49 CFR 218.9 - Civil penalty.

Science.gov (United States)

2010-10-01

... 49 Transportation 4 2010-10-01 2010-10-01 false Civil penalty. 218.9 Section 218.9 Transportation... TRANSPORTATION RAILROAD OPERATING PRACTICES General § 218.9 Civil penalty. Any person (an entity of any type... requirement of this part or causes the violation of any such requirement is subject to a civil penalty of at...

10 CFR 218.11 - Supply orders.

Science.gov (United States)

2010-01-01

... 10 Energy 3 2010-01-01 2010-01-01 false Supply orders. 218.11 Section 218.11 Energy DEPARTMENT OF ENERGY OIL STANDBY MANDATORY INTERNATIONAL OIL ALLOCATION Supply Orders § 218.11 Supply orders. (a) A supply order shall require that the firm to which it is issued take actions specified therein relating to...

20 CFR 218.28 - Sick pay.

Science.gov (United States)

2010-04-01

... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Sick pay. 218.28 Section 218.28 Employees... Beginning Date § 218.28 Sick pay. (a) From railroad employer. If the employee is carried on the payroll while sick, the annuity can begin no earlier than the day after the last day of sick pay. However, sick...

20 CFR 218.27 - Vacation pay.

Science.gov (United States)

2010-04-01

... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Vacation pay. 218.27 Section 218.27 Employees... Beginning Date § 218.27 Vacation pay. (a) From railroad employer. Vacation pay may be credited to the... vacation pay is credited to the vacation period, the annuity can begin no earlier than the day after the...

Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL

International Nuclear Information System (INIS)

Raeder, S.; Bastin, B.; Block, M.; Creemers, P.; Delahaye, P.; Ferrer, R.; Fléchard, X.; Franchoo, S.; Ghys, L.; Gaffney, L.P.; Granados, C.; Heinke, R.; Hijazi, L.

2016-01-01

To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.

Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL

Energy Technology Data Exchange (ETDEWEB)

Raeder, S., E-mail: s.raeder@gsi.de [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Bastin, B. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Block, M. [Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Institut für Kernchemie, Johannes Gutenberg Universität, 55128 Mainz (Germany); Creemers, P. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Delahaye, P. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Ferrer, R. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Fléchard, X. [LPC Caen, ENSICAEN, Université de Caen, CNRS/IN2P3, Caen (France); Franchoo, S. [Institute de Physique Nucléaire (IPN) d’Orsay, 91406 Orsay, Cedex (France); Ghys, L. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); SCK-CEN, Belgian Nuclear Research Center, Boeretang 200, 2400 Mol (Belgium); Gaffney, L.P.; Granados, C. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Heinke, R. [Institut für Physik, Johannes Gutenberg Universität, 55128 Mainz (Germany); Hijazi, L. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); and others

2016-06-01

To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.

49 CFR 218.3 - Application.

Science.gov (United States)

2010-10-01

... system of transportation, or (2) Rapid transit operations in an urban area that are not connected with... 49 Transportation 4 2010-10-01 2010-10-01 false Application. 218.3 Section 218.3 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF...

30 CFR 218.152 - Fishermen's Contingency Fund.

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Fishermen's Contingency Fund. 218.152 Section 218.152 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE..., Offshore § 218.152 Fishermen's Contingency Fund. Upon the establishment of the Fishermen's Contingency Fund...

42 CFR 93.218 - Person.

Science.gov (United States)

2010-10-01

... 42 Public Health 1 2010-10-01 2010-10-01 false Person. 93.218 Section 93.218 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES HEALTH ASSESSMENTS AND HEALTH EFFECTS STUDIES OF HAZARDOUS SUBSTANCES RELEASES AND FACILITIES PUBLIC HEALTH SERVICE POLICIES ON RESEARCH MISCONDUCT...

31 CFR 31.218 - Enforcement.

Science.gov (United States)

2010-07-01

... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Enforcement. 31.218 Section 31.218 Money and Finance: Treasury Office of the Secretary of the Treasury TROUBLED ASSET RELIEF PROGRAM... more of the following sanctions: (1) Rejection of work tainted by an organizational conflict of...

14 CFR 21.8 - Approval of articles.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Approval of articles. 21.8 Section 21.8 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION AIRCRAFT CERTIFICATION PROCEDURES FOR PRODUCTS AND PARTS General § 21.8 Approval of articles. If an article is required to be...

48 CFR 218.201 - Contingency operation.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Contingency operation. 218... Flexibilities 218.201 Contingency operation. (1) Selection, appointment, and termination of appointment... in a contingency contracting force. See 201.603-2(2). (2) Policy for unique item identification...

36 CFR 218.14 - Judicial proceedings.

Science.gov (United States)

2010-07-01

... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Judicial proceedings. 218.14... ADMINISTRATIVE REVIEW PROCESSES Predecisional Administrative Review Process for Hazardous Fuel Reduction Projects Authorized by the Healthy Forests Restoration Act of 2003 § 218.14 Judicial proceedings. The objection...

49 CFR 218.99 - Shoving or pushing movements.

Science.gov (United States)

2010-10-01

... 49 Transportation 4 2010-10-01 2010-10-01 false Shoving or pushing movements. 218.99 Section 218... Derails § 218.99 Shoving or pushing movements. (a)(1) Each railroad shall adopt and comply with an... violated the requirements of this section. (2) The following requirements for shoving or pushing movements...

22 CFR 218.23 - Self-evaluation.

Science.gov (United States)

2010-04-01

... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Self-evaluation. 218.23 Section 218.23 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT NONDISCRIMINATION ON THE BASIS OF AGE IN PROGRAMS OR... the agency and to the public for a period of three years following its completion. ...

27 CFR 24.218 - Other wine.

Science.gov (United States)

2010-04-01

... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Other wine. 24.218 Section... THE TREASURY LIQUORS WINE Production of Other Than Standard Wine § 24.218 Other wine. (a) General. Other than standard wine not included in other sections in this subpart are considered other wine. Those...

MiR-218 Mediates tumorigenesis and metastasis: Perspectives and implications

Energy Technology Data Exchange (ETDEWEB)

Lu, Ying-fei [Institute Guangzhou of Advanced Technology, Chinese Academy of Sciences, Guangzhou (China); Department of Orthopaedics & Traumatology, The Chinese University of Hong Kong, Prince of Wales Hospital, Shatin, Hong Kong (China); Zhang, Li [School of Biomedical Sciences, Faculty of Medicine, The Chinese University of Hong Kong, Hong Kong (China); Department of Anatomical and Cellular Pathology, State Key Laboratory of Oncology in South China, Prince of Wales Hospital, The Chinese University of Hong Kong, Hong Kong (China); Waye, Mary Miu Yee [School of Biomedical Sciences, Faculty of Medicine, The Chinese University of Hong Kong, Hong Kong (China); Fu, Wei-ming, E-mail: wm.fu@giat.ac.cn [Institute Guangzhou of Advanced Technology, Chinese Academy of Sciences, Guangzhou (China); School of Biomedical Sciences, Faculty of Medicine, The Chinese University of Hong Kong, Hong Kong (China); Zhang, Jin-fang, E-mail: zhangjf06@cuhk.edu.hk [Department of Orthopaedics & Traumatology, The Chinese University of Hong Kong, Prince of Wales Hospital, Shatin, Hong Kong (China); School of Biomedical Sciences, Faculty of Medicine, The Chinese University of Hong Kong, Hong Kong (China); Shenzhen Research Institute, The Chinese University of Hong Kong, Shenzhen (China)

2015-05-15

MicroRNAs (miRNAs) are a class of small non-coding RNAs that negatively regulate gene expression at the post-transcriptional level. As a highly conserved miRNA across a variety of species, microRNA-218 (miR-218) was found to play pivotal roles in tumorigenesis and progression. A group of evidence has demonstrated that miR-218 acts as a tumor suppressor by targeting many oncogenes related to proliferation, apoptosis and invasion. In this review, we provide a complex overview of miR-218, including its regulatory mechanisms, known functions in cancer and future challenges as a potential therapeutic target in human cancers. - Highlights: • miR-218 is frequently down regulated in multiple cancers. • miR-218 plays pivotal roles in carcinogenesis. • miR-218 mediates proliferation, apoptosis, metastasis, invasion, etc. • miR-218 mediates tumorigenesis and metastasis via multiple pathways.

MiR-218 Mediates tumorigenesis and metastasis: Perspectives and implications

International Nuclear Information System (INIS)

Lu, Ying-fei; Zhang, Li; Waye, Mary Miu Yee; Fu, Wei-ming; Zhang, Jin-fang

2015-01-01

MicroRNAs (miRNAs) are a class of small non-coding RNAs that negatively regulate gene expression at the post-transcriptional level. As a highly conserved miRNA across a variety of species, microRNA-218 (miR-218) was found to play pivotal roles in tumorigenesis and progression. A group of evidence has demonstrated that miR-218 acts as a tumor suppressor by targeting many oncogenes related to proliferation, apoptosis and invasion. In this review, we provide a complex overview of miR-218, including its regulatory mechanisms, known functions in cancer and future challenges as a potential therapeutic target in human cancers. - Highlights: • miR-218 is frequently down regulated in multiple cancers. • miR-218 plays pivotal roles in carcinogenesis. • miR-218 mediates proliferation, apoptosis, metastasis, invasion, etc. • miR-218 mediates tumorigenesis and metastasis via multiple pathways

49 CFR 218.22 - Utility employee.

Science.gov (United States)

2010-10-01

... 49 Transportation 4 2010-10-01 2010-10-01 false Utility employee. 218.22 Section 218.22... employee. (a) A utility employee shall be subject to the Hours of Service Act, and the requirements for... parts 217, 219, and 228 of this chapter. (b) A utility employee shall perform service as a member of...

49 CFR 218.80 - Movement of occupied camp cars.

Science.gov (United States)

2010-10-01

... 49 Transportation 4 2010-10-01 2010-10-01 false Movement of occupied camp cars. 218.80 Section 218... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD OPERATING PRACTICES Protection of Occupied Camp Cars § 218.80 Movement of occupied camp cars. Occupied cars may not be humped or flat switched unless coupled to...

24 CFR 972.218 - Conversion assessment components.

Science.gov (United States)

2010-04-01

... development as public housing for the remainder of its useful life. The cost methodology necessary to conduct... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Conversion assessment components. 972.218 Section 972.218 Housing and Urban Development Regulations Relating to Housing and Urban...

40 CFR 86.218-94 - Dynamometer calibration.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Dynamometer calibration. 86.218-94 Section 86.218-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS... 1994 and Later Model Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium...

Research on polonium-218 survey technique for uranium

International Nuclear Information System (INIS)

Zhou, R.

1985-01-01

This article makes an exposition of the principles and procedures of 218 Po survey technique for uranium. The experiments done with 218 Po method on a large scale on the deposits of granite, volcanic rock and carbon-silliceous slate types showed that the method of not only as effective as track method and 210 Po method, but also has the characteristics of its own. The device has higher working efficiency with only 5 minutes needed at each measurement point, and its sensitivity is higher, about 0.7 pulse/136.S (P ci /L). The results of measurement by 218 Po method will not be affected by thorium emanation and there will be no contamination of the scintillation chamber by radon daughter. The ratio of anomalous peak value to the bottom for 218 Po method is proved to be higher than that for track method and 210 Po method. In order to avoid the influence of moisture, the measurement by 218 Po method should be planned to do when it is not a rainy day and the holes must be dug some distance off the ditches and rice fields, thus ensuring the success in applying the method

22 CFR 218.39 - Alternate funds disbursal procedure.

Science.gov (United States)

2010-04-01

... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Alternate funds disbursal procedure. 218.39 Section 218.39 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT NONDISCRIMINATION ON THE BASIS OF... recipient, any public or non-profit private organization or agency, or State or political subdivision of the...

49 CFR 218.97 - Good faith challenge procedures.

Science.gov (United States)

2010-10-01

... 49 Transportation 4 2010-10-01 2010-10-01 false Good faith challenge procedures. 218.97 Section... Derails § 218.97 Good faith challenge procedures. (a) Employee responsibility. An employee shall inform the railroad or employer whenever the employee makes a good faith determination that the employee has...

30 CFR 218.580 - When do I submit Form MMS-4444?

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 2 2010-07-01 2010-07-01 false When do I submit Form MMS-4444? 218.580 Section 218.580 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE... Correspondence § 218.580 When do I submit Form MMS-4444? Initially, you must submit MMS Form-4444 by November 29...

The electrical and diffusive properties of unattached 218Po in argon gas

International Nuclear Information System (INIS)

Leung, H.M.-Y.; Phillips, C.R.

1987-01-01

Electrical and diffusive properties of unattached 218 Po were investigated in argon Parameters determined in electrostatic collection experiments were radon concentration, the fraction of 218 Po having a positive charge at the end of the recoil path, the diffusion coefficient of the neutral 218 Po species, and the ratio of the neutralisation rate constant of charged 218 Po species to the electrical mobility of charged 218 Po species. Independent electrical mobility data were obtained using a pulse width modulated ion mobility analyser. The neutralisation rate constant for charged 218 Po species was then determined from the electrostatic collection data together with the independent mobility data. Relative humidity (RH) and radon concentration were found to affect the neutralisation mechanism. Following recoil of the charged 218 Po species, neutralisation through recombination with small negative ions is important for radon concentrations greater than about 1.0 x 10 5 atoms cm -3 . The neutralisation rate constant is proportional to about the 0.6 power of the radon concentration for all relative humidities. At a radon concentration less than about 1.0 x 10 5 atoms cm -3 , the neutralisation rate constant is independent of radon concentration. (author)

The electrical and diffusive properties of unattached 218Po in air systems

International Nuclear Information System (INIS)

Leung, H.M.-Y.; Phillips, C.R.

1988-01-01

The electrical and diffusive properties of unattached 218 Po were determined in air environments containing traces of other gases. Of particular interest was the neutralisation of charged, unattached 218 Po. An electrostatic collection apparatus and a pulse width modulated ion mobility analyser were used to determine the fraction of the unattached 218 Po having a positive charge at the end of the recoil path (f); the diffusion coefficient of the neutral, unattached 218 Po Dsub(Α): the mobility of the charged, unattached 218 Po (B); and the neutralisation rate constant of charged, unattached 218 Po (K). Average values found for f, Dsub(Α), B and K were similar to those determined earlier for the argon system. Two mechanisms may be responsible for neutralisation, namely, scavenging of electrons from trace gases (charge transfer), and recombination with negative small ions. Which neutralisation mechanism is dominant depends on the amount and type of trace gas or organic vapour present and the degree of gas ionisation. (author)

Measurement of airborne 218Po - A Bayesian approach

International Nuclear Information System (INIS)

Groer, P.G.; Lo, Y.

1996-01-01

The standard mathematical treatment of the buildup and decay of airborne radionuclides on a filter paper uses the solutions of the so-called bateman equations adapted to the sampling process. The equations can be interpreted as differential equations for the expectation of an underlying stochastic process, which describes the random fluctuations in the accumulation and decay of the sampled radioactive atoms. The process for the buildup and decay of airborne 218 Po can be characterized as an open-quotes immigration-death processclose quotes in the widely adopted, biologically based jargon. The probability distribution for the number of 218 Po atoms, accumulated after sampling time t, is Poisson. We show that the distribution of the number of counts, registered by a detector with efficiency ε during a counting period T after the end of sampling, it also Poisson, with mean dependent on ε,t,T, the flowrate and N o , the number of airborne 218 Po atoms per unit volume. This Poisson distribution was used to construct the likelihood given the observed number of counts. After inversion with Bayes' Theorem we obtained the posterior density for N o . This density characterizes the remaining uncertainty about the measured under of 218 Po atoms per unit volume of air. 6 refs., 3 figs., 1 tab

218-E-8 Borrow Pit Demolition Site closure plan. Revision 1

International Nuclear Information System (INIS)

Ruck, F.R.

1994-01-01

The 218-E-8 Demolition Site was the site of a single demolition event in November of 1984. This demolition event was a form of thermal treatment for discarded explosive chemical products. Because the 218-E-8 Demolition Site will no longer be used for this thermal activity, the site will be closed. Closure will be conducted pursuant to the requirements of the Washington State Department of Ecology (Ecology) ''Dangerous Waste Regulations,'' Washington Administrative Code (WAC) 173-303-610 and 40 Code of Federal Regulations (CFR) 270.1. The 218-E-8 Borrow Pit Demolition Site Closure Plan consists of a Hanford Facility Dangerous Waste Part A Permit Application, Form 3, Revision 4, and a closure plan. An explanation of the Part A Form 3, submitted with this closure plan is provided at the beginning of the Part A Section. The closure plan consists of nine chapters and five appendices. This closure plan presents a description of the 218-E-8 Demolition Site, the history of the waste treated, and the approach that will be followed to close the 218-E-8 Demolition Site. Because there were no radioactively contaminated chemicals involved in t he demolitions at the 218-E-8 Borrow Pit site, the information on radionuclides is provided for ''information only.'' Remediation of any radioactive contamination is not within the scope of this closure plan. Only dangerous constituents derived from 218-E-8 Demolition Site operations will be addressed in this closure plan in accordance with WAC 173-303-610(2)(b)(i)

Journal of Naval Science. Volume 2. Number 3. July 1976

Science.gov (United States)

1976-07-01

supplementary food to the beakers containing stage VI nauplii: cyprids do not feed. The larvae in each beaker were con- fined within a close-fitting plastic...99-274% of Natural U) Uranium-234 (234U) (0-006% of Natural U) 2-48 X 10"’yrs Thorium-230 (230Th) Polonium -218(2I8Po) /through short lived...Natural U) Actinium-227 (--7Ac) FIG. 1. Nuclide chart. 4-51 X 10’Yrs 7 hours P 8 X 10’ Yrs 4 days Lead- 210 (210Pb) (22 yrs,/3"). 1-39 X 10

218 E-8 Borrow Pit Demolition Site clean closure soil evaluation report

International Nuclear Information System (INIS)

Korematsu-Olund, D.M.

1995-01-01

This report summarizes the sampling activities undertaken and the analytical results obtained in a soil sampling and analyses study performed for the 218 E-8 Borrow Pit Demolition Site (218 E-8 Demolition Site). The 218 E-8 Demolition Site is identified as a Resource Conservation and Recovery Act (RCRA) treatment unit that will be closed in accordance with the applicable laws and regulations. The site was used for the thermal treatment of discarded explosive chemical products. No constituents of concern were found in concentrations indicating contamination of the soil by 218 E-8 Demolition Site activities

49 CFR 173.218 - Fish meal or fish scrap.

Science.gov (United States)

2010-10-01

... 49 Transportation 2 2010-10-01 2010-10-01 false Fish meal or fish scrap. 173.218 Section 173.218... Fish meal or fish scrap. (a) Except as provided in Column (7) of the HMT in § 172.101 of this subchapter, fish meal or fish scrap, containing at least 6%, but not more than 12% water, is authorized for...

50 CFR 218.104 - Mitigation.

Science.gov (United States)

2010-10-01

... Mitigation. (a) When conducting training and utilizing the sound sources or explosives identified in § 218... Handbook (Naval Education and Training Command [NAVEDTRA] 12968-D). (iii) Lookout training shall include on... Lookout Training Handbook (NAVEDTRA 12968-D). (vi) After sunset and prior to sunrise, lookouts shall...

32 CFR 218.1 - Policies.

Science.gov (United States)

2010-07-01

... NUCLEAR TEST PROGRAM (1945-1962) § 218.1 Policies. (a) Upon request by the Veterans Administration in... done upon request from the individual, the individual's representative, the Veterans Administration, or... to arrive at a radiation dose. Such reconstruction is not a new concept; it is standard scientific...

36 CFR 223.218 - Consistency with plans, environmental standards, and other management requirements.

Science.gov (United States)

2010-07-01

..., environmental standards, and other management requirements. 223.218 Section 223.218 Parks, Forests, and Public... Special Forest Products § 223.218 Consistency with plans, environmental standards, and other management... with applicable land management plans. Each contract, permit, or other authorizing instrument shall...

5 CFR 591.218 - How does OPM compute price indexes?

Science.gov (United States)

2010-01-01

... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false How does OPM compute price indexes? 591.218 Section 591.218 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS ALLOWANCES AND DIFFERENTIALS Cost-of-Living Allowance and Post Differential-Nonforeign Areas Cost-Of-Living...

47 CFR 25.218 - Off-axis EIRP envelopes for FSS earth station operations.

Science.gov (United States)

2010-10-01

... 47 Telecommunication 2 2010-10-01 2010-10-01 false Off-axis EIRP envelopes for FSS earth station operations. 25.218 Section 25.218 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Technical Standards § 25.218 Off-axis EIRP envelopes for FSS...

49 CFR 218.93 - Definitions.

Science.gov (United States)

2010-10-01

... § 214.353 of this chapter for the purpose of establishing on-track safety for roadway work groups... TRANSPORTATION RAILROAD OPERATING PRACTICES Handling Equipment, Switches, and Fixed Derails § 218.93 Definitions... classification yard where rolling equipment is placed and made ready for an outgoing train movement. Employee...

49 CFR 218.75 - Methods of protection for camp cars.

Science.gov (United States)

2010-10-01

... 49 Transportation 4 2010-10-01 2010-10-01 false Methods of protection for camp cars. 218.75... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD OPERATING PRACTICES Protection of Occupied Camp Cars § 218.75 Methods of protection for camp cars. When camp cars requiring protection are on either main track...

Design criteria for the 218-group criticality safety reference library

International Nuclear Information System (INIS)

Westfall, R.M.; Ford, W.E. III; Webster, C.C.

1978-01-01

The generation of a 218-group neutron cross-section library from ENDF/B-IV data is described. Experience in selecting broad-group subsets and applying them in the analysis of critical experiments is related. Recommendations on the use of the 218-group library are made. 3 figures, 5 tables

Cluster decay of 218U isotope

International Nuclear Information System (INIS)

Shivakumaraswamy, G.; Umesh, T.K.

2012-01-01

The phenomenon of spontaneous emission of charged particles heavier than alpha particle and lighter than a fission fragment from radioactive nuclei without accompanied by the emission of neutrons is known as cluster radioactivity or exotic radioactivity. The process of emission of charged particles heavier than alpha particle and lighter than a fission fragment is called exotic decay or cluster decay. The phenomenon of cluster radioactivity was first predicted theoretically by Sandulescu et al in 1980. Rose and Jones made first experimental observations of 14 C emission from 223 Ra in 1984. Several cluster decay modes in trans-lead region have been experimentally observed. The half-life values for different modes of cluster decay from different isotopes of uranium have been calculated using different theoretical models such as the analytical super asymmetric model (ASAFM), Preformed cluster model (PCM) and Coulomb and Proximity potential model (CPPM) etc. Recently some semi-empirical formulae, i.e, single line of universal curve (UNIV), Universal decay law (UDL) for both alpha and cluster radioactivity have also been proposed to explain cluster decay data. The alpha decay half-life of 218-219 U isotopes has been experimentally measured in 2007. The half-life values for different cluster decay modes of 218 U isotopes have been calculated PCM model. Recently in 2011, the half-life values have also been calculated for some cluster decay modes of 222-236 U isotopes using the effective liquid drop description with the varying mass asymmetry (VMAS) shape and effective inertial coefficient. In the light of this, in the present work we have studied the cluster radioactivity of 218 U isotope. The logarithmic half-lives for few cluster decay modes from 218 U isotope have been calculated by using three different approaches, i.e, UNIV proposed by Poenaru et al in 2011, UDL proposed by Qi et al in 2009 and the CPPM model proposed by Santhosh et al in 2002. The CPPM based

Restoration of microRNA‑218 increases cellular chemosensitivity to cervical cancer by inhibiting cell‑cycle progression.

Science.gov (United States)

Dong, Ruofan; Qiu, Haifeng; Du, Guiqiang; Wang, Yuan; Yu, Jinjin; Mao, Caiping

2014-12-01

We previously reported frequent loss of microRNA‑218 (miR‑218) in human cervical cancer, which was associated with tumor progression and poor prognosis. In this study, we investigated whether restoration of the miR‑218 level is a valid strategy for the treatment of cervical cancer. The expression of miR‑218 in cervical cancer samples and cell lines was quantified by reverse transcription TaqMan quantitative (RT‑q)PCR. Overexpression of miR‑218 was achieved by both transient and stable transfection, using a miR‑218 mimic and a miR‑218‑expressing plasmid, respectively. Alterations in cellular proliferation and cell‑cycle progression were measured by the MTT assay and flow cytometry analysis. Nude mice bearing SiHa xenografts were used to investigate the functions of miR‑218 and carboplatin on tumor growth and weight. The expression of cycle‑related proteins was detected by western blotting and immunohistochemical staining. In vitro, miR‑218 significantly inhibited cellular growth in all four cell lines tested (P=0.021 for CaSki, P=0.009 for HeLa, P=0.016 for SiHa, and P=0.029 for C33A). Overexpression of miR‑218 induced G1 phase arrest and reduced expression of cyclin D1 and CDK4. In vivo, restoration of miR‑218 notably inhibited tumor growth and decreased tumor weight. In primary cultured samples, tumors with high levels of miR‑218 were more sensitive to carboplatin (R2=0.3319, P=0.0026); consistently, miR‑218 overexpression suppressed tumor growth, induced cell‑cycle arrest, and reduced the cyclin D1 level. Based on these and previous results, we conclude that restoration of the miR‑218 level inhibits the growth of cervical cancer cells both in vitro and in vivo; furthermore, overexpression of miR‑218 sensitizes cervical cancer cells to carboplatin. Our findings suggest a novel therapy for cervical cancer based on miR‑218, especially in patients with reduced levels of miR‑218.

MicroRNA-218 inhibits cell invasion and migration of pancreatic cancer via regulating ROBO1.

Science.gov (United States)

He, Hang; Hao, Si-Jie; Yao, Lie; Yang, Feng; Di, Yang; Li, Ji; Jiang, Yong-Jian; Jin, Chen; Fu, De-Liang

2014-10-01

miRNA-218 is a highlighted tumor suppressor and its underlying role in tumor progression is still unknown. Here, we restored the expression of miRNA-218 in pancreatic cancer to clarify the function and potent downstream pathway of miRNA-218. The expressions of both miRNA-218 and its potent target gene ROBO1 were revealed by RT-PCR and western blotting analysis. Transfection of miRNA-218 precursor mimics and luciferase assay were performed to elucidate the regulation mechanism between miRNA-218 and ROBO1. Cells, stably expressing miRNA-218 followed by forced expression of mutant ROBO1, were established through co-transfections of both lentivirus vector and plasmid vector. The cell migration and invasion abilities were evaluated by migration assay and invasion assay respectively. An increased expression of ROBO1 was revealed in cell BxPC-3-LN compared with cell BxPC-3. Elevated expression of miRNA-218 would suppress the expression of ROBO1 via complementary binding to a specific region within 3'UTR of ROBO1 mRNA (sites 971-978) in pancreatic cancer cells. Stably restoring the expression of miRNA-218 in pancreatic cancer significantly downregulated the expression of ROBO1 and effectively inhibited cell migration and invasion. Forced expression of mutant ROBO1 could reverse the repression effects of miRNA-218 on cell migration and invasion. Consequently, miRNA-218 acted as a tumor suppressor in pancreatic cancer by inhibiting cell invasion and migration. ROBO1 was a functional target of miRNA-218's downstream pathway involving in cell invasion and migration of pancreatic cancer.

B218 Weld Filler Wire Characterization for Al-Li Alloy 2195

Science.gov (United States)

Bjorkman, Gerry; Russell, Carolyn

2000-01-01

NASA Marshall Space Flight Center, Lockheed Martin Space Systems- Michoud Operations, and McCook Metals have developed an aluminum-copper weld filler wire for fusion welding aluminum lithium alloy 2195. The aluminum-copper based weld filler wire has been identified as B218, a McCook Metals designation. B218 is the result of six years of weld filler wire development funded by NASA, Lockheed Martin, and McCook Metals. The filler wire chemistry was developed to produce enhanced 2195 weld and repair weld mechanical properties over the 4043 aluminum-silicon weld filler wire, which is currently used to weld 2195 on the Super Lightweight External Tank for the NASA Space Shuttle Program. An initial characterization was performed consisting of a repair weld evaluation using B218 and 4043 weld filler wires. The testing involved room temperature and cryogenic repair weld tensile testing along with fracture toughness testing. From the testing, B218 weld filler wire produce enhanced repair weld tensile strength, ductility, and fracture properties over 4043. B218 weld filler wire has proved to be a superior weld filler wire for welding aluminum lithium alloy 2195 over 4043.

12 CFR 218.741 - Exemption for banks effecting transactions in money market funds.

Science.gov (United States)

2010-01-01

... money market funds. 218.741 Section 218.741 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS... EXCHANGE ACT OF 1934 (REGULATION R) § 218.741 Exemption for banks effecting transactions in money market... issued by a money market fund, provided that: (1) The bank either (i) Provides the customer, directly or...

13 CFR 134.218 - Judges.

Science.gov (United States)

2010-01-01

... Administrative Law Judge. The AA/OHA will assign all other cases before OHA to either an Administrative Law Judge... Business Credit and Assistance SMALL BUSINESS ADMINISTRATION RULES OF PROCEDURE GOVERNING CASES BEFORE THE OFFICE OF HEARINGS AND APPEALS Rules of Practice for Most Cases § 134.218 Judges. (a) Assignment. The AA...

Quantitative evaluation of 218Po behaviour in air in an artificial environment

International Nuclear Information System (INIS)

Yajima, K.; Hirao, S.; Moriizumi, J.; Yamazawa, H.

2015-01-01

Experiments were carried out in a small enclosed booth for the purpose of understanding and modelling 218 Po behaviour. The experiment was conducted under two kinds of conditions without and with injection of incense smoke. A working model of 218 Po behaviour was applied to analyse the measured data. Under the condition without incense smoke, temporal changes in aerosol-attached and unattached 218 Po concentrations were successfully reproduced by the model. The deposition rate of unattached fraction and the rate of attachment were determined by the working model. Under the condition with incense smoke, temporal changes in 218 Po concentration were poorly simulated by the model. This can be attributed to the significantly increased aerosol concentration in small size ranges which is not properly considered in the attachment rate calculation in the model. (authors)

Improving the yield of 2-[18F]fluoro-2-deoxyglucose using a microwave cavity.

Science.gov (United States)

Taylor, M D; Roberts, A D; Nickles, R J

1996-07-01

We have investigated the use of a microwave cavity (Labwell AB, Sweden) to improve the radiochemical yield of 2-[18F]fluoro-2-deoxyglucose (2-[18F]FDG). After characterizing the heating properties of the cavity, three steps of the Hamacher 2-[18F]FDG synthesis which require heating--azeotropic distillation of the target water, nucleophilic substitution, and hydrolysis of the product--were investigated separately. The average radiochemical yield of 2-[18F]FDG for the microwave synthesis, using the phase transfer reagent tetrabutylammonium bicarbonate, was 62 +/- 4% (72 +/- 5%, decay corrected, synthesis time = 31 min).

9 CFR 93.218 - Import permits and applications for inspection for poultry.

Science.gov (United States)

2010-01-01

... inspection for poultry. 93.218 Section 93.218 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE EXPORTATION AND IMPORTATION OF ANIMALS (INCLUDING POULTRY) AND ANIMAL PRODUCTS IMPORTATION OF CERTAIN ANIMALS, BIRDS, FISH, AND POULTRY, AND CERTAIN ANIMAL, BIRD, AND POULTRY...

30 CFR 218.560 - How do I submit Form MMS-4444?

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 2 2010-07-01 2010-07-01 false How do I submit Form MMS-4444? 218.560 Section... Correspondence § 218.560 How do I submit Form MMS-4444? A copy of Form MMS-4444 and instructions may be obtained from MMS. It will also be posted on the MMS Web site. Submit the completed, signed form to the address...

14 CFR 93.218 - Slots for transborder service to and from Canada.

Science.gov (United States)

2010-01-01

... Canada. 93.218 Section 93.218 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF... service to and from Canada. (a) Except as otherwise provided in this subpart, international slots...'Hare in the Winter season. (c) Any modification to the slot base by the Government of Canada or the...

30 CFR 218.151 - Rental fees.

Science.gov (United States)

2010-07-01

... MONIES AND PROVISION FOR GEOTHERMAL CREDITS AND INCENTIVES Oil, Gas and Sulfur, Offshore § 218.151 Rental... this section. Discovery means one or more wells on the lease that meet the requirements in 250, subpart... (c) of this section. For— Issued as a result of a sale held— The lessee must pay rental— (1) An oil...

30 CFR 218.42 - Cross-lease netting in calculation of late-payment interest.

Science.gov (United States)

2010-07-01

...-payment interest. 218.42 Section 218.42 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE MANAGEMENT COLLECTION OF MONIES AND PROVISION FOR GEOTHERMAL CREDITS AND...; (3) The payor submits production reports, pipeline allocation reports, or other similar documentary...

Neutron spectrometer using NE218 liquid scintillator

International Nuclear Information System (INIS)

Dance, J.B.; Francois, P.E.

1976-01-01

A neutron spectrometer has been constructed using NE218 liquid scintillator. Discrimination against electron-gamma events was obtained usng a charge-comparison pulse shape discrimination system. The resolution obtained was about 0.25 MeV F.W.H.M. at 2.0 MeV

50 CFR 216.218 - Letters of Authorization.

Science.gov (United States)

2010-10-01

... ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking of Marine Mammals Incidental to Explosive Severance Activities Conducted During Offshore Structure Removal Operations on the Outer Continental Shelf in the U.S. Gulf of Mexico § 216.218 Letters of...

Hotair mediates hepatocarcinogenesis through suppressing miRNA-218 expression and activating P14 and P16 signaling.

Science.gov (United States)

Fu, Wei-Ming; Zhu, Xiao; Wang, Wei-Mao; Lu, Ying-Fei; Hu, Bao-Guang; Wang, Hua; Liang, Wei-Cheng; Wang, Shan-Shan; Ko, Chun-Hay; Waye, Mary Miu-Yee; Kung, Hsiang-Fu; Li, Gang; Zhang, Jin-Fang

2015-10-01

Long non-coding RNA Hotair has been considered as a pro-oncogene in multiple cancers. Although there is emerging evidence that reveals its biological function and the association with clinical prognosis, the precise mechanism remains largely elusive. We investigated the function and mechanism of Hotair in hepatocellular carcinoma (HCC) cell models and a xenograft mouse model. The regulatory network between miR-218 and Hotair was elucidated by RNA immunoprecipitation and luciferase reporter assays. Finally, the correlation between Hotair, miR-218 and the target gene Bmi-1 were evaluated in 52 paired HCC specimens. In this study, we reported that Hotair negatively regulated miR-218 expression in HCC, which might be mediated through an EZH2-targeting-miR-218-2 promoter regulatory axis. Further investigation revealed that Hotair knockdown dramatically inhibited cell viability and induced G1-phase arrest in vitro and suppressed tumorigenicity in vivo by promoting miR-218 expression. Oncogene Bmi-1 was shown to be a functional target of miR-218, and the main downstream targets signaling, P16(Ink4a) and P14(ARF), were activated in Hotair-suppressed tumorigenesis. In primary human HCC specimens, Hotair and Bmi-1 were concordantly upregulated whereas miR-218 was downregulated in these tissues. Furthermore, Hotair was inversely associated with miR-218 expression and positively correlated with Bmi-1 expression in these clinical tissues. Hotair silence activates P16(Ink4a) and P14(ARF) signaling by enhancing miR-218 expression and suppressing Bmi-1 expression, resulting in the suppression of tumorigenesis in HCC. Copyright © 2015 European Association for the Study of the Liver. Published by Elsevier B.V. All rights reserved.

A pri-miR-218 variant and risk of cervical carcinoma in Chinese women

International Nuclear Information System (INIS)

Shi, Ting-Yan; Cheng, Xi; Wu, Xiaohua; Wei, Qingyi; Chen, Xiao-Jun; Zhu, Mei-Ling; Wang, Meng-Yun; He, Jing; Yu, Ke-Da; Shao, Zhi-Ming; Sun, Meng-Hong; Zhou, Xiao-Yan

2013-01-01

MicroRNA (miRNA)-related single nucleotide polymorphisms (SNPs) may compromise miRNA binding affinity and modify mRNA expression levels of the target genes, thus leading to cancer susceptibility. However, few studies have investigated roles of miRNA-related SNPs in the etiology of cervical carcinoma. In this case–control study of 1,584 cervical cancer cases and 1,394 cancer-free female controls, we investigated associations between two miR-218-related SNPs involved in the LAMB3-miR-218 pathway and the risk of cervical carcinoma in Eastern Chinese women. We found that the pri-miR-218 rs11134527 variant GG genotype was significantly associated with a decreased risk of cervical carcinoma compared with AA/AG genotypes (adjusted OR=0.77, 95% CI=0.63-0.95, P=0.015). However, this association was not observed for the miR-218 binding site SNP (rs2566) on LAMB3. Using the multifactor dimensionality reduction analysis, we observed some evidence of interactions of these two SNPs with other risk factors, especially age at primiparity and menopausal status, in the risk of cervical carcinoma. The pri-miR-218 rs11134527 SNP was significantly associated with the risk of cervical carcinoma in Eastern Chinese women. Larger, independent studies are warranted to validate our findings

Andrographolide impedes cancer stemness and enhances radio-sensitivity in oral carcinomas via miR-218 activation.

Science.gov (United States)

Yang, Po-Yu; Hsieh, Pei-Ling; Wang, Tong Hong; Yu, Cheng-Chia; Lu, Ming-Yi; Liao, Yi-Wen; Lee, Tzu-Hsin; Peng, Chih-Yu

2017-01-17

Current evidence suggests that oral cancer stem cells (OCSCs) possess high tumorigenic and metastatic properties as well as chemo- and radioresistance. In this study, we demonstrated that andrographolide, the main bioactive component in the medicinal plant Andrographis, significantly reduced oncogenicity and restored radio-sensitivity of ALDH1+CD44+ OCSCs. Mechanistic studies showed that andrographolide treatment increased the expression of microRNA-218 (miR-218), leading to the downregulation of Bmi1. We showed that knockdown of miR-218 in ALDH1-CD44- non-OCSCs enhanced cancer stemness, while silencing of Bmi1 significantly counteracted it. Furthermore, we found tumor growth was reduced in mice bearing xenograft tumors after andrographolide treatment via activation of miR-218/Bmi1 axis. Together, these data demonstrated that the inhibition of tumor aggressiveness in OCSCs by andrographolide was mediated through the upregulation of miR-218, thereby reducing Bmi1 expression. These findings suggest that andrographolide may be a valuable natural compound for anti-CSCs treatment of OSCC.

miRNA-218-loaded carboxymethyl chitosan - Tocopherol nanoparticle to suppress the proliferation of gastrointestinal stromal tumor growth

Energy Technology Data Exchange (ETDEWEB)

Tu, Lin; Wang, Ming; Zhao, Wen-Yi; Zhang, Zi-Zhen; Tang, De-Feng; Zhang, Ye-Qian [Department of Gastrointestinal Surgery, Ren Ji Hospital, School of Medicine, Shanghai Jiao Tong University, Shanghai 200127 (China); Cao, Hui, E-mail: caohui10281@163.com [Department of Gastrointestinal Surgery, Ren Ji Hospital, School of Medicine, Shanghai Jiao Tong University, Shanghai 200127 (China); Zhang, Zhi-Gang, E-mail: zhangzhiganggz@hotmail.com [State Key Laboratory for Oncogenes and Related Genes, Shanghai Cancer Institute, Ren Ji Hospital, School of Medicine, Shanghai Jiaotong University, Shanghai 200240 (China)

2017-03-01

Gastrointestinal stromal tumors (GIST) are one of the most common forms of mesenchymal cancers of the gastrointestinal tract. Although chemotherapeutic drugs inhibited the proliferation of GIST, however, sizable proportion of people developed resistance and therefore difficult to treat. In the present study, O-carboxymethyl chitosan (OCMC)-tocopherol polymer conjugate was synthesized and formulated into stable polymeric nanoparticles. The main aim of present study was to increase the therapeutic efficacy of miR-218 in GIST. The mean size of nanoparticles was ~ 110 nm with a spherical shape. The miR-218 NP has been shown inhibit the cell proliferation and exhibited a superior cell apoptosis. The miR-218 NP inhibited the cell invasion and promoted the apoptosis of GIST cancer cells. In the present study, we have successfully showed that KIT1 is the target gene of miR-218 as shown by the luciferase reporter assay. These findings collectively suggest the miR-218 loaded nanoparticle by virtue of effective transfection could act as a tumor suppressor miRNA in the treatment of GIST. - Highlights: • O-carboxymethyl chitosan (OCMC)-tocopherol polymer conjugate was synthesized and formulated in nanoparticles. • The miR-218 NP has been shown inhibit the cell proliferation and exhibited a superior cell apoptosis. • We have successfully showed that KIT1 is the target gene of miR-218 as shown by the luciferase reporter assay.

18 CFR 157.218 - Changes in customer name.

Science.gov (United States)

2010-04-01

... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Changes in customer... Act for Certain Transactions and Abandonment § 157.218 Changes in customer name. (a) Automatic... reflect the change in the name of an existing customer, if the certificate holder has filed any necessary...

