetes Association. Scientific Sessions /74./. 13.06.2014-17.06.2014, San Francisco] Institutional support: RVO:67985807 Keywords : continuous monitoring * type I diabetes * semiparametric modeling Subject RIV: FB - Endocrinology, Diabetology, Metabolism, Nutrition

  5. From microRNA functions to microRNA therapeutics: novel targets and novel drugs in breast cancer research and treatment (Review).

    Piva, Roberta; Spandidos, Demetrios A; Gambari, Roberto

    2013-10-01

    MicroRNAs (miRNAs or miRs) are a family of small non‑coding RNAs that regulate gene expression by the sequence-selective targeting of mRNAs, leading to translational repression or mRNA degradation, depending on the degree of complementarity with target mRNA sequences. miRNAs play a crucial role in cancer. In the case of breast tumors, several studies have demonstrated a correlation between: i) the expression profile of oncogenic miRNAs (oncomiRs) and tumor suppressor miRNAs; and ii) the tumorigenic potential of triple-negative [estrogen receptor (ER), progesterone receptor (PR) and Her2/neu] primary breast cancers. Among the miRNAs involved in breast cancer, miR-221 plays a crucial role for the following reasons: i) miR-221 is significantly overexpressed in triple-negative primary breast cancer; ii) the oncosuppressor p27Kip1, a validated miR-221 target is downregulated in aggressive cancer cell lines; and iii) the upregulation of a key transcription factor, Slug, appears to be crucial, since it binds to the miR-221/miR-222 promoter and is responsible for the high expression of the miR-221/miR-222 cluster in breast cancer cells. A Slug/miR-221 network has been suggested, linking miR-221 activity with the downregulation of a Slug repressor, leading to Slug/miR-221 upregulation and p27Kip1 downregulation. Interference with this process can be achieved using antisense miRNA (antagomiR) molecules targeting miR-221, inducing the downregulation of Slug and the upregulation of p27Kip1. PMID:23939688

  6. Purification system of gram-amount neptunium using anion exchange chromatography

    To develop a purification system of gram-amount neptunium using anion exchange chromatography, adsorption elution of excess amount of actinium in 6M HNO3 aqueous solution was studied using thorium and uranium tracer. The partition coefficient (Kd) of Th (IV) decreased from Kd=99.1 of tracer to Kd=44.0, 5% load. By decreasing the partition coefficient, we can wash until 30 Vs under the purification conditions of 1% load and 95% recovery. The retention volume of U (IV) was about 300 Vs, a large value. The partition coefficient of Np (IV) may be larger than it and the large amount of washable eluting solution may be obtained. Washing of impurity of 3d transition metal and actinide (VI) can be done until 20Vs. With washing of 150Vs, impurity of alkali earth metal, metals (III) and platinum group metals decreased less than 0.1%. (S.Y.)

  7. A francium-223 reservoir source

    By improving and accelerating a method which had been earlier tried for caesium-rubidium separation on a cellulose column, i.e. elution with 2N HCl-equilibrated phenol, the author succeeded in obtaining consecutive and quasi-selective elutions of francium-223, starting with actinium-227 fixed at the top of a small cellulose column to which ZrO2 had been added. The francium-223, rapidly eluted under pressure, is extracted by water while the phenol is extracted by ether; it can easily be cleared of any residual traces of radioactive contaminants (thallium-207, radium-223, thorium-227) by two consecutive BaSO4 precipitations. The preparation of a Fr223 solution (HCl-H2SO4) requires approximately 20 min; the time noted for Fr223 was closer to 22 than to 21 min. (author)

  8. Radionuclide interactions with marine sediments

    A critical review of the literature on the subject of the interactions of radionuclides with marine sediments has been carried out. On the basis of the information available, an attempt has been made to give ranges and 'best estimates' for the distribution ratios between seawater and sediments. These estimates have been based on an understanding of the sediment seawater system and the porewater chemistry and mineralogy. Field measurements, laboratory measurements and estimates based on stable-element geochemical data are all taken into account. Laboratory measurements include distribution-ratio and diffusion-coefficient determinations. The elements reviewed are carbon, chlorine, calcium, nickel, selenium, strontium, zirconium, niobium, technetium, tin, iodine, caesium, lead, radium, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium and curium. (author)

  9. Formerly utilized MED/AEC sites Remedial Action Program. Radiological survey of the St. Louis Airport Storage Site, St. Louis, Missouri. Final report

    Results of two radiological surveys of the St. Louis-Lambert Airport property, formerly known as the Airport Storage Site, St. Louis, Missouri, are presented. Uranium- and radium-bearing waste materials were stored from the 1940's to the late 1960's in this area. The surveys included direct measurements of beta-gamma radiation; determination of uranium, actinium, and radium concentrations in soil samples and from bore holes; determination of radionuclide concentrations in groundwater and surface water; measurement of radon flux from the ground surface; and measurements of 222Rn in air near the site. Results indicate that some offsite drainage pathways are becoming contaminated, probably by runoff from the site; no migration of 222Rn from the site was observed

  10. JAEA thermodynamic database for performance assessment of geological disposal of high-level and TRU wastes. Refinement of thermodynamic data for trivalent actinoids and samarium

    Within the scope of the JAEA thermodynamic database project for performance assessment of geological disposal of high-level radioactive and TRU wastes, the refinement of the thermodynamic data for the inorganic compounds and complexes of trivalent actinoids (actinium(III), plutonium(III), americium(III) and curium(III)) and samarium(III) was carried out. Refinement of thermodynamic data for these elements was based on the thermodynamic database for americium published by the Nuclear Energy Agency in the Organisation for Economic Co-operation and Development (OECD/NEA). Based on the similarity of chemical properties among trivalent actinoids and samarium, complementary thermodynamic data for their species expected under the geological disposal conditions were selected to complete the thermodynamic data set for the performance assessment of geological disposal of radioactive wastes. (author)

  11. Theoretical Study on Properties of New Isotope 265Bh

    2006-01-01

    The properties of nuclei belonging to the newly observed α-decay chain starting from 265Bh have been studied. The axially deformed relativistic mean-field calculation with the force NL-Z2 has been performed in the blockedBCS approximation. Some ground state properties such as binding energies, deformations, spins, and parities, as well as Q-values of the α-decay for this decay chain have been calculated and compared with known experimental data. Good agreement is found. The single-particle spectrum of the nucleus 265 Bh is studied and some new magic numbers are found,while the magnitudes of the shell gaps in superheavy nuclei are much smaller than those of nuclei before the actinium region, and the Fermi surfaces are close to the continuum. Thus the superheavy nuclei are usually not stable. The The methods which give good agreement with the data are selected.

  12. Proposed training program for construction personnel involved in remedial action work at sites contaminated by naturally occurring radionuclides

    Many sites used during the early days of the US atomic energy program are contaminated with radionuclides of the primordial decay chains (uranium, thorium, and actinium series). This contamination consists of residues resulting from refining and processing uranium and thorium. Preparation of these sites for release to unrestricted private use will involve the assistance of construction workers, many of whom have limited knowledge of the hazards associated with radioactive materials. Therefore, there is a need to educate these workers in the fundamentals of radioactive material handling to minimize exposures and possible spread of contamination. This training should disseminate relevant information at an appropriate educational level and should instill a cautious, common-sense attitude toward the handling of radioactive materials. The training should emphasize basic information concerning environmental radiation within a context of relative risk. A multi-media format, including colorful visual aids, demonstration, and discussion, should be used to maximize motivation and retention. A detailed, proposed training program design is presented

  13. Dicty_cDB: AHA802 [Dicty_cDB

    Full Text Available yostelium discoideum strain QS... 225 9e-80 FJ374891_1( FJ374891 |pid:none) Dictyostelium discoideum stra...in QS... 225 2e-79 FJ374901_1( FJ374901 |pid:none) Dictyostelium discoideum stra...in QS... 225 5e-79 FJ374895_1( FJ374895 |pid:none) Dictyostelium discoideum strain QS... 221 6e-...79 FJ374893_1( FJ374893 |pid:none) Dictyostelium discoideum strain QS... 221 6e-79 FJ374915_1( FJ374915 |pid:none) Dict...yostelium discoideum strain QS... 221 2e-78 FJ374902_1( FJ374902 |pid:none) Dict

  14. Optimisation of trierucin content in oilseed rape

    Batra, Neelu

    2005-01-01

    High erucic acid rapeseed (HEAR) cultivars have regained interest for industrial purposes because erucic acid (22:1) is a valuable feedstock with a wide range of applications especially if it is available in sufficient quantities and in sufficiently pure form. In HEAR oil, however, the 22:1 content is limited to 67% because 22:1 is excluded from the sn-2 position of the glycerol backbone. To overcome this theoretical limit in HEAR oil and, thus, to improve its oleochemical properties combined...

  15. Miasis cutánea por Cochliomyia hominivorax (Coquerel) (Díptera: Calliphoridae) en el Hospital Universidad del Norte, Soledad, Atlántico Cutaneous myiasis by Cochliomyia hominivorax (Coquerel) (Díptera Calliphoridae) in Hospital Universidad del Norte, Soledad, Atlántico

    Ana María Santos; Esther Díaz; Lila Visbal; Luis Eduardo Castro; Romero-Vivas, Claudia M.E.

    2009-01-01

    221e1f;">221e1f;">

    La miasis humana es el parasitismo de órganos y tejidos producido por especies de larvas del orden Díptera.

    221e1f; font-family: Helvetica,Helvetica;">El diagnóstico se realiza con base en hallazgos clínicos ...

  16. A porphyrin-based metal-organic framework as a pH-responsive drug carrier

    Lin, Wenxin; Hu, Quan; Jiang, Ke; Yang, Yanyu; Yang, Yu; Cui, Yuanjing; Qian, Guodong

    2016-05-01

    A low cytotoxic porphyrin-based metal-organic framework (MOF) PCN-221, which exhibited high PC12 cell viability via 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyl tetrazolium (MTT) assay, was selected as an oral drug carrier. Methotrexate (MTX) was chosen as the model drug molecule which was absorbed into inner pores and channels of MOFs by diffusion. PCN-221 showed high drug loading and sustained release behavior under physiological environment without "burst effect". The controlled pH-responsive release of drugs by PCN-221 revealed its promising application in oral drug delivery.

  17. Origin of elements of the Uranium-235 family observed in the Ellez river near the EL-4 experimental nuclear reactor in dismantling (Monts d'Arree- Finistere department); Origine des elements de la famille de l'uranium-235 observes dans la riviere Ellez a proximite du reacteur nucleaire experimental EL4 en cours de demantelement (Mont d'Arree - departement du Finistere). Resultats et premiers constats annee 2006

    NONE

    2006-07-01

    In a previous study which concerned the catchment basin of the harbour of Brest, the A.C.R.O. put in evidence a marking by artificial radioelements around the power plant of Brennilis which can be imputed without ambiguities to the nuclear installation. It also put in evidence abnormalities concerning the natural radioactivity which justifies this new study. In the area of the Monts d'Arree, actinium 227 ({sup 227}Ac), non born by its ascendents which are {sup 235}U and {sup 231}Pa is observed. This phenomenon is characterized by mass activities superior to these ones of {sup 235}U and able to reach these ones of {sup 238}U. Its presence corresponds with the drainage of the Ellez river since the former channel of radioactive effluents releases from the nuclear power plant EL-4 up to the reservoir Saint-Herblot situated 6 km downstream. The strongest values of radioactivity are registered near the disused power plant, at this place a relationship exists between the level of actinium 227 and this one of the artificial radioactivity as it exists a relationship with the decay products of radon exhaled from the subsoil ({sup 210}Pb). But its presence is not limited to a part of the Ellez river, it is equally observed in terrestrial medium, in places in priori not influenced by the direct liquid effluents of the power plant. This place is situated at more than 4 km and without any connection with the Ellez waters. At this stage of the study, it is not possible to answer with certainty the question of the origin of this phenomenon. A new reorientation is considered indispensable to clarify definitively the origin of this unknown phenomenon in the scientific publications and the environmental monitoring. (N.C.)

  18. origin of elements of the Uranium-235 family observed in the Ellez river near the EL-4 experimental nuclear reactor in dismantling (Monts d'Arree- Finistere department)

    In a previous study which concerned the catchment basin of the harbour of Brest, the A.C.R.O. put in evidence a marking by artificial radioelements around the power plant of Brennilis which can be imputed without ambiguities to the nuclear installation. It also put in evidence abnormalities concerning the natural radioactivity which justifies this new study. In the area of the Monts d'Arree, actinium 227 (227Ac), non born by its ascendents which are 235U and 231Pa is observed. This phenomenon is characterized by mass activities superior to these ones of 235U and able to reach these ones of 238U. Its presence corresponds with the drainage of the Ellez river since the former channel of radioactive effluents releases from the nuclear power plant EL-4 up to the reservoir Saint-Herblot situated 6 km downstream. The strongest values of radioactivity are registered near the disused power plant, at this place a relationship exists between the level of actinium 227 and this one of the artificial radioactivity as it exists a relationship with the decay products of radon exhaled from the subsoil (210Pb). But its presence is not limited to a part of the Ellez river, it is equally observed in terrestrial medium, in places in priori not influenced by the direct liquid effluents of the power plant. This place is situated at more than 4 km and without any connection with the Ellez waters. At this stage of the study, it is not possible to answer with certainty the question of the origin of this phenomenon. A new reorientation is considered indispensable to clarify definitively the origin of this unknown phenomenon in the scientific publications and the environmental monitoring. (N.C.)