20 CFR 725.218 - Conditions of entitlement; child.

Science.gov (United States)

2010-04-01

... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Conditions of entitlement; child. 725.218... Conditions of entitlement; child. (a) An individual is entitled to benefits where he or she meets the... the child of a deceased miner who: (1) Was receiving benefits under section 415 or part C of title IV...

Lack of association between miR-218 rs11134527 A>G and Kawasaki disease susceptibility.

Science.gov (United States)

Pi, Lei; Fu, Lanyan; Xu, Yufen; Che, Di; Deng, Qiulian; Huang, Xijing; Li, Meiai; Zhang, Li; Huang, Ping; Gu, Xiaoqiong

2018-05-01

Abstract Kawasaki disease (KD) is a type of disease that includes the development of a fever that lasts at least five days and involves the clinical manifestation of multicellular vasculitis. KD has become one of the most common pediatric cardiovascular diseases. Previous studies have reported that miR-218 rs11134527 A>G is associated with susceptibility to various cancer risks. However, there is a lack of evidence regarding the relationship between this polymorphism and KD risk. This study explored the correlation between the miR-218 rs11134527 A>G polymorphism and the risk of KD. We recruited 532 patients with KD and 623 controls to genotype the miR-218 rs11134527 A>G polymorphism with a TaqMan allelic discrimination assay. Our results illustrated that the miR-218 rs11134527 A>G polymorphism was not associated with KD risk. In an analysis stratified by age, sex, and coronary artery lesions, we found only that the risk of KD was significantly decreased for children older than 5 years (GG vs. AA/AG: adjusted OR=0.26, 95% CI=0.07-0.94, P =0.041). This study demonstrated that the miR-218 rs1113452 A>G polymorphism may have an age-related relationship with KD susceptibility that has not previously been revealed. ©2018 The Author(s).

48 CFR 218.270 - Head of contracting activity determinations.

Science.gov (United States)

2010-10-01

... REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES EMERGENCY ACQUISITIONS Emergency Acquisition Flexibilities 218.270 Head of contracting activity determinations. For contract... contracting activity,” as defined in FAR 2.101, in the following locations: (a) FAR 2.101: (1) Definition of...

Characterization of the Canine Anthracycline-Metabolizing Enzyme Carbonyl Reductase 1 (cbr1) and the Functional Isoform cbr1 V218.

Science.gov (United States)

Ferguson, Daniel C; Cheng, Qiuying; Blanco, Javier G

2015-07-01

The anthracyclines doxorubicin and daunorubicin are used in the treatment of various human and canine cancers, but anthracycline-related cardiotoxicity limits their clinical utility. The formation of anthracycline C-13 alcohol metabolites (e.g., doxorubicinol and daunorubicinol) contributes to the development of anthracycline-related cardiotoxicity. The enzymes responsible for the synthesis of anthracycline C-13 alcohol metabolites in canines remain to be elucidated. We hypothesized that canine carbonyl reductase 1 (cbr1), the homolog of the prominent anthracycline reductase human CBR1, would have anthracycline reductase activity. Recombinant canine cbr1 (molecular weight: 32.8 kDa) was purified from Escherichia coli. The enzyme kinetics of "wild-type" canine cbr1 (cbr1 D218) and a variant isoform (cbr1 V218) were characterized with the substrates daunorubicin and menadione, as well as the flavonoid inhibitor rutin. Canine cbr1 catalyzes the reduction of daunorubicin to daunorubicinol, with cbr1 D218 and cbr1 V218 displaying different kinetic parameters (cbr1 D218 Km: 188 ± 144 μM versus cbr1 V218 Km: 527 ± 136 μM, P < 0.05, and cbr1 D218 Vmax: 6446 ± 3615 nmol/min per milligram versus cbr1 V218 Vmax: 15539 ± 2623 nmol/min per milligram, P < 0.01). Canine cbr1 also metabolized menadione (cbr1 D218 Km: 104 ± 50 μM, Vmax: 2034 ± 307 nmol/min per milligram). Rutin acted as a competitive inhibitor for the reduction of daunorubicin (cbr1 D218 Ki: 1.84 ± 1.02 μM, cbr1 V218 Ki: 1.38 ± 0.47 μM). These studies show that canine cbr1 metabolizes daunorubicin and provide the necessary foundation to characterize the role of cbr1 in the variable pharmacodynamics of anthracyclines in canine cancer patients. Copyright © 2015 by The American Society for Pharmacology and Experimental Therapeutics.

24 CFR 5.218 - Penalties for failing to disclose and verify Social Security and Employer Identification Numbers.

Science.gov (United States)

2010-04-01

... and verify Social Security and Employer Identification Numbers. 5.218 Section 5.218 Housing and Urban... REQUIREMENTS; WAIVERS Disclosure and Verification of Social Security Numbers and Employer Identification Numbers; Procedures for Obtaining Income Information Disclosure and Verification of Social Security...

Thermo-chemotherapy Induced miR-218 upregulation inhibits the invasion of gastric cancer via targeting Gli2 and E-cadherin.

Science.gov (United States)

Ruan, Qiang; Fang, Zhi-Yuan; Cui, Shu-Zhong; Zhang, Xiang-Liang; Wu, Yin-Bing; Tang, Hong-Sheng; Tu, Yi-Nuo; Ding, Yan

2015-08-01

Thermo-chemotherapy has been proven to reduce the invasion capability of cancer cells. However, the molecular mechanism underlying this anti-invasion effect is still unclear. In this study, the role of thermo-chemotherapy in the inhibition of tumor invasion was studied. The results demonstrated that expression of miR-218 was downregulated in gastric cancer tissues, which had a positive correlation with tumor invasion and metastasis. In vitro thermo-chemotherapy increased miR-218 expression in SGC7901 cells and inhibited both proliferation and invasion of cancer cells. Gli2 was identified as a downstream target of miR-218, and its expression was negatively regulated by miR-218. The thermo-chemotherapy induced miR-218 upregulation was also accompanied by increasing of E-cadherin expression. In conclusion, the present study indicates that thermo-chemotherapy can effectively decrease the invasion capability of cancer cells and increase cell-cell adhesion. miR-218 and its downstream target Gli2, as well as E-cadherin, participate in the anti-invasion process.

Anticonvulsant and reproductive toxicological studies of the imidazole-based histamine H3R antagonist 2-18 in mice

Directory of Open Access Journals (Sweden)

Bastaki SM

2018-01-01

Full Text Available Salim M Bastaki,1 Yousef M Abdulrazzaq,2 Mohamed Shafiullah,1 Małgorzata Więcek,3 Katarzyna Kieć-Kononowicz,3 Bassem Sadek1 1Department of Pharmacology and Therapeutics, College of Medicine and Health Science, United Arab Emirates University, Al Ain, 2Department of Medical Education, Dubai Health Authority, Dubai, UAE; 3Department of Technology and Biotechnology of Drugs, Faculty of Pharmacy, Jagiellonian University Medical College, Medyczna, Kraków, Poland Abstract: The imidazole-based H3R antagonist 2-18 with high in vitro H3R antagonist affinity, excellent in vitro selectivity profile, and high in vivo H3R antagonist potency was tested for its anticonvulsant effect in maximal electroshock (MES-induced convulsions in mice having valproic acid (VPA as a reference antiepileptic drug (AED. Additionally, H3R antagonist 2-18 was evaluated for its reproductive toxicity in the same animal species. The results show that acute systemic administration (intraperitoneal; i.p. of H3R antagonist 2-18 (7.5, 15, 30, and 60 mg/kg, i.p. significantly and dose dependently protected male as well as female mice against MES-induced convulsion. The protective action observed for H3R antagonist 2-18 in both mice sexes was comparable to that of VPA and was reversed when mice were pretreated with the selective H3R agonist (R-alpha-methylhistamine (RAMH, 10 mg/kg, i.p.. Moreover, the results show that acute systemic administration of single (7.5, 15, 30, or 60 mg/kg, i.p. or multiple doses (15×3 mg/kg, i.p. of H3R antagonist 2-18 on gestation day (GD 8 or 13 did not affect the maternal body weight of mice when compared with the control group. Furthermore, no significant differences were observed in the average number of implantations and resorptions between the control and H3R antagonist 2-18-treated group at the early stages of gestation and the organogenesis period. However, oral treatment with H3R antagonist 2-18 (15 mg/kg on GD 8 induced a reduced number of

27 CFR 28.218 - Disposition of Forms 1582-A (5120.24).

Science.gov (United States)

2010-04-01

... AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS EXPORTATION OF ALCOHOL Exportation of Wine With Benefit of Drawback § 28.218 Disposition of Forms 1582-A (5120.24). On removal of the wines from the...

46 CFR 67.218 - Optional filing of instruments in portable document format as attachments to electronic mail.

Science.gov (United States)

2010-10-01

... format as attachments to electronic mail. 67.218 Section 67.218 Shipping COAST GUARD, DEPARTMENT OF... format as attachments to electronic mail. (a) Any instrument identified as eligible for filing and recording under § 67.200 may be submitted in portable document format (.pdf) as an attachment to electronic...

MicroRNA-218 functions as a tumor suppressor in lung cancer by targeting IL-6/STAT3 and negatively correlates with poor prognosis.

Science.gov (United States)

Yang, Yan; Ding, Lili; Hu, Qun; Xia, Jia; Sun, Junjie; Wang, Xudong; Xiong, Hua; Gurbani, Deepak; Li, Lianbo; Liu, Yan; Liu, Aiguo

2017-08-22

Aberrant expression of microRNAs in different human cancer types has been widely reported. MiR-218 acts as a tumor suppressor in diverse human cancer types impacting regulation of multiple genes in oncogenic pathways. Here, we evaluated the expression and function of miR-218 in human lung cancer and ALDH positive lung cancer cells to understand the potential mechanisms responsible for disease pathology. Also, the association between its host genes and the target genes could be useful towards the better understanding of prognosis in clinical settings. Publicly-available data from The Cancer Genome Atlas (TCGA) was mined to compare the levels of miR-218 and its host gene SLIT2/3 between lung cancer tissues and normal lung tissues. Transfection of miR-218 to investigate its function in lung cancer cells was done and in vivo effects were determined using miR-218 expressing lentiviruses. Aldefluor assay and Flow cytometry was used to quantify and enrich ALDH positive lung cancer cells. Levels of miR-218, IL-6R, JAK3 and phosphorylated STAT3 were compared in ALDH1A1 positive and ALDH1A1 negative cells. Overexpression of miR-218 in ALDH positive cells was carried to test the survival by tumorsphere culture. Finally, utilizing TCGA data we studied the association of target genes of miR-218 with the prognosis of lung cancer. We observed that the expression of miR-218 was significantly down-regulated in lung cancer tissues compared to normal lung tissues. Overexpression of miR-218 decreased cell proliferation, invasion, colony formation, and tumor sphere formation in vitro and repressed tumor growth in vivo. We further found that miR-218 negatively regulated IL-6 receptor and JAK3 gene expression by directly targeting the 3'-UTR of their mRNAs. In addition, the levels of both miR-218 host genes and the components of IL-6/STAT3 pathway correlated with prognosis of lung cancer patients. MiR-218 acts as a tumor suppressor in lung cancer via IL-6/STAT3 signaling pathway

KDG218, a nearby ultra-diffuse galaxy

Science.gov (United States)

Karachentsev, I. D.; Makarova, L. N.; Sharina, M. E.; Karachentseva, V. E.

2017-10-01

We present properties of the low-surface-brightness galaxy KDG218 observed with the HST/ACS. The galaxy has a half-light (effective) diameter of a e = 47″ and a central surface brightness of SB V (0) = 24.m4/□″. The galaxy remains unresolved with the HST/ACS, which implies its distance of D > 13.1 Mpc and linear effective diameter of A e > 3.0 kpc. We notice that KDG218 is most likely associated with a galaxy group around the massive lenticular NGC4958 galaxy at approximately 22 Mpc, or with the Virgo Southern Extension filament at approximately 16.5 Mpc. At these distances, the galaxy is classified as an ultra-diffuse galaxy (UDG) similar to those found in the Virgo, Fornax, and Coma clusters. We also present a sample of 15 UDG candidates in the Local Volume. These sample galaxies have the following mean parameters: 〈 D〉 = 5.1 Mpc, 〈 A e 〉 = 4.8 kpc, and 〈 SB B ( e)〉 = 27.m4/□″. All the local UDG candidates reside near massive galaxies located in the regions with the mean stellar mass density (within 1 Mpc) about 50 times greater than the average cosmic density. The local fraction of UDGs does not exceed 1.5% of the Local Volume population. We notice that the presented sample of local UDGs is a heterogeneous one containing irregular, transition, and tidal types, as well as objects consisting of an old stellar population.

Characterizing the Resolved M6 Dwarf Twin LP 318-218AB

Science.gov (United States)

Moreno Hilario, Elizabeth; Burgasser, Adam J.; Bardalez Gagliuffi, Daniella; Tamiya, Tomoki

2017-01-01

The lowest-mass stars and brown dwarfs are among the most common objects in the Milky Way Galaxy, but theories of their formation and evolution remain poorly constrained. Binary systems are important for understanding the formation of these objects and for making direct orbit and mass measurements to validate evolutionary theories. We report the discovery of LP 318-218, a high proper motion late M dwarf, as a near equal-brightness binary system with a separation of 0.72 arcseconds. Resolved near-infrared spectroscopy confirms the components as nearly identical M6 twins. We using our resolved photometry and spectroscopy to estimate the distance, projected separation and tangential velocity of the system, and confirm common proper motion. We also perform atmosphere model fits to the resolved spectra to assess their physical properties. We place LP 318-218 in context with other widely-separated late M dwarf binaries.

The marine geochemistry of actinium-227: Evidence for its migration through sediment pore water

International Nuclear Information System (INIS)

Nozaki, Yoshiyuki; Yamada, Masatoshi; Nikaido, Hirofumi

1990-01-01

227 Ac with a half life of 21.8 years has a potential utility as a tracer of deep water circulation and mixing studies on time scales less than 100 years. Here the authors present the first measurement of 227 Ac profile in the pore water of Northwest Pacific deep-sea sediment and in the ∼10,000 m long water column of Izu-Ogasawara Trench. The results clearly show that 227 Ac is supplied from the sediment to the overlying water through migration in the pore water. The model calculation indicates that the molecular diffusion alone through sediment porewater can support only a half of the standing crop of excess 227 Ac in the water column and the enhanced supply of 227 Ac by particle mixing is necessary to account for the remainder. Thus, bioturbation in the deep sea plays an important role in controlling the flux of some short-lived radionuclides such as 227 Ac and 228 Ra across the sediment-water interface

Andrographolide antagonizes cigarette smoke extract-induced inflammatory response and oxidative stress in human alveolar epithelial A549 cells through induction of microRNA-218.

Science.gov (United States)

Li, Ying-jie; Yu, Chang-hai; Li, Jing-bo; Wu, Xi-ya

2013-12-01

Andrographolide is a major bioactive labdane diterpenoid isolated from Andrographis paniculata and has protective effects against cigarette smoke (CS)-induced lung injury. This study was done to determine whether such protective effects were mediated through modulation of microRNA (miR)-218 expression. Therefore, we exposed human alveolar epithelial A549 cells to cigarette smoke extract (CSE) with or without andrographolide pretreatment and measured the level of glutathione, nuclear factor-kappaB (NF-κB) activation, proinflammatory cytokine production, and miR-218 expression. We found that andrographolide pretreatment significantly restored the glutathione level in CSE-exposed A549 cells, coupled with reduced inhibitor κB (IκB)-α phosphorylation and p65 nuclear translocation and interleukin (IL)-8 and IL-6 secretion. The miR-218 expression was significantly upregulated by andrographolide pretreatment. To determine the biological role of miR-218, we overexpressed and downregulated its expression using miR-218 mimic and anti-miR-218 inhibitor, respectively. We observed that miR-218 overexpression led to a marked reduction in IκB-α phosphorylation, p65 nuclear accumulation, and NF-κB-dependent transcriptional activity in CSE-treated A549 cells. In contrast, miR-218 silencing enhanced IκB-α phosphorylation and p65 nuclear accumulation in cells with andrographolide pretreatment and reversed andrographolide-mediated reduction of IL-6 and IL-8 production. In addition, depletion of miR-218 significantly reversed the upregulation of glutathione levels in A549 cells by andrographolide. Taken together, our results demonstrate that andrographolide mitigates CSE-induced inflammatory response in A549 cells, largely through inhibition of NF-κB activation via upregulation of miR-218, and thus has preventive benefits in CS-induced inflammatory lung diseases.

12 CFR 218.700 - Defined terms relating to the networking exception from the definition of “broker.”

Science.gov (United States)

2010-01-01

... the average of the minimum and maximum hourly wage established by the bank for the current or prior... exception from the definition of âbroker.â 218.700 Section 218.700 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM EXCEPTIONS FOR BANKS FROM THE DEFINITION OF BROKER IN...

30 CFR 218.101 - Royalty and rental remittance (naval petroleum reserves).

Science.gov (United States)

2010-07-01

... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Royalty and rental remittance (naval petroleum... INCENTIVES Oil and Gas, Onshore § 218.101 Royalty and rental remittance (naval petroleum reserves). Remittance covering payments of royalty or rental on naval petroleum reserves must be accomplished by...

Kinetics of neutralization of Po-218

International Nuclear Information System (INIS)

Chu, K.D.

1987-01-01

In a well-defined experimental system the neutralization of polonium-218 ions was investigated as a function of the physical and chemical properties of the controlled composition atmosphere. The mobilities of Po + and PoO 2 + are determined by combining experimental results with a computer model of the system. Three neutralization mechanisms were individually studied. The small ion recombination rate has been found to be proportional to the square root of radon concentration. The electron scavenging mechanism is responsible for the neutralization of Po + in NO 2 or H 2 O in nitrogen. When PoO 2 + is formed, the electron transfer mechanism dominates the neutralization process. The electron is transferred to PoO 2 + from molecules with lower ionization potentials. The ionization potential of PoO 2 + is also determined to be 10.44 +/- 0.05 eV

22 CFR Appendix B to Part 218 - List of Types of Federal Financial Assistance

Science.gov (United States)

2010-04-01

... by the United States International Communication Agency Subject to Age Discrimination Regulations... BASIS OF AGE IN PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Pt. 218, App. B Appendix B...

Study at high angular momentum of the reflection asymmetry in the 218 Ra transition nuclei

International Nuclear Information System (INIS)

Aiche, M.

1990-07-01

The investigations concerning the 218 Ra nuclei at high angular momentum are discussed. The aim of the study is to enlarge the knowledge on the octupolar phenomena and to analyse its evolution as a funcion of the angular momentum. The 218 Ra nuclei is obtained from the ( 14 C, 4n) reaction. The gamma angular distribution and the gamma-gamma coincidence were measured by means of the Chateau de Cristal multicounter. The reflection asymmetric mean field theory and the bosons interaction model were applied to analyze the data and obtain the structure at high angular moments. The results show the existence of dipole-octupole correlations in the nuclei [fr

12 CFR 218.781 - Exemption from the definition of “broker” for banks for a limited period of time.

Science.gov (United States)

2010-01-01

...” for banks for a limited period of time. A bank is exempt from the definition of the term “broker... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Exemption from the definition of âbrokerâ for banks for a limited period of time. 218.781 Section 218.781 Banks and Banking FEDERAL RESERVE SYSTEM...

Personal monitoring of 218Po and 214Po radionuclide deposition onto individuals under normal environmental exposure conditions

International Nuclear Information System (INIS)

Eatough, J.P.; Worley, A.; Moss, G.R.

1999-01-01

Personal dosemeters have been utilized to monitor the deposition of the radon decay products 218 Po and 214 Po onto individuals under normal environmental exposure conditions. Each detector consists of TASTRAK alpha-sensitive plastic incorporated into an ordinary working wristwatch. Subsequent analysis provides energy discrimination of the detected alpha-particle decays, and allows events from the individual radon decay products 218 Po and 214 Po, attached to the detector surface, to be uniquely identified. Assuming similar deposition onto skin and detector surfaces, the activity per unit area of deposited radionuclides can be determined for exposed skin. Forty-one personal dosemeters were issued to volunteers selected through the hospital medical physics departments at Reading, Northampton, Exeter and Plymouth. Each volunteer was also issued with a personal radon dosemeter to determine their individual radon exposure. The volunteers wore the two dosemeters simultaneously and continuously for a period of around one month. Correlations were observed between the radon exposure of the individual and the activity per unit area of 218 Po and 214 Po on the detector surface. From these correlations it can be estimated that at the UK average radon exposure of 20 Bq m -3 , the number of decays/cm 2 /year on continuously exposed skin surface is between 3500 and 28 000 for 218 Po, and between 7000 and 21 000 for 214 Po. These results can be combined with theoretical modelling of the dose distribution in the skin to yield the alpha-particle radiation dose to any identified target cells. (author)

MiR-495 and miR-218 regulate the expression of the Onecut transcription factors HNF-6 and OC-2

Energy Technology Data Exchange (ETDEWEB)

Simion, Alexandru; Laudadio, Ilaria; Prevot, Pierre-Paul; Raynaud, Peggy; Lemaigre, Frederic P. [Universite catholique de Louvain, de Duve Institute, 75 Avenue Hippocrate 7529, B-1200 Brussels (Belgium); Jacquemin, Patrick, E-mail: patrick.jacquemin@uclouvain.be [Universite catholique de Louvain, de Duve Institute, 75 Avenue Hippocrate 7529, B-1200 Brussels (Belgium)

2010-01-01

MicroRNAs are small, non-coding RNAs that posttranscriptionally regulate gene expression mainly by binding to the 3'UTR of their target mRNAs. Recent data revealed that microRNAs have an important role in pancreas and liver development and physiology. Using cloning and microarray profiling approaches, we show that a unique repertoire of microRNAs is expressed at the onset of liver and pancreas organogenesis, and in pancreas and liver at key stages of cell fate determination. Among the microRNAs that are expressed at these stages, miR-495 and miR-218 were predicted to, respectively, target the Onecut (OC) transcription factors Hepatocyte Nuclear Factor-6 (HNF-6/OC-1) and OC-2, two important regulators of liver and pancreas development. MiR-495 and miR-218 are dynamically expressed in developing liver and pancreas, and by transient transfection, we show that they target HNF-6 and OC-2 3'UTRs. Moreover, when overexpressed in cultured cells, miR-495 and miR-218 decrease the endogenous levels of HNF-6 and OC-2 mRNA. These results indicate that the expression of regulators of liver and pancreas development is modulated by microRNAs. They also suggest a developmental role for miR-495 and miR-218.

MiR-495 and miR-218 regulate the expression of the Onecut transcription factors HNF-6 and OC-2

International Nuclear Information System (INIS)

Simion, Alexandru; Laudadio, Ilaria; Prevot, Pierre-Paul; Raynaud, Peggy; Lemaigre, Frederic P.; Jacquemin, Patrick

2010-01-01

MicroRNAs are small, non-coding RNAs that posttranscriptionally regulate gene expression mainly by binding to the 3'UTR of their target mRNAs. Recent data revealed that microRNAs have an important role in pancreas and liver development and physiology. Using cloning and microarray profiling approaches, we show that a unique repertoire of microRNAs is expressed at the onset of liver and pancreas organogenesis, and in pancreas and liver at key stages of cell fate determination. Among the microRNAs that are expressed at these stages, miR-495 and miR-218 were predicted to, respectively, target the Onecut (OC) transcription factors Hepatocyte Nuclear Factor-6 (HNF-6/OC-1) and OC-2, two important regulators of liver and pancreas development. MiR-495 and miR-218 are dynamically expressed in developing liver and pancreas, and by transient transfection, we show that they target HNF-6 and OC-2 3'UTRs. Moreover, when overexpressed in cultured cells, miR-495 and miR-218 decrease the endogenous levels of HNF-6 and OC-2 mRNA. These results indicate that the expression of regulators of liver and pancreas development is modulated by microRNAs. They also suggest a developmental role for miR-495 and miR-218.

Association between A218C polymorphism of the tryptophan-hydroxylase-1 gene, harm avoidance and binge eating behavior in bulimia nervosa.

Science.gov (United States)

Monteleone, Palmiero; Tortorella, Alfonso; Martiadis, Vassilis; Serino, Ismene; Di Filippo, Carmela; Maj, Mario

2007-06-21

Genes involved in serotonin transmission are likely involved in the biological predisposition to bulimia nervosa. We investigated whether the A218C polymorphism of the tryptophan-hydroxylase-1 gene was associated to bulimia nervosa and/or to some phenotypic aspects of the disorder. One hundred eighty Caucasian women (91 patients with bulimia nervosa and 89 healthy controls) were enrolled into the study. They underwent a blood sample collection for A218C polymorphism of the tryptophan-hydroxylase-1 genotyping and a clinical evaluation assessing comorbidity for Axis I and II psychiatric disorders, harm avoidance personality dimension and bulimic symptoms. The distribution of both tryptophan-hydroxylase-1 A218C genotypes and alleles did not significantly differ between patients and controls. Bulimic women with the AA genotype exhibited a more severe binge eating behavior and higher harm avoidance scores than those with CC genotype. These findings support the idea that tryptophan-hydroxylase-1 A218C polymorphism does not play a part in the genetic susceptibility to bulimia nervosa, but it seems to be involved in predisposing bulimic patients to a more disturbed eating behavior and higher harm avoidance.

MiR-218-targeting-Bmi-1 mediates the suppressive effect of 1,6,7-trihydroxyxanthone on liver cancer cells.

Science.gov (United States)

Fu, Wei-Ming; Tang, Li-Peng; Zhu, Xiao; Lu, Ying-Fei; Zhang, Yan-Ling; Lee, Wayne Yuk-Wai; Wang, Hua; Yu, Yang; Liang, Wei-Cheng; Ko, Chun-Hay; Xu, Hong-Xi; Kung, Hsiang-Fu; Zhang, Jin-Fang

2015-01-01

Traditional Chinese medicine is recently emerged as anti-cancer therapy or adjuvant with reduced side-effects and improved quality of life. In the present study, an active ingredient, 1,6,7-trihydroxyxanthone (THA), derived from Goodyera oblongifolia was found to strongly suppress cell growth and induce apoptosis in liver cancer cells. MicroRNAs are a group of small non-coding RNAs that regulate gene expression at post-transcriptional levels. Our results demonstrated that miR-218 was up-regulated and oncogene Bmi-1 was down-regulated by THA treatment. Further investigation showed that THA-induced-miR-218 up-regulation could lead to activation of tumor suppressor P16(Ink4a) and P14(ARF), the main down-stream targets of Bmi-1. In conclusion, THA might be a potential anti-cancer drug candidate, at least in part, through the activation of miR-218 and suppression of Bmi-1 expression.

Heparin sodium compliance to USP monograph: structural elucidation of an atypical 2.18 ppm NMR signal.

Science.gov (United States)

Mourier, Pierre A J; Guichard, Olivier Y; Herman, Fréderic; Viskov, Christian

2012-01-01

The ¹H nuclear magnetic resonance (NMR) acceptance criteria in the new heparin US Pharmacopeia (USP) monograph do not take into account potential structural modifications responsible for any extra signals observed in ¹H NMR spectra, some purified heparins may be non-compliant under the proposed new USP guidelines and incorrectly classified as unsuitable for pharmaceutical use. Heparins from the "ES" source, containing an extra signal at 2.18 ppm, were depolymerized under controlled conditions using heparinases I, II, and III. The oligosaccharides responsible for the 2.18 ppm signal were enriched using orthogonal chromatographic techniques. After multiple purification steps, we obtained an oligosaccharide mixture containing a highly enriched octasaccharide bearing the structural modification responsible for the extra signal. Following heparinase I depolymerization, a pure tetrasaccharide containing the fingerprint structural modification was isolated for full structural determination. Using 1D and 2D ¹H NMR spectroscopy, the structural moiety responsible for the extra signal at 2.18 ppm was identified as an acetyl group on the heparin backbone, most likely resulting from a very minor manufacturing process side reaction that esterifies the uronic acid at position 3. Such analytical peculiarity has always been present in this heparin source and it was used safety over the years. Copyright © 2012 Elsevier B.V. All rights reserved.

Characterization of the K2-18 multi-planetary system with HARPS. A habitable zone super-Earth and discovery of a second, warm super-Earth on a non-coplanar orbit

Science.gov (United States)

Cloutier, R.; Astudillo-Defru, N.; Doyon, R.; Bonfils, X.; Almenara, J.-M.; Benneke, B.; Bouchy, F.; Delfosse, X.; Ehrenreich, D.; Forveille, T.; Lovis, C.; Mayor, M.; Menou, K.; Murgas, F.; Pepe, F.; Rowe, J.; Santos, N. C.; Udry, S.; Wünsche, A.

2017-12-01

Aims: The bright M2.5 dwarf K2-18 (Ms = 0.36 M⊙, Rs = 0.41 R⊙) at 34 pc is known to host a transiting super-Earth-sized planet orbiting within the star's habitable zone; K2-18b. Given the superlative nature of this system for studying an exoplanetary atmosphere receiving similar levels of insolation as the Earth, we aim to characterize the planet's mass which is required to interpret atmospheric properties and infer the planet's bulk composition. Methods: We have obtained precision radial velocity measurements with the HARPS spectrograph. We then coupled those measurements with the K2 photometry to jointly model the observed radial velocity variation with planetary signals and a correlated stellar activity model based on Gaussian process regression. Results: We measured the mass of K2-18b to be 8.0 ± 1.9M⊕ with a bulk density of 3.3 ± 1.2 g/cm3 which may correspond to a predominantly rocky planet with a significant gaseous envelope or an ocean planet with a water mass fraction ≳50%. We also find strong evidence for a second, warm super-Earth K2-18c (mp,csinic = 7.5 ± 1.3 M⊕) at approximately nine days with a semi-major axis 2.4 times smaller than the transiting K2-18b. After re-analyzing the available light curves of K2-18 we conclude that K2-18c is not detected in transit and therefore likely has an orbit that is non-coplanar with the orbit of K2-18b although only a small mutual inclination is required for K2-18c to miss a transiting configuration; | Δi| 1-2°. A suite of dynamical integrations are performed to numerically confirm the system's dynamical stability. By varying the simulated orbital eccentricities of the two planets, dynamical stability constraints are used as an additional prior on each planet's eccentricity posterior from which we constrain eb multi-planet systems around M dwarfs. The characterization of the density of K2-18b reveals that the planet likely has a thick gaseous envelope which, along with its proximity to the solar

1D Co2.18Ni0.82Si2O5(OH)4 architectures assembled by ultrathin nanoflakes for high-performance flexible solid-state asymmetric supercapacitors

Science.gov (United States)

Zhao, Junhong; Zheng, Mingbo; Run, Zhen; Xia, Jing; Sun, Mengjun; Pang, Huan

2015-07-01

1D Co2.18Ni0.82Si2O5(OH)4 architectures assembled by ultrathin nanoflakes are synthesized for the first time by a hydrothermal method. We present a self-reacting template method to synthesize 1D Co2.18Ni0.82Si2O5(OH)4 architectures using Ni(SO4)0.3(OH)1.4 nanobelts. A high-performance flexible asymmetric solid-state supercapacitor can be successfully fabricated based on the 1D Co2.18Ni0.82Si2O5(OH)4 architectures and graphene nanosheets. Interestingly, the as-assembled 1D Co2.18Ni0.82Si2O5(OH)4 architectures//Graphene nanosheets asymmetric solid-state supercapacitor can achieve a maximum energy density of 0.496 mWh cm-3, which is higher than most of reported solid state supercapacitors. Additionally, the device shows high cycle stability for 10,000 cycles. These features make the 1D Co2.18Ni0.82Si2O5(OH)4 architectures as one of the most promising candidates for high-performance energy storage devices.

Electronic Structures of Reduced and Superreduced Ir2(1,8-diisocyanomenthane)4 n+ Complexes

Czech Academy of Sciences Publication Activity Database

Záliš, Stanislav; Hunter, B. M.; Gray, H. B.; Vlček, Antonín

2017-01-01

Roč. 56, č. 5 (2017), s. 2874-2883 ISSN 0020-1669 R&D Projects: GA MŠk LD14129 Grant - others:COST(XE) CM1405; COST(XE) CM1202 Institutional support: RVO:61388955 Keywords : electronic structure * electrochemistry * Ir2(1,8-diisocyanomenthane)4 n+ Complexes Subject RIV: CG - Electrochemistry OBOR OECD: Physical chemistry Impact factor: 4.857, year: 2016

The atmospheric chemistry of Po-218: Technical report for the period March 1, 1987 to August 31, 1987

International Nuclear Information System (INIS)

Hopke, P.K.

1987-01-01

The chemical and physical properties of 218 Po immediately following its formation from 222 Rn decay are important in determining its behavior in indoor atmospheres and plays a major part in determining its potential health effects. In 88% of the decays, a singly charged, positive ion of 218 Po is obtained at the end of its recoil path. The modes of neutralization, small ion recombination, electron transfer, and electron scavenging are reviewed. In typical indoor air, the ion will be rapidly neutralized by transfer of electrons from lower ionization potential gases such as NO 2 . The neutral molecule can then become incorporated in ultrafine particles formed by the radiolytic processes in the recoil path. The evidence for these particles is presented

Myostatin inhibits osteoblastic differentiation by suppressing osteocyte-derived exosomal microRNA-218: A novel mechanism in muscle-bone communication.

Science.gov (United States)

Qin, Yiwen; Peng, Yuanzhen; Zhao, Wei; Pan, Jianping; Ksiezak-Reding, Hanna; Cardozo, Christopher; Wu, Yingjie; Divieti Pajevic, Paola; Bonewald, Lynda F; Bauman, William A; Qin, Weiping

2017-06-30

Muscle and bone are closely associated in both anatomy and function, but the mechanisms that coordinate their synergistic action remain poorly defined. Myostatin, a myokine secreted by muscles, has been shown to inhibit muscle growth, and the disruption of the myostatin gene has been reported to cause muscle hypertrophy and increase bone mass. Extracellular vesicle-exosomes that carry microRNA (miRNA), mRNA, and proteins are known to perform an important role in cell-cell communication. We hypothesized that myostatin may play a crucial role in muscle-bone interactions and may promote direct effects on osteocytes and on osteocyte-derived exosomal miRNAs, thereby indirectly influencing the function of other bone cells. We report herein that myostatin promotes expression of several bone regulators such as sclerostin (SOST), DKK1, and RANKL in cultured osteocytic (Ocy454) cells, concomitant with the suppression of miR-218 in both parent Ocy454 cells and derived exosomes. Exosomes produced by Ocy454 cells that had been pretreated with myostatin could be taken up by osteoblastic MC3T3 cells, resulting in a marked reduction of Runx2, a key regulator of osteoblastic differentiation, and in decreased osteoblastic differentiation via the down-regulation of the Wnt signaling pathway. Importantly, the inhibitory effect of myostatin-modified osteocytic exosomes on osteoblast differentiation is completely reversed by expression of exogenous miR-218, through a mechanism involving miR-218-mediated inhibition of SOST. Together, our findings indicate that myostatin directly influences osteocyte function and thereby inhibits osteoblastic differentiation, at least in part, through the suppression of osteocyte-derived exosomal miR-218, suggesting a novel mechanism in muscle-bone communication. © 2017 by The American Society for Biochemistry and Molecular Biology, Inc.

A mobility spectrometer for measurement of initial properties of 218Po

International Nuclear Information System (INIS)

Strydom, R.; Leuschner, A.H.; Stoker, P.H.

1990-01-01

This paper describes the development of a mobility spectrometer with adequate resolution to study the clustering processes (in ion-induced nucleation) that may occur. The first results of measurements of pure water clustering around 218 Po ions using the spectrometer are presented. It is found that the radius of the ion increases with relative humidity. The results are compared with predictions of two representations of the clustering theory. The theory qualitatively explains the results obtained, but there are considerable differences between the experimental measurements and the theoretical predictions, as well as between the two representations of the theory. (author)

Production and identification of an isomeric state in 217Pa and the new isotope 218Pa

International Nuclear Information System (INIS)

Schmidt, K.H.; Faust, W.; Muenzenberg, G.; Ewald, H.; Guettner, K.; Clerc, H.G.; Lang, W.; Wohlfarth, H.; Pielenz, K.

1977-02-01

Evaporation residues produced in the reaction 40Ar(176 MeV) + 181Ta were separated from the primary beam by the velocity filter SHIP and detected by a ΔE-E counter telescope. The technique of delayed coincidences was applied to individually identify the reaction products implanted into a Si-surface barrier detector by their subsequent alpha decays. The previously unknown nucleus 218Pa was identified by its known daughter decays. 218Pa was found to decay with Esub(α) = (9.614 +- 0.015) MeV, T(1/2) = (140 +- 50) μs and probably also with Esub(α) = (9.535 +- 0.020) MeV, T(1/2) = (150 + 100 - 50) μs. The half-life of the 8.33 MeV alpha decay of 217Pa was determined to be (o.2 +- 0.4) ms. Anew isomer in 217 Pa was found which decays with Esub(α) = (10.16 +- 0.02) MeV and T(1/2) = (1.8 +- 0.5) ms. (orig./BJ) [de

Cortical synaptic transmission in CaV2.1 knockin mice with the S218L missense mutation which causes a severe familial hemiplegic migraine syndrome in humans.

Directory of Open Access Journals (Sweden)

Dania eVecchia

2015-02-01

Full Text Available Familial hemiplegic migraine type 1 (FHM1 is caused by gain-of-function mutations in CaV2.1 (P/Q-type Ca2+ channels. Knockin (KI mice carrying the FHM1 R192Q missense mutation show enhanced cortical excitatory synaptic transmission at pyramidal cell synapses but unaltered cortical inhibitory neurotransmission at fast-spiking interneuron synapses. Enhanced cortical glutamate release was shown to cause the facilitation of cortical spreading depression (CSD in R192Q KI mice. It, however, remains unknown how other FHM1 mutations affect cortical synaptic transmission. Here, we studied neurotransmission in cortical neurons in microculture from KI mice carrying the S218L mutation, which causes a severe FHM syndrome in humans and an allele-dosage dependent facilitation of experimental CSD in KI mice, which is larger than that caused by the R192Q mutation. We show gain-of-function of excitatory neurotransmission, due to increased action-potential evoked Ca2+ influx and increased probability of glutamate release at pyramidal cell synapses, but unaltered inhibitory neurotransmission at multipolar interneuron synapses in S218L KI mice. In contrast with the larger gain-of-function of neuronal CaV2.1 current in homozygous than heterozygous S218L KI mice, the gain-of-function of evoked glutamate release, the paired-pulse ratio and the Ca2+ dependence of the EPSC were all similar in homozygous and heterozygous S218L KI mice, suggesting compensatory changes in the homozygous mice. Furthermore, we reveal a unique feature of S218L KI cortical synapses which is the presence of a fraction of mutant CaV2.1 channels being open at resting potential. Our data suggest that, while the gain-of-function of evoked glutamate release may explain the facilitation of CSD in heterozygous S218L KI mice, the further facilitation of CSD in homozygous S218L KI mice is due to other CaV2.1-dependent mechanisms, that likely include Ca2+ influx at voltages sub-threshold for action

miR-218 is involved in the negative regulation of osteoclastogenesis and bone resorption by partial suppression of p38MAPK-c-Fos-NFATc1 signaling: Potential role for osteopenic diseases.

Science.gov (United States)

Qu, Bo; Xia, Xun; Yan, Ming; Gong, Kai; Deng, Shaolin; Huang, Gang; Ma, Zehui; Pan, Xianming

2015-10-15

The increased osteoclastic activity accounts for pathological bone loss in diseases including osteoporosis. MicroRNAs are widely accepted to be involved in the regulation of osteopenic diseases. Recently, the low expression of miR-218 was demonstrated in CD14(+) peripheral blood mononuclear cells (PBMCs) from patients with postmenopausal osteoporosis. However, its role and the underlying mechanism in osteoporosis are still undefined. Here, an obvious decrease in miR-218 expression was observed during osteoclastogenesis under receptor activator of nuclear factor κB ligand (RANKL) stimulation, in both osteoclast precursors of bone marrow macrophages (BMMs) and RAW 264.7. Further analysis confirmed that overexpression of miR-218 obviously attenuated the formation of multinuclear mature osteoclasts, concomitant with the decrease in Trap and Cathepsin K levels, both the master regulators of osteoclastogenesis. Moreover, miR-218 up-regulation dramatically inhibited osteoclast precursor migration, actin ring formation and bone resorption. Mechanism assay demonstrated that miR-218 overexpression attenuated the expression of p38MAPK, c-Fos and NFATc1 signaling molecules. Following preconditioning with P79350, an agonist of p38MAPK, the inhibitor effect of miR-218 on osteoclastogenesis and bone-resorbing activity was strikingly ameliorated. Together, this study revealed a crucial role of miR-218 as a negative regulator for osteoclastogenesis and bone resorption by suppressing the p38MAPK-c-Fos-NFATc1 pathway. Accordingly, this research will provide a promising therapeutic agent against osteopenic diseases including osteoporosis. Copyright © 2015 Elsevier Inc. All rights reserved.