  19. Physical Measurements and Clinical Findings of Persons with Radium Burdens

    Results of physical measurements and some clinical findings of persons with radium burdens are reported and discussed. Ten workers of the dial painting industry, two chemists, who have been working for between 10 and 20 yr in the radium- industry, one technician, who has been- working for over 20 yr with high-emanation radium preparations and one person with high radium intake of rather unknown history were measured in a whole-body counter for evaluation of the body burdens of radium-226 and radium-228+ actinium-228. In some cases the radon concentration of expired air was also measured. For four of the measured persons the radium-226 burden is of the order of the maximum permissible amount (MPA : 10-7 c) or more. In one case the burden amounts to more than three times the MPA, (3.4 x 10-7 c), in another case to more than 100 times the MPA (160 x 10-7 c). In one case the radium-228 + actinium-228 burden exceeds the MPA (6 x 10-8 c in bone). The measured radon concentrations in the expired air were used to calculate the excretion rate of radon. The average was 67%. Clinical findings with some of the measured persons are related to the measured body burdens. The patient with the high body burden of 160 x 10-7 c radium-226 shows heavy bone changes leading to spontaneous bone fractures. The blood picture shows a decrease in the number of erythrocytes and a low haemoglobin content but puncture of the sternum indicates normal haematopoiesis. It seems that the low number of erythrocytes is caused by chronic nephropathia, the reason for which might be an additional intake of uranium because.uranium was found in the urine by gamma spectroscopy. The results are discussed with respect to the MPA of radium-226 recommended by the International Commission on Radiological Protection. (author)

  20. O przyczynach braku wyobrażeń miłości fizycznej w literaturze górnołużyckiej i kaszubskiej

    Derlatka, Tomasz

    2015-01-01

    Roč. 161, č. 1 (2015), s. 221-229. ISSN 0137-1150 Institutional support: RVO:68378017 Keywords : Cassubian literature * Upper Lusatian literature * sexuality in literature Subject RIV: AJ - Letters, Mass-media, Audiovision

  1. Exacerbation of substrate toxicity by IPTG in Escherichia coli BL21 (DE3) carrying a synthetic metabolic pathway

    Dvořák, P.; Chrást, L.; Nikel, P.; Fedr, Radek; Souček, Karel; Sedláčková, M.; Chaloupková, R.; Lorenzo, V.; Prokop, Z.; Damborský, J.

    2015-01-01

    Roč. 14, č. 201 (2015). ISSN 1475-2859 Institutional support: RVO:68081707 Keywords : Metabolic burden * Substrate toxicity * Escherichia coli Subject RIV: BO - Biophysics Impact factor: 4.221, year: 2014

  2. CCD-Photometry and Pole Coordinates for Eight Asteroids

    Shevchenko, V. G.; Tungalag, N.; Chiorny, V. G.; Gaftonyuk, N. M.; Krugly, Y. N.; Harris, A. W.; Young, J. W.

    2012-05-01

    The long time photometric observations were carried out for eight asteroids: (122) Gerda, (153) Hilda, (190) Ismene, (221) Eos, (411) Xanthe, (679) Pax, (700) Auravictrix, (787) Moskva. For the observed asteroids were determined new pole coordinates.

  3. Rough order of magnitude cost estimate for immobilization of 50 MT of plutonium using existing facilities at the Savannah River site: alternative 12B

    The purpose of this Cost Estimate Report is to identify preliminary capital and operating costs for a facility to immobilize 50 metric tons of plutonium using ceramic in an existing facility (221-F) at an Savannah River Site (SRS)

  4. Empaatiline või ahistav Teise pilk / Vappu Vabar

    Vabar, Vappu, 1960-

    1999-01-01

    Teemad: Medusa pilk. Apoteoos nägemisele. Pilt - ühtne ja paljukordne olemine. Täiendava kirjanduse loetelu: 11 nimetust. Ilmunud ka Vappu Thurlowi kogumikus "Lähenemised", Tallinn, 2006, lk. 221-226

  5. Adolescents' emotional reactions to parental cancer : effect on emotional and behavioral problems

    Donofrio, Stacey; Hoekstra, Harald J.; van der Graaf, Winette T. A.; van de Wiel, Harry B. M.; Visser, Annemieke; Huizinga, Gea A.; Hoekstra-Weebers, Josette E. H. M.

    2011-01-01

    OBJECTIVES: We examined adolescents' emotional reactions to parental cancer and explored relationships between emotional reactions and adolescents' emotional/behavioral problems. METHODS: Two studies were performed: retrospective and prospective. A total of 221 adolescents (105 sons) of 138 patients

  6. Mammoth bone deposits and subsistence practices during Mid-Upper Palaeolithic in Central Europe: three cases from Moravia and Poland

    Svoboda, Jiří; Péan, S.; Wojtal, P.

    126-128, - (2005), s. 209-221. ISSN 1040-6182 Institutional research plan: CEZ:AV0Z80010507 Keywords : Moravia, Poland * gravettian * Mammuthus primigenius Subject RIV: AC - Archeology, Anthropology, Ethnology Impact factor: 1.210, year: 2005

  7. Commuting patterns of Czech households exposed to flood risk

    Vikhrov, D.; Stojanov, Robert; Duží, Barbora; Jakubínský, Jiří

    Bielefeld: COMCAD, 2009, s. 2-21. ISBN N. [Tracing Social Inequalities in Environmentally-Induced Migration. Bielefeld (DE), 9.12.2012-13.12.2012] Institutional support : RVO:67179843 Subject RIV: EH - Ecology, Behaviour

  8. Geographic variation in diapause response of adult Rhipicephalus appendiculatus ticks

    Madder, M.; Speybroeck, N.; Brandt, J.; Tirry, L.; Hodek, Ivo; Berkvens, D.

    2002-01-01

    Roč. 277, - (2002), s. 209-221. ISSN 0168-8162 Institutional research plan: CEZ:AV0Z5007907 Keywords : Diapause * Life cycle * Rhipicephalus appendiculatus Subject RIV: ED - Physiology Impact factor: 0.921, year: 2002

  9. Disease: H00090 [KEGG MEDICUS

    Full Text Available H00090 NK cell defects, including the following disease: CD16 deficiency A patient with a mutati ... he patient also had severe clinical problems after BCG ... vaccination. Primary immunodeficiency hsa04650(221 ...

  10. 17 CFR 242.402 - General provisions.

    2010-04-01

    ... Regulation T, U or X of the Board of Governors of the Federal Reserve System (12 CFR parts 220, 221, and 224...) REGULATIONS M, SHO, ATS, AC, AND NMS AND CUSTOMER MARGIN REQUIREMENTS FOR SECURITY FUTURES Customer...

  11. RAP-PCR fingerprinting reveals time-dependent expression of development-related genes following differentiation process of Bacillus thuringiensis

    Huang, T.; Yu, X.; Gelbič, Ivan; Guan, X.

    2015-01-01

    Roč. 61, č. 9 (2015), s. 683-690. ISSN 0008-4166 Institutional support: RVO:60077344 Keywords : Bacillus thuringiensis * development * RNA arbitrarily primed PCR Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.221, year: 2014

  12. Effect of a phenyl group on excited-state properties of carotenoids

    Fuciman, M.; Hříbek, P.; Chábera, P.; Pšenčík, J.; Župčanová, Anita; Vácha, František; Polívka, Tomáš

    Göteborg : Chalmers University of Technology, 2008. s. 221. [IUPAC Symposium on Photochemistry /22./. 27.07.2008-01.08.2008, Göteborg] Institutional research plan: CEZ:AV0Z50510513 Keywords : carotenoids Subject RIV: BO - Biophysics

  13. Stackelberg leadership with product differentiation and endogenous entry: some comparative static and limiting results

    Žigić, Krešimir

    2012-01-01

    Roč. 106, č. 3 (2012), s. 221-232. ISSN 0931-8658 Institutional support: PRVOUK-P23 Keywords : Stackelberg leadership * product differentiation * endogenous entry Subject RIV: AH - Economics Impact factor: 0.512, year: 2012

  14. Hor - A Sedentarisation Success for Tibetan Pastoralists in Qinghai?

    Ptáčková, Jarmila

    2015-01-01

    Roč. 19, č. 2 (2015), s. 221-240. ISSN 0822-7942 Institutional support: RVO:68378009 Keywords : Sedentarisation, resettlement, Tibetan pastoralists, grassland development, vocational training Subject RIV: AC - Archeology, Anthropology, Ethnology

  15. 18 CFR 270.401 - Jurisdictional agency.

    2010-04-01

    ... agency (30 CFR part 221); and (3) All Indian lands which are under the supervision of the Osage Indian...) Washington—Department of Natural Resources, Geology and Earth Resources Division, PO Box 47001, Olympia,...

  16. How to Be a Good Visitor to a Healthcare Facility

    ... use text based ads over picture based mostly advertisements. Flashy ads with photographs and videos are effective ... written articles. Cheers for sharing your web page. facebook password hacker September 11, 2016 at 2:21 ...

  17. 77 FR 30530 - Ocean Transportation Intermediary License; Applicants

    2012-05-23

    .... Interfreight Harmonized Logistics Inc. (NVO & OFF), 221 Sheridan Blvd., Inwood, NY 11096, Officers: Thomas E... NVO License. Ruky International Shipping Line LLC (NVO & OFF), 100 Menlo Park, Suite 310, Edison,...

  18. Lebensbeschreibungen berühmter Männer aus den Zeiten der Wiederherstellung der Wissenschaften : zweyter Band

    Meiners, Christoph

    2007-01-01

    S. 3-110 : Ueber das Leben und die Schriften des Grafen Johannes Picus von Mirandula. S. 111-221 : Leben des Angelus Politianus nebst Beurtheilung seiner Verdienste und Schriften / Angelo Poliziano Insgesamt 393 S. in Bd. 2

  19. Gclust Server: 133137 [Gclust Server

    Full Text Available 133137 SCE_YER018C=SPC25 Cluster Sequences Related Sequences(3) 221 Component of the evolution...21 Representative annotation Component of the evolutionarily conserved kinetochore-associated Ndc80 complex

  20. Reliability of diagnostic techniques for Erwinia amylovora, the causative agent of fire blight disease

    Kokošková, B.; Mráz, Ivan

    2005-01-01

    Roč. 50, - (2005), s. 217-221. ISSN 0015-5632 Institutional research plan: CEZ:AV0Z5051902 Keywords : diagnostic techniques * plant diseases Subject RIV: EE - Microbiology, Virology Impact factor: 0.918, year: 2005

  1. Euneidese kai pneume. He Fainomenologia tu pneumatos tu Chegkel de sugkrise me tis antilepseis tu Giakompi kai tu hysteron Fichte

    Kuneš, Jan

    Athény: Alexandria, 2009 - (Kavoulakos, K.), s. 39-60 ISBN 978-960-221-455-8 Institutional research plan: CEZ:AV0Z90090514 Keywords : Phenomenology of Spirit, Hegel * consciousness * absolute Subject RIV: AA - Philosophy ; Religion

  2. Know Concentration Before Giving Acetaminophen to Infants

    ... For Consumers Consumer Updates Know Concentration Before Giving Acetaminophen to Infants Share Tweet Linkedin Pin it More ... Consumer Updates RSS Feed Download PDF (221 K) Acetaminophen Safety (Podcast) On this page Overdosing Has Been ...

  3. Looking a gift horse in the mouth: Evaluation of wide-field asteroid photometric surveys

    Harris, A. W.; Pravec, Petr; Warner, B. D.

    2012-01-01

    Roč. 221, č. 1 (2012), s. 226-235. ISSN 0019-1035 Institutional support: RVO:67985815 Keywords : asteroids * rotation * photometry Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 3.161, year: 2012

  4. Global epidemiology, risk factors and prevention of oral cancer

    Newell Johnson

    2008-01-01

    @@ The Globacan [2002] database from the International Agency for Research on Cancer, shows 400,318 cases of oral and pharyngeal [excluding nasopharynx] cancer in the world annually, and 221,917 deaths.

  5. q-deformed conformal superalgebra and its Hopf subalgebras

    We present in detail a Hopf superalgebra Uq(su(2,2/2)) which is a q-deformation of the conformal superalgebra su(2,2/1). The superalgebra Uq(su(2,2/1)) contains as a subalgebra a q-deformed super-Poincare algebra and as Hopf subalgebras two conjugate 16-generator q-deformed super-Weyl algebras, which are q-deformation of parabolic subalgebras of su(2,2/1). We use several (anti-) involutions, including the standard Cartan involution and a *-antiinvolution under which the super-Weyl algebras are *-subalgebras of Uq(su(2,2/1)). The q-deformed Lorentz algebra is Hopf subalgebra of both Weyl algebras and is preserved by all (anti-) involutions considered. (author). 26 refs

  6. The Way We Applauded: How popular culture stimulates collective memory of the socialist past in Czechoslovakia - the case of the television serial Vyprávěj and its viewers

    Carpentier-Reifová, I.; Gillárová, K.; Hladík, Radim

    London: Routledge, 2011 - (Imre, A.; Havens, T.; Lustyik, K.), s. 199-221 ISBN 978-0-415-89248-3 Institutional support: RVO:67985955 Keywords : memory * nostalgia * trauma * post-socialism * television Subject RIV: AA - Philosophy ; Religion

  7. Incidence vrozených srdečních vad v České republice - aktuální data

    Šípek, A.; Gregor, V.; Šípek jr., A.; Hudáková, J.; Horáček, J.; Klaschka, Jan; Skibová, J.; Langhammer, P.; Petržílková, L.; Klímová, B.; Peřinová, B.; Wiesnerová, J.

    2010-01-01

    Roč. 75, č. 3 (2010), s. 221-242. ISSN 1210-7832 Institutional research plan: CEZ:AV0Z10300504 Keywords : congenital heart defect * incidence * prenatal diagnostics * Czech Republic Subject RIV: FK - Gynaecology, Childbirth

  8. 7 CFR 1767.23 - Interest charges.

    2010-01-01

    ... (CONTINUED) ACCOUNTING REQUIREMENTS FOR RUS ELECTRIC BORROWERS Uniform System of Accounts § 1767.23 Interest... long-term debt issued or assumed by the utility, the liability for which included in Account 221,...