Abnormal cortical synaptic transmission in CaV2.1 knockin mice with the S218L missense mutation which causes a severe familial hemiplegic migraine syndrome in humans

Science.gov (United States)

Vecchia, Dania; Tottene, Angelita; van den Maagdenberg, Arn M.J.M.; Pietrobon, Daniela

2015-01-01

Familial hemiplegic migraine type 1 (FHM1) is caused by gain-of-function mutations in CaV2.1 (P/Q-type) Ca2+ channels. Knockin (KI) mice carrying the FHM1 R192Q missense mutation show enhanced cortical excitatory synaptic transmission at pyramidal cell synapses but unaltered cortical inhibitory neurotransmission at fast-spiking interneuron synapses. Enhanced cortical glutamate release was shown to cause the facilitation of cortical spreading depression (CSD) in R192Q KI mice. It, however, remains unknown how other FHM1 mutations affect cortical synaptic transmission. Here, we studied neurotransmission in cortical neurons in microculture from KI mice carrying the S218L mutation, which causes a severe FHM syndrome in humans and an allele-dosage dependent facilitation of experimental CSD in KI mice, which is larger than that caused by the R192Q mutation. We show gain-of-function of excitatory neurotransmission, due to increased action-potential evoked Ca2+ influx and increased probability of glutamate release at pyramidal cell synapses, but unaltered inhibitory neurotransmission at multipolar interneuron synapses in S218L KI mice. In contrast with the larger gain-of-function of neuronal CaV2.1 current in homozygous than heterozygous S218L KI mice, the gain-of-function of evoked glutamate release, the paired-pulse ratio and the Ca2+ dependence of the excitatory postsynaptic current were similar in homozygous and heterozygous S218L KI mice, suggesting compensatory changes in the homozygous mice. Furthermore, we reveal a unique feature of S218L KI cortical synapses which is the presence of a fraction of mutant CaV2.1 channels being open at resting potential. Our data suggest that, while the gain-of-function of evoked glutamate release may explain the facilitation of CSD in heterozygous S218L KI mice, the further facilitation of CSD in homozygous S218L KI mice is due to other CaV2.1-dependent mechanisms, that likely include Ca2+ influx at voltages sub-threshold for action

Epigenetic silencing of miR-218 by the lncRNA CCAT1, acting via BMI1, promotes an altered cell cycle transition in the malignant transformation of HBE cells induced by cigarette smoke extract

International Nuclear Information System (INIS)

Lu, Lu; Xu, Hui; Luo, Fei; Liu, Xinlu; Lu, Xiaolin; Yang, Qianlei; Xue, Junchao; Chen, Chao; Shi, Le; Liu, Qizhan

2016-01-01

Cigarette smoking is the strongest risk factor for the development of lung cancer, the leading cause of cancer-related deaths. However, the molecular mechanisms leading to lung cancer are largely unknown. A long-noncoding RNA (lncRNA), CCAT1, regarded as cancer-associated, has been investigated extensively. Moreover, the molecular mechanisms of lncRNAs in regulation of microRNAs (miRNAs) induced by cigarette smoke remain unclear. In the present investigation, cigarette smoke extract (CSE) caused an altered cell cycle and increased CCAT1 levels and decreased miR-218 levels in human bronchial epithelial (HBE) cells. Depletion of CCAT1 attenuated the CSE-induced decreases of miR-218 levels, suggesting that miR-218 is negatively regulated by CCAT1 in HBE cells exposed to CSE. The CSE-induced increases of BMI1 levels and blocked by CCAT1 siRNA were attenuated by an miR-218 inhibitor. Moreover, in CSE-transformed HBE cells, the CSE-induced cell cycle changes and elevated neoplastic capacity were reversed by CCAT1 siRNA or BMI1 siRNA. This epigenetic silencing of miR-218 by CCAT1 induces an altered cell cycle transition through BMI1 and provides a new mechanism for CSE-induced lung carcinogenesis. - Highlights: • CSE exposure induces increases of CCAT1 levels and decreases of miR-218 levels. • CCAT1 negatively regulates miR-218 expression. • CCAT1, regulated by miR-218, via BMI1, is involved in the CSE-induced altered cell cycle transition.

Epigenetic silencing of miR-218 by the lncRNA CCAT1, acting via BMI1, promotes an altered cell cycle transition in the malignant transformation of HBE cells induced by cigarette smoke extract

Energy Technology Data Exchange (ETDEWEB)

Lu, Lu; Xu, Hui; Luo, Fei; Liu, Xinlu; Lu, Xiaolin; Yang, Qianlei; Xue, Junchao; Chen, Chao; Shi, Le; Liu, Qizhan, E-mail: drqzliu@hotmail.com

2016-08-01

Cigarette smoking is the strongest risk factor for the development of lung cancer, the leading cause of cancer-related deaths. However, the molecular mechanisms leading to lung cancer are largely unknown. A long-noncoding RNA (lncRNA), CCAT1, regarded as cancer-associated, has been investigated extensively. Moreover, the molecular mechanisms of lncRNAs in regulation of microRNAs (miRNAs) induced by cigarette smoke remain unclear. In the present investigation, cigarette smoke extract (CSE) caused an altered cell cycle and increased CCAT1 levels and decreased miR-218 levels in human bronchial epithelial (HBE) cells. Depletion of CCAT1 attenuated the CSE-induced decreases of miR-218 levels, suggesting that miR-218 is negatively regulated by CCAT1 in HBE cells exposed to CSE. The CSE-induced increases of BMI1 levels and blocked by CCAT1 siRNA were attenuated by an miR-218 inhibitor. Moreover, in CSE-transformed HBE cells, the CSE-induced cell cycle changes and elevated neoplastic capacity were reversed by CCAT1 siRNA or BMI1 siRNA. This epigenetic silencing of miR-218 by CCAT1 induces an altered cell cycle transition through BMI1 and provides a new mechanism for CSE-induced lung carcinogenesis. - Highlights: • CSE exposure induces increases of CCAT1 levels and decreases of miR-218 levels. • CCAT1 negatively regulates miR-218 expression. • CCAT1, regulated by miR-218, via BMI1, is involved in the CSE-induced altered cell cycle transition.

Heterogeneous Seeding of a Prion Structure by a Generic Amyloid Form of the Fungal Prion-forming Domain HET-s(218-289)

Energy Technology Data Exchange (ETDEWEB)

Wan, William; Bian, Wen; McDonald, Michele; Kijac, Aleksandra; Wemmer, David E.; Stubbs, Gerald [UCB; (Vanderbilt); (LBNL)

2013-11-13

The fungal prion-forming domain HET-s(218–289) forms infectious amyloid fibrils at physiological pH that were shown by solid-state NMR to be assemblies of a two-rung β-solenoid structure. Under acidic conditions, HET-s(218–289) has been shown to form amyloid fibrils that have very low infectivity in vivo, but structural information about these fibrils has been very limited. We show by x-ray fiber diffraction that the HET-s(218–289) fibrils formed under acidic conditions have a stacked β-sheet architecture commonly found in short amyloidogenic peptides and denatured protein aggregates. At physiological pH, stacked β-sheet fibrils nucleate the formation of the infectious β-solenoid prions in a process of heterogeneous seeding, but do so with kinetic profiles distinct from those of spontaneous or homogeneous (seeded with infectious β-solenoid fibrils) fibrillization. Several serial passages of stacked β-sheet-seeded solutions lead to fibrillization kinetics similar to homogeneously seeded solutions. Our results directly show that structural mutation can occur between substantially different amyloid architectures, lending credence to the suggestion that the processes of strain adaptation and crossing species barriers are facilitated by structural mutation.

Production process validation of 2-[18F]-fluoro-2-deoxy-D-glucose

International Nuclear Information System (INIS)

Cantero, Miguel; Iglesias, Rocio; Aguilar, Juan; Sau, Pablo; Tardio, Evaristo; Narrillos, Marcos

2003-01-01

The main of validation of production process of 2-[18F]-fluoro-2-deoxi-D-glucose (FDG) was to check: A) equipment's and services implicated in the production process were correctly installed, well documented, and worked properly, and B) production of FDG was done in a repetitive way according to predefined parameters. The main document was the Validation Master Plan, and steps were: installation qualification, operation qualification, process qualification and validation report. After finalization of all tests established in qualification steps without deviations, we concluded that the production process was validated because is done in a repetitive way according predefined parameters (Au)

Subsidence evaluation in 218-E-E12B, trench 38

International Nuclear Information System (INIS)

Streit, J.J.

1995-01-01

An area in Trench 38 of the 218-E-12B Burial Ground has been gradually sinking over the past few years. The area spans the width of the trench and extends approximately 80 feet down the trench. The depth of the depression is approximately 3 feet in the center and gradually rises to existing grade at the trench edge. It has been determined that the most likely cause of the subsidence is decomposition of buried waste material. Fifty-six percent of the waste buried in the subject area is decomposable and has been in the ground for nine years. Waste packaging is largely plastic lined dump trucks and fiberboard boxes. It is recommended that this area be treated with dynamic compaction to stabilize the waste and minimize the reoccurrence of subsidence in this area

Investigation of the origin of elements of the uranium-235 family noticed in excess around the EL4 experimental nuclear reactor during its dismantling. Site of the Monts d'Arree - Brennilis (29) power plant. Years 2007-2008. Report and appendices with results

International Nuclear Information System (INIS)

2009-02-01

The presence of actinium-227 has been noticed in the Mont d'Arree region (Finistere district) and such a presence in the environment had never been reported before. Thus, a study has been performed to investigate the origin of this element: about 300 samples have been analysed. After an indication of the investigation chronology, the report outlines that there is no relationship between the excess of actinium-227 and land amendment or embankments, that there is no obvious relationship between this presence and radioactive liquid effluents or atmospheric effluents from the Brennilis nuclear site. It shows that there is an obvious relationship with the radiological quality. It states that this excess of actinium 227 is related to the management of rain waters about the Brennilis site. An appendix specifies the location, nature and agenda of samplings (bio-indicators, samplings in sludge, soils, food and tap water, aquatic foams and sediments, ponds, wet lands, and at the vicinity of the power plant channel), presents detailed results obtained by gamma spectrometry, and measurement equipment and methods

12 CFR 218.760 - Exemption from definition of “broker” for banks accepting orders to effect transactions in...

Science.gov (United States)

2010-01-01

... 218.760 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM... services provided by the bank to the account; and (6) Investment advice and recommendations. The bank does not provide investment advice or research concerning securities to the account, make recommendations...

Production process validation of 2-[18F]-fluoro-2-deoxy-D-glucose

International Nuclear Information System (INIS)

Cantero, Miguel; Iglesias, Rocio; Aguilar, Juan; Sau, Pablo; Tardio, Evaristo; Narrillos, Marcos

2003-01-01

The aim of production process validation of 2-[18F]-fluoro-2-deoxi-D-glucose (FDG) was to check: A) equipments and services implicated in the production process were correctly installed, well documented, and worked properly, and B) production of FDG was done in a repetitive way according to predefined parameters. The main document was the Validation Master Plan, and steps were: installation qualification, operational qualification, performance qualification and validation final report. After finalization of all tests established in qualification steps without deviations, we concluded that the production process was validated because consistently produced FDG meeting its pre-determined specifications and quality characteristics (Au)

First observation of the beta decay of neutron-rich $^{218}Bi$ by the pulsed-release technique and resonant laser ionization

CERN Document Server

De Witte, H; Borzov, I N; Caurier, E; Cederkäll, J; De Smet, A; Eckhaudt, S; Fedorov, D V; Fedosseev, V; Franchoo, S; Górska, M; Grawe, H; Huber, G; Huyse, M; Janas, Z; Köster, U; Kurcewicz, W; Kurpeta, J; Plochocki, A; Van Duppen, P; Van de Vel, K; Weissman, L

2004-01-01

The neutron-rich isotope /sup 218/Bi has been produced in proton- induced spallation of a uranium carbide target at the ISOLDE facility at CERN, extracted from the ion source by the pulsed-release technique and resonant laser ionization, and its beta decay is studied for the first time. A half-life of 33(1)s was measured and is discussed in the self-consistent continuum-quasi particle-random- phase approximation framework that includes Gamow-Teller and first- forbidden transitions. A level scheme was constructed for /sup 218 /Po, and a deexcitation pattern of stretched E2 transitions 8/sup +/ to 6/sup +/ to 4/sup +/ to 2/sup +/ to 0/sup +/ to the ground state is suggested. Shell-model calculations based on the Kuo-Herling interaction reproduce the experimental results satisfactorily. (28 refs).

Positron Emission Tomography (PET) Experience with 2-[18F]Fluoro-3-(2(S)-azetidinylmethoxy)pyridine (2-[18F]FA) in the Living Human Brain of Smokers with Paranoid Schizophrenia

Science.gov (United States)

BRAŠIĆ, JAMES ROBERT; CASCELLA, NICOLA; KUMAR, ANIL; ZHOU, YUN; HILTON, JOHN; RAYMONT, VANESSA; CRABB, ANDREW; GUEVARA, MARIA RITA; HORTI, ANDREW G.; WONG, DEAN FOSTER

2012-01-01

Utilizing postmortem data (Breese, et al., 2000), we hypothesized that the densities of high-affinity neuronal α4β2 nicotinic acetylcholine receptors (nAChRs) in the brain exist in a continuum from highest to lowest as follows: smokers without schizophrenia > smokers with schizophrenia > nonsmokers without schizophrenia > nonsmokers with schizophrenia. Application of the Kruskal-Wallis Test (Stata, 2003) to the postmortem data (Breese, et al., 2000) confirmed the hypothesized order in the cortex and the hippocampus and attained significance in the caudate and the thalamus. Positron emission tomography (PET) was performed for 60 minutes at 6 hours after the intravenous administration of 444 megabequerels [MBq] (12 mCi) 2-[18F]fluoro-3-(2(S)-azetidinylmethoxy)pyridine (2-[18F]FA), a radiotracer for high-affinity neuronal α4β2 nAChRs, as a bolus plus continuous infusion to 10 adults (7 men and 3 women) (6 smokers including 5 with paranoid schizophrenia and 4 nonsmokers) ranging in age from 22 to 56 years (mean 40.1, standard deviation 13.6). The thalamic nondisplaceable binding potential (BPND) was 1.32 ± 0.19 (mean ± standard deviation) for healthy control nonsmokers; 0.50 ± 0.19 for smokers with paranoid schizophrenia; and 0.51 for the single smoker without paranoid schizophrenia. The thalamic BPNDs of nonsmokers were significantly higher than those of smokers who smoked cigarettes a few hours before the scans (P = 0.0105) (StataCorp, 2003), which was likely due to occupancy of nAChRs by inhaled nicotine in smokers. Further research is needed to rule out the effects of confounding variables. PMID:22169936

12 CFR 218.775 - Exemption from the definition of “broker” for banks effecting certain excepted or exempted...

Science.gov (United States)

2010-01-01

... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Exemption from the definition of âbrokerâ for banks effecting certain excepted or exempted transactions in investment company securities. 218.775... EXCEPTIONS FOR BANKS FROM THE DEFINITION OF BROKER IN THE SECURITIES EXCHANGE ACT OF 1934 (REGULATION R...

Review on transactinium isotope build-up and decay in reactor fuel and related sensitivities to cross section changes and results and main conclusions of the IAEA-Advisory Group Meeting on Transactinium Nuclear Data, held at Karlsruhe, November 1975

International Nuclear Information System (INIS)

Kuesters, H.; Lalovic, M.

1976-04-01

In this report a review is given on the actinium isotope build-up and decay in LWRs, LMFBRs and HTRs. The dependence of the corresponding physical aspects on reactor type, fuel cycle strategy, calculational methods and cross section uncertainties is discussed. Results from postirradiation analyses and from integral experiments in fast zero power assemblies are compared with theoretical predictions. Some sensitivity studies about the influence of actinium nuclear data uncertainties on the isotopic concentration, decay heat, and the radiation out-put in fuel and waste are presented. In a second part, the main results of the IAEA-Advisory Group Meeting on Transactinium Nuclear Data are summarized and discussed. (orig.) [de

Pertussis Toxin Exploits Host Cell Signaling Pathways Induced by Meningitis-Causing E. coli K1-RS218 and Enhances Adherence of Monocytic THP-1 Cells to Human Cerebral Endothelial Cells

Directory of Open Access Journals (Sweden)

Laura Julia Starost

2016-10-01

Full Text Available Pertussis toxin (PTx, the major virulence factor of the whooping cough-causing bacterial pathogen Bordetella pertussis, permeabilizes the blood–brain barrier (BBB in vitro and in vivo. Breaking barriers might promote translocation of meningitis-causing bacteria across the BBB, thereby facilitating infection. PTx activates several host cell signaling pathways exploited by the neonatal meningitis-causing Escherichia coli K1-RS218 for invasion and translocation across the BBB. Here, we investigated whether PTx and E. coli K1-RS218 exert similar effects on MAPK p38, NF-κB activation and transcription of downstream targets in human cerebral endothelial TY10 cells using qRT-PCR, Western blotting, and ELISA in combination with specific inhibitors. PTx and E. coli K1-RS218 activate MAPK p38, but only E. coli K1-RS218 activates the NF-κB pathway. mRNA and protein levels of p38 and NF-κB downstream targets including IL-6, IL-8, CxCL-1, CxCL-2 and ICAM-1 were increased. The p38 specific inhibitor SB203590 blocked PTx-enhanced activity, whereas E. coli K1-RS218’s effects were inhibited by the NF-κB inhibitor Bay 11-7082. Further, we found that PTx enhances the adherence of human monocytic THP-1 cells to human cerebral endothelial TY10 cells, thereby contributing to enhanced translocation. These modulations of host cell signaling pathways by PTx and meningitis-causing E. coli support their contributions to pathogen and monocytic THP-1 cells translocation across the BBB.

Panel 2.18: logistics, information technology (IT), and telecommunications in crisis management.

Science.gov (United States)

De Silva, Terrence; Chikersal, Jyotsna; Snoad, Nigel; Woodworth, Brent; Ghaly, Cherif; Catterall, Martin

2005-01-01

This is a summary of the presentations and discussion of Panel 2.18, Logistics, Information Technology, and Telecommunications in Crisis Management of the Conference, Health Aspects of the Tsunami Disaster in Asia, convened by the World Health Organization (WHO) in Phuket, Thailand, 04-06 May 2005. The topics discussed included issues related to logistics, information technology (IT), and crisis communication pertaining to the responses to the damage created by the Tsunami. It is presented in the following major sections: (1) issues; (2) lessons learned; (3) what was done well; (4) what could have been done better; and (5) conclusions and recommendations. Each major section is presented in four sub-sections: (1) needs assessments; (2) coordination; (3) filling the gaps; and (4) capacity building.

Discovery of a probable galaxy with a redshift of 3.218

International Nuclear Information System (INIS)

Djorgovski, S.; Spinard, H.; McCarthy, P.; Strauss, M.A.

1985-01-01

We report the discovery of a narrow emission line object, probably a galaxy, with a redshift of 3.218. The object is a companion to the quasar PKS 1614+051, which is at a redshift of 3.209. This is the most distant non--QSO, non--gravitationally lensed object presently known by a large margin. Its properties are consistent with those expected of a high-redshift galaxy. This object has an age of only a few percent of the present age of the universe. The object was discovered with a novel technique, which promises to push studies of distant galaxies to redshifts as high as those of the most distant quasars known, and which may eventually lead to the discovery of primeval galaxies. This discovery opens the way for studies of galaxies beyond z = 3, which should prove invaluable for observational cosmology

Mass flow rate correlation for two-phase flow of R218 through a capillary tube

Czech Academy of Sciences Publication Activity Database

Vinš, Václav; Vacek, V.

2009-01-01

Roč. 29, 14-15 (2009), s. 2816-2823 ISSN 1359-4311 Institutional research plan: CEZ:AV0Z20760514 Keywords : artificial neural network * capillary tube * mass flow rate correlation * R218 Subject RIV: BK - Fluid Dynamics Impact factor: 1.922, year: 2009 http://www.sciencedirect.com/science?_ob=PublicationURL&_cdi=5687&_pubType=J&_acct=C000034318&_version=1&_urlVersion=0&_userid=640952&md5=fc314a471a010545ee185394a6c8f5f7&jchunk=29#29

VizieR Online Data Catalog: ACT high significance 148 and 218GHz sources (Marsden+, 2014)

Science.gov (United States)

Marsden, D.; Gralla, M.; Marriage, T. A.; Switzer, E. R.; Partridge, B.; Massardi, M.; Morales, G.; Addison, G.; Bond, J. R.; Crichton, D.; Das, S.; Devlin, M.; Dunner, R.; Hajian, A.; Hilton, M.; Hincks, A.; Hughes, J. P.; Irwin, K.; Kosowsky, A.; Menanteau, F.; Moodley, K.; Niemack, M.; Page, L.; Reese, E. D.; Schmitt, B.; Sehgal, N.; Sievers, J.; Staggs, S.; Swetz, D.; Thornton, R.; Wollack, E.

2014-11-01

The ACT experiment (Swetz et al., 2011ApJS..194...41S) is situated on the slopes of Cerro Toco in the Atacama Desert of Chile at an elevation of 5190m. ACT's latitude gives access to both the northern and southern celestial hemispheres. Observations occurred simultaneously in three frequency bands, at 148GHz (2.0mm), 218GHz (1.4mm) and 277GHz (1.1mm) with angular resolutions of roughly 1.4 , 1.0 and 0.9-arcmin, respectively. (1 data file).

Malignant transformation of oral leukoplakia: a retrospective cohort study of 218 Chinese patients

International Nuclear Information System (INIS)

Liu, Wei; Wang, Yu-Feng; Zhou, Hai-Wei; Shi, Peng; Zhou, Zeng-Tong; Tang, Guo-Yao

2010-01-01

Oral leukoplakia (OL) is the best-known potentially malignant disorder. A new binary system to grade dysplasia was proposed by WHO, but the biological significance in predicting malignant transformation risk is unknown. The objective of this study is to estimate the rate of malignant transformation in a long-term follow-up cohort, explore the usefulness of the new binary system of grading dysplasia and identify significant risk factors of OL malignant transformation in China. A total of 218 patients with clinical and histopathologic diagnosis of OL were retrospectively reviewed. They were selected among all archived files at the Department of Oral Mucosal Diseases, Ninth People's Hospital, Shanghai Jiao Tong University School of Medicine. The mean follow-up period was 5.3 years. Among 218 cases, 39 (17.9%) OL patients developed oral cancer, with a mean duration of 5.2 years. Cox regression analysis revealed that dysplasia was an independent risk factor for OL malignant transformation, but age, gender, lesion site, diet habit, smoking and ethanol intake were not risk factors. High-risk dysplastic OL was associated with a 4.57-fold (95% confidence interval, 2.36-8.84; P < 0.001) increased risk of malignant transformation, compared with low-risk dysplasia. Consistent with this result, high-risk dysplastic OL had signicantly higher malignant incidence than low-risk dysplasia, particularly during the first 2-3 years of follow-up, by Kaplan-Meier analysis (Log-rank test, P < 0.001). The new binary system's function in predicting OL malignant transformation risk was investigated in this survey. The utilization of high-risk dysplasia as a significant indicator for evaluating malignant transformation risk in patients with OL was suggested, which may be helpful to guide treatment selection in clinical practice

CRYSTAL-STRUCTURE OF DEOXYGENATED LIMULUS-POLYPHEMUS SUBUNIT-II HEMOCYANIN AT 2.18-ANGSTROM RESOLUTION - CLUES FOR A MECHANISM FOR ALLOSTERIC REGULATION

NARCIS (Netherlands)

HAZES, B; MAGNUS, KA; BONAVENTURA, C; BONAVENTURA, J; DAUTER, Z; KALK, KH; HOL, WGJ

The crystal structure of Limulus polyphemus subunit type II hemocyanin in the deoxygenated state has been determined to a resolution of 2.18 angstrom. Phase information for this first structure of a cheliceratan hemocyanin was obtained by molecular replacement using the crustacean hemocyanin

Bacillus velezensis RC 218 as a biocontrol agent to reduce Fusarium head blight and deoxynivalenol accumulation: Genome sequencing and secondary metabolite cluster profiles.

Science.gov (United States)

Palazzini, Juan M; Dunlap, Christopher A; Bowman, Michael J; Chulze, Sofía N

2016-11-01

Bacillus subtilis RC 218 was originally isolated from wheat anthers as a potential antagonist of Fusarium graminearum, the causal agent of Fusarium head blight (FHB). It was demonstrated to have antagonist activity against the plant pathogen under in vitro and greenhouse assays. The current study extends characterizing B. subtilis RC 218 with a field study and genome sequencing. The field study demonstrated that B. subtilis RC 218 could reduce disease severity and the associated mycotoxin (deoxynivalenol) accumulation, under field conditions. The genome sequencing allowed us to accurately determine the taxonomy of the strain using a phylogenomic approach, which places it in the Bacillus velezensis clade. In addition, the draft genome allowed us to use bioinformatics to mine the genome for potential metabolites. The genome mining allowed us to identify 9 active secondary metabolites conserved by all B. velezensis strains and one additional secondary metabolite, the lantibiotic ericin, which is unique to this strain. This study represents the first confirmed production of ericin by a B. velezensis strain. The genome also allowed us to do a comparative genomics with its closest relatives and compare the secondary metabolite production of the publically available B. velezensis genomes. The results showed that the diversity in secondary metabolites of strains in the B. velezensis clade is driven by strains making different antibacterials. Copyright © 2016 Elsevier GmbH. All rights reserved.

Low-Level Burial Grounds dangerous waste permit application: Request for exemption from lined trench requirements and from land disposal restrictions for residual liquid at 218-E-12B Burial Ground Trench 94

International Nuclear Information System (INIS)

1992-10-01

This document has been prepared and is being submitted to the respective agencies to satisfy three objectives of the US Department of Energy (DOE) Richland Field Office (DOE-RL) concerning Trench 94 of the 218-E-12B Burial Ground. The 218-E-12B Burial Ground is located in the 200 East Area of the Hanford Facility. Figure 1-1 shows the general location of the Hanford Site. The 218-E-12B Burial Ground is one of eight burial grounds included in the Low-Level Burial Grounds (LLBG), a treatment, storage and/or disposal (TSD) unit. Decommissioned, defueled naval submarine reactor compartments (SRCs) contain radioactivity caused by exposure of structural components to neutrons during normal operation of the submarines. After all the alternatives were evaluated in the US Department of the Navy 1984 environmental impact statement (EIS) (USN 1984), land burial of the SRCs was selected as the preferred disposal option. The SRCs currently are sent to Trench 94 of the 218-E-12B Burial Ground. In addition to radioactivity, the SRCs disposed in. The DOE-RL's three objectives in preparing and submitting this document are as follows. Request from Ecology an exemption from dangerous waste landfill liner and leachate collection and removal system (hereinafter referred to as liner/leachate system) requirements for Trench 94 of the 218-E-12B Burial Ground. Petition Ecology to exempt residual liquid in the SRCs from land disposal restrictions. Obtain EPA Region 10 review and comment on the request to Ecology for exemption from liner/leachate system requirements

miR-7 and miR-218 epigenetically control tumor suppressor genes RASSF1A and Claudin-6 by targeting HoxB3 in breast cancer

International Nuclear Information System (INIS)

Li, Qiaoyan; Zhu, Fufan; Chen, Puxiang

2012-01-01

Highlights: ► Both miR-7 and miR-218 down-regulates HoxB3 expression by targeting the 3′-UTR of HoxB3 mRNA. ► A reverse correlation between the levels of endogenous miR-7, miR218 and HoxB3 expression. ► Epigenetic changes involve in the reactivation of HoxB3. ► Both miRNAs inhibits the cell cycle and clone formation of breast cancer cells. -- Abstract: Many microRNAs have been implicated as key regulators of cellular growth and differentiation and have been found to dysregulate proliferation in human tumors, including breast cancer. Cancer-linked microRNAs also alter the epigenetic landscape by way of DNA methylation and post-translational modifications of histones. Aberrations in Hox gene expression are important for oncogene or tumor suppressor during abnormal development and malignancy. Although recent studies suggest that HoxB3 is critical in breast cancer, the putative role(s) of microRNAs impinging on HoxB3 is not yet fully understood. In this study, we found that the expression levels of miR-7 and miR-218 were strongly and reversely associated with HoxB3 expression. Stable overexpression of miR-7 and miR-218 was accompanied by reactivation of tumor suppressor genes including RASSF1A and Claudin-6 by means of epigenetic switches in DNA methylation and histone modification, giving rise to inhibition of the cell cycle and clone formation of breast cancer cells. The current study provides a novel link between overexpression of collinear Hox genes and multiple microRNAs in human breast malignancy.

31 CFR 585.218 - Trade in United Nations Protected Areas of Croatia and those areas of the Republic of Bosnia and...

Science.gov (United States)

2010-07-01

... HERZEGOVINA SANCTIONS REGULATIONS Prohibitions § 585.218 Trade in United Nations Protected Areas of Croatia... importation from, exportation to, or transshipment of goods through the United Nations Protected Areas in the... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Trade in United Nations Protected...

Measurement of initial clustering on the radon decay product 218Po

International Nuclear Information System (INIS)

Strydom, R.

1989-01-01

The formation of water clusters on 218 Po ions is studied. The formation of the water clusters is discussed in the light of the classical theory of clustering, the clustering theory of Hawrynski and a kinetic model of clustering. The design of a specialized electric mobility spectrometer to measure the electric mobilities of the water clusters at various humidity levels is discussed. From the mobilities the radii of, and a number of water molecules in, the clusters are calculated using kinetic gas theory. The determinations were done for humidity levels between 0,16 and 96% relative humidity, and the results compared with the theoretical predictions. It was found that the classical theory underestimates the sizes of the clusters and the theory of Hawrynski overestimates the cluster sizes. It is concluded that the spectrometer is capable of high resolution measurement of the electric mobility of the small clusters. The underlying result of the clustering theories is that stable clusters with particular radii are formed at each humidity level. 91 refs., 70 figs., 11 tabs

Geophysical investigation of trench 4, Burial Ground 218-W-4C, 200 west area

International Nuclear Information System (INIS)

Kiesler, J.P.

1994-01-01

This report contains the results of a geophysical investigation conducted to characterize Trench 4, located in Burial Ground 218-W-4C, 200 West Area. Trench 4 is where transuranic (TRU) waste is stored. The primary objective of these geophysical investigations was to determine the outer edges of the trench/modules and select locations for plate-bearing tests. The test locations are to be 5 to 8 ft. beyond the edges of the trench. Secondary objectives include differentiating between the different types of waste containers within a given trench, determining the amount of soil cover over the waste containers, and to locate the module boundaries. Ground-penetrating radar (GPR) and electromagnetic induction (EMI) were the methods selected for this investigation

Behaviour of uranium series radionuclides in surface water (Crouzille, Limousin). Geochemical implications

International Nuclear Information System (INIS)

Moulin, J.

2008-06-01

Understanding natural radionuclides behaviour in surface water is a required step to achieve uranium mine rehabilitation and preserve water quality. The first objective of this thesis is to determine which are the radionuclides sources in a drinking water reservoir. The second objective is to improve the knowledge about the behaviour of uranium series radionuclides, especially actinium. The investigated site is a brook (Sagnes, Limousin, France) which floods a peat bog contaminated by a former uranium mine and which empties into the Crouzille lake. It allows studying radionuclides transport in surface water and radionuclides retention through organic substance or water reservoir. Radionuclides distribution in particulate, colloidal and dissolved phases is determined thanks to ultra-filtrations. Gamma spectrometry allows measuring almost all natural radionuclides with only two counting stages. However, low activities of 235 U series radionuclides impose the use of very low background well-type Ge detectors, such as those of the Underground Laboratory of Modane (France). Firstly, this study shows that no or few radionuclides are released by the Sagnes peat bog, although its radioactivity is important. Secondly, it provides details on the behaviour of uranium series radionuclides in surface water. More specifically, it provides the first indications of actinium solubility in surface water. Actinium's behaviour is very close to uranium's even if it is a little less soluble. (author)

Study of the origin of elements of the uranium-235 family observed in excess in the vicinity of the experimental nuclear EL4 reactor under dismantling. Lessons got at this day and conclusions

International Nuclear Information System (INIS)

2007-01-01

This study resumes the discovery of an excess of actinium 227 found around by EL4 nuclear reactor actually in dismantling. The search for the origin of this excess revealed a real inquiry of investigation during three years. Because a nuclear reactor existed in this area a particular attention will have concerned this region. The doubt became the line of conduct to find the answer to the human or natural origin of this excess. Finally and against any evidence, it appears that the origin of this phenomenon was natural, consequence of the particular local geology. The detail of the different investigations is given: search of a possible correlation with the composition of elevations constituent of lanes, search (and underlining) of new sites in the surroundings of the Rusquec pond and the Plouenez station, study of the atmospheric deposits under winds of the nuclear power plant and in the east direction, search of a possible relationship with the gaseous effluents of the nuclear power plant in the past, historical study of radioactive effluents releases in the fifty last years by the analysis of the sedimentary deposits in the Saint-Herbiot reservoir, search of a possible correlation between the excess of actinium 227 and the nuclear power plant activity; search of a possible correlation with a human activity without any relationship with the nuclear activities, search of a correlation with the underground waters, search of a correlation with the geological context, collect of information on the possible transfers in direction of the food chain, determination of the radiological composition of the underground waters ( not perturbed by human activity), search of the cause of an excess of actinium 227 in the old channel of liquid effluents release of the nuclear power plant. The results are given and discussed. And contrary to all expectations the origin of the excess of actinium 227 is completely natural. (N.C.)

Study of the origin of elements of the uranium-235 family observed in excess in the vicinity of the experimental nuclear EL4 reactor under dismantling. Lessons got at this day and conclusions; Etude de l'origine des elements de la famille de l'uranium-235 observes en exces dans les environs du reacteur nucleaire experimental EL4 en cours de demantelement. Enseignements retires a ce jour et conclusion

Energy Technology Data Exchange (ETDEWEB)

NONE

2007-07-01

This study resumes the discovery of an excess of actinium 227 found around by EL4 nuclear reactor actually in dismantling. The search for the origin of this excess revealed a real inquiry of investigation during three years. Because a nuclear reactor existed in this area a particular attention will have concerned this region. The doubt became the line of conduct to find the answer to the human or natural origin of this excess. Finally and against any evidence, it appears that the origin of this phenomenon was natural, consequence of the particular local geology. The detail of the different investigations is given: search of a possible correlation with the composition of elevations constituent of lanes, search (and underlining) of new sites in the surroundings of the Rusquec pond and the Plouenez station, study of the atmospheric deposits under winds of the nuclear power plant and in the east direction, search of a possible relationship with the gaseous effluents of the nuclear power plant in the past, historical study of radioactive effluents releases in the fifty last years by the analysis of the sedimentary deposits in the Saint-Herbiot reservoir, search of a possible correlation between the excess of actinium 227 and the nuclear power plant activity; search of a possible correlation with a human activity without any relationship with the nuclear activities, search of a correlation with the underground waters, search of a correlation with the geological context, collect of information on the possible transfers in direction of the food chain, determination of the radiological composition of the underground waters ( not perturbed by human activity), search of the cause of an excess of actinium 227 in the old channel of liquid effluents release of the nuclear power plant. The results are given and discussed. And contrary to all expectations the origin of the excess of actinium 227 is completely natural. (N.C.)

Sorption studies of radioelements on geological materials

International Nuclear Information System (INIS)

Berry, John A.; Yui, Mikazu; Kitamura, Akira

2007-11-01

Batch sorption experiments have been carried out to study the sorption of uranium, technetium, curium, neptunium, actinium, protactinium, polonium, americium and plutonium onto bentonite, granodiorite and tuff. Mathematical modelling using the HARPHRQ program and the HATCHES database was carried out to predict the speciation of uranium and technetium in the equilibrated seawater, and neptunium, americium and plutonium in the rock equilibrated water. Review of the literature for thermodynamic data for curium, actinium, protactinium and polonium was carried out. Where sufficient data were available, predictions of the speciation and solubility were made. This report is a summary report of the experimental work conducted by AEA Technology during April 1991-March 1998, and the main results have been presented at Material Research Society Symposium Proceedings and published as proceedings of them. (author)

Interactions of Neuropathogenic Escherichia coli K1 (RS218) and Its Derivatives Lacking Genomic Islands with Phagocytic Acanthamoeba castellanii and Nonphagocytic Brain Endothelial Cells

Science.gov (United States)

Yousuf, Farzana Abubakar; Yousuf, Zuhair; Iqbal, Junaid; Siddiqui, Ruqaiyyah; Khan, Hafsa; Khan, Naveed Ahmed

2014-01-01

Here we determined the role of various genomic islands in E. coli K1 interactions with phagocytic A. castellanii and nonphagocytic brain microvascular endothelial cells. The findings revealed that the genomic islands deletion mutants of RS218 related to toxins (peptide toxin, α-hemolysin), adhesins (P fimbriae, F17-like fimbriae, nonfimbrial adhesins, Hek, and hemagglutinin), protein secretion system (T1SS for hemolysin), invasins (IbeA, CNF1), metabolism (D-serine catabolism, dihydroxyacetone, glycerol, and glyoxylate metabolism) showed reduced interactions with both A. castellanii and brain microvascular endothelial cells. Interestingly, the deletion of RS218-derived genomic island 21 containing adhesins (P fimbriae, F17-like fimbriae, nonfimbrial adhesins, Hek, and hemagglutinin), protein secretion system (T1SS for hemolysin), invasins (CNF1), metabolism (D-serine catabolism) abolished E. coli K1-mediated HBMEC cytotoxicity in a CNF1-independent manner. Therefore, the characterization of these genomic islands should reveal mechanisms of evolutionary gain for E. coli K1 pathogenicity. PMID:24818136

Interactions of Neuropathogenic Escherichia coli K1 (RS218 and Its Derivatives Lacking Genomic Islands with Phagocytic Acanthamoeba castellanii and Nonphagocytic Brain Endothelial Cells

Directory of Open Access Journals (Sweden)

Farzana Abubakar Yousuf

2014-01-01

Full Text Available Here we determined the role of various genomic islands in E. coli K1 interactions with phagocytic A. castellanii and nonphagocytic brain microvascular endothelial cells. The findings revealed that the genomic islands deletion mutants of RS218 related to toxins (peptide toxin, α-hemolysin, adhesins (P fimbriae, F17-like fimbriae, nonfimbrial adhesins, Hek, and hemagglutinin, protein secretion system (T1SS for hemolysin, invasins (IbeA, CNF1, metabolism (D-serine catabolism, dihydroxyacetone, glycerol, and glyoxylate metabolism showed reduced interactions with both A. castellanii and brain microvascular endothelial cells. Interestingly, the deletion of RS218-derived genomic island 21 containing adhesins (P fimbriae, F17-like fimbriae, nonfimbrial adhesins, Hek, and hemagglutinin, protein secretion system (T1SS for hemolysin, invasins (CNF1, metabolism (D-serine catabolism abolished E. coli K1-mediated HBMEC cytotoxicity in a CNF1-independent manner. Therefore, the characterization of these genomic islands should reveal mechanisms of evolutionary gain for E. coli K1 pathogenicity.

High sensitivity cavity ring down spectroscopy of N_2O near 1.22 µm: (II) "1"4N_2"1"6O line intensity modeling and global fit of "1"4N_2"1"8O line positions

International Nuclear Information System (INIS)

Tashkun, S.A.; Perevalov, V.I.; Karlovets, E.V.; Kassi, S.; Campargue, A.

2016-01-01

In a recent work (Karlovets et al., 2016 [1]), we reported the measurement and rovibrational assignments of more than 3300 transitions belonging to 64 bands of five nitrous oxide isotopologues ("1"4N_2"1"6O, "1"4N"1"5N"1"6O, "1"5N"1"4N"1"6O, "1"4N_2"1"8O and "1"4N_2"1"7O) in the high sensitivity CRDS spectrum recorded in the 7915–8334 cm"−"1 spectral range. The assignments were performed by comparison with predictions of the effective Hamiltonian models developed for each isotopologue. In the present paper, the large amount of measurements from our previous work mentioned above and literature are gathered to refine the modeling of the nitrous oxide spectrum in two ways: (i) improvement of the intensity modeling for the principal isotopologue, "1"4N_2"1"6O, near 8000 cm"−"1 from a new fit of the relevant effective dipole moment parameters, (ii) global modeling of "1"4N_2"1"8O line positions from a new fit of the parameters of the global effective Hamiltonian using an exhaustive input dataset collected in the literature in the 12–8231 cm"−"1 region. The fitted set of 81 parameters allowed reproducing near 5800 measured line positions with an RMS deviation of 0.0016 cm"−"1. The dimensionless weighted standard deviation of the fit is 1.22. As an illustration of the improvement of the predictive capabilities of the obtained effective Hamiltonian, two new "1"4N_2"1"8O bands could be assigned in the CRDS spectrum in the 7915–8334 cm"−"1 spectral range. A line list at 296 K has been generated in the 0–10,700 cm"−"1 range for "1"4N_2"1"8O in natural abundance with a 10"−"3"0 cm/molecule intensity cutoff. - Highlights: • Line parameters of two new "1"4N_2"1"8O bands centered at 7966 cm"−"1 and at 8214 cm"−"1. • Refined sets of the "1"4N_2"1"6O effective dipole moment parameters for ΔP=13,14 series. • Global modeling of "1"4N_2"1"8O line positions and intensities in the 12–8231 cm"−"1 range. • 5800 observed of "1"4N_2"1"8O line positions

Measurement of the activity size distribution of the polonium-218 under laboratory conditions

International Nuclear Information System (INIS)

Yoon, Suk Chul; Ha, Chung Woo

1992-01-01

A number of investigators have reported the formation of the radiolytic ultrafine particles produced by the interaction of ionizing radiation with water vapor. Previous studies have suggested that a very high localized concentration of the OH radical produced by the radiolysis of water can react with trace gas like organic vapors and produce lower vapor pressure compounds that can then nucleate. In order to determine water vapor and trace gas dependence of the active, positive-charged, first radon daughter, an experiment was conducted using a radon chamber. The activity size distribution of the radon daughter in the range of 0.5 - 100 nm was measured using the stacked wire screens sampler. Measurements were taken for different relative humidity. The resultant activity size distributions were analyzed. The addition of water vapor to the radon carrier gases resulted in the formation of ultrafine particles by OH radicals formed radon radiolysis. It may be due to the neutralization of charged Po-218 ion with water vapor through the radiolysis

Continuous monitoring α-activity on aerosol filters by the pseudo-coincidence-technique. Explicitly taking into account the short lived Po-218 activity; Kontinuierliche Ueberwachung der α-Aktivitaet eines Aerosolfilters mit der Pseudokoinzidenzmesstechnik. Explizite Beruecksichtigung der kurzlebigen Po-218 Aktivitaetsbeitraaege

Energy Technology Data Exchange (ETDEWEB)

Kraut, W.; Schwarz, W. [Duale Hochschule Baden-Wuerttemberg (DHBW), Karlsruhe (Germany). Studiengang Sicherheitswesen; Kraut, B. [Berthold Technologies GmbH und Co.KG, Bad Wildbad (Germany)

2015-07-01

Pseudo-coincidence-technique is applied to continuous monitoring of α-activity on aerosolfilters by proportional counters. Filter activity can markedly increase or decrease by changing air conditions especially by the amount of short lived Po-218 activity. Conditions of constant proportions of activity concentrations for the short lived species for operating this technique are seldom fulfilled. The dynamic behavior of artificial (long lived) and natural (short lived) activity is mathematically modelled and the measured moving count rates are analyzed under this model by a multivariate regression analysis for activity concentrations of artificial resp. short lived activity. Results are compared to standard recommendations of DIN ISO 11929.

Novel one-pot one-step synthesis of 2'-[(18)F]fluoroflumazenil (FFMZ) for benzodiazepine receptor imaging.

Science.gov (United States)

Yoon, Young Hyun; Jeong, Jae Min; Kim, Hyung Woo; Hong, Sung Hyun; Lee, Yun-Sang; Kil, Hee Sup; Chi, Dae Yoon; Lee, Dong Soo; Chung, June-Key; Lee, Myung Chul

2003-07-01

We describe the synthesis of 2'-[(18)F]fluoroflumazenil (FFMZ), which differs from the typically used [(18)F]fluoroethylflumazenil (FEFMZ) for benzodiazepine receptor imaging. For one-pot one-step labeling, the precursors, 2'-tosyloxyflumazenil (TFMZ) and 2'-mesyloxyflumazenil (MFMZ), were synthesized in three steps. The precursors were successfully labeled with no-carrier-added (18)F-fluoride which was activated by repeated azeotropic distillation with Kryptofix 2.2.2./potassium carbonate in MeCN. An automated system for labeling and purification of [(18)F]FFMZ was developed. Labeling efficiency and radiochemical purity of [(18)F]FFMZ after synthesis by the automated system were 68% and 98%, respectively. Specific binding of [(18)F]FFMZ to central benzodiazepine receptor of rats was demonstrated by phosphoimaging.

Partially-deuterated samples of HET-s(218–289) fibrils: assignment and deuterium isotope effect

Energy Technology Data Exchange (ETDEWEB)

Smith, Albert A.; Ravotti, Francesco; Testori, Emilie; Cadalbert, Riccardo; Ernst, Matthias, E-mail: maer@ethz.ch [ETH Zürich, Physical Chemistry (Switzerland); Böckmann, Anja, E-mail: a.bockmann@ibcp.fr [Institut de Biologie et Chimie des Protéines, Bases Moléculaires et Structurales des Systèmes Infectieux, Labex Ecofect, UMR 5086 CNRS, Université de Lyon (France); Meier, Beat H., E-mail: beme@ethz.ch [ETH Zürich, Physical Chemistry (Switzerland)

2017-02-15

Fast magic-angle spinning and partial sample deuteration allows direct detection of {sup 1}H in solid-state NMR, yielding significant gains in mass sensitivity. In order to further analyze the spectra, {sup 1}H detection requires assignment of the {sup 1}H resonances. In this work, resonance assignments of backbone H{sup N} and Hα are presented for HET-s(218–289) fibrils, based on the existing assignment of Cα, Cβ, C’, and N resonances. The samples used are partially deuterated for higher spectral resolution, and the shifts in resonance frequencies of Cα and Cβ due to the deuterium isotope effect are investigated. It is shown that the deuterium isotope effect can be estimated and used for assigning resonances of deuterated samples in solid-state NMR, based on known resonances of the protonated protein.

On the origin of high spin states (J > Jsub(max) of IBA=10) and their enhanced E1 decay mode in 218Ra

International Nuclear Information System (INIS)

Gai, M.

1984-01-01

The high spin states of 218 Ra exhibit a band of alternating parity states with enhanced E1 decay mode (B(E1) >=10 -2 W.u.). Various theoretical models are discussed, such as the octupole model, f and g boson model, second order E1 operator in IBA1 model, and the cluster model. The enhanced E1 deexcitation favors the cluster model. The low spin negative parity states lie on a J(J+1) trajectory contrary to the assumed vibrational character of the negative parity states in 218 Ra. A change in the character of states above the 11 - state is observed via a change in the moment of inertia and a decrease in the B(E1)/B(E2) branch ratios. Two quasi-particle 11 - states systematically occurring in the Ra-isotopes may be responsible for this change. The well known effect of loss of collectivity arising from two quasi-particle states, as observed in the hindrance of B(E2), is suggested to more dramatically hinder the B(E1) and lead to a reduction in the branch ratio B(E1)/B(E2). This observation suggests that the E1 enhancement is of collective character

Formation and evolution of ultrafine particles produced by radiolysis and photolysis

International Nuclear Information System (INIS)

Madelaine, G.J.; Perrin, M.L.; Renoux, A.

1980-01-01

Results are presented, concerning the formation, the size distribution, and the behavior of ultrafine particles produced by alpha disintegration of actinium and uv irradiation in filtered and natural atmospheric air. The characterization of these particles is obtained by electrical aerosol analyzer and diffusion battery method. Measurements are made in the range between 0.003 and 0.5 micrometer. Some qualitative indications are obtained on the different mechanisms which govern the evolution of ultrafine particles in the atmosphere (nucleation, coagulation, and condensation). It is now well established that the photo-oxydation of SO 2 in the atmosphere leads to the production of sulphuric acid and of sulphate, which are usually found in the form of submicronic particles. This paper concerns the evolution of ultrafine particles generated in the presence of a preexisting aerosol. They are either instantaneously produced by the alpha disintegrations of actinium 219 or continuously produced by the transformation of SO 2 under uv irradiation

Actinide metals

Energy Technology Data Exchange (ETDEWEB)

Brown, Paul L. [Geochem Australia, Kiama, NSW (Australia); Ekberg, Christian [Chalmers Univ. of Technology, Goeteborg (Sweden). Nuclear Chemistry/Industrial Materials Recycling

2016-07-01

All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO{sub 2}OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH{sup 2+} for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.

Status of liquid metal reactor development in the United States of America

International Nuclear Information System (INIS)

Griffith, J.D.; Horton, K.E.

1991-01-01

An existing network of government and industry research facilities and engineering test centers in the United States is currently providing test capabilities and the technical expertise required to conduct an aggressive advanced reactor development program. Subsequent to the directive to shut down the Fast Flux Test Facility in early 1990, a variety of activities were undertaken to provide support for continued operation. The United States has made substantial progress in achieving ALMR program objectives. The metal fuel cycle is designed to recycle and burn its own actiniums, and has the potential to be a very effective burner of actiniums generated in the LWRs. The current emphasis in the IFR Program is on the comprehensive development of the IFR (Integral Fast Reactor) technology, to be followed by a period of technology demonstration which would verify the economic feasibility of the concept. The United States has been active in international cooperative activities in the fast reactor sector since 1969. (author). 11 figs, 1 tab

Actinide metals

International Nuclear Information System (INIS)

Brown, Paul L.; Ekberg, Christian

2016-01-01

All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO 2 OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH 2+ for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.

Environmental assessment for Trench 33 widening in 218-W-5 Low-Level Burial Ground, Hanford Site, Richland, Washington

International Nuclear Information System (INIS)

1997-07-01

This environmental assessment (EA) has been prepared to assess potential environmental impacts associated with the US Department of Energy''s proposed action: to widen and operated the unused Trench 33 in the 218-W-5 Low-Level Burial Ground. Information contained herein will be used by the US Department of Energy, Richland Operations Office Manager, to determine if the Proposed Action is a major federal action significantly affecting the quality of the human environment. If the Proposed Action is determined to be major and significant, an environmental impact statement will be prepared. If the Proposed Action is determined not to be major and significant, a Finding of No significant Impact will be issued and the action may proceed

Environmental assessment for Trench 33 widening in 218-W-5 Low-Level Burial Ground, Hanford Site, Richland, Washington

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-07-01

This environmental assessment (EA) has been prepared to assess potential environmental impacts associated with the US Department of Energy`s proposed action: to widen and operated the unused Trench 33 in the 218-W-5 Low-Level Burial Ground. Information contained herein will be used by the US Department of Energy, Richland Operations Office Manager, to determine if the Proposed Action is a major federal action significantly affecting the quality of the human environment. If the Proposed Action is determined to be major and significant, an environmental impact statement will be prepared. If the Proposed Action is determined not to be major and significant, a Finding of No significant Impact will be issued and the action may proceed.

Build up of radon, /sup 218/Po and /sup 214/Po in a Karlsruhe diffusion chamber as a function of time

International Nuclear Information System (INIS)

Fazal-ur-Rehman; Jamil, K.; Ali, S.; Khan, H.A.

1996-01-01

Passive radon /sup 222/Rn dosimeters employing particle detectors are widely used in concentration (p Ci/l) measurement in houses, mines and other areas of activity. These dosimeters yield track density which is needed to be converted into physically meaningful parameter of radon concentration in either p Ci/l or Bq m/sup -3/. Therefore, it is required to know the separate contributions of /sup 222/Rn and its progeny. In the present study we have measured the concentration of /sup 222/Rn and its daughters (/sup 218/Po and /sup 214/Po) separately in the Karlsruhe diffusion chamber radon dosimeter, with and without a filter, as a function of time by an active method using a surface barrier detector. The build up behavior of radon and its two daughters (/sup 218/Po and /sup 214/Po) as a function of time was studied by plotting the area under each peak versus collection time. The differential curves and the relative concentration of radon daughters as a function of time were also studied. The concentration of radon and its daughters shows a somewhat linear build up as a function of time for the presently studied time periods. The results of this experiment are expected to be useful in converting the integrated alpha track density as measured by a particle track detector, (used in passive radon dosimetry) to radon concentration levels and for determination of equilibrium factor. (author)

Whole-body distribution and dosimetry of O-(2-[18F]fluoroethyl)-L-tyrosine.

Science.gov (United States)

Pauleit, Dirk; Floeth, Frank; Herzog, Hans; Hamacher, Kurt; Tellmann, Lutz; Müller, Hans-W; Coenen, Heinz H; Langen, Karl-J

2003-04-01

The whole-body distribution of O-(2-[(18)F]fluoroethyl)- l-tyrosine (FET) was studied in seven patients with brain tumours by positron emission tomography (PET). Based on the IMEDOSE and MIRDOSE procedures, radiation absorbed doses were estimated from whole-body PET scans acquired approximately 70 and 200 min after i.v. injection of 400 MBq FET. After injection of FET, the peak of radioactivity in the blood was observed after 1.5 min, and a plateau of nearly constant radioactivity was reached at 20 min. The whole-body distribution of FET showed the highest activities in the urinary tract. All other organs exhibited only moderate FET uptake (SUV

Normal magnetic resonance appearances of the temporomandibular joints in children and young adults aged 2-18 years

International Nuclear Information System (INIS)

Angenete, Oskar W.; Augdal, Thomas A.; Jellestad, Stig; Rygg, Marite; Rosendahl, Karen

2018-01-01

Knowledge of normal appearances of the temporomandibular joint (TMJ) is paramount when assessing the joint for disease in juvenile idiopathic arthritis. Reliable features defining normal TMJs in children are limited. To establish reliable normal standards for the TMJ at magnetic resonance imaging (MRI). We included children and young adults aged 2-18 years undergoing a head MRI for reasons not believed to affect the TMJs. We assessed TMJ anatomy and contrast enhancement using a high-resolution 3-D T1-weighted sequence. We noted joint fluid and bone marrow oedema based on a T2-weighted sequence. Three experienced radiologists read all examinations twice in consensus and defined intraobserver consensus agreement. We evaluated the TMJs in 101 children and young adults (45 female), mean age 10.7 years (range 2-18 years). The intraobserver consensus agreement for the assessment of anterior condylar inclination in the sagittal/oblique plane was moderate to good (Cohen κ=0.7 for the right side). Cohen κ for intraobserver consensus agreement for condylar shape in the coronal plane on a 0-2 scale was 0.4 for the right and 0.6 for the left. Intraobserver agreement for measurement of joint space height and assessment of bone marrow oedema was poor. There was a statistically significant increase in anterior inclination by age in the sagittal plane on a 0-2 scale (P<0.0001). Eighty percent of the condyles showed a rounded shape in the coronal plane while 20% showed mild flattening. Thirty-five of 36 right TMJs showed contrast enhancement (mild enhancement in 32 joints, moderate in 3 joints). Subjective assessment of the anterior condylar inclination in the sagittal/oblique plane and condylar flattening in the coronal plane can be considered precise features for describing TMJ anatomy in healthy children. There is an increasing anterior inclination by age. Mild contrast enhancement of the TMJs should be considered a normal finding. (orig.)

Cooked oatmeal consumption is associated with better diet quality, better nutrient intakes, and reduced risk for central adiposity and obesity in children 2-18 years: NHANES 2001-2010.

Science.gov (United States)

O'Neil, Carol E; Nicklas, Theresa A; Fulgoni, Victor L; DiRienzo, Maureen A

2015-01-01

None of the studies of whole grains that have looked either at diet or weight/adiposity measures have focused exclusively on oatmeal. The objective of this study was to assess the association between oatmeal consumption and nutrient intake, diet quality, and weight/adiposity of children aged 2-18. A nationally representative sample of children aged 2-18 (N=14,690) participating in National Health and Nutrition Examination Survey 2001-2010 was used. Intake was determined from a single 24-h dietary recall. Diet quality was measured using the Healthy Eating Index-2010 (HEI-2010). Covariate-adjusted regression analyses, using appropriate sample weights, were used to determine differences between oatmeal consumers and non-consumers for demographics, nutrient intakes, diet quality, and weight/adiposity measures (pempty calories. Children consuming oatmeal were at lower risk for having central adiposity and being obese. Consumption of oatmeal by children was associated with better nutrient intake, diet quality, and reduced risk for central adiposity and obesity and should be encouraged as part of an overall healthful diet.

Estimating the Nucleotide Diversity in Ceratodon purpureus (Ditrichaceae from 218 Conserved Exon-Primed, Intron-Spanning Nuclear Loci

Directory of Open Access Journals (Sweden)

Stuart F. McDaniel

2013-04-01

Full Text Available Premise of the study: We developed and tested primers for 218 nuclear loci for studying population genetics, phylogeography, and genome evolution in bryophytes. Methods and Results: We aligned expressed sequence tags (ESTs from Ceratodon purpureus to the Physcomitrella patens genome sequence, and designed primers that are homologous to conserved exons but span introns in the P. patens genome. We tested these primers on four isolates from New York, USA; Otavalo, Ecuador; and two laboratory isolates from Austria (WT4 and GG1. The median genome-wide nucleotide diversity was 0.008 substitutions/site, but the range was large (0–0.14, illustrating the among-locus heterogeneity in the species. Conclusions: These loci provide a valuable resource for finely resolved, genome-wide population genetic and species-level phylogenetic analyses of C. purpureus and its relatives.

Study of the atmospheric chemistry of 218Po. Progress report, August 21, 1983-March 14, 1984

International Nuclear Information System (INIS)

Hopke, P.K.

1984-03-01

Studies have been completed that have demonstrated that there are two mechanisms for the neutralization of 218 Po + ions formed by the decay of 222 Rn. In the presence of oxygen, an oxide species is formed. It has been determined as part of the present work that this oxide species has an ionization potential in the range of 10.35 to 10.53 eV and that it can be neutralized by extracting electrons from lower ionization potential trace gases. It has also been found that a second mechanism is responsible for neutralization in the absence of oxygen. The behavior of NO 2 in the range of 50 ppB to 1 ppM in N 2 was explored. For NO 2 concentrations above 700 ppB, complete neutralization was observed. For lower concentrations, a concentration dependent degree of neutralization was observed. Studies are now being initiated to examine the kinetics of these neutralization processes. 27 references, 3 figures, 4 tables

DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS

Energy Technology Data Exchange (ETDEWEB)

P. Bernot

2005-07-13

The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this activity is to predict dissolved concentrations or solubility limits for elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) relevant to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are provided in the form of tabulated functions with pH and log fCO{sub 2} as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. Even though selection of an appropriate set of radionuclides documented in Radionuclide Screening (BSC 2002 [DIRS 160059]) includes actinium, transport of Ac is not modeled in the total system performance assessment for the license application (TSPA-LA) model because of its extremely short half-life. Actinium dose is calculated in the TSPA-LA by assuming secular equilibrium with {sup 231}Pa (Section 6.10); therefore, Ac is not analyzed in this report. The output data from this report are fundamental inputs for TSPA-LA used to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for the actinides discussed in this report. These models cover broad ranges of environmental conditions so they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or

DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS

International Nuclear Information System (INIS)

P. Bernot

2005-01-01

The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this activity is to predict dissolved concentrations or solubility limits for elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) relevant to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are provided in the form of tabulated functions with pH and log fCO 2 as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. Even though selection of an appropriate set of radionuclides documented in Radionuclide Screening (BSC 2002 [DIRS 160059]) includes actinium, transport of Ac is not modeled in the total system performance assessment for the license application (TSPA-LA) model because of its extremely short half-life. Actinium dose is calculated in the TSPA-LA by assuming secular equilibrium with 231 Pa (Section 6.10); therefore, Ac is not analyzed in this report. The output data from this report are fundamental inputs for TSPA-LA used to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for the actinides discussed in this report. These models cover broad ranges of environmental conditions so they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or otherwise

The CARMENES Search for Exoplanets around M Dwarfs: A Low-mass Planet in the Temperate Zone of the Nearby K2-18

Science.gov (United States)

Sarkis, Paula; Henning, Thomas; Kürster, Martin; Trifonov, Trifon; Zechmeister, Mathias; Tal-Or, Lev; Anglada-Escudé, Guillem; Hatzes, Artie P.; Lafarga, Marina; Dreizler, Stefan; Ribas, Ignasi; Caballero, José A.; Reiners, Ansgar; Mallonn, Matthias; Morales, Juan C.; Kaminski, Adrian; Aceituno, Jesús; Amado, Pedro J.; Béjar, Victor J. S.; Hagen, Hans-Jürgen; Jeffers, Sandra; Quirrenbach, Andreas; Launhardt, Ralf; Marvin, Christopher; Montes, David

2018-06-01

K2-18 is a nearby M2.5 dwarf, located at 34 pc and hosting a transiting planet that was first discovered by the K2 mission and later confirmed with Spitzer Space Telescope observations. With a radius of ∼2 R ⊕ and an orbital period of ∼33 days, the planet lies in the temperate zone of its host star and receives stellar irradiation similar to that of Earth. Here we perform radial velocity follow-up observations with the visual channel of CARMENES with the goal of determining the mass and density of the planet. We measure a planetary semi-amplitude of K b ∼ 3.5 {{m}} {{{s}}}-1 and a mass of M b ∼ 9 M ⊕, yielding a bulk density around {ρ }b∼ 4 {{g}} {cm}}-3. This indicates a low-mass planet with a composition consistent with a solid core and a volatile-rich envelope. A signal at 9 days was recently reported using radial velocity measurements taken with the HARPS spectrograph. This was interpreted as being due to a second planet. We see a weaker, time- and wavelength-dependent signal in the CARMENES data set and thus favor stellar activity for its origin. K2-18 b joins the growing group of low-mass planets detected in the temperate zone of M dwarfs. The brightness of the host star in the near-infrared makes the system a good target for detailed atmospheric studies with the James Webb Space Telescope.

Kinetics of radioisotope exchange between brine and rock in a geothermal system

International Nuclear Information System (INIS)

Hammond, D.E.; Zukin, J.G.; Teh-Lung Ku

1988-01-01

A wide range of isotopes in the /sup 238/U, /sup 235/U, and /sup 232/Th decay chains was measured in geothermal brines collected from two production zones at 1898 and 3220 m in the Salton Sea Scientific Drilling Project well. High concentrations of radium, radon, and lead isotopes are generated and maintained by the input of these isotopes from solid phases into brine by both recoil and leaching processes, by the high chloride content of the brine which complexes radium and lead, and by the apparent absence of suitable unoccupied adsorption sites. In contrast, uranium, thorium, actinium, bismuth, and polonium isotopes all have low concentrations due to their efficient sorption from brine to rock. Measurements of short-lived isotopes in these decay series yield insights regarding the mechanisms controlling radioisotope exchange, and they permit estimation of rates of brine-rock interaction. For example, the /sup 228/Ac//sup 228/Ra activity ratio of 0.2 in brines indicates that the mean residence time of actinium in solution before sorption onto solid surfaces is less than 2.5 hours

2-deoxy-2-(18F)fluoro-D-glucose positron emission tomography/computed tomography imaging in paediatric oncology

Institute of Scientific and Technical Information of China (English)

John; Freebody; Eva; A; Wegner; Monica; A; Rossleigh

2014-01-01

Positron emission tomography(PET) is a minimally in-vasive technique which has been well validated for the diagnosis, staging, monitoring of response to therapy, and disease surveillance of adult oncology patients. Tra-ditionally the value of PET and PET/computed tomogra-phy(CT) hybrid imaging has been less clearly defined for paediatric oncology. However recent evidence has emerged regarding the diagnostic utility of these mo-dalities, and they are becoming increasingly important tools in the evaluation and monitoring of children with known or suspected malignant disease. Important indi-cations for 2-deoxy-2-(18F)fluoro-D-glucose(FDG) PET in paediatric oncology include lymphoma, brain tumours, sarcoma, neuroblastoma, Langerhans cell histiocytosis, urogenital tumours and neurofibromatosis type Ⅰ. This article aims to review current evidence for the use of FDG PET and PET/CT in these indications. Attention will also be given to technical and logistical issues, the description of common imaging pitfalls, and dosimetric concerns as they relate to paediatric oncology.

A program for calculating load coefficient matrices utilizing the force summation method, L218 (LOADS). Volume 1: Engineering and usage

Science.gov (United States)

Miller, R. D.; Anderson, L. R.

1979-01-01

The LOADS program L218, a digital computer program that calculates dynamic load coefficient matrices utilizing the force summation method, is described. The load equations are derived for a flight vehicle in straight and level flight and excited by gusts and/or control motions. In addition, sensor equations are calculated for use with an active control system. The load coefficient matrices are calculated for the following types of loads: translational and rotational accelerations, velocities, and displacements; panel aerodynamic forces; net panel forces; shears and moments. Program usage and a brief description of the analysis used are presented. A description of the design and structure of the program to aid those who will maintain and/or modify the program in the future is included.

Neuromyelitis optica spectrum disorder: 2-deoxy-2-[18F]fluoro-D-glucose positron emission tomography findings--case report.

Science.gov (United States)

Oyama, Hirofumi; Miwa, Shigeru; Noda, Tomoyuki; Sobajima, Atsuhiro; Kito, Akira; Maki, Hideki; Hattori, Kenichi; Wada, Kentaro

2012-01-01

A 51-year-old female with a history of rheumatoid arthritis rapidly developed anterior neck pain and paresis in the left upper and lower extremities and right lower extremity, sensory disturbance in the left upper and lower extremities, and bladder and rectal disorder. Adduction of the left eye and abduction of the right eye were also disturbed. Spinal magnetic resonance imaging demonstrated severe edema in the C1-T5 levels, which then deteriorated rapidly over 3 days, and lesions enhanced with gadolinium in the C1-C3 and C5-T3 levels. 2-Deoxy-2-[18F]fluoro-D-glucose positron emission tomography study demonstrated the inflammatory sites as segmental enhanced accumulation in the C1-C3, C5-C6, and T1 levels. The serum anti-aquaporin 4 antibody level was positive and she was diagnosed with neuromyelitis optica spectrum disorder. Marked improvement in the neurological conditions, concomitant with reduced spinal cord edema, was obtained by steroid pulse therapy.

Dynamic 2-[18F]fluoro-2-deoxy-D-glucose positron emission tomography of liver tumours without blood sampling

DEFF Research Database (Denmark)

Keiding, S; Munk, O L; Schiøtt, K M

2000-01-01

Positron emission tomography (PET) using 2-[18F]fluoro-2-deoxy-D-glucose (FDG) is a useful diagnostic tool for the detection of tumours. Using dynamic FDG PET, net metabolic clearance of FDG, K, can be calculated by Gjedde-Patlak analysis of the time course of the radioactivity concentrations...... in tissue and arterial blood. We examined whether time-activity curves (TACs) based on arterial blood sampling could be replaced by TACs obtained from the descending aorta in dynamic PET scans of patients with liver tumours. The study was performed in two parts, using data from dynamic liver scans......, and 2.1-8.4:1 (mean, 4.6:1) based on blood sample TACs (P>0.3). We conclude that arterial blood sampling can be replaced by the present AORTA-VOI in the calculation of the net metabolic clearance of FDG in dynamic PET studies of liver tumours in human subjects. Udgivelsesdato: 2000-Apr...

Effect of Shot Peening on the Fatigue Strength of Automotive Tubular Stabilizer Bars DC 218

Directory of Open Access Journals (Sweden)

Wittek A.M.

2016-12-01

Full Text Available This paper concerns issues related to the development of designs of stabilizer bars for new motor vehicle models. It involves not only the designing of a stabilizer bar with the shape required by the manufacturer, but also the preparation of bending and heat treatment processes as well as the performance of strength and fatigue tests. In the prototype development phase, the simulations techniques (FEM may be used to assess the design. The article contains a detailed analysis of a stabilizer bar designated with the DC 218 VA symbol. Performed numerical strength and fatigue calculations showed that the developed stabilizer bar design with the desired shape did not achieve the required number of fatigue cycles. It was also proven at the test stand by testing a prototype stabilizer bar. Therefore, it was suggested to supplement the technological process with an additional shot peening operation whose main aim was to reduce the length of microcracks on the stabilizer bar’s surface. This effect was confirmed during comparative metallographic tests of not shot – peened and shot – peened stabilizer bars. After shot peening, the analysed stabilizer bar reached a fatigue strength which exceeded the limits set by the manufacturer.

Documentation associated with the shipping of Hot-Cell Waste from WESF 225-B to the 200W (218-W-3AE) burial grounds under shipment number RSR-37338

International Nuclear Information System (INIS)

PAWLAK, M.W.

1998-01-01

The purpose of this report is to compile the records generated during the Packaging and Shipping of WESF Hot-Cell Waste from the 225-B Facility to 200W (218-W-3AE) burial grounds. A total of six 55-gallon drums were packaged and shipped using the Chem-Nuc Cask in accordance with WHC-SD-TP-SARP-025, Rev.0 ''Safety Analysis Report for Packaging (Onsite) for Type B Material in the CNS-14-215H Cask''

LASL experience in decontamination of the environment

International Nuclear Information System (INIS)

Ahlquist, A.J.

1981-01-01

This discussion represents one part of a major effort in soil decontamination at the Los Alamos site. A contaminated industrial waste line in the Los Alamos townsite was removed, and a plutonium incineration facility, and a filter building contaminated with actinium-227 were dismantled. The former plutonium handling facility has been decontaminated, and canyons and an old firing site contaminated with strontium-90 have been surveyed

Determination of radionuclides in discharged water from gold ...

African Journals Online (AJOL)

Long-lived radionuclides from the Uranium-, Thorium- and Actinium-decay chains in the discharged water into the environment were radiochemically separated and the activity concentrations determined for 238U-series ranged from 3.8 ± 1.5 to 178 ± 19 mBqL-1, 232Th-series ranged from < 2.0 to 47.8 ± 7.3 mBqL-1 and ...

Estimation of the release and migration of nickel through soils and groundwater at the Hanford Site 218-E-12B Burial Ground

International Nuclear Information System (INIS)

Rhoads, K.; Bjornstad, B.N.; Lewis, R.E.

1994-05-01

An assessment was performed to evaluate release and transport of nickel from large metal components containing nickel-bearing alloys at the Hanford Site 218-E-12B Burial Ground. The potential for nickel within the components to enter groundwater under the burial site was investigated by examining available data on the site's geology, geochemistry, and geohydrology to develop a conceptual model for release and transport of nickel from the components. In addition, laboratory studies were performed to provide information needed for the model, but which was not available from existing databases. Estimates of future concentrations of nickel radioisotopes ( 59 Ni and 63 Ni) and total elemental nickel in the unconfined aquifer and in the Columbia River were developed based on this information

Electromagnetic characteristics of manganese oxide-coated Fe3O4 nanoparticles at 2-18 GHz

Science.gov (United States)

Yang, R. B.; Liang, W. F.; Lin, C. K.

2011-04-01

The dielectric and magnetic properties of manganese oxide-coated Fe3O4 nanoparticles (NPs) were measured by the transmission/reflection method in 2-18 GHz. MnOx-coated Fe3O4 NPs were prepared by sol-gel method followed by heat-treating at 300, 400, and 500 °C, respectively. The heat-treated powders were then used as magnetic fillers and added to an epoxy resin to prepare MnOx-coated Fe3O4 composites for the complex permittivity (ɛ'-jɛ″) and permeability (μ'-jμ″) measurements. After the sol-gel process, the coating of manganese oxide (mixture of major Mn2O3 and minor Mn3O4) reduced the value of ɛ'. The lower the heat-treating temperature, the larger the decrease in ɛ'. The relative decrease in ɛ', compared with uncoated Fe3O4 nanoparticles, is 28.7, 23.5, and 20.0% for coated MnOx heat-treated at 300, 400, and 500 °C, respectively, while the relative decrease in ɛ″ is 74.1, 68.8, and 65.2%, respectively. In the present study, MnOx-coated Fe3O4 exhibited a significant decrease in dielectric loss tangent of ˜100% compared to that of uncoated NPs and can be of practical use for microwave components.

Chelator-Accelerated One-Pot ‘Click’ Labeling of Small Molecule Tracers with 2-[18F]Fluoroethyl Azide

Directory of Open Access Journals (Sweden)

Erik Årstad

2013-05-01

Full Text Available 2-[18F]Fluoroethyl azide ([18F]FEA can readily be obtained by nucleophilic substitution of 2-azidoethyl-4-toluenesulfonate with [18F]fluoride (half-life 110 min, and has become widely used as a reagent for ‘click’ labeling of PET tracers. However, distillation of [18F]FEA is typically required, which is time-consuming and unpractical for routine applications. In addition, copper(I-catalyzed cycloaddition of [18F]FEA with non-activated alkynes, and with substrates containing labile functional groups, can be challenging. Herein, we report a highly efficient and practical ligand-accelerated one-pot/two-step method for ‘click’ labeling of small molecule tracers with [18F]FEA. The method exploits the ability of the copper(I ligand bathophenanthrolinedisulfonate to accelerate the rate of the cycloaddition reaction. As a result, alkynes can be added directly to the crude reaction mixture containing [18F]FEA, and as cyclisation occurs almost immediately at room temperature, the reaction is tolerant to labile functional groups. The method was demonstrated by reacting [18F]FEA with a series of alkyne-functionalized 6-halopurines to give the corresponding triazoles in 55–76% analytical radiochemical yield.

An aerial radiological survey of the Sandia National Laboratories and surrounding area

International Nuclear Information System (INIS)

Riedhauser, S.R.

1994-06-01

A team from the Remote Sensing Laboratory conducted an aerial radiological survey of the area surrounding the Sandia National Laboratories and Kirtland Air Force Base in Albuquerque, New Mexico, during March and April 1993. The survey team measured the terrestrial gamma radiation at the site to determine the levels of natural and man-made radiation. This survey includes the areas covered by a previous survey in 1981. The results of the aerial survey show a background exposure rate which varies between 5 and 18 μR/h plus an approximate 6 μR/h contribution from cosmic rays. The major radioactive isotopes found in this survey were: potassium-40, thallium-208, bismuth-214, and actinium-228, which are all naturally-occurring isotopes, and cobalt-60, cesium-137, and excess amounts of thallium-208 and actinium-228, which are due to human actions in the survey area. In regions away from man-made activity, the exposure rates inferred from this survey's gamma ray measurements agree almost exactly with the exposure rates inferred from the 1981 survey. In addition to the aerial measurements, another survey team conducted in situ and soil sample radiation measurements at three sites within the survey perimeter. These ground-based measurements agree with the aerial measurements within ± 5%

The L1495-B218 filaments in Taurus seen in NH3 & CCS and Dynamical Stability of Filaments and Dense Cores

Science.gov (United States)

Seo, Youngmin

2016-01-01

We present deep NH3 map of L1495-B218 filaments and the dense cores embedded within the filaments in Taurus. The L1495-B218 filaments form an interconnected, nearby, large complex extending 8 pc. We observed the filaments in NH3 (1,1) & (2,2) and CCS 21-10 with spectral resolution of 0.038 km/s and spatial resolution of 31". The CSAR algorithm, which is a hybrid of seeded-watershed and binary dendrogram algorithm, identifies 39 leaves and 16 branches in NH3 (1,1). Applying a virial analysis for the 39 NH3 leaves, we find only 9 out of 39 leaves are gravitationally bound, and 12 out of 30 gravitationally unbound leaves are pressure-confined. Our analysis suggests that a dense core may form as a pressure-confined structure, evolve to a gravitationally bound core, and then undergo collapse to form a protostar (Seo et al. 2015).We also present more realistic dynamic stability conditions for dense cores with converging motions and under the influence of radiation pressure. The critical Bonnor-Ebert sphere and the isothermal cylinder have been widely used to test stability of dense cores and filaments; however, these assume a quiescent environment while actual star forming regions are turbulent and illuminated by radiation. In a new analysis of stability conditions we account for converging motions which have been modeled toward starless cores (Seo et al. 2011) and the effect of radiation fields into account. We find that the critical size of a dense core having a homologous converging motion with its peak speed being the sound speed is roughly half of the critical size of the Bonnor-Ebert sphere (Seo et al. 2013). We also find that the critical mass/line density of a dense core/filament irradiated by radiation are considerably smaller than that of the Bonnor-Ebert sphere/isothermal cylinder when the radiation pressure is stronger than the central gas pressure of dense core/isothermal cylinder. For inner Galactic regions and regions near OB associations, the critical

Metabolic liver function in humans measured by 2-(18)F-fluoro-2-deoxy-D-galactose PET/CT-reproducibility and clinical potential

DEFF Research Database (Denmark)

Bak-Fredslund, Kirstine P; Lykke Eriksen, Peter; Munk, Ole L

2017-01-01

Background: PET/CT with the radioactively labelled galactose analogue 2-18F-fluoro-2-deoxy-D-galactose (18F-FDGal) can be used to quantify the hepatic metabolic function and visualise regional metabolic heterogeneity. We determined the day-to-day variation in humans with and without liver disease....... Furthermore, we examined whether the standardised uptake value (SUV) of 18F-FDGal from static scans can substitute the hepatic systemic clearance of 18F- FDGal (Kmet, mL blood/min/mL liver tissue/) quantified from dynamic scans as measure of metabolic function. Four patients with cirrhosis and six healthy...... subjects underwent two 18F-FDGal PET/CT scans within a median interval of 15 days for determination of day-to-day variation. The correlation between Kmet and SUV was examined using scan data and measured arterial blood concentrations of 18F-FDGal (blood samples) from 14 subjects from previous studies...

Elastic scattering for 16O + 12C at 140 MeV and 218 MeV

International Nuclear Information System (INIS)

Galindo U, A.

1981-01-01

In this work, angular distribution of cross sections have been measured for 12 C( 16 O, 16 O) 12 C at two energies. The measurements were carried out in 0.5 0 intervals between 5 0 -19.5 0 C (lab.) at 140 MeV, 4.5 0 -14.5 0 at 218 MeV. An optical model analysis of these strong structure angular distributions was done. Good fits of the data were obtained using the optical model search code GENOA with a full Woods-Saxon potential form. This yielded parameters subject to considerable ambiguities as it is known to occur for strongly absorbed particles. These ambiguities were explored in detail and it was found that both the real and the imaginary parts present some characteristics that have been found before for the real potential (as Igo relation for continous ambiguities and the fact that potentials with different diffusivities tend to have the same value at the strong absorption radii). It was found, among other results, that the real volume integral, the mean square radius, as well as the total reaction cross section (σsub(r)) cannot be determined unambiguously. A strong correlation was found between σsub(r) and the imaginary diffusivity. A systematic study of how the variation of the potential parameters affects the angular distribution is presented and some features of the diffraction structure of the angular distribution are discussed. (author)

The Atacama Cosmology Telescope: A Measurement of the Cosmic Microwave Background Power Spectrum at 148 AND 218 GHz from the 2008 Southern Survey

Science.gov (United States)

Das, Sudeep; Marriage, Tobias A.; Ade, Peter A. R.; Aguirre, Paula; Amiri, Mandana; Appel, John W.; Barrientos, L. Felipe; Battistelli, Elia A.; Bond, J. Richard; Brown, Ben;

The propagation of a soil H218O labeling through the atmosphere-plant-soil system under drought using H218O and C18OO as two independent proxies

Science.gov (United States)

Barthel, Matthias; Sturm, Patrick; Hammerle, Albin; Siegwolf, Rolf; Gentsch, Lydia; Buchmann, Nina; Knohl, Alexander

2013-04-01

Above- and belowground processes in plants are tightly coupled via carbon and water flows through the atmosphere-plant-soil system. While recent studies elucidated the influence of drought on the carbon flow through plant and soil using 13C, much less is known about the propagation of 18O. Therefore, this study aimed to examine the timing and intensity of 18O enrichment in soil and shoot CO2 and H2O vapor fluxes of European beech saplings (Fagus sylvatica L.) after applying 18O-labeled water to the soil. A custom-made chamber system, separating shoot from soil compartments, allowed independent measurements of shoot and soil related processes in a controlled climate chamber environment. Gas-exchange of oxygen stable isotopes in CO2 and H2O-vapor served as the main tool for investigation and was monitored in real-time using laser spectroscopy. This is the first study measuring concurrently and continuously the enrichment of 18O in CO2 and H2O in shoot- and soil gas-exchange after applying 18O-labeled water to the soil. Photosynthesis (A) and stomatal conductance (gs) of drought-stressed plants showed an immediate coinciding small increase to the H218O irrigation event after only ~30 min. This rapid information transfer, however, was not accompanied by the arrival of 18O labeled water molecules within the shoot. The actual label induced 18O enrichment in transpired water and CO2 occurred not until ~4h after labeling. Further, the timing of the enrichment of 18O in the transpirational flux was similar in both treatments, thus pointing to similar transport rates. However, drought reduced the 18O exchange rate between H2O and CO2at the shoot level, likely caused by a smaller leaf CO2retroflux. Moreover, 18O exchange between H2O and CO2 occurred also in the soil. However, the there was no difference observed between the treatments.

A Fully Automated Radiosynthesis of [18F]Fluoroethyl-Diprenorphine on a Single Module by Use of SPE Cartridges for Preparation of High Quality 2-[18F]Fluoroethyl Tosylate

Directory of Open Access Journals (Sweden)

Gjermund Henriksen

2013-06-01

Full Text Available We have developed a new method for automated production of 2-[18F]fluoroethyl tosylate ([18F]FETos that enables 18F-alkylation to provide PET tracers with high chemical purity. The method is based on the removal of excess ethylene glycol bistosylate precursor by precipitation and subsequent filtration and purification of the filtrate by means of solid phase extraction cartridges (SPE. The method is integrated to a single synthesis module and thereby provides the advantage over previous methods of not requiring HPLC purification, as demonstrated by the full radiosynthesis of the potent opioid receptor PET tracer [18F]fluoroethyldiprenorphine.