  9. Irenická idea - Irenej, Řehoř z Nyssy, Komenský a současnost

    Rajchl, Jaroslav

    2008-01-01

    Roč. 38, č. 80 (2008), s. 221-224. ISSN 0323-2220 Institutional research plan: CEZ:AV0Z10030501 Keywords : cross complementarity * triadicity * relations between members Subject RIV: AA - Philosophy ; Religion

  10. Biosphere reserves – learning sites of sustainable development?

    Kušová, Drahomíra; Těšitel, Jan; Bartoš, Michael

    2008-01-01

    Roč. 14, č. 3 (2008), s. 221-234. ISSN 1211-7420 Institutional research plan: CEZ:AV0Z60870520 Keywords : nature protection * learning sites * biosphere reserves * sustainable development Subject RIV: DO - Wilderness Conservation

  11. Il commento di Bartolomeo di Bruges al De inundatione Nili. Edizione del testo

    Blažek, Pavel

    2008-01-01

    Roč. 33, č. 33 (2008), s. 221-264. ISSN 0391-2566 Institutional research plan: CEZ:AV0Z90090514 Keywords : Aristotle * medieval philosophy * aristotelianism * commentaries * Nile * Egypt Subject RIV: AA - Philosophy ; Religion

  12. AcEST: DK947077 [AcEST

    Full Text Available YMU02A01NGRL0014_L12 412 Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0014_L12. 5' end seq ... synthase, chloroplastic OS=Arabidopsis thaliana GN=CSR ... 1.2 PE=1 SV=1 Length = 670 Score = 89.7 bits (221) ... H Acetolactate synthase OS=Arabidopsis thaliana GN=CSR 1 PE=3 SV=1 Length = 670 Score = 89.7 bits (221), E ...

  13. AcEST: BP920703 [AcEST

    Full Text Available YMU001_000140_D08 408 Adiantum capillus-veneris mRNA. clone: YMU001_000140_D08. BP920703 CL774Co ... = -3 Query: 400 VKLGCCDWYSKRIEKVALLEFDRSRKSMGVIVRTPSG ANKLLVKGAVENVLERSSHLQLA 221 VKLGCCDW+ KR ++VA LEFDR ... = -3 Query: 400 VKLGCCDWYSKRIEKVALLEFDRSRKSMGVIVRTPSG ANKLLVKGAVENVLERSSHLQLA 221 VKL CCDW++KR +KVA LEFDR ... me = -3 Query: 394 LGCCDWYSKRIEKVALLEFDRSRKSMGVIVRTPSG ANKLLVKGAVENVLERSSHLQLANG 215 L CC +S+ +++A LEFDR R ... me = -3 Query: 394 LGCCDWYSKRIEKVALLEFDRSRKSMGVIVRTPSG ANKLLVKGAVENVLERSSHLQLANG 215 L CC +S+ +++A LEFDR R ...

  14. GETDB: 113188 [GETDB

    Full Text Available 113188 Link to Original w[*]; P{GawB}NP3265 / CyO, P{UAS-lacZ.UW14}UW14 23D1 Link to DGRC Genome ... abd blood calls lethal - comment1:C, comment2:21C1-C4 ... - - - - Show 113188 DGRC Number 113188 Link to Ori ... n as - Original Comments comment1:C, comment2:21C1-C4 ... Disc (Image) - Disc (number) 0 Embryo (Image) - Em ...

  15. EST Table: FS790069 [KAIKOcDNA[Archive

    Full Text Available FS790069 E_FL_ffbm_02I12_F_0 10/09/28 45 %/221 aa ref|NP_001153726.1| glyoxylate reductase/hydro ... tase-like [Tribolium castaneum] gb|EFA08834.1| LOW QUALITY ... PROTEIN: hypothetical protein TcasGA2_TC006532 [Tr ... /09/10 45 %/221 aa gi|270012386|gb|EFA08834.1| LOW QUALITY ... PROTEIN: hypothetical protein TcasGA2_TC006532 [Tr ...

  16. Dicty_cDB: Contig-U09672-1 [Dicty_cDB

    Full Text Available ore = 704 bits (355), Expect = 0.0 Identities = 355/355 (100%) Strand = Plus / Pl... = e-132 Identities = 240/240 (100%) Strand = Plus / Plus Query: 1 tttaaatggatgtgatnaacttttacagctgaactagataa... (140), Expect = 1e-74 Identities = 221/221 (100%) Strand = Plus / Plus Query: 69...Expect = 1e-06 Identities = 32/32 (100%) Strand = Plus / Plus Query: 967 tattnctnccgactgtgtatataataataaat 99..., Expect = 5e-06 Identities = 43/49 (87%) Strand = Plus / Plus Query: 426 atcttcttcctctacatcaccaccaccaactaca

  17. 17 CFR 240.3b-8 - Definitions of “Qualified OTC Market Maker, Qualified Third Market Maker” and “Qualified Block...

    2010-04-01

    ... customer (other than a partner or a joint venture or other entity in which a partner, the dealer, or a... “Qualified Block Positioner”. For the purposes of Regulation U under the Act (12 CFR part 221): (a) The term... Security” (as that term is defined in section 2(j) of Regulation U (12 CFR 221.2(j)) who (1) is a broker...

  18. beta-Casein mRNA sequesters a single-stranded nucleic acid-binding protein which negatively regulates the beta-casein gene promoter.

    Altiok, S; Groner, B

    1994-01-01

    beta-Casein gene expression in mammary epithelial cells is under the control of the lactogenic hormones, glucocorticoids, insulin, and prolactin. The hormonal control affects gene transcription, and several regulatory elements in the beta-casein gene promoter between positions -80 and -221 have previously been identified. A region located in the promoter between positions -170 and -221 contains overlapping sequences for negative and positive regulatory elements. A sequence-specific single-str...

  19. Minor Actinide Burning in Thermal Reactors. A Report by the Working Party on Scientific Issues of Reactor Systems

    The actinides (or actinoids) are those elements in the periodic table from actinium upwards. Uranium (U) and plutonium (Pu) are two of the principal elements in nuclear fuel that could be classed as major actinides. The minor actinides are normally taken to be the triad of neptunium (Np), americium (Am) and curium (Cm). The combined masses of the remaining actinides (i.e. actinium, thorium, protactinium, berkelium, californium, einsteinium and fermium) are small enough to be regarded as very minor trace contaminants in nuclear fuel. Those elements above uranium in the periodic table are known collectively as the transuranics (TRUs). The operation of a nuclear reactor produces large quantities of irradiated fuel (sometimes referred to as spent fuel), which is either stored prior to eventual deep geological disposal or reprocessed to enable actinide recycling. A modern light water reactor (LWR) of 1 GWe capacity will typically discharge about 20-25 tonnes of irradiated fuel per year of operation. About 93-94% of the mass of uranium oxide irradiated fuel is comprised of uranium (mostly 238U), with about 4-5% fission products and ∼1% plutonium. About 0.1-0.2% of the mass is comprised of neptunium, americium and curium. These latter elements accumulate in nuclear fuel because of neutron captures, and they contribute significantly to decay heat loading and neutron output, as well as to the overall radio-toxic hazard of spent fuel. Although the total minor actinide mass is relatively small - approximately 20-25 kg per year from a 1 GWe LWR - it has a disproportionate impact on spent fuel disposal, and thus the longstanding interest in transmuting these actinides either by fission (to fission products) or neutron capture in order to reduce their impact on the back end of the fuel cycle. The combined masses of the trace actinides actinium, thorium, protactinium, berkelium and californium in irradiated LWR fuel are only about 2 parts per billion, which is far too low for

  20. TRASH TO TREASURE: CONVERTING COLD WAR LEGACY WASTE INTO WEAPONS AGAINST CANCER

    As part of its commitment to clean up Cold War legacy sites, the U.S. Department of Energy (DOE) has initiated an exciting and unique project to dispose of its inventory of uranium-233 (233U) stored at Oak Ridge National Laboratory (ORNL), and extract isotopes that show great promise in the treatment of deadly cancers. In addition to increasing the supply of potentially useful medical isotopes, the project will rid DOE of a nuclear concern and cut surveillance and security costs. For more than 30 years, DOE's ORNL has stored over 1,200 containers of fissile 233U, originally produced for several defense-related projects, including a pilot study that looked at using 233U as a commercial reactor fuel. This uranium, designated as special nuclear material, requires expensive security, safety, and environmental controls. It has been stored at an ORNL facility, Building 3019A, that dates back to the Manhattan Project. Down-blending the material to a safer form, rather than continuing to store it, will eliminate a $15 million a year financial liability for the DOE and increase the supply of medical isotopes by 5,700 percent. During the down-blending process, thorium-229 (229Th) will be extracted. The thorium will then be used to extract actinium-225 (225Ac), which will ultimately supply its progeny, bismuth-213 (213Bi), for on-going cancer research. The research includes Phase II clinical trials for the treatment of acute myelogenous leukemia at Sloan-Kettering Memorial Cancer Center in New York, as well as other serious cancers of the lungs, pancreas, and kidneys using a technique known as alpha-particle radioimmunotherapy. Alpha-particle radioimmunotherapy is based on the emission of alpha particles by radionuclides. 213Bi is attached to a monoclonal antibody that targets specific cells. The bismuth then delivers a high-powered but short-range radiation dose, effectively killing the cancerous cells but sparing the surrounding tissue. Production of the actinium and

  1. TRASH TO TREASURE: CONVERTING COLD WAR LEGACY WASTE INTO WEAPONS AGAINST CANCER

    Nicholas, R.G.; Lacy, N.H.; Butz, T.R.; Brandon, N.E.

    2004-10-06

    As part of its commitment to clean up Cold War legacy sites, the U.S. Department of Energy (DOE) has initiated an exciting and unique project to dispose of its inventory of uranium-233 (233U) stored at Oak Ridge National Laboratory (ORNL), and extract isotopes that show great promise in the treatment of deadly cancers. In addition to increasing the supply of potentially useful medical isotopes, the project will rid DOE of a nuclear concern and cut surveillance and security costs. For more than 30 years, DOE's ORNL has stored over 1,200 containers of fissile 233U, originally produced for several defense-related projects, including a pilot study that looked at using 233U as a commercial reactor fuel. This uranium, designated as special nuclear material, requires expensive security, safety, and environmental controls. It has been stored at an ORNL facility, Building 3019A, that dates back to the Manhattan Project. Down-blending the material to a safer form, rather than continuing to store it, will eliminate a $15 million a year financial liability for the DOE and increase the supply of medical isotopes by 5,700 percent. During the down-blending process, thorium-229 (229Th) will be extracted. The thorium will then be used to extract actinium-225 (225Ac), which will ultimately supply its progeny, bismuth-213 (213Bi), for on-going cancer research. The research includes Phase II clinical trials for the treatment of acute myelogenous leukemia at Sloan-Kettering Memorial Cancer Center in New York, as well as other serious cancers of the lungs, pancreas, and kidneys using a technique known as alpha-particle radioimmunotherapy. Alpha-particle radioimmunotherapy is based on the emission of alpha particles by radionuclides. 213Bi is attached to a monoclonal antibody that targets specific cells. The bismuth then delivers a high-powered but short-range radiation dose, effectively killing the cancerous cells but sparing the surrounding tissue. Production of the actinium and

  2. Dicty_cDB: Contig-U10201-1 [Dicty_cDB

    Full Text Available melanogaster chromos... 221 5e-56 (Q99LC5) RecName: Full=Electron transfer flavoprotein...e) Rat electron transfer flavoprotein (ET... 154 6e-36 AM412317_3290( AM412317 |pid:none) Clostridium botul...13_610( CP000713 |pid:none) Psychrobacter sp. PRwf-1, comple... 202 8e-86 (Q9HZP7) RecName: Full=Electron transfer flavopro...g VV78X021543.... 194 6e-59 (A2XNR6) RecName: Full=Electron transfer flavopro...t... 221 4e-56 ( P13804 ) RecName: Full=Electron transfer flavoprotein subunit al... 221 4e

  3. Role of Ca2+ and L-Phe in regulating functional cooperativity of disease-associated "toggle" calcium-sensing receptor mutations.

    Chen Zhang

    Full Text Available The Ca(2+-sensing receptor (CaSR regulates Ca(2+ homeostasis in the body by monitoring extracellular levels of Ca(2+ ([Ca(2+]o and amino acids. Mutations at the hinge region of the N-terminal Venus flytrap domain (VFTD produce either receptor inactivation (L173P, P221Q or activation (L173F, P221L related to hypercalcemic or hypocalcemic disorders. In this paper, we report that both L173P and P221Q markedly impair the functional positive cooperativity of the CaSR as reflected by [Ca(2+]o-induced [Ca(2+]i oscillations, inositol-1-phosphate (IP1 accumulation and extracellular signal-regulated kinases (ERK1/2 activity. In contrast, L173F and P221L show enhanced responsiveness of these three functional readouts to [Ca(2+]o. Further analysis of the dynamics of the VFTD mutants using computational simulation studies supports disruption in the correlated motions in the loss-of-function CaSR mutants, while these motions are enhanced in the gain-of-function mutants. Wild type (WT CaSR was modulated by L-Phe in a heterotropic positive cooperative way, achieving an EC50 similar to those of the two activating mutations. The response of the inactivating P221Q mutant to [Ca(2+]o was partially rescued by L-Phe, illustrating the capacity of the L-Phe binding site to enhance the positive homotropic cooperativity of CaSR. L-Phe had no effect on the other inactivating mutant. Moreover, our results carried out both in silico and in intact cells indicate that residue Leu(173, which is close to residues that are part of the L-Phe-binding pocket, exhibited impaired heterotropic cooperativity in the presence of L-Phe. Thus, Pro(221 and Leu(173 are important for the positive homo- and heterotropic cooperative regulation elicited by agonist binding.

  4. Residues R199H200 of prototype foamy virus transactivator Bel1 contribute to its binding with LTR and IP promoters but not its nuclear localization

    Prototype foamy virus encodes a transactivator called Bel1 that enhances viral gene transcription and is essential for PFV replication. Nuclear localization of Bel1 has been reported to rely on two proximal basic motifs R199H200 and R221R222R223 that likely function together as a bipartite nuclear localization signal. In this study, we report that mutating R221R222R223, but not R199H200, relocates Bel1 from the nucleus to the cytoplasm, suggesting an essential role for R221R222R223 in the nuclear localization of Bel1. Although not affecting the nuclear localization of Bel1, mutating R199H200 disables Bel1 from transactivating PFV promoters. Results of EMSA reveal that the R199H200 residues are vital for the binding of Bel1 to viral promoter DNA. Moreover, mutating R199H200 in Bel1 impairs PFV replication to a much greater extent than mutating R221R222R223. Collectively, our findings suggest that R199H200 directly participate in Bel1 binding to viral promoter DNA and are indispensible for Bel1 transactivation activity. - Highlights: • The R221R222R223 residues are essential for the nuclear localization of Bel1. • Although not affecting the nuclear localization of Bel1, mutating R199H200 disables Bel1 from transactivating PFV promoters. • The R199H200 residues directly participate in Bel1 binding to viral promoter DNA. • Mutating R199H200 in Bel1 impairs PFV replication to a much greater extent than mutating R221R222R223

  5. Palleronia abyssalis sp. nov., isolated from the deep Mediterranean Sea and the emended description of the genus Palleronia and of the species Palleronia marisminoris.