A numerical model for the movement of H 2O, H 218O, and 2HHO in the unsaturated zone

Science.gov (United States)

Shurbaji, Abdel-Rahman M.; Phillips, Fred M.

1995-09-01

Vertical profiles of H 218O and 2HHO concentrations have yielded useful information on evaporation and infiltration processes in soils. However, in the field, quantitative interpretation of such profiles has been limited by the restrictions inherent in the quasi-steady-state and transient analytical models available to describe the physical processes. This study presents a flexible numerical model that simulates transient fluxes of heat, liquid water, water vapor, and isotopic species. The model can simulate both infiltration and evaporation under fluctuating meteorological conditions and thus should be useful in reproducing changes in field isotope profiles. A transition factor is introduced in the isotope transport equation. This factor combines hydrologic and isotopic parameters and changes slowly with depth in the soil profile but strongly in the evaporation zone, owing to the rapid change in the dominant phase of water from liquid to vapor. Using the transition factor in the isotope transport equation facilitates obtaining the typical shape of the isotope profile (bulge at the evaporation zone). This factor also facilitates producing broad isotope enrichment peaks that may be seen in very dry soils.

Dual time point 2-deoxy-2-[18F]fluoro-D-glucose PET/CT: nodal staging in locally advanced breast cancer.

Science.gov (United States)

García Vicente, A M; Soriano Castrejón, A; Cruz Mora, M Á; Ortega Ruiperez, C; Espinosa Aunión, R; León Martín, A; González Ageitos, A; Van Gómez López, O

2014-01-01

To assess dual time point 2-deoxy-2-[(18)F]fluoro-D-glucose (18)(F)FDG PET-CT accuracy in nodal staging and in detection of extra-axillary involvement. Dual time point [(18)F] FDG PET/CT scan was performed in 75 patients. Visual and semiquantitative assessment of lymph nodes was performed. Semiquantitative measurement of SUV and ROC-analysis were carried out to calculate SUV(max) cut-off value with the best diagnostic performance. Axillary and extra-axillary lymph node chains were evaluated. Sensitivity and specificity of visual assessment was 87.3% and 75%, respectively. SUV(max) values with the best sensitivity were 0.90 and 0.95 for early and delayed PET, respectively. SUV(max) values with the best specificity were 1.95 and 2.75, respectively. Extra-axillary lymph node involvement was detected in 26.7%. FDG PET/CT detected extra-axillary lymph node involvement in one-fourth of the patients. Semiquantitative lymph node analysis did not show any advantage over the visual evaluation. Copyright © 2013 Elsevier España, S.L. and SEMNIM. All rights reserved.

Development & automation of a novel ["1"8F]F prosthetic group, 2-["1"8F]-fluoro-3-pyridinecarboxaldehyde, and its application to an amino(oxy)-functionalised Aβ peptide

International Nuclear Information System (INIS)

Morris, Olivia; Gregory, J.; Kadirvel, M.; Henderson, Fiona; Blykers, A.; McMahon, Adam; Taylor, Mark; Allsop, David; Allan, Stuart; Grigg, J.; Boutin, Herve; Prenant, Christian

2016-01-01

2-["1"8F]-Fluoro-3-pyridinecarboxaldehyde (["1"8F]FPCA) is a novel, water-soluble prosthetic group. It's radiochemistry has been developed and fully-automated for application in chemoselective radiolabelling of amino(oxy)-derivatised RI-OR2-TAT peptide, (Aoa-k)-RI-OR2-TAT, using a GE TRACERlab FX-FN. RI-OR2-TAT is a brain-penetrant, retro-inverso peptide that binds to amyloid species associated with Alzheimer's Disease. Radiolabelled (Aoa-k)-RI-OR2-TAT was reproducibly synthesised and the product of the reaction with FPCA has been fully characterised. In-vivo biodistribution of ["1"8F]RI-OR2-TAT has been measured in Wistar rats.

New indides Sc{sub 6}Co{sub 2.18}In{sub 0.82}, Sc{sub 10}Ni{sub 9}In{sub 19.44} and ScCu{sub 4}In-synthesis, structure, and crystal chemistry

Energy Technology Data Exchange (ETDEWEB)

Zaremba, R.I.; Rodewald, U. Ch.; Poettgen, R. [Inst. fuer Anorganische und Analytische Chemie, Westfaelische Wilhelms-Univ. Muenster (Germany); Kalychak, Y.M.; Zaremba, V.I. [Inorganic Chemistry Dept., Ivan Franko National Univ. of Lviv, Lviv (Ukraine)

2006-08-15

New indides Sc{sub 6}Co{sub 2.18}In{sub 0.82}, Sc{sub 10}Ni{sub 9}In{sub 19.44} and ScCu{sub 4}In have been synthesized from the elements by arc-melting. Single crystals were grown by special annealing modes. The thee indides were investigated via X-ray powder and single crystal diffraction: Ho{sub 6}Co{sub 2}Ga type, Immm, a = 886.7(3), b = 878.0(2), c = 932.1(3) pm, wR2 = 0.0517, 711 F{sup 2} values, 35 variables for Sc{sub 6}Co{sub 2.18}In{sub 0.82}, Ho{sub 10}Ni{sub 9}In{sub 20} type, P4/nmm, a = 1287.5(2), c = 884.7(1) pm, wR2 = 0.0642, 1221 F{sup 2} values, 63 variables for Sc{sub 10}Ni{sub 9}In{sub 19.44}, and MgCu{sub 4}Sn type, anti F 43m, a = 704.03(7) pm, wR2 = 0.0267, 101 F{sup 2} values, and 7 variables for ScCu{sub 4}In. The scandium rich indide Sc{sub 6}Co{sub 2.18}In{sub 0.82} contains two Co{sub 2} dumb-bells at Co-Co distances of 221 and 230 pm. Each cobalt atom within these dumb-bells has a tricapped trigonal prismatic coordination. The In1 site has a distorted cube-like coordination by scandium and shows a mixed occupancy (36%) with cobalt. The In2 atoms have distorted icosahedral scandium coordination. As a consequence of the small size of the scandium atoms, the In4 site in Sc{sub 10}Ni{sub 9}In{sub 19.44} shows defects and was furthermore refined with a split model leading to a new distorted variant within the family of Ho{sub 10}Ni{sub 9}In{sub 20} compounds. ScCu{sub 4}In is an ordered version of the cubic Laves phase with scandium and indium atoms in the CN16 voids of the copper substructure. The Cu-Cu distances within the three-dimensional network of corner-sharing tetrahedra are 248.6 and 249.2 pm. The crystal chemical peculiarities of these three indide structures are briefly discussed. (orig.)

A PET system based on 2-18FDG production with a low energy electrostatic proton accelerator and a dual headed PET scanner.

Science.gov (United States)

Sandell, A; Ohlsson, T; Erlandsson, K; Hellborg, R; Strand, S E

1992-01-01

We have developed a comparatively inexpensive PET system, based on a rotating scanner with two scintillation camera heads, and a nearby low energy electrostatic proton accelerator for production of short-lived radionuclides. Using a 6 MeV proton beam of 5 microA, and by optimization of the target geometry for the 18O(p,n)18F reaction, 750 MBq of 2-18FDG can be obtained. The PET scanner shows a spatial resolution of 6 mm (FWHM) and a sensitivity of 80 s-1kBq-1ml-1 (3 kcps/microCi/ml). Various corrections are included in the imaging process, to compensate for spatial and temporal response variations in the detector system. Both filtered backprojection and iterative reconstruction methods are employed. Clinical studies have been performed with acquisition times of 30-40 min. The system will be used for clinical experimental research with short- as well as long-lived positron emitters. Also the possibility of true 3D reconstruction is under evaluation.

The usefulness of dynamic O-(2-18F-fluoroethyl)-L-tyrosine PET in the clinical evaluation of brain tumors in children and adolescents

DEFF Research Database (Denmark)

Dunkl, Veronika; Cleff, Corvin; Stoffels, Gabriele

2015-01-01

UNLABELLED: Experience regarding O-(2-(18)F-fluoroethyl)-L-tyrosine ((18)F-FET) PET in children and adolescents with brain tumors is limited. METHODS: Sixty-nine (18)F-FET PET scans of 48 children and adolescents (median age, 13 y; range, 1-18 y) were analyzed retrospectively. Twenty-six scans...... to assess newly diagnosed cerebral lesions, 24 scans for diagnosing tumor progression or recurrence, 8 scans for monitoring of chemotherapy effects, and 11 scans for the detection of residual tumor after resection were obtained. Maximum and mean tumor-to-brain ratios (TBRs) were determined at 20-40 min...... after injection, and time-activity curves of (18)F-FET uptake were assigned to 3 different patterns: constant increase; peak at greater than 20-40 min after injection, followed by a plateau; and early peak (≤ 20 min), followed by a constant descent. The diagnostic accuracy of (18)F-FET PET was assessed...

TH-A-BRC-03: AAPM TG218: Measurement Methods and Tolerance Levels for Patient-Specific IMRT Verification QA

Energy Technology Data Exchange (ETDEWEB)

Miften, M. [University of Colorado School of Medicine (United States)

2016-06-15

of possible dosimetry protocols. The report will be reviewed by the AAPM Working Group on Recommendations for Radiotherapy External Beam Quality Assurance and then by the AAPM Science Council before publication in Medical Physics Survey of possible calibration protocols for calibration of Gamma Stereotactic Radiosurgery (GSR) devices Overview of modern Quality Assurance techniques for GSR AAPM TG-218 Tolerance Levels and Methodologies for IMRT Verification QA - Moyed Miften Patient-specific IMRT QA measurement is a process designed to identify discrepancies between calculated and delivered doses. Error tolerance limits are not well-defined or consistently applied across centers. The AAPM TG-218 report has been prepared to improve the understanding and consistency of this process by providing recommendations for methodologies and tolerance limits in patient-specific IMRT QA. Learning Objectives: Review measurement methods and methodologies for absolute dose verification Provide recommendations on delivery methods, data interpretation, the use of analysis routines and choice of tolerance limits for IMRT QA Sonja Dieterich has a research agreement with Sun Nuclear Inc. Steven Goetsch is a part-time consultant for Elekta.

TH-A-BRC-03: AAPM TG218: Measurement Methods and Tolerance Levels for Patient-Specific IMRT Verification QA

International Nuclear Information System (INIS)

Miften, M.

2016-01-01

of possible dosimetry protocols. The report will be reviewed by the AAPM Working Group on Recommendations for Radiotherapy External Beam Quality Assurance and then by the AAPM Science Council before publication in Medical Physics Survey of possible calibration protocols for calibration of Gamma Stereotactic Radiosurgery (GSR) devices Overview of modern Quality Assurance techniques for GSR AAPM TG-218 Tolerance Levels and Methodologies for IMRT Verification QA - Moyed Miften Patient-specific IMRT QA measurement is a process designed to identify discrepancies between calculated and delivered doses. Error tolerance limits are not well-defined or consistently applied across centers. The AAPM TG-218 report has been prepared to improve the understanding and consistency of this process by providing recommendations for methodologies and tolerance limits in patient-specific IMRT QA. Learning Objectives: Review measurement methods and methodologies for absolute dose verification Provide recommendations on delivery methods, data interpretation, the use of analysis routines and choice of tolerance limits for IMRT QA Sonja Dieterich has a research agreement with Sun Nuclear Inc. Steven Goetsch is a part-time consultant for Elekta.

A novel PRNP Y218N mutation in Gerstmann-Sträussler-Scheinker disease with neurofibrillary degeneration.

Science.gov (United States)

Alzualde, Ainhoa; Indakoetxea, Begoña; Ferrer, Isidre; Moreno, Fermin; Barandiaran, Myriam; Gorostidi, Ana; Estanga, Ainara; Ruiz, Irune; Calero, Miguel; van Leeuwen, Fred W; Atares, Begoña; Juste, Ramón; Rodriguez-Martínez, Ana Belén; López de Munain, Adolfo

2010-08-01

Gerstmann-Sträussler-Scheinker (GSS) disease is a prion disease associated with prion protein gene (PRNP) mutations. We report a novel PRNP mutation (Y218N) associated with GSS disease in a pathologically confirmed case and in two other affected family members. The clinical features of these cases met criteria for possible Alzheimer disease and possible frontotemporal dementia. Neuropathologic analysis revealed deposition of proteinase K-resistant prion protein (PrP(res)), widespread hyperphosphorylated tau pathology, abnormal accumulation of mitochondria in the vicinity of PrP deposits, and expression of mutant ubiquitin (UBB(+1)) in neurofibrillary tangles and dystrophic neurites. Prion protein immunoblotting using 3F4 and 1E4 antibodies disclosed multiple bands ranging from approximately 20 kd to 80 kd and lower bands of 15 kd and approximately 10 kd, the latter only seen after a long incubation. These bands were partially resistant to proteinase K pretreatment. This pattern differs from those seen in Creutzfeldt-Jakob disease andresembles those reported in other GSS cases. The approximately 10kd band was recognized with anti-PrP C-terminus antibodies but not with anti-N terminus antibodies, suggesting PrP truncation at the N terminal. This new mutation extends the list of known mutations responsible for GSS disease and reinforces its clinical heterogeneity. Genetic examination of the PRNP gene should be included in the workup of patients with poorly classifiable dementia.

Radiometric determination of {sup 226}, {sup 228}Ac and {sup 40}K in fly ashes and building materials

Energy Technology Data Exchange (ETDEWEB)

Harangozo, M; Toelgyessy, J; Lesny, J; Cik, G [Slovak Technical Univ., Bratislava (Slovakia). Fac. of Chemical Technology, Dept. of Environmental Science

1996-12-31

In this paper the activities of radium-226, actinium-228 and potassium-40 in fly ashes and building materials of Slovakia were determined. Different origin of coals combusted results in significant differences in specific activities of radium-226 and activities-228 of measured fly-ashes and building materials. The knowledge of the specific activity of selected nuclides contained in fly-ashes is, therefore, very important and in specific cases can indicate the possibilities of their further technological use. (J.K.) 1 tab., 3 refs.

A Radium-223 microgenerator from cyclotron-produced trace Actinium-227

International Nuclear Information System (INIS)

Abou, Diane S.; Pickett, Juile; Mattson, John E.; Thorek, Daniel L.J.

2017-01-01

The alpha particle emitter Radium-223 dichloride ("2"2"3RaCl_2) has recently been approved for treatment of late-stage bone metastatic prostate cancer. There is considerable interest in studying this new agent outside of the clinical setting, however the supply of "2"2"3Ra is limited and expensive. We have engineered a "2"2"3Ra microgenerator using traces of "2"2"7Ac previously generated from cyclotron-produced "2"2"5Ac. Radiochemically pure "2"2"3RaCl_2 was made, characterized, evaluated in vivo, and the source was recovered in high yield for regeneration of the microgenerator. - Highlights: • A "2"2"3Ra microgenerator was built using residual "2"2"7Ac from cyclotron-produced "2"2"5Ac. • Following "2"2"5Ac decay, the residual "2"2"7Ac was processed into pure "2"2"3Ra. • "2"2"7Ac and "2"2"7Th were recovered in high yield for a permanent supply of "2"2"3Ra. • Clinically supplied and generator-produced "2"2"3Ra have equivalent in vivo distribution. • Microdose column provides sufficient material for research use.

Purification of cerium, neodymium and gadolinium for low background experiments

Directory of Open Access Journals (Sweden)

Boiko R.S.

2014-01-01

Full Text Available Cerium, neodymium and gadolinium contain double beta active isotopes. The most interesting are 150Nd and 160Gd (promising for 0ν2β search, 136Ce (2β+ candidate with one of the highest Q2β. The main problem of compounds containing lanthanide elements is their high radioactive contamination by uranium, radium, actinium and thorium. The new generation 2β experiments require development of methods for a deep purification of lanthanides from the radioactive elements. A combination of physical and chemical methods was applied to purify cerium, neodymium and gadolinium. Liquid-liquid extraction technique was used to remove traces of Th and U from neodymium, gadolinium and for purification of cerium from Th, U, Ra and K. Co-precipitation and recrystallization methods were utilized for further reduction of the impurities. The radioactive contamination of the samples before and after the purification was tested by using ultra-low-background HPGe gamma spectrometry. As a result of the purification procedure the radioactive contamination of gadolinium oxide (a similar purification efficiency was reached also with cerium and neodymium oxides was decreased from 0.12 Bq/kg to 0.007 Bq/kg in 228Th, from 0.04 Bq/kg to <0.006 Bq/kg in 226Ra, and from 0.9 Bq/kg to 0.04 Bq/kg in 40K. The purification methods are much less efficient for chemically very similar radioactive elements like actinium, lanthanum and lutetium.

'Masurium' and the 'early transuranium elements' or how discovery of nuclear fission was not clearly seen

International Nuclear Information System (INIS)

Keller, C.

1988-01-01

Fifty years after the discovery of fission, the scientific community is aware that this type of nuclear reaction could have been discovered more than a decade earlier. Noddack, Tacke and Berg announced in 1925 the discovery of elements Z = 43 (masurium) and rhenium (Z = 75), the first one could be detected only in U-bearing minerals. A recent re-examination by P.H.M. von Assche of the published data clearly showed that the original claim for element Z = 43 of the authors in 1925 was correct and, therefore, they detected not only element Z = 43 but also the first fission product. Because this discovery of element Z = 43 could not be repeated by other authors as that time, the scientific credibility of Noddack-Tacke was very low in order to give credit to her proposal that the 'early' transuranium elements by Enrico Fermi might also be fragments of known (lighter) elements. Enrico Fermi in 1934 obtained these 'early' (and as we today know: wrong) transuranium isotopes by irradiation of uranium with neutrons. A 'wrong' periodic system in the thirties which placed Th, Pa and U as 6d-elements and not as 5f-actinides chemically helped to consider these fission products as transuranium elements Z = 93/94. In 1937/38 I. Curie and P. Savitch discovered an 'actinium-nuclide' with 3,5 h half-life which, however, had properties similar to lanthanium and not to actinium, as they stated. (orig.) [de

Shape of intrinsic alpha pulse height spectra in lanthanide halide scintillators

Science.gov (United States)

Wolszczak, W.; Dorenbos, P.

2017-06-01

Internal contamination with actinium-227 and its daughters is a serious drawback in low-background applications of lanthanide-based scintillators. In this work we showed the important role of nuclear γ de-excitations on the shape of the internal alpha spectrum measured in scintillators. We calculated with Bateman equations the activities of contamination isotopes and the time evolution of actinium-227 and its progenies. Next, we measured the intrinsic background spectra of LaBr3(Ce), LaBr3(Ce,Sr) and CeBr3 with a digital spectroscopy technique, and we analyzed them with a pulse shape discrimination method (PSD) and a time-amplitude analysis. Finally, we simulated the α background spectrum with Geant4 tool-kit, consequently taking into account complex α-γ-electron events, the α / β ratio dependence on the α energy, and the electron/γ nonproportionality. We found that α-γ mixed events have higher light yield than expected for alpha particles alone, which leads to overestimation of the α / β ratio when it is measured with internal 227Th and 223Ra isotopes. The time-amplitude analysis showed that the α peaks of 219Rn and 215Po in LaBr3(Ce) and LaBr3(Ce,Sr) are not symmetric. We compared the simulation results with the measured data and provided further evidence of the important role of mixed α-γ-electron events for understanding the shape of the internal α spectrum in scintillators.

Actinides

International Nuclear Information System (INIS)

Martinot, L.; Fuger, J.

1985-01-01

The oxidation behavior of the actinides is explained on the basis of their electronic structure. The actinide elements, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium, curium, berkelium, californium, einsteinium, fermium, mendelevium, nobelium, and laurencium are included. For all except the last three elements, the points of discussion are oxidation states, Gibbs energies and potentials, and potential diagram for the element in acid solution; and thermodynamic properties of these same elements are tabulated. References are cited following discussion of each element with a total of 97 references being cited. 13 tables

Calculation of entropy of liquid metals using acoustic measurements in the framework of the rigid sphere model

International Nuclear Information System (INIS)

Tekuchev, V.V.; Barashkov, B.I.; Rygalov, L.N.; Dolzhikov, Yu.S.

2001-01-01

For the first time one obtained the polytherms of ultrasound velocity for liquid high-melting metals within wide temperature range. In terms of the rigid sphere model on the basis of the acoustic data one calculated the entropy values for 34 liquid metals at the melting point. The average discrepancy of the calculated values of entropy with the published one constitutes 8.2%. With increase of metal valency the error increases from 2.8 up to 13%. In case of francium, radium, promethium, actinium, hafnium, polonium, rhenium one obtained data for the first time [ru

Status of the lanthanides and actinides in the periodic table

International Nuclear Information System (INIS)

Holden, N.E.

1985-01-01

In extended discussions and correspondence with Ekkehard Fluck, the author was made aware of a problem with the Periodic Table, i.e., which element should be shown in the main table as the representative of the lanthanide series and the actinide series. In earlier discussion, he came to the conclusion that lanthanum and actinium are not the elements which should appear, but rather lutetium and lawrencium are more appropriate for inclusion in their place. This paper will attempt to justify the reasons for the above conclusions. 4 refs

Three-dimensional patterns of speech-induced cerebral and cerebellar activation in healthy volunteers and in aphasic stroke patients studied by positron emission tomography of 2(18F)-fluorodeoxyglucose

International Nuclear Information System (INIS)

Pawlik, G.; Heiss, W.D.; Beil, C.; Gruenewald, G.; Herholz, K.; Wienhard, K.; Wagner, R.

1987-01-01

Eight healthy male volunteers and eight moderately aphasic patients with a single cerebral infarctions in the postacute stage, were studied by dynamic positron emission tomography (PET) using the 2(18F)-fluoro-2-deoxy-D-glucose method and a 7-slice positron camera. Because hemispheric speech dominance is commonly thought to be closely related to handedness, subjects were tested by the Oldfield and Bryden questionnaires; the volunteers also had a tracking and pin-sort test. PET studies were performed in random order, both at rest and during spontaneous speech of rather abstract and some biographic content, with a time interval of 2 to 7 days between measurements of the same individual. Data was analyzed by means of weighted, repeated measures of analysis of variance (ANOVA). 11 refs.; 2 figs

49 CFR 571.218 - Standard No. 218; Motorcycle helmets.

Science.gov (United States)

2010-10-01

...), and exhibit no resonant frequencies below 2,000 Hz. S7.1.6 The monorail drop test system is used for... assembly weight for the monorail system is the drop assembly weight minus the combined weight of the test... axes of the test headform assembly on a monorail drop test equipment are oriented as follows: From the...

PHEBUS/test-218, Behaviour of a Fuel Rod Bundle during a Large Break LOCA Transient with a two Peaks Temperature History

International Nuclear Information System (INIS)

1987-01-01

1 - Description of test facility: PHEBUS test facility operated at CEA Research Center Cadarache consists of a pressurized circuit involving pumps, heat exchangers and a blowdown tank - 25 nuclear fuel rod bundle, coupled to a separate driver core; - active length 0.8 m, cosine axial power profile; - pressurized and un-pressurized fuel rods; - controlled cooling conditions at the bundle inlet (blowdown, refill and reflood period); - de-pressurized test rig volume 0.22 m 3 . The following 'as measured' boundary conditions (B.C.) were offered to participants as options with decreasing challenge to their analytical approach: Boundary conditions B.C.0: - full thermal-hydraulic analysis of PHEBUS test rig (was not recommended). Boundary conditions B.C.1: - thermal power level of fuel bundle; - fluid inlet conditions to bundle section. Boundary conditions B.C.2: - local cladding temperatures of rods; - heat transfer coefficients. Boundary conditions B.C.3: - cladding temperatures of rods; - internal pressure of rods. 2 - Description of test: Post-test investigation into the response of a nuclear fuel bundle to a large break loss of coolant accident with respect to - local fuel temperatures, - cladding strain at the time of burst, - time to burst and under given thermal-hydraulic boundary conditions of PHEBUS-test 218

A study of uranium and thorium migration at the Koongarra uranium deposit with application to actinide transport from nuclear waste repositories

International Nuclear Information System (INIS)

Payne, T.E.

1991-01-01

One way to gain confidence in modelling possible radionuclide releases is to study natural systems which are similar to components of the multibarrier waste repository. Several such analogues are currently under study and these provide useful data about radionuclide behaviour in the natural environment. One such system is the Koongarra uranium deposit in the Northern Territory. In this dissertation, the migration of actinides, primarily uranium and thorium, has been studied as an analogue for the behaviour of transuranics in the far-field of a waste repository. The major findings of this study are: 1. the main process retarding uranium migration in the dispersion fan at Koongarra is sorption, which suppresses dissolved uranium concentrations well below solubility limits, with ferrihydrite being a major sorbing phase; 2. thorium is extremely immobile, with very low dissolved concentrations and corresponding high distribution ratios for 230 Th. Overall, it is estimated that colloids are relatively unimportant in Koongarra groundwater. Uranium migrates mostly as dissolved species, whereas thorium and actinium are mostly adsorbed to larger, relatively immobile particles and the stationary phase. However, of the small amount of 230 Th that passes through a 1μm filter, a significant proportion is associated with colloidal particles. Actinium appears to be slightly more mobile than thorium and is associated with colloids to a greater extent, although generally present in low concentrations. These results support the possibility of colloidal transport of trivalent and tetravalent actinides in the vicinity of a nuclear waste repository. 112 refs., 23 tabs., 32 figs

Tropospheric water vapour isotopologue data (H216O, H218O, and HD16O) as obtained from NDACC/FTIR solar absorption spectra

Science.gov (United States)

Barthlott, Sabine; Schneider, Matthias; Hase, Frank; Blumenstock, Thomas; Kiel, Matthäus; Dubravica, Darko; García, Omaira E.; Sepúlveda, Eliezer; Mengistu Tsidu, Gizaw; Takele Kenea, Samuel; Grutter, Michel; Plaza-Medina, Eddy F.; Stremme, Wolfgang; Strong, Kim; Weaver, Dan; Palm, Mathias; Warneke, Thorsten; Notholt, Justus; Mahieu, Emmanuel; Servais, Christian; Jones, Nicholas; Griffith, David W. T.; Smale, Dan; Robinson, John

2017-01-01

We report on the ground-based FTIR (Fourier transform infrared) tropospheric water vapour isotopologue remote sensing data that have been recently made available via the database of NDACC (Network for the Detection of Atmospheric Composition Change; MUSICA/" target="_blank">ftp://ftp.cpc.ncep.noaa.gov/ndacc/MUSICA/) and via doi:10.5281/zenodo.48902. Currently, data are available for 12 globally distributed stations. They have been centrally retrieved and quality-filtered in the framework of the MUSICA project (MUlti-platform remote Sensing of Isotopologues for investigating the Cycle of Atmospheric water). We explain particularities of retrieving the water vapour isotopologue state (vertical distribution of H216O, H218O, and HD16O) and reveal the need for a new metadata template for archiving FTIR isotopologue data. We describe the format of different data components and give recommendations for correct data usage. Data are provided as two data types. The first type is best-suited for tropospheric water vapour distribution studies disregarding different isotopologues (comparison with radiosonde data, analyses of water vapour variability and trends, etc.). The second type is needed for analysing moisture pathways by means of H2O, δD-pair distributions.

Tolerance limits and methodologies for IMRT measurement-based verification QA: Recommendations of AAPM Task Group No. 218.

Science.gov (United States)

Miften, Moyed; Olch, Arthur; Mihailidis, Dimitris; Moran, Jean; Pawlicki, Todd; Molineu, Andrea; Li, Harold; Wijesooriya, Krishni; Shi, Jie; Xia, Ping; Papanikolaou, Nikos; Low, Daniel A

2018-04-01

Patient-specific IMRT QA measurements are important components of processes designed to identify discrepancies between calculated and delivered radiation doses. Discrepancy tolerance limits are neither well defined nor consistently applied across centers. The AAPM TG-218 report provides a comprehensive review aimed at improving the understanding and consistency of these processes as well as recommendations for methodologies and tolerance limits in patient-specific IMRT QA. The performance of the dose difference/distance-to-agreement (DTA) and γ dose distribution comparison metrics are investigated. Measurement methods are reviewed and followed by a discussion of the pros and cons of each. Methodologies for absolute dose verification are discussed and new IMRT QA verification tools are presented. Literature on the expected or achievable agreement between measurements and calculations for different types of planning and delivery systems are reviewed and analyzed. Tests of vendor implementations of the γ verification algorithm employing benchmark cases are presented. Operational shortcomings that can reduce the γ tool accuracy and subsequent effectiveness for IMRT QA are described. Practical considerations including spatial resolution, normalization, dose threshold, and data interpretation are discussed. Published data on IMRT QA and the clinical experience of the group members are used to develop guidelines and recommendations on tolerance and action limits for IMRT QA. Steps to check failed IMRT QA plans are outlined. Recommendations on delivery methods, data interpretation, dose normalization, the use of γ analysis routines and choice of tolerance limits for IMRT QA are made with focus on detecting differences between calculated and measured doses via the use of robust analysis methods and an in-depth understanding of IMRT verification metrics. The recommendations are intended to improve the IMRT QA process and establish consistent, and comparable IMRT QA

An eighteen-membered macrocyclic ligand for actinium-225 targeted alpha therapy

International Nuclear Information System (INIS)

Thiele, Nikki A.; MacMillan, Samantha N.; Wilson, Justin J.; Rodriguez-Rodriguez, Cristina

2017-01-01

The 18-membered macrocycle H 2 macropa was investigated for 225 Ac chelation in targeted alpha therapy (TAT). Radiolabeling studies showed that macropa, at submicromolar concentration, complexed all 225 Ac (26 kBq) in 5 min at RT. [ 225 Ac(macropa)] + remained intact over 7 to 8 days when challenged with either excess La 3+ ions or human serum, and did not accumulate in any organ after 5 h in healthy mice. A bifunctional analogue, macropa-NCS, was conjugated to trastuzumab as well as to the prostate-specific membrane antigen-targeting compound RPS-070. Both constructs rapidly radiolabeled 225 Ac in just minutes at RT, and macropa-Tmab retained >99 % of its 225 Ac in human serum after 7 days. In LNCaP xenograft mice, 225 Ac-macropa-RPS-070 was selectively targeted to tumors and did not release free 225 Ac over 96 h. These findings establish macropa to be a highly promising ligand for 225 Ac chelation that will facilitate the clinical development of 225 Ac TAT for the treatment of soft-tissue metastases. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

An eighteen-membered macrocyclic ligand for actinium-225 targeted alpha therapy

Energy Technology Data Exchange (ETDEWEB)

Thiele, Nikki A.; MacMillan, Samantha N.; Wilson, Justin J. [Cornell Univ., Ithaca, NY (United States). Chemistry and Chemical Biology; Brown, Victoria; Jermilova, Una; Ramogida, Caterina F.; Robertson, Andrew K.H.; Schaffer, Paul; Radchenko, Valery [TRIUMF, Vancouver, BC (Canada). Life Science Div.; Kelly, James M.; Amor-Coarasa, Alejandro; Nikolopoulou, Anastasia; Ponnala, Shashikanth; Williams, Clarence Jr.; Babich, John W. [Radiology, Weill Cornell Medicine, New York, NY (United States); Rodriguez-Rodriguez, Cristina [British Columbia Univ., Vancouver, BC (Canada). Dept. of Physics and Astronomy and Centre for Comparative Medicine

2017-11-13

The 18-membered macrocycle H{sub 2}macropa was investigated for {sup 225}Ac chelation in targeted alpha therapy (TAT). Radiolabeling studies showed that macropa, at submicromolar concentration, complexed all {sup 225}Ac (26 kBq) in 5 min at RT. [{sup 225}Ac(macropa)]{sup +} remained intact over 7 to 8 days when challenged with either excess La{sup 3+} ions or human serum, and did not accumulate in any organ after 5 h in healthy mice. A bifunctional analogue, macropa-NCS, was conjugated to trastuzumab as well as to the prostate-specific membrane antigen-targeting compound RPS-070. Both constructs rapidly radiolabeled {sup 225}Ac in just minutes at RT, and macropa-Tmab retained >99 % of its {sup 225}Ac in human serum after 7 days. In LNCaP xenograft mice, {sup 225}Ac-macropa-RPS-070 was selectively targeted to tumors and did not release free {sup 225}Ac over 96 h. These findings establish macropa to be a highly promising ligand for {sup 225}Ac chelation that will facilitate the clinical development of {sup 225}Ac TAT for the treatment of soft-tissue metastases. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

Early Treatment Response Monitoring Using 2-Deoxy-2-[18F]fluoro-D-glucose Positron Emission Tomography Imaging during Fractionated Radiotherapy of Head Neck Cancer Xenografts

Directory of Open Access Journals (Sweden)

Jiayi Huang

2014-01-01

Full Text Available Background. To determine the optimal timing and analytic method of 2-deoxy-2-[18F]fluoro-D-glucose positron emission tomography (PET imaging during fractionated radiotherapy (RT to predict tumor control. Methods. Ten head neck squamous cell carcinoma xenografts derived from the UT-14-SCC cell line were irradiated with 50 Gy at 2 Gy per day over 5 weeks. Dynamic PET scans were acquired over 70 minutes at baseline (week 0 and weekly for seven weeks. PET data were analyzed using standard uptake value (SUV, retention index (RI, sensitivity factor (SF, and kinetic index (Ki. Results. Four xenografts had local failure (LF and 6 had local control. Eighty scans from week 0 to week 7 were analyzed. RI and SF after 10 Gy appeared to be the optimal predictors for LF. In contrast, SUV and Ki during RT were not significant predictors for LF. Conclusion. RI and SF of PET obtained after the first week of fractionated RT were the optimal methods and timing to predict tumor control.

A phase I study on stereotactic body radiotherapy of liver metastases based on functional treatment planning using positron emission tomography with 2-[(18)F]fluoro-2-deoxy-d-galactose

DEFF Research Database (Denmark)

Fode, Mette Marie; Bak-Fredslund, Kirstine; Petersen, Jørgen Baltzer

2017-01-01

BACKGROUND AND PURPOSE: The galactose analog 2-[18F]fluoro-2-deoxy-d-galactose (FDGal) is used for quantification of regional hepatic metabolic capacity by functional positron emission tomography computerized tomography (PET/CT). In the present study, FDGal PET/CT was used for functional treatment...... planning (FTP) of stereotactic body radiotherapy (SBRT) of liver metastases with the aim of minimizing radiation dose to the best functioning liver tissue. MATERIAL AND METHODS: Fourteen patients referred for SBRT had FDGal PET/CT performed before and one month after the treatment. The planning CT...... and the FDGal PET/CT images were deformable co-registered. RESULTS: A reduction in the mean dose of approximately 2 Gy to the best functioning sub-volumes was obtained. One patient developed grade 2 acute morbidity and no patients experienced grade 3 or higher acute morbidities. The regional hepatic metabolic...

2-[18 F]fluoro-2-deoxy-d-glucose (FDG) positron-emission tomography (PET) findings of chronic expanding intrapericardial hematoma: a potential interpretive pitfall that mimics a malignant tumor

Science.gov (United States)

2013-01-01

A 77-year-old man who had undergone mitral valve replacement 5 years previously presented with an intrapericardial mass. Computed tomography and magnetic resonance imaging showed that the mass lesion contained hematoma components. Positron-emission tomography (PET) with 2-[18 F] fluoro-2-deoxy-d-glucose (FDG) revealed uptake in the peripheral rim of the mass. These findings suggested the presence of hematoma associated with a malignant lesion. Surgical resection was performed, and the histological diagnosis was chronic expanding intrapericardial hematoma without neoplastic changes. Chronic expanding intrapericardial hematoma is a rare disease but should be considered when an expanding mass is found in a patient after cardiac surgery. The FDG-PET findings of chronic expanding hematomas, including FDG uptake in the peripheral rim of the mass as a result of inflammation, should be recognized as a potential interpretive pitfall that mimics a malignant tumor. PMID:23324446

Miocene palynoflora from the KRAM-P 218 leaf assemblage from the Bełchatów Lignite Mine (Central Poland

Directory of Open Access Journals (Sweden)

Worobiec Elżbieta

2016-12-01

Full Text Available During a palynological analysis of four samples from the Bełchatów KRAM-P 218 collection of plant macroremains 95 fossil species of sporomorphs were identified. Among the non-pollen palynomorphs was the fossil species Desmidiaceaesporites cosmarioformis, previously not reported from fossil floras of Poland, most probably related to the zygospores of desmids. The pollen analysis indicates the presence of a freshwater body (probably an oxbow lake and shows the dominant role of wetland, predominantly riparian vegetation, at the time of sedimentation. The riparian forests probably consisted of Carya, Pterocarya, Celtis, and Ulmus, accompanied by Alnus, Acer, Fraxinus, Juglans, Liquidambar, Vitis, Zelkova, and Salix. In mixed forests there probably were Fagus, Quercus, Carpinus, Eucommia, Corylus, Tilioideae, and conifers, as well as some thermophilous taxa (e.g. Castanea, Symplocos, Reevesia, Mastixiaceae, and plants producing pollen of the fossil species Tricolporopollenites pseudocingulum. Taxodium, Nyssa, and presumably Glyptostrobus and Alnus were components of swamp communities that might have overgrown the adjacent area with higher groundwater. Members of the families Ericaceae, Cyrillaceae, and Clethraceae, as well as Myrica and probably also Ilex, may have been components of swamp forests and bush swamps. Our analysis indicates that the climate was warm temperate and moderately wet. The palynoflora is most similar in composition to the spore-pollen spectra of the X climatic phase - the Nyssapollenites spore-pollen zone. Deposits bearing assemblages of the Nyssapollenites spore-pollen zone were deposited during the Sarmatian and early Pannonian. Our results are consistent with those from plant macroremains from the same collection.

REVIEW ARTICLE 218

African Journals Online (AJOL)

boaz

The strategy group reviewed and approved all of the teams work and needed resources. ... de cas/ Contrôle de l'infection, 3) la mobilisation sociale, 4) Les Services de laboratoire, 5) le point d'entrée et 6) Gestion / ... molecular evidence for adaptation during human to ... respond to malaria treatment and his travel from an.

REVIEW ARTICLE 218

African Journals Online (AJOL)

boaz

1) Epidemiology/ Surveillance, 2) Case Management/ Infection Control, 3) Social mobilization, 4) Laboratory ... The strategy group reviewed and approved all of the teams work and needed .... accountability measures and success of the polio.

Monitoring of Radiochemotherapy in Patients with Glioblastoma Using O-(2-[18F]Fluoroethyl-L-Tyrosine Positron Emission Tomography: Is Dynamic Imaging Helpful?

Directory of Open Access Journals (Sweden)

Marc D. Piroth

2013-09-01

Full Text Available Monitoring of radiochemotherapy (RCX in patients with glioblastoma is difficult because unspecific alterations in magnetic resonance imaging with contrast enhancement can mimic tumor progression. Changes in tumor to brain ratios (TBRs in positron emission tomography (PET using O-(2-[18F]fluoroethyl-L-tyrosine (18F-FET after RCX with temozolomide of patients with glioblastoma have been shown to be valuable parameters to predict survival. The kinetic behavior of 18F-FET in the tumors is another promising parameter to analyze tumor metabolism. In this study, we investigated the predictive value of dynamic 18F-FET PET during RCX of glioblastoma. Time-activity curves (TACs of 18F-FET uptake of 25 patients with glioblastoma were evaluated after surgery (FET-1, early (7–10 days after completion of RCX (FET-2, and 6 to 8 weeks later (FET-3. Changes in the time to peak (TTP and the slope of the TAC (10–50 minutes postinjection were analyzed and related to survival. Changes in kinetic parameters of 18F-FET uptake after RCX showed no relationship with survival time. In contrast, the high predictive value of changes of TBR to predict survival was confirmed. We conclude that dynamic 18F-FET PET does not provide additional prognostic information during RCX. Static 18F-FET PET imaging (20–40 minutes postinjection appears to be sufficient for this purpose and reduces costs.

Purification of radium-226 for the manufacturing of actinium-225 in a cyclotron for alpha-immunotherapy; Radium-Aufreinigung zur Herstellung von Actinium-225 am Zyklotron fuer die Alpha-Immuntherapie

Energy Technology Data Exchange (ETDEWEB)

Marx, Sebastian Markus

2014-09-23

The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.

Dietary sodium intake is associated with total fluid and sugar-sweetened beverage consumption in US children and adolescents aged 2-18 y: NHANES 2005-2008.

Science.gov (United States)

Grimes, Carley A; Wright, Jacqueline D; Liu, Kiang; Nowson, Caryl A; Loria, Catherine M

2013-07-01

Increasing dietary sodium drives the thirst response. Because sugar-sweetened beverages (SSBs) are frequently consumed by children, sodium intake may drive greater consumption of SSBs and contribute to obesity risk. We examined the association between dietary sodium, total fluid, and SSB consumption in a nationally representative sample of US children and adolescents aged 2-18 y. We analyzed cross-sectional data from NHANES 2005-2008. Dietary sodium, fluid, and SSB intakes were assessed with a 24-h dietary recall. Multiple regression analysis was used to assess associations between sodium, fluid, and SSBs adjusted for age, sex, race-ethnic group, body mass index (BMI), socioeconomic status (SES), and energy intake. Of 6400 participants, 51.3% (n = 3230) were males, and the average (±SEM) age was 10.1 ± 0.1 y. The average sodium intake was 3056 ± 48 mg/d (equivalent to 7.8 ± 0.1 g salt/d). Dietary sodium intake was positively associated with fluid consumption (r = 0.42, P sodium is positively associated with fluid consumption and predicted SSB consumption in consumers of SSBs. The high dietary sodium intake of US children and adolescents may contribute to a greater consumption of SSBs, identifying a possible link between dietary sodium intake and excess energy intake.