    Albuquerque, Luciana; França, Luís; Taborda, Marco; La Cono, Violetta; Yakimov, Michail; da Costa, Milton S

    2015-02-01

    Three strains designated 221-F1(T), 221-F2 and 3030-F1 were isolated from the Matapan Vavilov Deep canyon, also known as Calypso Deep in the Eastern Mediterranean Sea, at a depth of 4,908 m. Based on 16S rRNA gene sequence analysis these strains were found to be most closely related to Palleronia marisminoris and Hwanghaeicola aestuarii, with 16S rRNA gene pairwise sequence similarity of 95.3 and 94.7 % respectively, belonging to the family Rhodobacteraceae. The strains were observed to be red-pigmented and to form non-motile cocci or pleomorphic cells. The cells were found to stain Gram-negative, to be strictly aerobic, oxidase and catalase positive. Strains 221-F1(T), 221-F2 and 3030-F1 were found to be mesophilic and to grow in medium containing up to 13 % NaCl. The major polar lipids of the three strains were identified as diphosphatidylglycerol, phosphatidylglycerol, phosphatidylcholine, an unidentified glycolipid and an unidentified aminolipid. Ubiquinone 10 (U-10) was found to be the major respiratory quinone. The DNA G+C content of strain 221-F1(T) was determined to be 64.7 mol%. Based on phylogenetic, physiological and biochemical characteristics we describe a new species represented by strain 221-F1(T) (=CECT 8504(T) = LMG 27977(T)) for which we propose the name Palleronia abyssalis sp. nov. We also propose to emend the description of the genus Palleronia and the species P. marisminoris to reflect new results obtained in this study. PMID:25524421

  6. Structure of a regulatory complex involving the Abl SH3 domain, the Crk SH2 domain, and a Crk-derived phosphopeptide

    Donaldson, Logan W.; Gish, Gerald; Pawson, Tony; Kay, Lewis E.; Forman-Kay, Julie D.

    2002-01-01

    On phosphorylation of Y221 by Abelson (Abl) kinase, the Crk-II adapter protein undergoes an intramolecular reorganization initiated by the binding of its own Src homology 2 (SH2) domain to the pY221 site. Conformational changes induced by phosphotyrosine recognition promote the binding of the Src homology 3 (SH3) domain of the Abl tyrosine kinase to a proline-rich loop located between the βD and βE strands of the SH2 domain (DE loop). We have determined the NMR solution structure of the terna...

  7. AcEST: BP916382 [AcEST

    Full Text Available YMU001_000087_B01 545 Adiantum capillus-veneris mRNA. clone: YMU001_000087_B01. BP916382 - Show ... VS--ISALDLNLLLSACPMI 176 Query: 173 KHLSLKN--ILVMEAPSG MELNICTLETLQIE 84 + L L + I + +A +EL+ TL+++ + Sbjct ... e = -1 Query: 221 LSAINFMLLP----SFFPRLKHLSLKNILVMEAPSG MELNICTLETLQIEHMATKVRTML 54 L++ +F+ LP P LKHL L+N + ... DNPSLGDSGLMAALCPNKF 220 Query: 182 PRLKHLSLKNILVMEAPSG M 123 P L++L+L+N ME PSG + Sbjct: 221 PALQYLALRN-AGME ... TPSG V 239 >sp|Q9VCU9|DCR1_DROME Endoribonuclease Dcr-1 ...

  8. Flavor-Universal Form of Neutrino Oscillation Probabilities in Matter

    Minakata, Hisakazu

    2015-01-01

    We construct a new perturbative framework to describe neutrino oscillation in matter with the unique expansion parameter \\epsilon, which is defined as \\Delta m^2_{21} / \\Delta m^2_{ren} with the renormalized atmospheric \\Delta m^2_{ren} \\equiv \\Delta m^2_{31} - s^2_{12} \\Delta m^2_{21}. It allows us to derive the maximally compact expressions of the oscillation probabilities in matter to order \\epsilon in the form akin to those in vacuum. This feature allows immediate physical interpretation of the formulas, and facilitates understanding of physics of neutrino oscillations in matter. Moreover, quite recently, we have shown that our three-flavor oscillation probabilities P(\

  9. Synthesis, structural characterisation and thermoelectric properties of Bi1−xPbxOCuSe

    Luu, Son D. N.; Vaqueiro, Paz

    2013-01-01

    The effect of Pb2+ doping on the structure and thermoelectric properties of BiOCuSe (also known as BiCuSeO or BiCuOSe) is described. With increasing Pb2+ content, the expansion of the unit cell results in a weakening of the bonding between the [Bi2(1-x) Pb2xO2]2(1-x)+ and the [Cu2Se2]2(1-x)- layers. The electrical resistivity and Seebeck coefficient decrease in a systematic way with growing Pb2+ levels. The thermal conductivity rises due to the increase of the electronic contribution with dop...

  10. Occipital Emissary Foramina in South Indian Modern Human Skulls

    Singhal, Suruchi; Ravindranath, Roopa

    2013-01-01

    An occipital emissary foramen has been traditionally described as a foramen present in the squamous part of the occipital bone at the occipital protuberance transmitting a vein that connects the confluence of sinuses with the occipital vein. The present study was done on 221 South Indian adult modern human skulls of unknown sex in the Department of Anatomy, St John’s Medical College, Bangalore, India. The foramen was observed in 21/221 (9.50%) skulls, 6/21 (28.57%) to the right of, 10/21 (47....

  11. Nosocomial Urinary Tract Infections in Children

    BALAT, Ayse

    1999-01-01

    Nosocomial infections are a major cause of morbidity and mortality in hospitalized children, and the urinary tract is one of the most common sites of these infections. We retrospectively reviewed the charts of 1,221 children discharged with a diagnosis of urinary tract infection (UTI) from July 1, 1991 to June 30, 1994. Of the 1,221 UTIs, there were 137 (11.2%) cases of nosocomial UTI (NUTI) in 136 patients. NUTI accounted for 0.28% of all discharges (48, 382 patients) at a single institution...

  12. Drugs and violence: social perception in a community

    Lúcia Margarete dos Reis; Magda Lúcia Félix Oliveira

    2015-01-01

    This cross-sectional, descriptive study aimed at investigating social perception on street drugs and violence in a community in northwestern Paraná. A structured questionnaire was applied to 358 inhabitants, of whom 98.6% reported to perceive the presence of drugs in high intensity (82.4%), a situation considered as “alarming” for 56.1% and a cause of suffering for 61.5%. Seventy-eight interviewees (22.1%) reported that the presence of drugs caused changes in family life (22.1%), social life ...

  13. AcEST: DK959802 [AcEST

    Full Text Available TST39A01NGRL0005_K22 669 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0005_K22. 5' end seq ... rator 3 OS=Mus musculus GN=S... 63 1e-09 sp|Q12116|TMS 1_YEAST Membrane protein TMS 1 OS=Saccharomyces cere ... za sativa subs... 221 3e-56 tr|Q10IH0|Q10IH0_ORYSJ TMS ... membrane family protein, putative, ex... 221 3e-56 ...