Origin of elements of the Uranium-235 family observed in the Ellez river near the EL-4 experimental nuclear reactor in dismantling (Monts d'Arree- Finistere department); Origine des elements de la famille de l'uranium-235 observes dans la riviere Ellez a proximite du reacteur nucleaire experimental EL4 en cours de demantelement (Mont d'Arree - departement du Finistere). Resultats et premiers constats annee 2006

Energy Technology Data Exchange (ETDEWEB)

NONE

2006-07-01

In a previous study which concerned the catchment basin of the harbour of Brest, the A.C.R.O. put in evidence a marking by artificial radioelements around the power plant of Brennilis which can be imputed without ambiguities to the nuclear installation. It also put in evidence abnormalities concerning the natural radioactivity which justifies this new study. In the area of the Monts d'Arree, actinium 227 ({sup 227}Ac), non born by its ascendents which are {sup 235}U and {sup 231}Pa is observed. This phenomenon is characterized by mass activities superior to these ones of {sup 235}U and able to reach these ones of {sup 238}U. Its presence corresponds with the drainage of the Ellez river since the former channel of radioactive effluents releases from the nuclear power plant EL-4 up to the reservoir Saint-Herblot situated 6 km downstream. The strongest values of radioactivity are registered near the disused power plant, at this place a relationship exists between the level of actinium 227 and this one of the artificial radioactivity as it exists a relationship with the decay products of radon exhaled from the subsoil ({sup 210}Pb). But its presence is not limited to a part of the Ellez river, it is equally observed in terrestrial medium, in places in priori not influenced by the direct liquid effluents of the power plant. This place is situated at more than 4 km and without any connection with the Ellez waters. At this stage of the study, it is not possible to answer with certainty the question of the origin of this phenomenon. A new reorientation is considered indispensable to clarify definitively the origin of this unknown phenomenon in the scientific publications and the environmental monitoring. (N.C.)

origin of elements of the Uranium-235 family observed in the Ellez river near the EL-4 experimental nuclear reactor in dismantling (Monts d'Arree- Finistere department)

International Nuclear Information System (INIS)

2006-01-01

In a previous study which concerned the catchment basin of the harbour of Brest, the A.C.R.O. put in evidence a marking by artificial radioelements around the power plant of Brennilis which can be imputed without ambiguities to the nuclear installation. It also put in evidence abnormalities concerning the natural radioactivity which justifies this new study. In the area of the Monts d'Arree, actinium 227 ( 227 Ac), non born by its ascendents which are 235 U and 231 Pa is observed. This phenomenon is characterized by mass activities superior to these ones of 235 U and able to reach these ones of 238 U. Its presence corresponds with the drainage of the Ellez river since the former channel of radioactive effluents releases from the nuclear power plant EL-4 up to the reservoir Saint-Herblot situated 6 km downstream. The strongest values of radioactivity are registered near the disused power plant, at this place a relationship exists between the level of actinium 227 and this one of the artificial radioactivity as it exists a relationship with the decay products of radon exhaled from the subsoil ( 210 Pb). But its presence is not limited to a part of the Ellez river, it is equally observed in terrestrial medium, in places in priori not influenced by the direct liquid effluents of the power plant. This place is situated at more than 4 km and without any connection with the Ellez waters. At this stage of the study, it is not possible to answer with certainty the question of the origin of this phenomenon. A new reorientation is considered indispensable to clarify definitively the origin of this unknown phenomenon in the scientific publications and the environmental monitoring. (N.C.)

Association between Body Mass Index and Health-Related Quality of Life: The "Obesity Paradox" in 21,218 Adults of the Chinese General Population.

Science.gov (United States)

Zhu, Yanbo; Wang, Qi; Pang, Guoming; Lin, Lin; Origasa, Hideki; Wang, Yangyang; Di, Jie; Shi, Mai; Fan, Chunpok; Shi, Huimei

2015-01-01

There was no consistent recognition of the association between high or low body mass index (BMI) and health related quality of life (HRQL). The aim of this research was to study the association between BMI and HRQL in Chinese adults, and to further explore the stability of that association in the subgroup analysis stratified by status of chronic conditions. A total of 21,218 adults aged 18 and older were classified as underweight, normal weight, overweight, class I obese, and class II obese based on their BMI. HRQL was measured by the SF-36 Health Survey. The independent impact of each BMI category on HRQL was examined through standard least squares regression by comparing the difference of SF-36 scores and the minimum clinically important differences (MCID), which was defined as 3 points. Compared to the normal weight, the class I obese was significantly associated with better HRQL scores in the mental component summary (MCS) (75.1 vs. 73.4, Pobese (D=-3.43) and the general health for the underweight (D=-3.71). Stratified analyses showed a similar result in the health subjects and chronic conditions, and it was significant in the chronic conditions. The class I obese showed the best HRQL, especially in the mental domain. The worst HRQL was found in the underweight. The class II obese reduced HRQL in the physical functioning only. "Obesity paradox" was more obvious in the participants with chronic conditions.

Aluminum Lithium Alloy 2195 Fusion Welding Improvements with New Filler Wire

Science.gov (United States)

Russell, C.

2001-01-01

The objective of this research was to assess the B218 weld filler wire for Super Lightweight External Tank production, which could improve current production welding and repair productivity. We took the following approaches: (1) Perform a repair weld quick look evaluation between 4043/B218 and B218/B218 weld filler wire combinations and evaluation tensile properties for planished and unplanished conditions; and (2) Perform repair weld evaluation on structural simulation panel using 4043-B218 and B218/B218 weld filler wire combinations and evaluation tensile and simulated service fracture properties for planished and unplanished conditions.

Tumour and lymph node uptakes on dual-phased 2-deoxy-2-[18F]fluoro-D-glucose positron emission tomography/computed tomography correlate with prognostic parameters in breast cancer.

Science.gov (United States)

Chang, Chin-Chuan; Tu, Hung-Pin; Chen, Yu-Wen; Lin, Chia-Yang; Hou, Ming-Feng

2014-12-01

To examine correlations between the uptake of 2-deoxy-2-[18F]fluoro-D-glucose (FDG) by primary tumours and axillary lymph nodes, and clinical and biological tumour prognostic parameters, in patients with newly diagnosed breast cancer. Newly diagnosed breast cancer patients who had received a dual-phased FDG positron emission tomography/computed tomography scan for pretreatment staging were enrolled retrospectively. Maximal standardized uptake values at 1 h (SUV1), 2 h (SUV2), and retention indices (RI) of the tumours and ipsilateral axillary lymph nodes were measured. SUV and RI were compared with clinical and biological prognostic parameters. A total of 32 patients participated in the study. Tumour FDG uptake correlated with histological grade and tumour size. FDG uptake in axillary lymph nodes correlated positively with lymph node status, metastasis status and clinical stage. RI values for the tumour and lymph nodes were significantly positively correlated with human epidermal growth factor receptor-2 positivity. FDG uptake in tumours and lymph nodes showed correlations with some clinical and biological parameters, and may serve as a predictive marker of tumour biological behaviour in breast cancer. © The Author(s) 2014 Reprints and permissions: sagepub.co.uk/journalsPermissions.nav.

The Non-Destructive Determination of Burn-Up by Means of the Prl44 2.18 M Gamma Activity

International Nuclear Information System (INIS)

Forsyth, R.S.; Blackadder, W.H.

1965-05-01

In recent years, gamma scanning has been used at several establishments for the determination of the burn-up profile along irradiated fuel elements, the 0.75 MeV gamma from Zr-95/Nb-95 being most often employed as the monitored radiation. Difficulties in establishing the geometry and the self-absorption of the gamma activity in the fuel have tended to prevent the application of the method to quantitative burn-up determination, which has usually been carried out by dissolution of selected portions of the fuel followed by conventional fission product separation or by uranium depletion methods. The present paper describes experiments carried out to calibrate a gamma scanner for quantitative measurements by counting the 2.18 MeV gamma activity due to Pr-144, the short-lived daughter of Ce-144 (t 1/2 = 285 days) from selected pellets in several UO 2 fuel specimens. Accurate burn-up values were then determined by dissolution and application of the isotopic dilution method, using stable molybdenum fission products. The elements, which were rotated about their longitudinal axes to minimize asymmetry effects, were viewed by a sodium iodide crystal and a multichannel analyser through a suitable collimator. Correction for attenuation of the gamma activity (much less than for 0.75 MeV) in the fuel elements which were of different diameters (12.6 to 15.04 mm) was made by applying relative attenuation factors and the effective geometry factor of the instrument was determined. In order to check the corrections applied, the counter factor was also calculated, for the 0.75 MeV activity from Zr-95/Nb-95 and in certain cases for the 0.66 MeV activity from Cs-137. The results obtained, demonstrate that at least over the range of diameters and cooling times used the method is suitable for quantitative determinations. Preliminary experiments to explore the possibility of using the high energy gammas (2.35, 2.65 MeV) from Rh-106 as a method for estimating the fraction of fission events

Area 3 Support Buildings (A3SB) H5-0992, H5-0996 PRL 218 Confirmatory Sampling Report

Science.gov (United States)

Mrdjenovich, Timothy

2015-01-01

The Area 3 Support Buildings site (A3SB) consists of two separate areas located on the north side of Beach Road in the northern portion of Kennedy Space Center, Florida (KSC), outside the secured perimeter of KSC. The A3SB areas are approximately 0.6 miles apart, and were developed as Shiffler's Grocery Store and Service Station (west site) and as a residence (east site) prior to acquisition by the National Aeronautics and Space Administration (NASA) in 1963. Both areas were used by the Bendix Company in support of NASA as chemical laboratories from 1963 through 1969. Both of the buildings were demolished by 1987. The west portion of the site was used by the US Fish & Wildlife Service (F&W) in support of the Merritt Island National Wildlife Refuge (MINWR) for parking at the entrance to the Hammock Trails from 1969 to the present. The east portion of the site was used for intermittent suspect materials staging in the early 1990s and is still used as an apiary location, but is otherwise no longer active. In support of the NASA HSWA permit requirements, this site was identified as Potential Release Location (PRL) 218 and a Solid Waste Management Unit (SWMU) Assessment (SA) was conducted in 2013. Confirmatory Sampling (CS) was recommended and approved by the KSC Remediation Team (KSCRT). Three locations of concern (LOCs) were identified and sampled at the site. The LOCs include two former chemical labs and a former suspect staging area. The CS was conducted in March of 2015 at three locations by means of Direct Push Technology (DPT) groundwater sampling and at one location for soil sampling. The samples were collected and analyzed in accordance with the approved CS Work Plan. There were no exceedances of criteria detected in any of the samples from the three LOCs. The results of this investigation indicate that past and/or present operations have not negatively impacted environmental media at the A3SB. Based upon no confirmed groundwater detections above GCTLs and no

SU-E-T-96: An Analysis of VMAT SBRT Lung Treatment Plans

Energy Technology Data Exchange (ETDEWEB)

Wilson, D; James, J; Wang, B; Dunlap, N; Woo, S; Silverman, C; Dragun, A; El-Ghamry, M [Univ Louisville, Louisville, KY (United States)

2015-06-15

Purpose: To present an analysis of 218 lung sbrt treatment plans delivered using Varian Eclipse RapidArc software and delivered with Varian linear accelerators. Methods: A retrospective analysis of treatment plans generated using the Varian Eclipse PRO RapidArc VMAT optimization and AAA photon beam calculation algorithms was done for 218 plans delivered using Varian Trilogy and TrueBeam linear accelerators. Some of the patients were enrolled in the RTOG 0813 and RTOG 0915 lung protocols. All of the patients’ plans were optimized using the guidelines outlined by these protocols. The plans presented were normalized so that 95% of the PTV volume received 100% of the prescribed dose. Results: The dose co formality constraints from the RTOG protocols and the number of plans within those constraints were:Tumor dose between 60% of maximum dose and 90% of maximum: 218/218 = 100%.Volume of 105% tumor dose outside put less than 15% of the PTV volume: 218/218 = 100%.Maximum dose 2 cm away from PTV within protocol table guidelines: No minor deviation: 188/218 = 86.2%. No major deviation: 216/218 = 99.1%.Ratio of 50% dose volume to PTV volume less than R50 in protocol table: No minor deviation 148/218 = 67.9%. No major deviation: 213/218 = 97.7%.Percent of lung receiving 20 Gy less than 10% (no minor violation): 218/218 = 100%.99% of PTV receiving at least 90% of the tumor dose: 214/218 = 98.2%. Conclusion: Varian RapidArc VMAT can successfully deliver lung SBRT treatments as outlined in the RTOG 0813 and 0915 protocols. The largest deviations were seen in the R50 constraints for the larger PTV volumes.

Radionuclide interactions with marine sediments

International Nuclear Information System (INIS)

Higgo, J.J.W.

1987-09-01

A critical review of the literature on the subject of the interactions of radionuclides with marine sediments has been carried out. On the basis of the information available, an attempt has been made to give ranges and 'best estimates' for the distribution ratios between seawater and sediments. These estimates have been based on an understanding of the sediment seawater system and the porewater chemistry and mineralogy. Field measurements, laboratory measurements and estimates based on stable-element geochemical data are all taken into account. Laboratory measurements include distribution-ratio and diffusion-coefficient determinations. The elements reviewed are carbon, chlorine, calcium, nickel, selenium, strontium, zirconium, niobium, technetium, tin, iodine, caesium, lead, radium, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium and curium. (author)

Calculation technique of free and impurity ion electronic structures

International Nuclear Information System (INIS)

Kulagin, N.A.; Sviridov, D.T.

1986-01-01

The monograph deals with calculation technique of free and impurity ion spectra with completed nl N -shell. The principles of the theory of irreducible tensor operators, genealogical coefficients, calculation technique of angular and radial parts of matrix elements operators are stated. The correlation accounting methods in free ions are considered in detail. The principles of the theory of crystal field and ligand field, the method of self-consistent field for impurity ions are reported. The technique efficiency based on example of lanthanum and actinium group ions is shown. Experimental data by nf N -ion spectra are given. The tables of angular coefficients, energy values of X-ray lines of rare earth ions and genealogical coefficients are given in the appendix

JAEA thermodynamic database for performance assessment of geological disposal of high-level and TRU wastes. Refinement of thermodynamic data for trivalent actinoids and samarium

International Nuclear Information System (INIS)

Kitamura, Akira; Fujiwara, Kenso; Yui, Mikazu

2010-01-01

Within the scope of the JAEA thermodynamic database project for performance assessment of geological disposal of high-level radioactive and TRU wastes, the refinement of the thermodynamic data for the inorganic compounds and complexes of trivalent actinoids (actinium(III), plutonium(III), americium(III) and curium(III)) and samarium(III) was carried out. Refinement of thermodynamic data for these elements was based on the thermodynamic database for americium published by the Nuclear Energy Agency in the Organisation for Economic Co-operation and Development (OECD/NEA). Based on the similarity of chemical properties among trivalent actinoids and samarium, complementary thermodynamic data for their species expected under the geological disposal conditions were selected to complete the thermodynamic data set for the performance assessment of geological disposal of radioactive wastes. (author)

Formerly utilized MED/AEC sites Remedial Action Program. Radiological survey of the St. Louis Airport Storage Site, St. Louis, Missouri. Final report. [U, Ra-bearing wastes stored in 1940-60's

Energy Technology Data Exchange (ETDEWEB)

None

1979-09-01

Results of two radiological surveys of the St. Louis-Lambert Airport property, formerly known as the Airport Storage Site, St. Louis, Missouri, are presented. Uranium- and radium-bearing waste materials were stored from the 1940's to the late 1960's in this area. The surveys included direct measurements of beta-gamma radiation; determination of uranium, actinium, and radium concentrations in soil samples and from bore holes; determination of radionuclide concentrations in groundwater and surface water; measurement of radon flux from the ground surface; and measurements of /sup 222/Rn in air near the site. Results indicate that some offsite drainage pathways are becoming contaminated, probably by runoff from the site; no migration of /sup 222/Rn from the site was observed.

O-(2-18F-fluoroethyl)-L-tyrosine PET for evaluation of brain metastasis recurrence after radiotherapy: an effectiveness and cost-effectiveness analysis.

Science.gov (United States)

Heinzel, Alexander; Müller, Dirk; Yekta-Michael, Sareh Said; Ceccon, Garry; Langen, Karl-Josef; Mottaghy, Felix M; Wiesmann, Martin; Kocher, Martin; Hattingen, Elke; Galldiks, Norbert

2017-09-01

Conventional MRI is the standard method to diagnose recurrence of brain metastases after radiation. However, following radiation therapy, reactive transient blood-brain barrier alterations with consecutive contrast enhancement can mimic brain metastasis recurrence. Recent studies have suggested that O-(2-18F-fluoroethyl)-L-tyrosine (FET) PET improves the correct differentiation of brain metastasis recurrence from radiation injury. Based on published evidence and clinical expert opinion, we analyzed effectiveness and cost-effectiveness of the use of FET PET in addition to MRI compared with MRI alone for the diagnosis of recurrent brain metastases. A decision-tree model was designed to compare the 2 diagnostic strategies from the perspective of the German Statutory Health Insurance (SHI) system. Effectiveness was defined as correct diagnosis of recurrent brain metastasis and was compared between FET PET with MRI and MRI alone. Costs were calculated for a baseline scenario and for a more expensive scenario. Robustness of the results was tested using sensitivity analyses. Compared with MRI alone, FET PET in combination with MRI increases the rate of correct diagnoses by 42% (number needed to diagnose of 3) with an incremental cost-effectiveness ratio of €2821 (baseline scenario) and €4014 (more expensive scenario) per correct diagnosis. The sensitivity analyses confirmed the robustness of the results. The model suggests that the additional use of FET PET with conventional MRI for the diagnosis of recurrent brain metastases may be cost-effective. Integration of FET PET has the potential to avoid overtreatment with corresponding costs as well as unnecessary side effects. © The Author(s) 2017. Published by Oxford University Press on behalf of the Society for Neuro-Oncology. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com

Physical activity attenuates the influence of FTO variants on obesity risk: a meta-analysis of 218,166 adults and 19,268 children.

Directory of Open Access Journals (Sweden)

Tuomas O Kilpeläinen

2011-11-01

Full Text Available The FTO gene harbors the strongest known susceptibility locus for obesity. While many individual studies have suggested that physical activity (PA may attenuate the effect of FTO on obesity risk, other studies have not been able to confirm this interaction. To confirm or refute unambiguously whether PA attenuates the association of FTO with obesity risk, we meta-analyzed data from 45 studies of adults (n = 218,166 and nine studies of children and adolescents (n = 19,268.All studies identified to have data on the FTO rs9939609 variant (or any proxy [r(2>0.8] and PA were invited to participate, regardless of ethnicity or age of the participants. PA was standardized by categorizing it into a dichotomous variable (physically inactive versus active in each study. Overall, 25% of adults and 13% of children were categorized as inactive. Interaction analyses were performed within each study by including the FTO×PA interaction term in an additive model, adjusting for age and sex. Subsequently, random effects meta-analysis was used to pool the interaction terms. In adults, the minor (A- allele of rs9939609 increased the odds of obesity by 1.23-fold/allele (95% CI 1.20-1.26, but PA attenuated this effect (p(interaction  = 0.001. More specifically, the minor allele of rs9939609 increased the odds of obesity less in the physically active group (odds ratio  = 1.22/allele, 95% CI 1.19-1.25 than in the inactive group (odds ratio  = 1.30/allele, 95% CI 1.24-1.36. No such interaction was found in children and adolescents.The association of the FTO risk allele with the odds of obesity is attenuated by 27% in physically active adults, highlighting the importance of PA in particular in those genetically predisposed to obesity.

The use of dynamic O-(2-18F-fluoroethyl)-l-tyrosine PET in the diagnosis of patients with progressive and recurrent glioma.

Science.gov (United States)

Galldiks, Norbert; Stoffels, Gabriele; Filss, Christian; Rapp, Marion; Blau, Tobias; Tscherpel, Caroline; Ceccon, Garry; Dunkl, Veronika; Weinzierl, Martin; Stoffel, Michael; Sabel, Michael; Fink, Gereon R; Shah, Nadim J; Langen, Karl-Josef

2015-09-01

We evaluated the diagnostic value of static and dynamic O-(2-[(18)F]fluoroethyl)-L-tyrosine ((18)F-FET) PET parameters in patients with progressive or recurrent glioma. We retrospectively analyzed 132 dynamic (18)F-FET PET and conventional MRI scans of 124 glioma patients (primary World Health Organization grade II, n = 55; grade III, n = 19; grade IV, n = 50; mean age, 52 ± 14 y). Patients had been referred for PET assessment with clinical signs and/or MRI findings suggestive of tumor progression or recurrence based on Response Assessment in Neuro-Oncology criteria. Maximum and mean tumor/brain ratios of (18)F-FET uptake were determined (20-40 min post-injection) as well as tracer uptake kinetics (ie, time to peak and patterns of the time-activity curves). Diagnoses were confirmed histologically (95%) or by clinical follow-up (5%). Diagnostic accuracies of PET and MR parameters for the detection of tumor progression or recurrence were evaluated by receiver operating characteristic analyses/chi-square test. Tumor progression or recurrence could be diagnosed in 121 of 132 cases (92%). MRI and (18)F-FET PET findings were concordant in 84% and discordant in 16%. Compared with the diagnostic accuracy of conventional MRI to diagnose tumor progression or recurrence (85%), a higher accuracy (93%) was achieved by (18)F-FET PET when a mean tumor/brain ratio ≥2.0 or time to peak dynamic (18)F-FET PET parameters differentiate progressive or recurrent glioma from treatment-related nonneoplastic changes with higher accuracy than conventional MRI. © The Author(s) 2015. Published by Oxford University Press on behalf of the Society for Neuro-Oncology. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

Characterization of Growing Soil Bacterial Communities across a pH gradient Using H218O DNA-Stable Isotope Probing

Science.gov (United States)

Welty-Bernard, A. T.; Schwartz, E.

2014-12-01

Recent studies have established consistent relationships between pH and bacterial diversity and community structure in soils from site-specific to landscape scales. However, these studies rely on DNA or PLFA extraction techniques from bulk soils that encompass metabolically active and inactive, or dormant, communities, and loose DNA. Dormant cells may comprise up to 80% of total live cells. If dormant cells dominate a particular environment, it is possible that previous interpretations of the soil variables assumed to drive communities could be profoundly affected. We used H218O stable isotope probing and bar-coded illumina sequencing of 16S rRNA genes to monitor the response of actively growing communities to changes in soil pH in a soil microcosm over 14 days. This substrate-independent approach has several advantages over 13C or 15N-labelled molecules in that all growing bacteria should be able to make use of water, allowing characterization of whole communities. We hypothesized that Acidobacteria would increasingly dominate the growing community and that Actinobacteria and Bacteroidetes would decline, given previously established responses by these taxa to soil pH. Instead, we observed the reverse. Actinobacteria abundance increased three-fold from 26 to 76% of the overall community as soil pH fell from pH 5.6 to pH 4.6. Shifts in community structure and decreases in diversity with declining soil pH were essentially driven by two families, Streptomyceaca and Microbacteracea, which collectively increased from 2 to 40% of the entire community. In contrast, Acidobacteria as a whole declined although numbers of subdivision 1 remained stable across all soil pH levels. We suggest that the brief incubation period in this SIP study selected for growth of acid-tolerant Actinobacteria over Acidobacteria. Taxa within Actinomycetales have been readily cultured over short time frames, suggesting rapid growth patterns. Conversely, taxa within Acidobacteria have been

Dissolved Concentration Limits of Radioactive Elements

Energy Technology Data Exchange (ETDEWEB)

Y. Chen; E.R. Thomas; F.J. Pearson; P.L. Cloke; T.L. Steinborn; P.V. Brady

2003-06-20

The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of radioactive elements under possible repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, and measurements made in laboratory experiments and field work. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 radioactive elements (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium), which are important to calculated dose. Model outputs are mainly in the form of look-up tables plus one or more uncertainty terms. The rest are either in the form of distributions or single values. The results of this analysis are fundamental inputs for total system performance assessment to constrain the release of these elements from waste packages and the engineered barrier system. Solubilities of plutonium, neptunium, uranium, americium, actinium, thorium, protactinium, lead, and radium have been re-evaluated using the newly updated thermodynamic database (Data0.ymp.R2). For all of the actinides, identical modeling approaches and consistent environmental conditions were used to develop solubility models in this revision. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, activity coefficients, and selection of solubility controlling phase have been quantified or otherwise addressed. Moreover, a new blended plutonium solubility model has been developed in this revision, which gives a mean solubility that is three orders of magnitude lower than the plutonium solubility model used for the Total System Performance Assessment for the Site Recommendation. Two alternative neptunium solubility models have also been

Dissolved Concentration Limits of Radioactive Elements

International Nuclear Information System (INIS)

Y. Chen; E.R. Thomas; F.J. Pearson; P.L. Cloke; T.L. Steinborn; P.V. Brady

2003-01-01

The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of radioactive elements under possible repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, and measurements made in laboratory experiments and field work. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 radioactive elements (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium), which are important to calculated dose. Model outputs are mainly in the form of look-up tables plus one or more uncertainty terms. The rest are either in the form of distributions or single values. The results of this analysis are fundamental inputs for total system performance assessment to constrain the release of these elements from waste packages and the engineered barrier system. Solubilities of plutonium, neptunium, uranium, americium, actinium, thorium, protactinium, lead, and radium have been re-evaluated using the newly updated thermodynamic database (Data0.ymp.R2). For all of the actinides, identical modeling approaches and consistent environmental conditions were used to develop solubility models in this revision. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, activity coefficients, and selection of solubility controlling phase have been quantified or otherwise addressed. Moreover, a new blended plutonium solubility model has been developed in this revision, which gives a mean solubility that is three orders of magnitude lower than the plutonium solubility model used for the Total System Performance Assessment for the Site Recommendation. Two alternative neptunium solubility models have also been

How fission was discovered

International Nuclear Information System (INIS)

Fluegge, S.

1989-01-01

After the great survey of neutron induced radioactivity by Fermi and co-workers, the laboratories in Paris and Berlin-Dahlen tried to disentangle the complex results found in uranium. At that time neutron sources were small, activities low, and equipment very simple. Chemistry beyond uranium still was unknown. Hahn and Meitner believed to have observed three transuranic isomeric chains, a doubtful result even then. Early in 1938, Curie and Savic in Paris found an activity interpreted to be actinium, and Hahn and Meitner another to be radium. Both interpretations seemed impossible from energy considerations. Hahn and Strassmann, therefore, continued this work and succeeded to separate the new activity from radium. There remained no doubt that a barium isotope had been produced, the uranium nucleus splitting in the yet-unknown process we now call fission

Association between Body Mass Index and Health-Related Quality of Life: The "Obesity Paradox" in 21,218 Adults of the Chinese General Population.

Directory of Open Access Journals (Sweden)

Yanbo Zhu

Full Text Available There was no consistent recognition of the association between high or low body mass index (BMI and health related quality of life (HRQL. The aim of this research was to study the association between BMI and HRQL in Chinese adults, and to further explore the stability of that association in the subgroup analysis stratified by status of chronic conditions.A total of 21,218 adults aged 18 and older were classified as underweight, normal weight, overweight, class I obese, and class II obese based on their BMI. HRQL was measured by the SF-36 Health Survey. The independent impact of each BMI category on HRQL was examined through standard least squares regression by comparing the difference of SF-36 scores and the minimum clinically important differences (MCID, which was defined as 3 points.Compared to the normal weight, the class I obese was significantly associated with better HRQL scores in the mental component summary (MCS (75.1 vs. 73.4, P<0.001. The underweight had the lowest score in both the physical components summary (PCS (75.4 vs. 77.5, P<0.001 and mental components summary (MCS (71.8 vs. 73.4, P<0.001. For the MCID, the HRQL score was reduced by more than 3 points in the physical functioning for the class II obese (D=-3.43 and the general health for the underweight (D=-3.71. Stratified analyses showed a similar result in the health subjects and chronic conditions, and it was significant in the chronic conditions.The class I obese showed the best HRQL, especially in the mental domain. The worst HRQL was found in the underweight. The class II obese reduced HRQL in the physical functioning only. "Obesity paradox" was more obvious in the participants with chronic conditions.

The Non-Destructive Determination of Burn-Up by Means of the Pr{sup l44} 2.18 M Gamma Activity

Energy Technology Data Exchange (ETDEWEB)

Forsyth, R S; Blackadder, W H

1965-05-15

In recent years, gamma scanning has been used at several establishments for the determination of the burn-up profile along irradiated fuel elements, the 0.75 MeV gamma from Zr-95/Nb-95 being most often employed as the monitored radiation. Difficulties in establishing the geometry and the self-absorption of the gamma activity in the fuel have tended to prevent the application of the method to quantitative burn-up determination, which has usually been carried out by dissolution of selected portions of the fuel followed by conventional fission product separation or by uranium depletion methods. The present paper describes experiments carried out to calibrate a gamma scanner for quantitative measurements by counting the 2.18 MeV gamma activity due to Pr-144, the short-lived daughter of Ce-144 (t{sub 1/2} = 285 days) from selected pellets in several UO{sub 2} fuel specimens. Accurate burn-up values were then determined by dissolution and application of the isotopic dilution method, using stable molybdenum fission products. The elements, which were rotated about their longitudinal axes to minimize asymmetry effects, were viewed by a sodium iodide crystal and a multichannel analyser through a suitable collimator. Correction for attenuation of the gamma activity (much less than for 0.75 MeV) in the fuel elements which were of different diameters (12.6 to 15.04 mm) was made by applying relative attenuation factors and the effective geometry factor of the instrument was determined. In order to check the corrections applied, the counter factor was also calculated, for the 0.75 MeV activity from Zr-95/Nb-95 and in certain cases for the 0.66 MeV activity from Cs-137. The results obtained, demonstrate that at least over the range of diameters and cooling times used the method is suitable for quantitative determinations. Preliminary experiments to explore the possibility of using the high energy gammas (2.35, 2.65 MeV) from Rh-106 as a method for estimating the fraction of

New method for large scale production of medically applicable Actinium-225 and Radium-223

International Nuclear Information System (INIS)

Aliev, R.A.; Vasilyev, A.N.; Ostapenko, V.; Kalmykov, S.N.; Zhuikov, B.L.; Ermolaev, S.V.; Lapshina, E.V.

2014-01-01

Alpha-emitters ( 211 At, 212 Bi, 213 Bi, 223 Ra, 225 Ac) are promising for targeted radiotherapy of cancer. Only two alpha decays near a cell membrane result in 50% death of cancer cell and only a single decay inside the cell is required for this. 225 Ac may be used either directly or as a mother radionuclide in 213 Bi isotope generator. Production of 225 Ac is provided by three main suppliers - Institute for Transuranium Elements in Germany, Oak Ridge National Laboratory in USA and Institute of Physics and Power Engineering in Obninsk, Russia. The current worldwide production of 225 Ac is approximately 1.7 Ci per year that corresponds to only 100-200 patients that could be treated annually. The common approach for 225 Ac production is separation from mother 229 Th or irradiation of 226 Ra with protons in a cyclotron. Both the methods have some practical limitations to be applied routinely. 225 Ac can be also produced by irradiation of natural thorium with medium energy protons . Cumulative cross sections of 225 Ac, 227 Ac, 227 Th, 228 Th formations have been obtained recently. Thorium targets (1-9 g) were irradiated by 114-91 MeV proton beam (1-50 μA) at INR linear accelerator. After dissolution in 8 M HNO 3 + 0.004 M HF thorium was removed by double LLX by HDEHP in toluene (1:1). Ac and REE were pre-concentrated and separated from Ra and most fission products by DGA-Resin (Triskem). After washing out by 0.01 M HNO 3 Ac was separated from REE by TRU Resin (Triskem) in 3 M HNO 3 media. About 6 mCi 225 Ac were separated in hot cell with chemical yield 85%. The method may be upscaled for production of Ci amounts of the radionuclide. The main impurity is 227 Ac (0.1% at the EOB) but it does not hinder 225 Ac from being used for medical 225 Ac/ 213 Bi generators. (author)

Prognostic value of negative interim 2-["1"8F]-fluoro-2-deoxy-D-glucose PET/CT in diffuse large B-cell lymphoma

International Nuclear Information System (INIS)

Kwon, S.H.; Kang, D.R.; Kim, J.; Yoon, J.-K.; Lee, S.J.; Jeong, S.H.; Lee, H.W.; An, Y.-S.

2016-01-01

Aim: To assess the prognostic value of negative interim combined 2-["1"8F]-fluoro-2-deoxy-D-glucose ("1"8F-FDG) positron-emission tomography/computed tomography (PET/CT) in patients with diffuse large B-cell lymphoma (DLBCL). Materials and methods: Ninety-two patients with histologically proven DLBCL were enrolled. All of the patients underwent "1"8F-FDG PET/CT at diagnosis, and interim PET/CT after the second cycle of chemotherapy with rituximab, cyclophosphamide, hydroxydaunorubicin, vincristine, and prednisolone (R-CHOP). Negative interim PET/CT was defined as the disappearance of all abnormal "1"8F-FDG uptake compared to the pretreatment PET/CT image, as determined by visual assessment. The clinical outcome of patients was estimated as progression-free survival (PFS), and the prognostic significance of clinicopathological and imaging parameters were assessed using the Cox proportional hazards model. Results: Thirty-six patients (39.1%) showed lymphoma progression within a median follow-up of 30.8 months. According to univariate analysis, Ann Arbor stage, serum lactate dehydrogenase level, Eastern Cooperative Oncology Group scale, International Prognostic Index (IPI) score, and maximum standardised uptake values on initial PET/CT were significant prognostic factors for PFS (all p<0.05). Among these parameters, only the IPI score was an independent predictor for PFS (p=0.044). Survival of patients with a high IPI score (≥3) was poorer than those with a low IPI score (0–2; p<0.001). Conclusion: Despite a negative interim "1"8F-FDG PET/CT, approximately 39% of DLBCL patients showed progression during follow-up. Although the negative PET/CT was obtained during chemotherapy, it is important to closely follow-up patients, especially those with a high IPI score. - Highlights: • About 39% of patients showed progression after negative interim PET/CT. • The IPI score was an independent predictor for PFS. • It is important to closely follow-up with high IPI score

Process for radioisotope recovery and system for implementing same

Science.gov (United States)

Meikrantz, David H [Idaho Falls, ID; Todd, Terry A [Aberdeen, ID; Tranter, Troy J [Idaho Falls, ID; Horwitz, E Philip [Naperville, IL

2009-10-06

A method of recovering daughter isotopes from a radioisotope mixture. The method comprises providing a radioisotope mixture solution comprising at least one parent isotope. The at least one parent isotope is extracted into an organic phase, which comprises an extractant and a solvent. The organic phase is substantially continuously contacted with an aqueous phase to extract at least one daughter isotope into the aqueous phase. The aqueous phase is separated from the organic phase, such as by using an annular centrifugal contactor. The at least one daughter isotope is purified from the aqueous phase, such as by ion exchange chromatography or extraction chromatography. The at least one daughter isotope may include actinium-225, radium-225, bismuth-213, or mixtures thereof. A liquid-liquid extraction system for recovering at least one daughter isotope from a source material is also disclosed.

22 CFR 218.03 - Definitions.

Science.gov (United States)

2010-04-01

...) United States (b) As used in this part, (1) Agency means the Department of State, the U.S. International..., university, or other postsecondary institution, or a public system of higher education; or (B) A local educational agency (as defined in 20 U.S.C. 7801), system of vocational education, or other school system...

49 CFR 218.5 - Definitions.

Science.gov (United States)

2010-10-01

.... Group of workers means two or more workers of the same or different crafts assigned to work together as... assigned such work on railroad rolling equipment that is not part of the train or yard movement they have... which the testing, servicing, repair, inspection, or rebuilding of railroad rolling equipment is under...

50 CFR 218.23 - Mitigation.

Science.gov (United States)

2010-10-01

... to avoid a collision with any marine animal and can be stopped within a distance appropriate to the... for marine mammals and shall report any sightings to the surface observers. These animals shall be... and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION...

50 CFR 218.183 - Mitigation.

Science.gov (United States)

2010-10-01

... within the command structure in order to facilitate implementation of mitigation measures if marine... attention to the things on the outer edges of their field of vision. (viii) Marine observers shall be...

50 CFR 218.4 - Mitigation.

Science.gov (United States)

2010-10-01

... species mitigation measures. (B) Commanding Officers shall make use of marine species detection cues and... entire target area shall take place with “Big Eyes” and the naked eye during the retrieval of the IMPASS...

10 CFR 218.10 - Rule.

Science.gov (United States)

2010-01-01

... necessary for implementation of the obligations of the United States under chapters III and IV of the IEP that relate to the mandatory international allocation of oil by IEP participating countries. (b) Any...

10 CFR 218.3 - Definitions.

Science.gov (United States)

2010-01-01

... International Energy Agency established to implement the IEP. IEP means the International Energy Program... that the President determines allocation of petroleum products to nations participating in the IEP is required by chapters III and IV of the IEP and (b) ending on a date on which he determines such allocation...

50 CFR 218.13 - Mitigation.

Science.gov (United States)

2010-10-01

... Anchoring drills and the Shipboard Electronic System Evaluation Facility range that necessarily operate at... night vision devices available for use. (ii) Operating Procedures & Collision Avoidance: (A) Prior to... create an imminent and serious threat to a person, vessel, or aircraft, and to the extent vessels are...

76 FR 29797 - Westpoint Home, Inc., New York Corporate Sales Office, New York, NY, Including Employees Working...

Science.gov (United States)

2011-05-23

... Home, Inc., New York Corporate Sales Office, working off-site in Illinois, Georgia, Minnesota, Indiana...,218B, TA-W-74,218C, TA-W-74,218D] Westpoint Home, Inc., New York Corporate Sales Office, New York, NY, Including Employees Working Off-Site in Illinois, Georgia, Minnesota, Indiana, North Carolina; Westpoint...

Request for interim approval to operate Trench 94 of the 218-E-12B Burial Ground as a chemical waste landfill for disposal of polychlorinated biphenyl waste in submarine reactor compartments

International Nuclear Information System (INIS)

Cummins, G.D.

1994-06-01

This request is submitted to seek interim approval to operate a Toxic Substances Control Act (TSCA) of 1976 chemical waste landfill for the disposal of polychlorinated biphenyl (PCB) waste. Operation of a chemical waste landfill for disposal of PCB waste is subject to the TSCA regulations of 40 CFR 761. Interim approval is requested for a period not to exceed 5 years from the date of approval. This request covers only the disposal of small 10 quantities of solid PCB waste contained in decommissioned, defueled submarine reactor compartments (SRC). In addition, the request applies only to disposal 12 of this waste in Trench 94 of the 218-E-12B Burial Ground (Trench 94) in the 13 200 East Area of the US Department of Energy's (DOE) Hanford Facility. Disposal of this waste will be conducted in accordance with the Compliance 15 Agreement (Appendix H) between the DOE Richland Operations Office (DOE-RL) and 16 the US Environmental Protection Agency (EPA), Region 10. During the 5-year interim approval period, the DOE-RL will submit an application seeking final 18 approval for operation of Trench 94 as a chemical waste landfill, including 19 any necessary waivers, and also will seek a final dangerous waste permit from 20 the Washington State Department of Ecology (Ecology) for disposal of lead 21 shielding contained in the SRCS

Sick-leave track record and other potential predictors of a disability pension. A population based study of 8,218 men and women followed for 16 years

Directory of Open Access Journals (Sweden)

Rosengren Annika

2009-04-01

Full Text Available Abstract Background A number of previous studies have investigated various predictors for being granted a disability pension. The aim of this study was to test the efficacy of sick-leave track record as a predictor of being granted a disability pension in a large dataset based on subjects sampled from the general population and followed for a long time. Methods Data from five ongoing population-based Swedish studies was used, supplemented with data on all compensated sick leave periods, disability pensions granted, and vital status, obtained from official registers. The data set included 8,218 men and women followed for 16 years, generated 109,369 person years of observation and 97,160 sickness spells. Various measures of days of sick leave during follow up were used as independent variables and disability pension grant was used as outcome. Results There was a strong relationship between individual sickness spell duration and annual cumulative days of sick leave on the one hand and being granted a disability pension on the other, among both men and women, after adjustment for the effects of marital status, education, household size, smoking habits, geographical area and calendar time period, a proxy for position in the business cycle. The interval between sickness spells showed a corresponding inverse relationship. Of all the variables studied, the number of days of sick leave per year was the most powerful predictor of a disability pension. For both men and women 245 annual sick leave days were needed to reach a 50% probability of transition to disability. The independent variables, taken together, explained 96% of the variation in disability pension grantings. Conclusion The sick-leave track record was the most important predictor of the probability of being granted a disability pension in this study, even when the influences of other variables affecting the outcome were taken into account.