  14. Rõdu annab kodule meeleolu / Eve Kaunis

    Kaunis, Eve

    2008-01-01

    Rõdud ja terrassid on korteri lisaväärtuseks. Eve Kaunis Uus Maa kinnisvarabüroost 7-toalisest korterist Tallinnas Pärnu mnt 110 (pindala 221,2 m2, lisandub terrass 80 m2 ja 2 rõdu 14,35 m2), 4-toalisest korterist Pirita tee 26f (pindala 166 m2, 2 rõdu 58 m2) ja 5-toalisest korterist Merirahu Klipperi majas (pindala 189,4 m2, 5 rõdu ja katuseterrass 221,5 m2, korteri viimistlus ja planeering on tehtud koostöös sisekujundaja Helen Mäkeläga)

  15. DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS

    NA

    2004-11-22

    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) important to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are in the form of tabulated functions with pH and log (line integral) CO{sub 2} as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. The output data from this report are fundamental inputs for Total System Performance Assessment for the License Application (TSPA-LA) to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for all of the actinides. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or otherwise addressed.

  16. Formerly utilized MED/AEC sites remedial action program. Radiological survey of the E. I. Du Pont de Nemours and Co. , Deepwater, New Jersey. Final report

    None

    1978-12-01

    The results of a radiological survey of the E. I. Du Pont Company, Deepwater, New Jersey, are presented in this report. During the 1940's this site was used for development of a process for the conversion of uranium oxide to produce uranium tetrafluoride and small quantities of uranium metal. The survey included measurements of the following: residual alpha and beta--gamma contamination levels, both fixed and transferable, in the one remaining uranium tetrafluoride operations building; external gamma radiation levels at 1 m above the surface inside this building and at outdoor locations where radioactive materials were handled; radon and radon daughter concentrations in the air in the operations building; uranium, radium, actinium, and thorium concentrations in soil and water on and near the site; and the airborne concentrations of uranium, thorium, and radium in the operations building. Elevated concentrations of uranium were found in residues from the operations building and in some surface and subsurface soil samples. Alpha and beta--gamma contamination levels in some areas of the operations building were above the limits of current federal guidelines set for the release of property for unrestricted use. 18 figures, 11 tables.

  17. Geological disposal: security and R and D. Security of 'second draft for R and D of geological disposal'

    The second draft for R and D of geological disposal (second draft) was arranged in 1999. The idea of security of geological disposal in the second draft is explained. The evaluation results of the uncertainty analysis and an example of evaluation of the effect of separation nuclear transmutation on the geological disposal are shown. The construction of strong engineered barrier is a basic idea of geological disposal system. Three processes such as isolation, engineering countermeasures and safety evaluation are carried out for the security of geological disposal. The security of geological environment for a long time of 12 sites in Japan was studied by data. Provability of production and enforcement of engineered barrier were confirmed by trial of over pack, tests and the present and future technologies developed. By using the conditions of reference case in the second draft, the evaluation results of dose effects in the two cases: 1) 90 to 99% Cs and Sr removed from HLW (High Level radioactive Waste) and 2) high stripping ratio of actinium series are explained. (S.Y.)

  18. Selective Decontamination Effect of Metal Ions in Soil Using Supercritical CO{sub 2} and TBP Complex

    Park, Jihye; Park, Kwangheon; Jung, Wonyoung [Kyunghee Univ., Yongin (Korea, Republic of)

    2014-10-15

    Decontamination of soil pollution is difficult because the type of contamination largely depends on the characteristics of the pollutant and the area. Also, existing soil decontamination methods generate large quantities of secondary waste and additional process costs. For this reason, new decontamination methods are always under active investigation. A method involving the use of supercritical carbon dioxide with excellent permeability in place of chemical solvents is currently being studied. Unlike other heavy metals in fission products, uranium is used as fuel, and must be handled carefully. Therefore, in this paper, we studied a supercritical carbon dioxide method for decontaminating heavy metal ions in soil using tri-n-butyl phosphate(TBP), which is well known as a ligand for the extraction of metal ions of actinium. We investigated the decontamination effect of heavy metal ions in the soil using TBP-HNO{sub 3} Complex and supercritical carbon dioxide. The study results showed that when heavy metals in soil are extracted using supercritical carbon dioxide, the extraction efficiency is different according to the type of pollutant metal ions in the soil. When TBP-HNO{sub 3} Complex is used with an extractant, uranium extraction is very effective, but lithium, strontium, and cesium extraction is not effective. Therefore, in the case of a mixture of uranium and other metals such as lithium, strontium, cesium, and so on in soil contaminated by fission product leaks from nuclear power plants, we can selectively decontaminate uranium with supercritical carbon dioxide and TBP-HNO{sub 3} Complex.

  19. Tumor immunotargeting using innovative radionuclides.

    Kraeber-Bodéré, Françoise; Rousseau, Caroline; Bodet-Milin, Caroline; Mathieu, Cédric; Guérard, François; Frampas, Eric; Carlier, Thomas; Chouin, Nicolas; Haddad, Ferid; Chatal, Jean-François; Faivre-Chauvet, Alain; Chérel, Michel; Barbet, Jacques

    2015-01-01

    This paper reviews some aspects and recent developments in the use of antibodies to target radionuclides for tumor imaging and therapy. While radiolabeled antibodies have been considered for many years in this context, only a few have reached the level of routine clinical use. However, alternative radionuclides, with more appropriate physical properties, such as lutetium-177 or copper-67, as well as alpha-emitting radionuclides, including astatine-211, bismuth-213, actinium-225, and others are currently reviving hopes in cancer treatments, both in hematological diseases and solid tumors. At the same time, PET imaging, with short-lived radionuclides, such as gallium-68, fluorine-18 or copper-64, or long half-life ones, particularly iodine-124 and zirconium-89 now offers new perspectives in immuno-specific phenotype tumor imaging. New antibody analogues and pretargeting strategies have also considerably improved the performances of tumor immunotargeting and completely renewed the interest in these approaches for imaging and therapy by providing theranostics, companion diagnostics and news tools to make personalized medicine a reality. PMID:25679452

  20. Tumor Immunotargeting Using Innovative Radionuclides

    Françoise Kraeber-Bodéré

    2015-02-01

    Full Text Available This paper reviews some aspects and recent developments in the use of antibodies to target radionuclides for tumor imaging and therapy. While radiolabeled antibodies have been considered for many years in this context, only a few have reached the level of routine clinical use. However, alternative radionuclides, with more appropriate physical properties, such as lutetium-177 or copper-67, as well as alpha-emitting radionuclides, including astatine-211, bismuth-213, actinium-225, and others are currently reviving hopes in cancer treatments, both in hematological diseases and solid tumors. At the same time, PET imaging, with short-lived radionuclides, such as gallium-68, fluorine-18 or copper-64, or long half-life ones, particularly iodine-124 and zirconium-89 now offers new perspectives in immuno-specific phenotype tumor imaging. New antibody analogues and pretargeting strategies have also considerably improved the performances of tumor immunotargeting and completely renewed the interest in these approaches for imaging and therapy by providing theranostics, companion diagnostics and news tools to make personalized medicine a reality.