Immunogenicity and safety of a single dose of a CRM-conjugated meningococcal ACWY vaccine in children and adolescents aged 2-18 years in Taiwan: results of an open label study.

Science.gov (United States)

Huang, Li-Min; Chiu, Nan-Chang; Yeh, Shu-Jen; Bhusal, Chiranjiwi; Arora, Ashwani Kumar

2014-09-08

MenACWY-CRM (Menveo®, Novartis Vaccines, Siena, Italy) is a quadrivalent meningococcal conjugate vaccine developed to help prevent invasive meningococcal disease caused by Neisseria meningitidis serogroups A, C, W, and Y. It is approved within the European Union in persons >2 years of age and in persons from 2 months to 55 years of age in the United States, among other countries. Little is known about the immunogenicity and safety of this vaccine in Taiwanese children >2 years and adolescents. This study assessed the immunogenicity and safety of a single injection of MenACWY-CRM vaccine in Taiwanese subjects aged 2-18 years old. In this phase III, multicentre, open-label study 341 subjects received one dose of MenACWY-CRM. Immunogenicity measures were rates of seroresponse (defined as the proportion of subjects with a postvaccination hSBA ≥1:8 if the prevaccination (baseline) titre was CRM vaccination at Day 29 for the serogroups A, C, W, and Y were 83%, 93%, 50%, and 65%, respectively. At Day 29 the percentages of subjects with hSBA ≥1:8 against all four serogroups A, C, W and Y were: 83%, 96%, 96% and 82%, respectively. GMTs against all serogroups rose by ≥7-fold from baseline to Day 29. The vaccine was well tolerated. A single dose of MenACWY-CRM demonstrated a robust immune response, and an acceptable safety profile in Taiwanese children and adolescents. Copyright © 2014 Elsevier Ltd. All rights reserved.

The chemistry of the actinide elements. Volume I

International Nuclear Information System (INIS)

Katz, J.J.; Seaborg, G.T.; Morss, L.R.

1986-01-01

The Chemistry of the Actinide Elements is a comprehensive, contemporary and authoritative exposition of the chemistry and related properties of the 5f series of elements: actinium, thorium, protactinium, uranium and the first eleven. This second edition has been completely restructured and rewritten to incorporate current research in all areas of actinide chemistry and chemical physics. The descriptions of each element include accounts of their history, separation, metallurgy, solid-state chemistry, solution chemistry, thermo-dynamics and kinetics. Additionally, separate chapters on spectroscopy, magnetochemistry, thermodynamics, solids, the metallic state, complex ions and organometallic compounds emphasize the comparative chemistry and unique properties of the actinide series of elements. Comprehensive lists of properties of all actinide compounds and ions in solution are given, and there are special sections on such topics as biochemistry, superconductivity, radioisotope safety, and waste management, as well as discussion of the transactinides and future elements

A neutron source of variable fluence

International Nuclear Information System (INIS)

Brachet, Guy; Demichel, Pascal; Prigent, Yvon; Riche, J.C.

1975-01-01

The invention concerns a variable fluence neutron source, like those that use in the known way a reaction between a radioactive emitter and a target, particularly of type (α,n). The emitter being in powder form lies in a carrier fluid forming the target, inside a closed containment. Facilities are provided to cause the fluidisation of the emitter by the carrier fluid in the containment. The fluidisation of the emitting powder is carried out by a booster with blades, actuated from outside by a magnetic coupling. The powder emitter is a α emitter selected in the group of curium, plutonium, thorium, actinium and americium oxides and the target fluid is formed of compounds of light elements selected from the group of beryllium, boron, fluorine and oxygen 18. The target fluid is a gas used under pressure or H 2 O water highly enriched in oxygen 18 [fr

Lipidomics and H218O labeling techniques reveal increased remodeling of DHA-containing membrane phospholipids associated with abnormal locomotor responses in α-tocopherol deficient zebrafish (danio rerio embryos

Directory of Open Access Journals (Sweden)

Melissa Q. McDougall

2016-08-01

Full Text Available We hypothesized that vitamin E (α-tocopherol is required by the developing embryonic brain to prevent depletion of highly polyunsaturated fatty acids, especially docosahexaenoic acid (DHA, 22:6, the loss of which we predicted would underlie abnormal morphological and behavioral outcomes. Therefore, we fed adult 5D zebrafish (Danio rerio defined diets without (E− or with added α-tocopherol (E+, 500 mg RRR-α-tocopheryl acetate/kg diet for a minimum of 80 days, and then spawned them to obtain E− and E+ embryos. The E− compared with E+ embryos were 82% less responsive (p<0.01 to a light/dark stimulus at 96 h post-fertilization (hpf, demonstrating impaired locomotor behavior, even in the absence of gross morphological defects. Evaluation of phospholipid (PL and lysophospholipid (lyso-PL composition using untargeted lipidomics in E− compared with E+ embryos at 24, 48, 72, and 120 hpf showed that four PLs and three lyso-PLs containing docosahexaenoic acid (DHA, including lysophosphatidylcholine (LPC 22:6, required for transport of DHA into the brain, p<0.001, were at lower concentrations in E− at all time-points. Additionally, H218O labeling experiments revealed enhanced turnover of LPC 22:6 (p<0.001 and three other DHA-containing PLs in the E− compared with the E+ embryos, suggesting that increased membrane remodeling is a result of PL depletion. Together, these data indicate that α-tocopherol deficiency in the zebrafish embryo causes the specific depletion and increased turnover of DHA-containing PL and lyso-PLs, which may compromise DHA delivery to the brain and thereby contribute to the functional impairments observed in E− embryos.

Request for interim approval to operate Trench 94 of the 218-E-12B Burial Ground as a chemical waste landfill for disposal of polychlorinated biphenyl waste in submarine reactor compartments. Revision 2

Energy Technology Data Exchange (ETDEWEB)

Cummins, G.D.

1994-06-01

This request is submitted to seek interim approval to operate a Toxic Substances Control Act (TSCA) of 1976 chemical waste landfill for the disposal of polychlorinated biphenyl (PCB) waste. Operation of a chemical waste landfill for disposal of PCB waste is subject to the TSCA regulations of 40 CFR 761. Interim approval is requested for a period not to exceed 5 years from the date of approval. This request covers only the disposal of small 10 quantities of solid PCB waste contained in decommissioned, defueled submarine reactor compartments (SRC). In addition, the request applies only to disposal 12 of this waste in Trench 94 of the 218-E-12B Burial Ground (Trench 94) in the 13 200 East Area of the US Department of Energy`s (DOE) Hanford Facility. Disposal of this waste will be conducted in accordance with the Compliance 15 Agreement (Appendix H) between the DOE Richland Operations Office (DOE-RL) and 16 the US Environmental Protection Agency (EPA), Region 10. During the 5-year interim approval period, the DOE-RL will submit an application seeking final 18 approval for operation of Trench 94 as a chemical waste landfill, including 19 any necessary waivers, and also will seek a final dangerous waste permit from 20 the Washington State Department of Ecology (Ecology) for disposal of lead 21 shielding contained in the SRCS.

Radon Daughters Background Reduction in Alpha Particles Counting System

International Nuclear Information System (INIS)

Dadon, S. S.; Pelled, O.; Orion, I.

2014-01-01

The ABPC method is using a serially occurring events of the beta decay of the 214Bi fallow by alpha decay of the 214Po that take place almost simultaneously to detect the Pseudo Coincidence Event (PCE) from the RDP, and to subtract them from the gross alpha counts. 267 This work showed that it is possible to improve the efficiency of RDP background reduction, including subtracting the 218Po contribution by using the ABPC method based on a single solid state silicon PIPS detector. False counts percentage obtained at the output of the PCE circuit were smaller than 0.1%. The results show that the PCE circuit was not influenced by non RDP alpha emitters. The PCE system did not reduce the non PCE of the 218Po. After 20 minutes the 218Po was strongly decayed, and its contribution became negligible. In order to overcome this disadvantage, a mathematical matching calculations for the 214Po and the 218Po decay equations were employed, and a constant ratio of the APo214(0) / APo218(0) was obtained. This ratio can be used to estimate the count rate of the 218Po at the first 20 minutes, and to subtract it from the total count rate in order to obtain correct RDP reduction

A perillyl alcohol-conjugated analog of 3-bromopyruvate without cellular uptake dependency on monocarboxylate transporter 1 and with activity in 3-BP-resistant tumor cells.

Science.gov (United States)

Chen, Thomas C; Yu, Jiali; Nouri Nigjeh, Eslam; Wang, Weijun; Myint, Phyo Thazin; Zandi, Ebrahim; Hofman, Florence M; Schönthal, Axel H

2017-08-01

The anticancer agent 3-bromopyruvate (3-BP) is viewed as a glycolytic inhibitor that preferentially kills glycolytic cancer cells through energy depletion. However, its cytotoxic activity is dependent on cellular drug import through transmembrane monocarboxylate transporter 1 (MCT-1), which restricts its anticancer potential to MCT-1-positive tumor cells. We created and characterized an MCT-1-independent analog of 3-BP, called NEO218. NEO218 was synthesized by covalently conjugating 3-BP to perillyl alcohol (POH), a natural monoterpene. The responses of various tumor cell lines to treatment with either compound were characterized in the presence or absence of supplemental pyruvate or antioxidants N-acetyl-cysteine (NAC) and glutathione (GSH). Drug effects on glyceraldehyde 3-phosphate dehydrogenase (GAPDH) enzyme activity were investigated by mass spectrometric analysis. The development of 3-BP resistance was investigated in MCT-1-positive HCT116 colon carcinoma cells in vitro. Our results show that NEO218: (i) pyruvylated GAPDH on all 4 of its cysteine residues and shut down enzymatic activity; (ii) severely lowered cellular ATP content below life-sustaining levels, and (iii) triggered rapid necrosis. Intriguingly, supplemental antioxidants effectively prevented cytotoxic activity of NEO218 as well as 3-BP, but supplemental pyruvate powerfully protected cells only from 3-BP, not from NEO218. Unlike 3-BP, NEO218 exerted its potent cytotoxic activity irrespective of cellular MCT-1 status. Treatment of HCT116 cells with 3-BP resulted in prompt development of resistance, based on the emergence of MCT-1-negative cells. This was not the case with NEO218, and highly 3-BP-resistant cells remained exquisitely sensitive to NEO218. Thus, our study identifies a mechanism by which tumor cells develop rapid resistance to 3-BP, and presents NEO218 as a superior agent not subject to this cellular defense. Furthermore, our results offer alternative interpretations of previously

RESOLUTE PET/MRI Attenuation Correction for O-(2-18F-fluoroethyl-L-tyrosine (FET in Brain Tumor Patients with Metal Implants

Directory of Open Access Journals (Sweden)

Claes N. Ladefoged

2017-08-01

Full Text Available Aim: Positron emission tomography (PET imaging is a useful tool for assisting in correct differentiation of tumor progression from reactive changes, and the radiolabeled amino acid analog tracer O-(2-18F-fluoroethyl-L-tyrosine (FET-PET is amongst the most frequently used. The FET-PET images need to be quantitatively correct in order to be used clinically, which require accurate attenuation correction (AC in PET/MRI. The aim of this study was to evaluate the use of the subject-specific MR-derived AC method RESOLUTE in post-operative brain tumor patients.Methods: We analyzed 51 post-operative brain tumor patients (68 examinations, 200 MBq [18F]-FET investigated in a PET/MRI scanner. MR-AC maps were acquired using: (1 the Dixon water fat separation sequence, (2 the ultra short echo time (UTE sequences, (3 calculated using our new RESOLUTE methodology, and (4 a same day low-dose CT used as reference “gold standard.” For each subject and each AC method the tumor was delineated by isocontouring tracer uptake above a tumor(T-to-brain background (B activity ratio of 1.6. We measured B, tumor mean and maximal activity (TMEAN, TMAX, biological tumor volume (BTV, and calculated the clinical metrics TMEAN/B and TMAX/B.Results: When using RESOLUTE 5/68 studies did not meet our predefined acceptance criteria of TMAX/B difference to CT-AC < ±0.1 or 5%, TMEAN/B < ±0.05 or 5%, and BTV < ±2 mL or 10%. In total, 46/68 studies failed our acceptance criteria using Dixon, and 26/68 using UTE. The 95% limits of agreement for TMAX/B was for RESOLUTE (−3%; 4%, Dixon (−9%; 16%, and UTE (−7%; 10%. The absolute error when measuring BTV was 0.7 ± 1.9 mL (N.S with RESOLUTE, 5.3 ± 10 mL using Dixon, and 1.7 ± 3.7 mL using UTE. RESOLUTE performed best in the identification of the location of peak activity and in brain tumor follow-up monitoring using clinical FET PET metrics.Conclusions: Overall, we found RESOLUTE to be the AC method that most robustly

49 CFR 218.4 - Preemptive effect.

Science.gov (United States)

2010-10-01

... negligence standards apply where there is no Federal action covering the subject matter. Under 49 U.S.C. 20106 (section 20106), issuance of the regulations in this part preempts any State law, regulation, or order covering the same subject matter, except an additional or more stringent law, regulation, or order...

Publications | Page 218 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

IDRC works with developing-country researchers and institutions to build local capacity ... Use this search tool to locate a specific publication for your field of research. ... Americas, a nonprofit affiliate to the Organization of the American States (OAS). ... algorithm to find optimally effective drug in a drug complex (open access).

Publications | Page 218 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

... technologies as well as the characteristics specific to rural communities that will allow ... Towards the development of an Energy-Water-Food Security Nexus based ... Water management challenges in the context of agricultural intensification ...

Purification of radium-226 for the manufacturing of actinium-225 in a cyclotron for alpha-immunotherapy

International Nuclear Information System (INIS)

Marx, Sebastian Markus

2014-01-01

The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.

Linear free energy relationship applied to trivalent cations with lanthanum and actinium oxide and hydroxide structure

International Nuclear Information System (INIS)

Ragavan, Anpalaki J.

2006-01-01

Linear free energy relationships for trivalent cations with crystalline M 2 O 3 and, M(OH) 3 phases of lanthanides and actinides were developed from known thermodynamic properties of the aqueous trivalent cations, modifying the Sverjensky and Molling equation. The linear free energy relationship for trivalent cations is as ΔG f,MvX 0 =a MvX ΔG n,M 3+ 0 +b MvX +β MvX r M 3+ , where the coefficients a MvX , b MvX , and β MvX characterize a particular structural family of MvX, r M 3+ is the ionic radius of M 3+ cation, ΔG f,MvX 0 is the standard Gibbs free energy of formation of MvX and ΔG n,M 3+ 0 is the standard non-solvation free energy of the cation. The coefficients for the oxide family are: a MvX =0.2705, b MvX =-1984.75 (kJ/mol), and β MvX =197.24 (kJ/molnm). The coefficients for the hydroxide family are: a MvX =0.1587, b MvX =-1474.09 (kJ/mol), and β MvX =791.70 (kJ/molnm).

Positron emission tomography with 2-[18F]-Fluoro-2-Deoxy-D-Glucose for initial staging of hodgkin lymphoma: a single center experience in Brazil

Directory of Open Access Journals (Sweden)

Juliano Julio Cerci

2009-06-01

Full Text Available BACKGROUND: 2-[18F]-Fluoro-2-Deoxy-D-Glucose (FDG-PET is a well established functional imaging modality for the initial staging of Hodgkin lymphoma (HL in patients from Western Europe and North America. The reliability of FDG-PET in populations of different ethnic groups is unclear, as all investigations published to date have come from developed countries. PURPOSE: The aim of the present study was to investigate the effectiveness of FDG-PET in the initial staging of HL patients in a Brazilian population. METHODS: Eighty-two patients with newly diagnosed HL were prospectively included in the study. All patients were staged with both conventional clinical staging (CCS methods, including computed tomography (CT and whole-body FDG-PET methods. A standard of reference for the nodal regions and the extranodal organs was determined using all available information, including the CCS methods, FDG-PET, the diagnostic histology and the follow-up examinations. The results of the CCS were then compared to the FDG-PET results. RESULTS: The sensitivity of FDG-PET was higher for nodal staging than that of CT (87.8% vs. 61.6%, respectively. FDG-PET was also more sensitive than CT in regard to evaluating the extranodal organs for lymphomatous involvement (96.2% vs. 40.0%, respectively. FDG-PET detected all 16 patients who were characterized by a positive bone marrow biopsy and identified an additional 4 patients with bone marrow disease. The incorporation of FDG-PET coupled with CCS in the staging procedure upstaged 20% (17/82 of the patients and downstaged 11% (9/82 of the patients. As a result of these changes in staging, 15% (13/82 of the patients would have received a different therapeutic regimen. CONCLUSIONS: The FDG-PET method is superior to CT for the detection of nodal and extra-nodal HL. The observation that the FDG-PET method upstaged the disease was the most common result (20% of patients brought about by the addition of PET to the staging algorithm

Development of ion beam sputtering techniques for actinide target preparation

International Nuclear Information System (INIS)

Aaron, W.S.; Zevenbergen, L.A.; Adair, H.L.

1985-01-01

Ion beam sputtering is a routine method for the preparation of thin films used as targets because it allows the use of minimum quantity of starting material, and losses are much lower than most other vacuum deposition techniques. Work is underway in the Isotope Research Materials Laboratory (IRML) at ORNL to develop the techniques that will make the preparation of actinide targets up to 100 μg/cm 2 by ion beam sputtering a routinely available service from IRML. The preparation of the actinide material in a form suitable for sputtering is a key to this technique, as is designing a sputtering system that allows the flexibility required for custom-ordered target production. At present, development work is being conducted on low-activity in a bench-top system. The system will then be installed in a hood or glove box approved for radioactive materials handling where processing of radium, actinium, and plutonium isotopes among others will be performed. (orig.)

Development of ion beam sputtering techniques for actinide target preparation

Science.gov (United States)

Aaron, W. S.; Zevenbergen, L. A.; Adair, H. L.

1985-06-01

Ion beam sputtering is a routine method for the preparation of thin films used as targets because it allows the use of a minimum quantity of starting material, and losses are much lower than most other vacuum deposition techniques. Work is underway in the Isotope Research Materials Laboratory (IRML) at ORNL to develop the techniques that will make the preparation of actinide targets up to 100 μg/cm 2 by ion beam sputtering a routinely available service from IRML. The preparation of the actinide material in a form suitable for sputtering is a key to this technique, as is designing a sputtering system that allows the flexibility required for custom-ordered target production. At present, development work is being conducted on low-activity actinides in a bench-top system. The system will then be installed in a hood or glove box approved for radioactive materials handling where processing of radium, actinium, and plutonium isotopes among others will be performed.

Proposed training program for construction personnel involved in remedial action work at sites contaminated by naturally occurring radionuclides

International Nuclear Information System (INIS)

Berven, B.A.; Goldsmith, W.A.; Haywood, F.F.; Schiager, K.J.

1979-01-01

Many sites used during the early days of the US atomic energy program are contaminated with radionuclides of the primordial decay chains (uranium, thorium, and actinium series). This contamination consists of residues resulting from refining and processing uranium and thorium. Preparation of these sites for release to unrestricted private use will involve the assistance of construction workers, many of whom have limited knowledge of the hazards associated with radioactive materials. Therefore, there is a need to educate these workers in the fundamentals of radioactive material handling to minimize exposures and possible spread of contamination. This training should disseminate relevant information at an appropriate educational level and should instill a cautious, common-sense attitude toward the handling of radioactive materials. The training should emphasize basic information concerning environmental radiation within a context of relative risk. A multi-media format, including colorful visual aids, demonstration, and discussion, should be used to maximize motivation and retention. A detailed, proposed training program design is presented

Evaluation of outcome prediction and disease extension by quantitative 2-deoxy-2-[18F] fluoro-D-glucose with positron emission tomography in patients with small cell lung cancer

International Nuclear Information System (INIS)

Arslan, N.; Tuncel, M.; Kuzhan, O.; Alagoz, E.; Budakoglu, B.; Ozet, A.; Ozguven, M.A.

2011-01-01

The objective of this study is to determine whether 2-deoxy-2-[18F] fluoro-D-glucose with positron emission tomography (FDG-PET) imaging and quantitative PET parameters can predict outcome and differentiate patients with limited disease (LD) from extensive disease (ED) in patients with small cell lung cancer (SCLC). We retrospectively evaluated data from 25 patients who underwent either initial staging (Group A, n 12) or restaging (Group B, n 13) by conventional imaging methods and FDG-PET according to the simplified staging scheme developed by the Veterans Administration Lung Cancer Study Group-2. FDG-PET images were both visually and quantitatively evaluated with standardized uptake value (SUV) max , SUV ave , total metabolic tumor volume (with SUV max >%50 and SUV max >2.5), total lesion glycolysis (TLG) (with SUV max >%50 and SUV max >2.5). The correlation between quantitative PET parameters, disease stages and survival were analyzed. By conventional methods 14 of 25 (56%) patients were reported to have LD and 11 of 25 (44%) had ED. FDG-PET scan upstaged 9 out of 25 (36%) and downstaged 2 out of 25 (%8) patients. Among the quantitative PET parameters, TLGs were the only PET parameters that differentiated between Group A and Group B patients. FDG-PET staging (p=0.019) could predict significant survival difference between stages on contrary to conventional staging (p=0.055). Moreover, TLG [SUV max >%50] was the only quantitative PET parameter that could predict survival (p=0.027). FDG-PET imaging is a valuable tool in the management of patients with SCLC for a more accurate staging. The use of quantitative PET parameters may have a role in prediction of stage and survival. (author)

MicroRNA-133 mediates cardiac diseases: Mechanisms and clinical implications

Energy Technology Data Exchange (ETDEWEB)

Liu, Yi; Liang, Yan [Guangdong Key Laboratory for Research and Development of Natural Drugs, Guangdong Medical University, Zhanjiang 524023, Guangdong (China); Zhang, Jin-fang [Department of Orthopaedics and Traumatology, The Chinese University of Hong Kong, Prince of Wales Hospital, Shatin, Hong Kong (China); Fu, Wei-ming, E-mail: fuweiming76@smu.edu.cn [School of Pharmaceutical Sciences, Southern Medical University, Guangzhou 510515 (China)

2017-05-15

MicroRNAs (miRNAs) belong to the family of small non-coding RNAs that mediate gene expression by post-transcriptional regulation. Increasing evidence have demonstrated that miR-133 is enriched in muscle tissues and myogenic cells, and its aberrant expression could induce the occurrence and development of cardiac disorders, such as cardiac hypertrophy, heart failure, etc. In this review, we summarized the regulatory roles of miR-133 in cardiac disorders and the underlying mechanisms, which suggest that miR-133 may be a potential diagnostic and therapeutic tool for cardiac disorders. - Highlights: • miR-218 is frequently downregulated in multiple cancers. • miR-218 plays pivotal roles in carcinogenesis. • miR-218 mediates proliferation, apoptosis, metastasis, invasion, etc. • miR-218 mediates tumorigenesis and metastasis via multiple pathways.

MicroRNA-133 mediates cardiac diseases: Mechanisms and clinical implications

International Nuclear Information System (INIS)

Liu, Yi; Liang, Yan; Zhang, Jin-fang; Fu, Wei-ming

2017-01-01

MicroRNAs (miRNAs) belong to the family of small non-coding RNAs that mediate gene expression by post-transcriptional regulation. Increasing evidence have demonstrated that miR-133 is enriched in muscle tissues and myogenic cells, and its aberrant expression could induce the occurrence and development of cardiac disorders, such as cardiac hypertrophy, heart failure, etc. In this review, we summarized the regulatory roles of miR-133 in cardiac disorders and the underlying mechanisms, which suggest that miR-133 may be a potential diagnostic and therapeutic tool for cardiac disorders. - Highlights: • miR-218 is frequently downregulated in multiple cancers. • miR-218 plays pivotal roles in carcinogenesis. • miR-218 mediates proliferation, apoptosis, metastasis, invasion, etc. • miR-218 mediates tumorigenesis and metastasis via multiple pathways.

Comparison of Positron Emission Tomography Using 2-[18F]-fluoro-2-deoxy-D-glucose and 3-deoxy-3-[18F]-fluorothymidine in Lung Cancer Imaging

Science.gov (United States)

Wang, Fu-Li; Tan, Ye-Ying; Gu, Xiang-Min; Li, Tian-Ran; Lu, Guang-Ming; Liu, Gang; Huo, Tian-Long

2016-01-01

Background: The detection of solitary pulmonary nodules (SPNs) that may potentially develop into a malignant lesion is essential for early clinical interventions. However, grading classification based on computed tomography (CT) imaging results remains a significant challenge. The 2-[18F]-fluoro-2-deoxy-D-glucose (18F-FDG) positron emission tomography (PET)/CT imaging produces both false-positive and false-negative findings for the diagnosis of SPNs. In this study, we compared 18F-FDG and 3-deoxy-3-[18F]-fluorothymidine (18F-FLT) in lung cancer PET/CT imaging. Methods: The binding ratios of the two tracers to A549 lung cancer cells were calculated. The mouse lung cancer model was established (n = 12), and micro-PET/CT analysis using the two tracers was performed. Images using the two tracers were collected from 55 lung cancer patients with SPNs. The correlation among the cell-tracer binding ratios, standardized uptake values (SUVs), and Ki-67 proliferation marker expression were investigated. Results: The cell-tracer binding ratio for the A549 cells using the 18F-FDG was greater than the ratio using 18F-FLT (P < 0.05). The Ki-67 expression showed a significant positive correlation with the 18F-FLT binding ratio (r = 0.824, P < 0.01). The tumor-to-nontumor uptake ratio of 18F-FDG imaging in xenografts was higher than that of 18F-FLT imaging. The diagnostic sensitivity, specificity, and the accuracy of 18F-FDG for lung cancer were 89%, 67%, and 73%, respectively. Moreover, the diagnostic sensitivity, specificity, and the accuracy of 18F-FLT for lung cancer were 71%, 79%, and 76%, respectively. There was an obvious positive correlation between the lung cancer Ki-67 expression and the mean maximum SUV of 18F-FDG and 18F-FLT (r = 0.658, P < 0.05 and r = 0.724, P < 0.01, respectively). Conclusions: The 18F-FDG uptake ratio is higher than that of 18F-FLT in A549 cells at the cellular level. 18F-FLT imaging might be superior for the quantitative diagnosis of lung tumor

VizieR Online Data Catalog: Massive star forming molecular clumps Tkin (Tang+, 2017)

Science.gov (United States)

Tang, X. D.; Henkel, C.; Menten, K. M.; Zheng, X. W.; Esimbek, J.; Zhou, J. J.; Yeh, C. C.; Konig, C.; Yuan, Y.; He, Y. X.; Li, D. L.

2016-10-01

We have selected 30 massive clumps of the Galactic disk at various stages of high-mass star formation and with strong NH3 emission from the ATLASGAL survey (see Table 1). Our observations were carried out in 2015 April, July, and October with the 15m James Clerk Maxwell Telescope telescope (JCMT) on Mauna Kea. The beam size is ~23" and the main-beam efficiency is {eta}mb=Ta*/Tmb~=0.7 at 218GHz. The para-H2CO JKAKC =303-202, 322-221, and 321-220 transitions have rest frequencies of 218.222, 218.475, and 218.760GHz, respectively, which are measured simultaneously by employing the ACSIS digital autocorrelation spectrometer with the special backend configuration RxAH2CO250x3 allowing for three windows, each with a bandwidth of 250MHz. This provides a velocity resolution of 0.084km/s for para-H2CO (303-202 and 322-221) and 0.042km/s for para-H2CO (321-220); CH3OH (422-312) at 218.440GHz is also observed together with para-H2CO (322-221). (6 data files).

On the removal efficiency of padon decay products by fog droplets

International Nuclear Information System (INIS)

Girgzhdis, A.I.; Girgzhdene, R.V.; Shopauskas, K.K.

1978-01-01

The results of the experimental investigations on quantitative evaluation of the 218 Po and 214 Bi washout efficiency by fog in an aerosol chamber are presented. The radioactivity has been measured by means of α-spectrometric method. Comparison of eXperimental and calculated data is made. The 218 Po and 214 Bi washout efficiency ratio is found to be dependent mainly on the aerosol concentration. The change of 218 Po concentration imitates the process of coagulation of free atoms of light ions, and that of 214 Bi - of aerosol particles by fog droplets

Actiniarian Sea anemone fauna of India

Digital Repository Service at National Institute of Oceanography (India)

Parulekar, A.H.

stream_size 11 stream_content_type text/plain stream_name Mar_Biofouling_Power_Plants_1990_218.pdf.txt stream_source_info Mar_Biofouling_Power_Plants_1990_218.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset...

Tourism and the coastal zone

Digital Repository Service at National Institute of Oceanography (India)

Mascarenhas, A.

stream_size 1 stream_content_type text/plain stream_name Fish_Curry_Rice_2002_218.pdf.txt stream_source_info Fish_Curry_Rice_2002_218.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

29 CFR 502.5 - Investigation authority of Secretary.

Science.gov (United States)

2010-07-01

... ENFORCEMENT OF CONTRACTUAL OBLIGATIONS FOR TEMPORARY ALIEN AGRICULTURAL WORKERS ADMITTED UNDER SECTION 218 OF... gather such information as deemed necessary by the Secretary to determine compliance with contractual obligations under sec. 218 of the INA or these regulations. (b) Failure to cooperate with an investigation...

Comparative Oncology: Evaluation of 2-Deoxy-2-[18F]fluoro-D-glucose (FDG Positron Emission Tomography/Computed Tomography (PET/CT for the Staging of Dogs with Malignant Tumors.

Directory of Open Access Journals (Sweden)

Stefanie M F Seiler

Full Text Available 2-Deoxy-2-[18F]fluoro-D-glucose PET/CT is a well-established imaging method for staging, restaging and therapy-control in human medicine. In veterinary medicine, this imaging method could prove to be an attractive and innovative alternative to conventional imaging in order to improve staging and restaging. The aim of this study was both to evaluate the effectiveness of this image-guided method in canine patients with spontaneously occurring cancer as well as to illustrate the dog as a well-suited animal model for comparative oncology.Ten dogs with various malignant tumors were included in the study and underwent a whole body FDG PET/CT. One patient has a second PET-CT 5 months after the first study. Patients were diagnosed with histiocytic sarcoma (n = 1, malignant lymphoma (n = 2, mammary carcinoma (n = 4, sertoli cell tumor (n = 1, gastrointestinal stromal tumor (GIST (n = 1 and lung tumor (n = 1. PET/CT data were analyzed with the help of a 5-point scale in consideration of the patients' medical histories.In seven of the ten dogs, the treatment protocol and prognosis were significantly changed due to the results of FDG PET/CT. In the patients with lymphoma (n = 2 tumor extent could be defined on PET/CT because of increased FDG uptake in multiple lymph nodes. This led to the recommendation for a therapeutic polychemotherapy as a treatment. In one of the dogs with mammary carcinoma (n = 4 and in the patient with the lung tumor (n = 1, surgery was cancelled due to the discovery of multiple metastasis. Consequently no treatment was recommended.FDG PET/CT offers additional information in canine patients with malignant disease with a potential improvement of staging and restaging. The encouraging data of this clinical study highlights the possibility to further improve innovative diagnostic and staging methods with regard to comparative oncology. In the future, performing PET/CT not only for staging but also in therapy control could offer a

76 FR 67631 - Airworthiness Directives; Cirrus Design Corporation Airplanes

Science.gov (United States)

2011-11-02

... Corporation, 4515 Taylor Circle, Duluth, Minnesota 55811- 1548, phone: (218) 788-3000; fax: (218) 788-3525... as applicable. (f) Compliance Comply with this AD following Cirrus Design Corporation SR22T Service... this AD, contact Cirrus Design Corporation, 4515 Taylor Circle, Duluth, Minnesota 55811-1548, phone...

77 FR 24228 - Condition Monitoring Techniques for Electric Cables Used in Nuclear Power Plants

Science.gov (United States)

2012-04-23

... Used in Nuclear Power Plants AGENCY: Nuclear Regulatory Commission. ACTION: Regulatory guide; issuance... guide, (RG) 1.218, ``Condition Monitoring Techniques for Electric Cables Used in Nuclear Power Plants... of electric cables for nuclear power plants. RG 1.218 is not intended to be prescriptive, instead it...

CAN THE STABILITY OF PROTEIN MUTANTS BE PREDICTED BY FREE-ENERGY CALCULATIONS

NARCIS (Netherlands)

YUNYU, S; MARK, AE; WANG, CX; HUANG, FH; BERENDSEN, HJC; VANGUNSTEREN, WF

The use of free energy simulation techniques in the study of protein stability is critically evaluated. Results from two simulations of the thermostability mutation Asn218 to Ser218 in Subtilisin are presented. It is shown that components of the free energy change can be highly sensitive to the

32 CFR 218.3 - Dose reconstruction methodology.

Science.gov (United States)

2010-07-01

... with air and soil, generated within a fraction of a second. Because of the complexity of these radiation sources and their varied interaction properties with air and soil, it is necessary to obtain... cause material to become airborne (such as wind, decontamination or traffic) are used with empirical...

40 CFR 94.218 - Deterioration factor determination.

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Deterioration factor determination. 94... Deterioration factor determination. Manufacturers shall determine exhaust emission deterioration factors using good engineering judgement according to the provisions of this section. Every deterioration factor must...

48 CFR 218.170 - Additional acquisition flexibilities.

Science.gov (United States)

2010-10-01

... the Governmentwide commercial purchase card. Governmentwide commercial purchase cards do not have to... entirely outside the United States. See 213.270(c)(1). (d) Master agreement for repair and alteration of... work to a contractor that has previously executed a master agreement, when delay would endanger a...

41 CFR 101-29.218 - Voluntary standards.

Science.gov (United States)

2010-07-01

... Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS SUPPLY AND PROCUREMENT 29-FEDERAL PRODUCT... standards,” but does not include professional standards of personal conduct, institutional codes of ethics...

218-IJBCS-Article-Dr S Nwodo Chinedu

African Journals Online (AJOL)

Dr Gatsing

Agro-waste: a potential fermentation substrate for Penicillium chrysogenum ... Cassava shavings significantly (P<0.001) produced the highest amount of mycelia ..... the hydrolysis of cellulosic biomass. ... chrysogenum from ammonia pretreated ... enzymatic hydrolysis of cellulose by ethanol. Biotechnol. Lett., 19: 977-979.

Gender | Page 218 | IDRC - International Development Research ...

International Development Research Centre (IDRC) Digital Library (Canada)

A research team in Lebanon's remote Arsaal region used an updated version of the traditional tribal council, combined with modern technologies such as videos and GIS surveys, to resolve long-standing conflicts among land users. The results have had an impact on local government across the region and served as a ...

Hot wire production of single-wall and multi-wall carbon nanotubes

Science.gov (United States)

Dillon, Anne C.; Mahan, Archie H.; Alleman, Jeffrey L.

2010-10-26

Apparatus (210) for producing a multi-wall carbon nanotube (213) may comprise a process chamber (216), a furnace (217) operatively associated with the process chamber (216), and at least one filament (218) positioned within the process chamber (216). At least one power supply (220) operatively associated with the at least one filament (218) heats the at least one filament (218) to a process temperature. A gaseous carbon precursor material (214) operatively associated with the process chamber (216) provides carbon for forming the multi-wall carbon nanotube (213). A metal catalyst material (224) operatively associated with the process (216) catalyzes the formation of the multi-wall carbon nanotube (213).

26 CFR 31.6413(c)-1 - Special refunds.

Science.gov (United States)

2010-04-01

... from the employee's remuneration by reason of such agreement has been paid to the district director... such remuneration for services covered by an agreement made pursuant to section 218 of the Social... from an employee's remuneration as a result of an agreement made pursuant to section 218 of the Social...

76 FR 46853 - International Business Machines Corporation, ITD Business Unit, Division 7, E-mail and...

Science.gov (United States)

2011-08-03

... DEPARTMENT OF LABOR Employment and Training Administration [TA-W-73,218; TA-W-73,218A] International Business Machines Corporation, ITD Business Unit, Division 7, E-mail and Collaboration Group, Including Workers Off-Site From Various States in the United States Reporting to Armonk, NY; International Business Machines Corporation, Web Strategy...

Geological disposal: security and R and D. Security of 'second draft for R and D of geological disposal'

International Nuclear Information System (INIS)

Shiotsuki, Masao; Miyahara, Kaname

2003-01-01

The second draft for R and D of geological disposal (second draft) was arranged in 1999. The idea of security of geological disposal in the second draft is explained. The evaluation results of the uncertainty analysis and an example of evaluation of the effect of separation nuclear transmutation on the geological disposal are shown. The construction of strong engineered barrier is a basic idea of geological disposal system. Three processes such as isolation, engineering countermeasures and safety evaluation are carried out for the security of geological disposal. The security of geological environment for a long time of 12 sites in Japan was studied by data. Provability of production and enforcement of engineered barrier were confirmed by trial of over pack, tests and the present and future technologies developed. By using the conditions of reference case in the second draft, the evaluation results of dose effects in the two cases: 1) 90 to 99% Cs and Sr removed from HLW (High Level radioactive Waste) and 2) high stripping ratio of actinium series are explained. (S.Y.)

Ac, La, and Ce radioimpurities in {sup 225}Ac produced in 40-200 MeV proton irradiations of thorium

Energy Technology Data Exchange (ETDEWEB)

Engle, Jonathan W.; Ballard, Beau D. [Los Alamos National Laboratory, NM (United States); Weidner, John W. [Air Force Institute of Technology, Wright Patterson Air Force Base, OH (United States); and others

2014-10-01

Accelerator production of {sup 225}Ac addresses the global supply deficiency currently inhibiting clinical trials from establishing {sup 225}Ac's therapeutic utility, provided that the accelerator product is of sufficient radionuclidic purity for patient use. Two proton activation experiments utilizing the stacked foil technique between 40 and 200 MeV were employed to study the likely co-formation of radionuclides expected to be especially challenging to separate from {sup 225}Ac. Foils were assayed by nondestructive γ-spectroscopy and by α-spectroscopy of chemically processed target material. Nuclear formation cross sections for the radionuclides {sup 226}Ac and {sup 227}Ac as well as lower lanthanide radioisotopes {sup 139}Ce, {sup 141}Ce, {sup 143}Ce, and {sup 140}La whose elemental ionic radii closely match that of actinium were measured and are reported. The predictions of the latest MCNP6 event generators are compared with measured data, as they permit estimation of the formation rates of other radionuclides whose decay emissions are not clearly discerned in the complex spectra collected from {sup 232}Th(p,x) fission product mixtures. (orig.)

Background radiation and individual dosimetry in the coastal area of Tamil Nadu (India)

International Nuclear Information System (INIS)

Matsuda, N.; Brahmanandhan, G. M.; Yoshida, M.; Takamura, N.; Suyama, A.; Koguchi, Y.; Juto, N.; Raj, Y. L.; Winsley, G.; Selvasekarapandian, S.

2011-01-01

South coast of India is known as the high-level background radiation area (HBRA) mainly due to beach sands that contain natural radionuclides as components of the mineral monazite. The rich deposit of monazite is unevenly distributed along the coastal belt of Tamil Nadu and Kerala. An HBRA site that laid in 2x7 m along the sea was found in the beach of Chinnavillai, Tamil Nadu, where the maximum ambient dose equivalent reached as high as 162.7 mSv y -1 . From the sands collected at the HBRA spot, the high-purity germanium semi-conductor detector identified six nuclides of thorium series, four nuclides of uranium series and two nuclides belonging to actinium series. The highest radioactivity observed was 43.7 Bq g -1 of Th-228. The individual dose of five inhabitants in Chinnavillai, as measured by the radiophotoluminescence glass dosimetry system, demonstrated the average dose of 7.17 mSv y -1 ranging from 2.79 to 14.17 mSv y -1 . (authors)

Soil nuclide distribution coefficients and their statistical distributions

International Nuclear Information System (INIS)

Sheppard, M.I.; Beals, D.I.; Thibault, D.H.; O'Connor, P.

1984-12-01

Environmental assessments of the disposal of nuclear fuel waste in plutonic rock formations require analysis of the migration of nuclides from the disposal vault to the biosphere. Analyses of nuclide migration via groundwater through the disposal vault, the buffer and backfill, the plutonic rock, and the consolidated and unconsolidated overburden use models requiring distribution coefficients (Ksub(d)) to describe the interaction of the nuclides with the geological and man-made materials. This report presents element-specific soil distribution coefficients and their statistical distributions, based on a detailed survey of the literature. Radioactive elements considered were actinium, americium, bismuth, calcium, carbon, cerium, cesium, iodine, lead, molybdenum, neptunium, nickel, niobium, palladium, plutonium, polonium, protactinium, radium, samarium, selenium, silver, strontium, technetium, terbium, thorium, tin, uranium and zirconium. Stable elements considered were antimony, boron, cadmium, tellurium and zinc. Where sufficient data were available, distribution coefficients and their distributions are given for sand, silt, clay and organic soils. Our values are recommended for use in assessments for the Canadian Nuclear Fuel Waste Management Program

A designated centre for people with disabilities operated by Health Service Executive, Sligo

LENUS (Irish Health Repository)

Gegenbauer, Kristina

2013-11-01

Regulator of G-protein signaling 18 (RGS18) is a GTPase-activating protein that turns off Gq signaling in platelets. RGS18 is regulated by binding to the adaptor protein 14-3-3 via phosphorylated serine residues S49 and S218 on RGS18. In this study we confirm that thrombin, thromboxane A2, or ADP stimulate the interaction of RGS18 and 14-3-3 by increasing the phosphorylation of S49. Cyclic AMP- and cyclic GMP-dependent kinases (PKA, PKG) inhibit the interaction of RGS18 and 14-3-3 by phosphorylating S216. To understand the effect of S216 phosphorylation we studied the phosphorylation kinetics of S49, S216, and S218 using Phos-tag gels and phosphorylation site-specific antibodies in transfected cells and in platelets. Cyclic nucleotide-induced detachment of 14-3-3 from RGS18 coincides initially with double phosphorylation of S216 and S218. This is followed by dephosphorylation of S49 and S218. Dephosphorylation of S49 and S218 might be mediated by protein phosphatase 1 (PP1) which is linked to RGS18 by the regulatory subunit PPP1R9B (spinophilin). We conclude that PKA and PKG induced S216 phosphorylation triggers the dephosphorylation of the 14-3-3 binding sites of RGS18 in platelets.

Cyclic nucleotide dependent dephosphorylation of regulator of G-protein signaling 18 in human platelets.

LENUS (Irish Health Repository)

Gegenbauer, Kristina

2013-11-01

Regulator of G-protein signaling 18 (RGS18) is a GTPase-activating protein that turns off Gq signaling in platelets. RGS18 is regulated by binding to the adaptor protein 14-3-3 via phosphorylated serine residues S49 and S218 on RGS18. In this study we confirm that thrombin, thromboxane A2, or ADP stimulate the interaction of RGS18 and 14-3-3 by increasing the phosphorylation of S49. Cyclic AMP- and cyclic GMP-dependent kinases (PKA, PKG) inhibit the interaction of RGS18 and 14-3-3 by phosphorylating S216. To understand the effect of S216 phosphorylation we studied the phosphorylation kinetics of S49, S216, and S218 using Phos-tag gels and phosphorylation site-specific antibodies in transfected cells and in platelets. Cyclic nucleotide-induced detachment of 14-3-3 from RGS18 coincides initially with double phosphorylation of S216 and S218. This is followed by dephosphorylation of S49 and S218. Dephosphorylation of S49 and S218 might be mediated by protein phosphatase 1 (PP1) which is linked to RGS18 by the regulatory subunit PPP1R9B (spinophilin). We conclude that PKA and PKG induced S216 phosphorylation triggers the dephosphorylation of the 14-3-3 binding sites of RGS18 in platelets.

The effect of D,L-β-aminobutyric acid on the growth and development of Fusarium oxysporum f. sp. tulipae (Apt.

Directory of Open Access Journals (Sweden)

Anna Jarecka

2012-12-01

Full Text Available The effect of D,L-β-aminobutyric acid (BABA on the growth and development of the root system and the development of fusariosis on tulip bulbs cv. Apeldoorn infected by Fusarium oxysporum f. sp. tulipae (F.ox.t. 218 was studied. The length and fresh weight of roots, the development of fusariosis on bulbs and the linear growth of mycelium of F.ox.t. 218 on PDA medium were measured. Preventively used BABA at a concentration of 100, 250 and 300 µg·cm-3 for soaking uncooled and cooled tulip bulbs greatly inhibited the development of fusariosis on the root system; the length and fresh weight of roots were similar to those of the bulbs not inoculated with F.ox.t. 218. At a concentration of 100 µg·cm-3;, BABA used for soaking bulbs limited the development of fusariosis on scales in about 50% and the concentration of 200 µg·cm-3 totally inhibited the disease symptoms induced by F.ox.t. 218. At a concentration of 100 - 1000 µg·cm-3, BABA did not inhibit the mycelium growth of F.ox.t. 17 and F.xo.t. 218 on PDA medium. This study suggests that BABA protects tulip roots and bulb scales against F. oxysporum f. sp. tulipae by inducing resistance in these organs and has no direct influence on the pathogen.

77 FR 26071 - Revisions to the Unregulated Contaminant Monitoring Regulation (UCMR 3) for Public Water Systems

Science.gov (United States)

2012-05-02

... acid (PFNA) perfluorobutanesulfonic acid (PFBS). Chromium-6 using EPA Method 218.7 (IC/UV-VIS): \\10... (ASTM, 2008). \\9\\ EPA Method 537 (LC/MS/MS) (USEPA, 2009b). \\10\\ EPA Method 218.7 (IC/UV-VIS) (USEPA... chromatography with UV detection (HPLC/UV) methods have been published (Howard and Boyer, 2007), they do not...

Remote Patient Management in a Mammographic Screening Environment in Underserved Areas

Science.gov (United States)

2005-09-01

of 4,945 paired examinations. Radiology 2001; 218:873-880. 10. Malich A, Marx C, Facius M, Boehm T, Fleck M, Kaiser WA. Tumour 24. Venta LA, Hendrick...218:873-880. KF, Sickles EA. Mammographic character- factor determining the quality of com- 15. Venta LA, Hendrick RE, Adler YT, et al. iSicks of 115

Transport and deposition of nano-particles. Application to the free action of short-lived radon daughters

International Nuclear Information System (INIS)

Malet, J.

1997-01-01

Short-lived radon daughters ( 218 Po, 214 Pb, 214 Bi, and 214 Po) are important contributors to the natural average annual individual dose. The models describing the evolution of these aerosol in a house depend critically on a parameter, the 218 Po deposition velocity, which, although aerosol deposition has been extensively studied, is poorly known. A numerical and experimental study is thus carried out for a simple case: deposition in a cylindrical tube under laminar flow condition. The numerical results help understanding the difference between the transport and deposition of these radionuclides and those of non radioactive aerosols. Comparison of these well environment does not give satisfactory correlation, requiring the study of phenomena that may affect deposition. The first of these is the possible variation in the e 218 Po diffusion coefficient. Furthermore, experiments coupled with numerical calculations show that this variation could be due to 218 Po neutralization. The second phenomenon concerns the effect of the surface type, which is also shown experimentally. By modelling the neutralization and using results with a piratically smooth surface, good numerical/experimental correlations are obtained. Understanding this simple case than makes possible studying a more complex case: deposition in controlled turbulent flow. Two theories are thus experimentally validated. In addition, a 218 Po deposition velocity representative of our experimental conditions is determined. Finally, we report a feasibility study of radon daughters transport and deposition in a ventilated chamber taking into account all the involved phenomena. (author)

TRASH TO TREASURE: CONVERTING COLD WAR LEGACY WASTE INTO WEAPONS AGAINST CANCER

International Nuclear Information System (INIS)

Nicholas, R.G.; Lacy, N.H.; Butz, T.R.; Brandon, N.E.

2004-01-01

As part of its commitment to clean up Cold War legacy sites, the U.S. Department of Energy (DOE) has initiated an exciting and unique project to dispose of its inventory of uranium-233 (233U) stored at Oak Ridge National Laboratory (ORNL), and extract isotopes that show great promise in the treatment of deadly cancers. In addition to increasing the supply of potentially useful medical isotopes, the project will rid DOE of a nuclear concern and cut surveillance and security costs. For more than 30 years, DOE's ORNL has stored over 1,200 containers of fissile 233U, originally produced for several defense-related projects, including a pilot study that looked at using 233U as a commercial reactor fuel. This uranium, designated as special nuclear material, requires expensive security, safety, and environmental controls. It has been stored at an ORNL facility, Building 3019A, that dates back to the Manhattan Project. Down-blending the material to a safer form, rather than continuing to store it, will eliminate a $15 million a year financial liability for the DOE and increase the supply of medical isotopes by 5,700 percent. During the down-blending process, thorium-229 (229Th) will be extracted. The thorium will then be used to extract actinium-225 (225Ac), which will ultimately supply its progeny, bismuth-213 (213Bi), for on-going cancer research. The research includes Phase II clinical trials for the treatment of acute myelogenous leukemia at Sloan-Kettering Memorial Cancer Center in New York, as well as other serious cancers of the lungs, pancreas, and kidneys using a technique known as alpha-particle radioimmunotherapy. Alpha-particle radioimmunotherapy is based on the emission of alpha particles by radionuclides. 213Bi is attached to a monoclonal antibody that targets specific cells. The bismuth then delivers a high-powered but short-range radiation dose, effectively killing the cancerous cells but sparing the surrounding tissue. Production of the actinium and

Transport and deposition of nano-particles. Application to the free action of short-lived radon daughters; Transport et depot des aerosols nanometriques. Application a la fraction libre des descendants a vie courte du radon

Energy Technology Data Exchange (ETDEWEB)

Malet, J

1997-10-10

Short-lived radon daughters ({sup 218}Po, {sup 214}Pb, {sup 214}Bi, and {sup 214}Po) are important contributors to the natural average annual individual dose. The models describing the evolution of these aerosol in a house depend critically on a parameter, the {sup 218}Po deposition velocity, which, although aerosol deposition has been extensively studied, is poorly known. A numerical and experimental study is thus carried out for a simple case: deposition in a cylindrical tube under laminar flow condition. The numerical results help understanding the difference between the transport and deposition of these radionuclides and those of non radioactive aerosols. Comparison of these well environment does not give satisfactory correlation, requiring the study of phenomena that may affect deposition. The first of these is the possible variation in the e {sup 218}Po diffusion coefficient. Furthermore, experiments coupled with numerical calculations show that this variation could be due to {sup 218}Po neutralization. The second phenomenon concerns the effect of the surface type, which is also shown experimentally. By modelling the neutralization and using results with a piratically smooth surface, good numerical/experimental correlations are obtained. Understanding this simple case than makes possible studying a more complex case: deposition in controlled turbulent flow. Two theories are thus experimentally validated. In addition, a {sup 218}Po deposition velocity representative of our experimental conditions is determined. Finally, we report a feasibility study of radon daughters transport and deposition in a ventilated chamber taking into account all the involved phenomena. (author)

Methodologies for Blunt Trauma Assessment in Military Helmets

Science.gov (United States)

2010-09-13

Assessment; Monorail Drop Tower 16. SECURITY CLASSIFICATION OF: 17. LIMITATION OF ABSTRACT UU 18. NUMBER OF PAGES 10 19a. NAME OF RESPONSIBLE...Laboratory Test Procedure for Motorcycle Helmets (TP-218-06) [8]. TP-218-06 specifies a guided monorail drop and provides requirements for how helmets...a hemispherical anvil. The monorail restricts movement to control the impact location, and acceleration is measured using a uniaxial accelerometer

Minor Actinide Burning in Thermal Reactors. A Report by the Working Party on Scientific Issues of Reactor Systems

International Nuclear Information System (INIS)

Hesketh, K.; Porsch, D.; Rimpault, G.; Taiwo, T.; Worrall, A.

2013-01-01

The actinides (or actinoids) are those elements in the periodic table from actinium upwards. Uranium (U) and plutonium (Pu) are two of the principal elements in nuclear fuel that could be classed as major actinides. The minor actinides are normally taken to be the triad of neptunium (Np), americium (Am) and curium (Cm). The combined masses of the remaining actinides (i.e. actinium, thorium, protactinium, berkelium, californium, einsteinium and fermium) are small enough to be regarded as very minor trace contaminants in nuclear fuel. Those elements above uranium in the periodic table are known collectively as the transuranics (TRUs). The operation of a nuclear reactor produces large quantities of irradiated fuel (sometimes referred to as spent fuel), which is either stored prior to eventual deep geological disposal or reprocessed to enable actinide recycling. A modern light water reactor (LWR) of 1 GWe capacity will typically discharge about 20-25 tonnes of irradiated fuel per year of operation. About 93-94% of the mass of uranium oxide irradiated fuel is comprised of uranium (mostly 238 U), with about 4-5% fission products and ∼1% plutonium. About 0.1-0.2% of the mass is comprised of neptunium, americium and curium. These latter elements accumulate in nuclear fuel because of neutron captures, and they contribute significantly to decay heat loading and neutron output, as well as to the overall radio-toxic hazard of spent fuel. Although the total minor actinide mass is relatively small - approximately 20-25 kg per year from a 1 GWe LWR - it has a disproportionate impact on spent fuel disposal, and thus the longstanding interest in transmuting these actinides either by fission (to fission products) or neutron capture in order to reduce their impact on the back end of the fuel cycle. The combined masses of the trace actinides actinium, thorium, protactinium, berkelium and californium in irradiated LWR fuel are only about 2 parts per billion, which is far too low for

49 CFR 218.29 - Alternate methods of protection.

Science.gov (United States)

2010-10-01

... between rolling equipment in a car shop repair track area: (1) A blue signal must be displayed at or near... direction of the person in charge of the workemen, a car mover may be used to reposition rolling equipment... more cars coupled to a locomotive, and blue signals are not available, the engineman or operator at the...

24 CFR 92.218 - Amount of matching contribution.

Science.gov (United States)

2010-04-01

... under § 92.102(b)(2) from the resources of a State (other than a transfer of the State's formula... (pursuant to § 92.207); community housing development organization operating expenses (pursuant to § 92.208); capacity building (pursuant to § 92.300(b)) of community housing development organizations; and project...

TU-C-218-02: Effective Oncology Physics Education.

Science.gov (United States)

Burmeister, J; Coffey, C; Salehpour, M; Ibbott, G

2012-06-01

The education of medical physicists has historically been quite varied and medical physicists have entered the field through several pathways including specialized educational programs, postdoctoral fellowships, and on-the-job training. It is argued that the contributions of viewpoints from different branches of physics has contributed to the development of novel solutions and advances in radiation oncology. However, there also has been an effort recently to make graduate education of medical physicists more consistent and uniform, particularly for the preparation of clinically oriented therapy physicists. The trend towards a more systematic approach has been guided in part by the requirements for graduate program accreditation developed by CAMPEP and by the requirements for medical physicist certification by the ABR. At the same time, there has been criticism of this approach as being too confining and guiding graduates toward a career as technicians rather than independent thinkers. Educational programs have had to balance the requirements of accreditation and certification against the goal of preparing students for careers as independent researchers. Three speakers will describe the approaches taken by their graduate educational programs to meet the requirements of CAMPEP and adequately prepare graduates for certification by the ABR, while maintaining a commitment to providing a comprehensive education in medical physics. 1. Understand the requirements for graduate program accreditation 2. Understand the education and experience requirements for certification 3. Learn the approaches taken by several graduate programs to meet the requirements for accreditation and certification while providing a comprehensive education in medical physics. © 2012 American Association of Physicists in Medicine.

32 CFR 724.218 - Limitation-Continuance and Postponements.

Science.gov (United States)

2010-07-01

... 32 National Defense 5 2010-07-01 2010-07-01 false Limitation-Continuance and Postponements. 724... Limitation—Continuance and Postponements. (a) A continuance of a discharge review hearing may be authorized... continuance is of reasonable duration and is essential to achieving a full and fair hearing. When a proposal...

218 GAGANIJA, MS, *MKOMA, SL and LEMA, ES

African Journals Online (AJOL)

Osondu

2012-03-24

Mar 24, 2012 ... environment, are also the main source of urban noise emission, contributing about 55% to the total noise (Pandya 2002; Sinha and Sridharan,. 2003). The growing vehicle population gives rise to unrestrained noise pollution and associated health effects and can cause psychological and physiological ...

Electronic structure and dynamics of ordered clusters with ME or RE ions on oxide surface

Energy Technology Data Exchange (ETDEWEB)

Kulagin, N.A., E-mail: nkulagin@bestnet.kharkov.u [Kharkiv National University for Radio Electronics, Avenue Shakespeare 6-48, 61045 Kharkiv (Ukraine)

2011-03-15

Selected data of ab initio simulation of the electronic structure and spectral properties of either cluster with ions of iron, rare earth or actinium group elements have been presented here. Appearance of doped Cr{sup +4} ions in oxides, Cu{sup +2} in HTSC, Nd{sup +2} in solids has been discussed. Analysis of experimental data for plasma created ordered structures of crystallites with size of about 10{sup -9} m on surface of separate oxides are given, too. Change in the spectroscopic properties of clusters and nano-structures on surface of strontium titanate crystals discussed shortly using the X-ray line spectroscopy experimental results. - Research highlights: External influence and variation of technology induce changes in valence of nl ions in compounds. Wave function of cluster presented as anti-symmetrical set of ions wave functions. The main equation describes the self-consistent field depending on state of all electrons of cluster. Level scheme of Cr{sup 4+} ions in octo- and tetra-site corresponds to doped oxides spectra after treatment. Plasma treatment effects in appearance of systems of unit crystallites with size of about 10{sup -6}-10{sup -9} m.

Electronic structure and dynamics of ordered clusters with ME or RE ions on oxide surface

International Nuclear Information System (INIS)

Kulagin, N.A.

2011-01-01

Selected data of ab initio simulation of the electronic structure and spectral properties of either cluster with ions of iron, rare earth or actinium group elements have been presented here. Appearance of doped Cr +4 ions in oxides, Cu +2 in HTSC, Nd +2 in solids has been discussed. Analysis of experimental data for plasma created ordered structures of crystallites with size of about 10 -9 m on surface of separate oxides are given, too. Change in the spectroscopic properties of clusters and nano-structures on surface of strontium titanate crystals discussed shortly using the X-ray line spectroscopy experimental results. - Research highlights: → External influence and variation of technology induce changes in valence of nl ions in compounds. → Wave function of cluster presented as anti-symmetrical set of ions wave functions. → The main equation describes the self-consistent field depending on state of all electrons of cluster. → Level scheme of Cr 4+ ions in octo- and tetra-site corresponds to doped oxides spectra after treatment. → Plasma treatment effects in appearance of systems of unit crystallites with size of about 10 -6 -10 -9 m.

Review of radionuclide source terms used for performance-assessment analyses

International Nuclear Information System (INIS)

Barnard, R.W.

1993-06-01

Two aspects of the radionuclide source terms used for total-system performance assessment (TSPA) analyses have been reviewed. First, a detailed radionuclide inventory (i.e., one in which the reactor type, decay, and burnup are specified) is compared with the standard source-term inventory used in prior analyses. The latter assumes a fixed ratio of pressurized-water reactor (PWR) to boiling-water reactor (BWR) spent fuel, at specific amounts of burnup and at 10-year decay. TSPA analyses have been used to compare the simplified source term with the detailed one. The TSPA-91 analyses did not show a significant difference between the source terms. Second, the radionuclides used in source terms for TSPA aqueous-transport analyses have been reviewed to select ones that are representative of the entire inventory. It is recommended that two actinide decay chains be included (the 4n+2 ''uranium'' and 4n+3 ''actinium'' decay series), since these include several radionuclides that have potentially important release and dose characteristics. In addition, several fission products are recommended for the same reason. The choice of radionuclides should be influenced by other parameter assumptions, such as the solubility and retardation of the radionuclides

Renal uptake of bismuth-213 and its contribution to kidney radiation dose following administration of actinium-225-labeled antibody

Energy Technology Data Exchange (ETDEWEB)

Schwartz, J; O' Donoghue, J A; Humm, J L [Department of Medical Physics, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); Jaggi, J S [Bristol-Myers Squibb, Plainsboro, NJ (United States); Ruan, S; Larson, S M [Nuclear Medicine Service Department of Radiology, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); McDevitt, M; Scheinberg, D A, E-mail: schwarj1@mskcc.org [Molecular Pharmacology and Chemistry, Sloan-Kettering Institute, 1275 York Avenue, New York, NY 10065 (United States)

2011-02-07

Clinical therapeutic studies using {sup 225}Ac-labeled antibodies have begun. Of major concern is renal toxicity that may result from the three alpha-emitting progeny generated following the decay of {sup 225}Ac. The purpose of this study was to determine the amount of {sup 225}Ac and non-equilibrium progeny in the mouse kidney after the injection of {sup 225}Ac-huM195 antibody and examine the dosimetric consequences. Groups of mice were sacrificed at 24, 96 and 144 h after injection with {sup 225}Ac-huM195 antibody and kidneys excised. One kidney was used for gamma ray spectroscopic measurements by a high-purity germanium (HPGe) detector. The second kidney was used to generate frozen tissue sections which were examined by digital autoradiography (DAR). Two measurements were performed on each kidney specimen: (1) immediately post-resection and (2) after sufficient time for any non-equilibrium excess {sup 213}Bi to decay completely. Comparison of these measurements enabled estimation of the amount of excess {sup 213}Bi reaching the kidney ({gamma}-ray spectroscopy) and its sub-regional distribution (DAR). The average absorbed dose to whole kidney, determined by spectroscopy, was 0.77 (SD 0.21) Gy kBq{sup -1}, of which 0.46 (SD 0.16) Gy kBq{sup -1} (i.e. 60%) was due to non-equilibrium excess {sup 213}Bi. The relative contributions to renal cortex and medulla were determined by DAR. The estimated dose to the cortex from non-equilibrium excess {sup 213}Bi (0.31 (SD 0.11) Gy kBq{sup -1}) represented {approx}46% of the total. For the medulla the dose contribution from excess {sup 213}Bi (0.81 (SD 0.28) Gy kBq{sup -1}) was {approx}80% of the total. Based on these estimates, for human patients we project a kidney-absorbed dose of 0.28 Gy MBq{sup -1} following administration of {sup 225}Ac-huM195 with non-equilibrium excess {sup 213}Bi responsible for approximately 60% of the total. Methods to reduce renal accumulation of radioactive progeny appear to be necessary for the success of {sup 225}Ac radioimmunotherapy.

Distribution of trace elements in land plants and botanical taxonomy with special reference to rare earth elements and actinium

International Nuclear Information System (INIS)

Koyama, Mutsuo

1989-01-01

Distribution profiles of trace elements in land plants were studied by neutron activation analysis and radioactivity measurements without activation. Number of botanical samples analyzed were more than three thousand in which more than three hundred botanical species were included. New accumulator plants of Co, Cr, Zn, Cd, rare earth elements, Ac, U, etc., were found. Capabilities of accumulating trace elements can be related to the botanical taxonomy. Discussions are given from view points of inorganic chemistry as well as from botanical physiology

Turbine Engine Fault Detection and Isolation Program. Volume I. Turbine Engine Performance Estimation Methods

Science.gov (United States)

1982-08-01

DATA NUMBER OF POINTS 1988 CHANNEL MINIMUM MAXIMUM 1 PHMG -130.13 130.00 2 PS3 -218.12 294.77 3 T3 -341.54 738.15 4 T5 -464.78 623.47 5 PT51 12.317...Continued) CRUISE AND TAKE-OFF MODE DATA I NUMBER OF POINTS 4137 CHANNEL MINIMUM MAXIMUM 1 PHMG -130.13 130.00 2 P53 -218.12 376.60 3 T3 -482.72

Regional Use of Social Networking Tools

Science.gov (United States)

2014-12-01

4 2.1.7 Tumblr 4 2.1.8 Instagram 4 2.2 Local Social Networking Services 5 3 Regional Preferences for Social Networking Tools 6 4 African Region...YouTube 280 million Twitter 255 million LinkedIn n/a Pinterest n/a Tumblr 300 million Instagram 200 million The active-user base numbers...so this percentage may decline in the future. 2.1.8 Instagram Instagram , acquired by Facebook in 2012, is a mobile social networking service that

The tryptophan hydroxylase 1 (TPH1) gene, schizophrenia susceptibility, and suicidal behavior: a multi-centre case-control study and meta-analysis

DEFF Research Database (Denmark)

Saetre, Peter; Lundmark, Per; Wang, August

2010-01-01

Serotonin (5-hydroxytryptamin; 5-HT) alternations has since long been suspected in the pathophysiology of schizophrenia. Tryptophan hydroxylase (tryptophan 5-monooxygenase; TPH) is the rate-limiting enzyme in the biosynthesis of 5-HT, and sequence variation in intron 6 of the TPH1 gene has been...... affected individuals having attempted suicide at least once and patients with no history of suicide attempts (P = 0.84). A systematic literature review and meta-analysis support the A218C polymorphism as a susceptibility locus for schizophrenia (odds ratio 1.17, 95% confidence interval 1.......07-1.29). Association studies on suicide attempts are however conflicting (heterogeneity index I(2) = 0.54) and do not support the A218C/A779C polymorphisms being a susceptibility locus for suicidal behavior among individuals diagnosed with a psychiatric disorder (OR = 0.96 [0.80-1.16]). We conclude that the TPH1 A218...

Coordination of Rad1-Rad10 interactions with Msh2-Msh3, Saw1 and RPA is essential for functional 3' non-homologous tail removal.

Science.gov (United States)

Eichmiller, Robin; Medina-Rivera, Melisa; DeSanto, Rachel; Minca, Eugen; Kim, Christopher; Holland, Cory; Seol, Ja-Hwan; Schmit, Megan; Oramus, Diane; Smith, Jessica; Gallardo, Ignacio F; Finkelstein, Ilya J; Lee, Sang Eun; Surtees, Jennifer A

2018-04-06

Double strand DNA break repair (DSBR) comprises multiple pathways. A subset of DSBR pathways, including single strand annealing, involve intermediates with 3' non-homologous tails that must be removed to complete repair. In Saccharomyces cerevisiae, Rad1-Rad10 is the structure-specific endonuclease that cleaves the tails in 3' non-homologous tail removal (3' NHTR). Rad1-Rad10 is also an essential component of the nucleotide excision repair (NER) pathway. In both cases, Rad1-Rad10 requires protein partners for recruitment to the relevant DNA intermediate. Msh2-Msh3 and Saw1 recruit Rad1-Rad10 in 3' NHTR; Rad14 recruits Rad1-Rad10 in NER. We created two rad1 separation-of-function alleles, rad1R203A,K205A and rad1R218A; both are defective in 3' NHTR but functional in NER. In vitro, rad1R203A,K205A was impaired at multiple steps in 3' NHTR. The rad1R218A in vivo phenotype resembles that of msh2- or msh3-deleted cells; recruitment of rad1R218A-Rad10 to recombination intermediates is defective. Interactions among rad1R218A-Rad10 and Msh2-Msh3 and Saw1 are altered and rad1R218A-Rad10 interactions with RPA are compromised. We propose a model in which Rad1-Rad10 is recruited and positioned at the recombination intermediate through interactions, between Saw1 and DNA, Rad1-Rad10 and Msh2-Msh3, Saw1 and Msh2-Msh3 and Rad1-Rad10 and RPA. When any of these interactions is altered, 3' NHTR is impaired.

Changes of primary and secondary metabolites in barley plants exposed to CdO nanoparticles

Czech Academy of Sciences Publication Activity Database

Večeřová, Kristýna; Večeřa, Zbyněk; Dočekal, Bohumil; Oravec, Michal; Pompeiano, Antonio; Tříska, Jan; Urban, Otmar

2016-01-01

Roč. 218, NOV (2016), s. 207-218 ISSN 0269-7491 R&D Projects: GA MŠk(CZ) LO1415; GA ČR(CZ) GAP503/11/2315; GA ČR(CZ) GBP503/12/G147; GA MŠk(CZ) LD15039 Institutional support: RVO:67179843 ; RVO:68081715 Keywords : Barley * CdO nanoparticles * Gas chromatography * High performance liquid chromatography * Mass spectrometry * Plant metabolites Subject RIV: EH - Ecology, Behaviour; CB - Analytical Chemistry, Separation (UIACH-O) Impact factor: 5.099, year: 2016

Waves and currents in tide-dominated location off Dahej, Gulf of Khambhat, India

Digital Repository Service at National Institute of Oceanography (India)

SanilKumar, V.; AshokKumar, K.

stream_size 28493 stream_content_type text/plain stream_name Mar_Geod_33_218a.pdf.txt stream_source_info Mar_Geod_33_218a.pdf.txt Content-Encoding UTF-8 Content-Type text/plain; charset=UTF-8 1 Waves and currents... the Indian coastline. Unnikrishnan et al. (1999) developed a barotropic numerical model of the Gulf of Khambhat and surrounding areas to simulate tides in the Gulf and were successful in simulating the tidal amplification. Nayak and Shetye (2003) found...

The Atacama Cosmology Telescope: cross correlation with Planck maps

Energy Technology Data Exchange (ETDEWEB)

Louis, Thibaut; Calabrese, Erminia; Dunkley, Joanna; Næss, Sigurd [Department of Astrophysics, Oxford University, Oxford OX1 3RH (United Kingdom); Addison, Graeme E.; Hincks, Adam D. [Department of Physics and Astronomy, University of British Columbia, Vancouver, BC V6T 1Z4 (Canada); Hasselfield, Matthew; Hlozek, Renée [Department of Astrophysical Sciences, Peyton Hall, Princeton University, Princeton, NJ 08544 (United States); Bond, J. Richard; Hajian, Amir [Canadian Institute for Theoretical Astrophysics, University of Toronto, Toronto, ON M5S 3H8 (Canada); Das, Sudeep [Argonne National Laboratory, 9700 S. Cass Ave., Lemont, IL 60439 (United States); Devlin, Mark J. [Department of Physics and Astronomy, University of Pennsylvania, 209 South 33rd Street, Philadelphia, PA 19104, U.S.A (United States); Dünner, Rolando; Infante, Leopoldo [Departamento de Astronomía y Astrofísica, Facultad de Física, Pontificia Universidad Católica de Chile, Casilla 306, Santiago 22 (Chile); Gralla, Megan; Marriage, Tobias A. [Dept. of Physics and Astronomy, The Johns Hopkins University, 3400 N. Charles St., Baltimore, MD 21218-2686 (United States); Huffenberger, Kevin [Department of Physics, Florida State University, Keen Physics Building, 77 Chieftan Way, Tallahassee, Florida (United States); Kosowsky, Arthur [Department of Physics and Astronomy, University of Pittsburgh, Pittsburgh, PA, 15260 (United States); Moodley, Kavilan [Astrophysics and Cosmology Research Unit, School of Mathematical Sciences, University of KwaZulu-Natal, Durban, 4041 (South Africa); Niemack, Michael D., E-mail: Thibaut.Louis@astro.ox.ac.uk [Joseph Henry Laboratories of Physics, Jadwin Hall, Princeton University, Princeton, NJ 08544 (United States); and others

2014-07-01

We present the temperature power spectrum of the Cosmic Microwave Background obtained by cross-correlating maps from the Atacama Cosmology Telescope (ACT) at 148 and 218 GHz with maps from the Planck satellite at 143 and 217 GHz, in two overlapping regions covering 592 square degrees. We find excellent agreement between the two datasets at both frequencies, quantified using the variance of the residuals between the ACT power spectra and the ACT × Planck cross-spectra. We use these cross-correlations to measure the calibration of the ACT data at 148 and 218 GHz relative to Planck, to 0.7% and 2% precision respectively. We find no evidence for anisotropy in the calibration parameter. We compare the Planck 353 GHz power spectrum with the measured amplitudes of dust and cosmic infrared background (CIB) of ACT data at 148 and 218 GHz. We also compare planet and point source measurements from the two experiments.

ORF Alignment: NC_002695 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available 159 GIALGAEDYVRNLRTERSPEGTELLFARCSILQAARSAGIQAFDTVYSDANNEAGFLQEA 218 ... GIALGAEDYVRNLRTERSPEGTELLFARC...SILQAARSAGIQAFDTVYSDANNEAGFLQEA Sbjct: 121 GIALGAEDYVRNLRTERSPEGTELLFARCSILQAARSAGIQAFDTVYSDANNEAGFLQEA 180 ...

Solid waste retrieval. Phase 1, Operational basis

International Nuclear Information System (INIS)

Johnson, D.M.

1994-01-01

This Document describes the operational requirements, procedures, and options for execution of the retrieval of the waste containers placed in buried storage in Burial Ground 218W-4C, Trench 04 as TRU waste or suspect TRU waste under the activity levels defining this waste in effect at the time of placement. Trench 04 in Burial Ground 218W-4C is totally dedicated to storage of retrievable TRU waste containers or retrievable suspect TRU waste containers and has not been used for any other purpose

Isotope Exchange in Oxide Catalyst

Science.gov (United States)

Hess, Robert V.; Miller, Irvin M.; Schryer, David R.; Sidney, Barry D.; Wood, George M., Jr.; Hoyt, Ronald F.; Upchurch, Billy T.; Brown, Kenneth G.

1987-01-01

Replacement technique maintains level of CO2/18 in closed-cycle CO2 lasers. High-energy, pulsed CO2 lasers using rare chemical isotopes must be operated in closed cycles to conserve gas. Rare isotopes operated in closed cycles to conserve gas. Rare isotopes as CO2/18 used for improved transmission of laser beam in atmosphere. To maintain laser power, CO2 must be regenerated, and O2 concentration kept below few tenths of percent. Conditions achieved by recombining CO and O2.

Solid waste retrieval. Phase 1, Operational basis

Energy Technology Data Exchange (ETDEWEB)

Johnson, D.M.

1994-09-30

This Document describes the operational requirements, procedures, and options for execution of the retrieval of the waste containers placed in buried storage in Burial Ground 218W-4C, Trench 04 as TRU waste or suspect TRU waste under the activity levels defining this waste in effect at the time of placement. Trench 04 in Burial Ground 218W-4C is totally dedicated to storage of retrievable TRU waste containers or retrievable suspect TRU waste containers and has not been used for any other purpose.

50 CFR 218.105 - Requirements for monitoring and reporting.

Science.gov (United States)

2010-10-01

... Dead Marine Mammals. Navy personnel shall ensure that NMFS is notified immediately ((see Communication... ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking and Importing Marine Mammals; U.S. Navy's Mariana Islands Training Range...

50 CFR 218.184 - Requirements for monitoring and reporting.

Science.gov (United States)

2010-10-01

... individuals; (D) Number of calves present, if any; (E) Duration of sighting; (F) Behavior of marine animals... both visual sightings and behavioral observations of marine animals. (3) These transect data shall... surveys of the detonation area and nearby beaches shall be conducted for stranded marine animals following...

All projects related to | Page 218 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

2012-04-01

Promoting Innovation in the Services Sector: Toward Productivity and Competitiveness. Project. The services sector is increasingly important to the economies of Latin America and the Caribbean, but productivity remains relatively low. Start Date: April 1, 2012. End Date: March 12, 2014. Topic: LATIN AMERICA, SERVICE ...

7 CFR 2.18 - Under Secretary for Food Safety.

Science.gov (United States)

2010-01-01

... availability and safety of processes and treatments that eliminate or substantially reduce the level of... inspection of eggs and egg products. (4) Related to biotechnology. Coordinate the development and carrying... biotechnology as they may affect the safety of meat, poultry or egg products. (5) Related to environmental...

50 CFR 218.24 - Requirements for monitoring and reporting.

Science.gov (United States)

2010-10-01

... days the ship is at sea. (ii) The towed hydrophone array shall be used to supplement the ship-based... for Cherry Point Range Complex and across range complexes, (e) General Notification of Injured or Dead... collection methods shall be standardized across range complexes to allow for comparison in different...

50 CFR 218.5 - Requirements for monitoring and reporting.

Science.gov (United States)

2010-10-01

... array shall be deployed during daylight hours for each of the days the ship is at sea. (ii) The towed... method for standardizing data collection for VACAPES Range Complex and across range complexes. (e... Monitoring Plan. Data collection methods shall be standardized across range complexes to allow for comparison...

50 CFR 218.14 - Requirements for monitoring and reporting.

Science.gov (United States)

2010-10-01

... array shall be deployed during daylight hours for each of the days the ship is at sea. (ii) The towed... method for standardizing data collection for JAX Range Complex and across range complexes. (e) General... collection methods will be standardized across range complexes to allow for comparison in different...

Molecular Evolution at a Meiosis Gene Mediates Species Differences in the Rate and Patterning of Recombination.

Science.gov (United States)

Brand, Cara L; Cattani, M Victoria; Kingan, Sarah B; Landeen, Emily L; Presgraves, Daven C

2018-04-23

Crossing over between homologous chromosomes during meiosis repairs programmed DNA double-strand breaks, ensures proper segregation at meiosis I [1], shapes the genomic distribution of nucleotide variability in populations, and enhances the efficacy of natural selection among genetically linked sites [2]. Between closely related Drosophila species, large differences exist in the rate and chromosomal distribution of crossing over. Little, however, is known about the molecular genetic changes or population genetic forces that mediate evolved differences in recombination between species [3, 4]. Here, we show that a meiosis gene with a history of rapid evolution acts as a trans-acting modifier of species differences in crossing over. In transgenic flies, the dicistronic gene, mei-217/mei-218, recapitulates a large part of the species differences in the rate and chromosomal distribution of crossing over. These phenotypic differences appear to result from changes in protein sequence not gene expression. Our population genetics analyses show that the protein-coding sequence of mei-218, but not mei-217, has a history of recurrent positive natural selection. By modulating the intensity of centromeric and telomeric suppression of crossing over, evolution at mei-217/-218 has incidentally shaped gross differences in the chromosomal distribution of nucleotide variability between species. We speculate that recurrent bouts of adaptive evolution at mei-217/-218 might reflect a history of coevolution with selfish genetic elements. Copyright © 2018 Elsevier Ltd. All rights reserved.

123I-MIBG imaging detects cardiac involvement and predicts cardiac events in Churg-Strauss syndrome

International Nuclear Information System (INIS)

Horiguchi, Yoriko; Morita, Yukiko; Tsurikisawa, Naomi; Akiyama, Kazuo

2011-01-01

In Churg-Strauss syndrome (CSS) it is important to detect cardiac involvement, which predicts poor prognosis. This study evaluated whether 123 I-metaiodobenzylguanidine (MIBG) scintigraphy could detect cardiac damage and predict cardiac events in CSS. 123 I-MIBG scintigraphy was performed in 28 patients with CSS, 12 of whom had cardiac involvement. The early and delayed heart to mediastinum ratio (early H/M and delayed H/M) and washout rate were calculated by using 123 I-MIBG scintigraphy and compared with those in control subjects. Early H/M and delayed H/M were significantly lower and the washout rate was significantly higher in patients with cardiac involvement than in those without and in controls (early H/M, p = 0.0024, p = 0.0001; delayed H/M, p = 0.0002, p = 0.0001; washout rate, p = 0.0012, p = 0.0052 vs those without and vs controls, respectively). Accuracy for detecting cardiac involvement was 86% for delayed H/M and washout rate and 79% for early H/M and B-type natriuretic peptide (BNP). Kaplan-Meier analysis showed significantly lower cardiac event-free rates in patients with early H/M ≤ 2.18 and BNP > 21.8 pg/ml than those with early H/M > 2.18 and BNP ≤ 21.8 pg/ml (log-rank test p = 0.006). Cardiac sympathetic nerve function was damaged in CSS patients with cardiac involvement. 123 I-MIBG scintigraphy was useful in detecting cardiac involvement and in predicting cardiac events. (orig.)

ORF Alignment: NC_003305 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available = 70 ... Query: 218 LGRLRSTIEAEREFTANSAHELRTPIAGALAQAQRLRVDIPPELAPRVENIEKSLQHLAH 277 ... LGRLRSTIEAEREFTANSAHEL...RTPIAGALAQAQRLRVDIPPELAPRVENIEKSLQHLAH Sbjct: 1 ... LGRLRSTIEAEREFTANSAHELRTPIAGALAQAQRLRVDIPPELAPRVENIEKSLQHLAH 60 ...

Melting-pressure and density equations of 3He at temperatures from 0.001 to 30 K

International Nuclear Information System (INIS)

Huang Yonghua; Chen Guobang

2005-01-01

Nonsegmented equations for melting pressure and density at temperatures from 0.001 K to 30 K have been developed to fit the reference data. The maximum and average deviations between the melting pressure equation and the totaling 298 reference data are 2.17% and 0.218%, respectively. For the density equations, the average deviations are 0.236% for the liquid side and 0.218% for the solid side. Both the melting pressure curve and melting density curves predicted by the submitted equations approach their minimums at about 0.315 K

Low-Level Burial Grounds Dangerous Waste Permit Application design documents

International Nuclear Information System (INIS)

1990-01-01

This document presents the Functional Design Criteria for trenches to be constructed to receive solid radioactive mixed waste (RMW) from on and offsite generators. The new RMW disposal facilities are considered modifications to or lateral expansion of the existing low-level waste burial grounds. The new facilities upgrade the existing disposal practice for RMW to the minimum technology requirements of the Resource Conservation and Recovery Act. The proposed locations for the two facilities are: 218-E-10 for drag-off-waste packages and, 218-W-4C for non drag-off waste packages

Consumer Psychology and Marketing Overview: An Influence Operations Perspective

Science.gov (United States)

2012-01-01

Ontario – en particulier les examens de la littérature sur les opérations d’influence (CR-2007-146), la psychologie du consommateur (CR 2008-218) et... psychologie du consommateur, dont certains ou la totalité pourraient être applicables aux opérations d’influence actuelles des FC. Cet article se veut une...les opérations d’influence (CR-2007-146), l’examen de la littérature sur la psychologie du consommateur (CR 2008-218) et une annexe au matériel, à la

Emanations and 'induced' radioactivity: from mystery to (mis)use

International Nuclear Information System (INIS)

Kolar, Z.I.

1999-01-01

The natural Rn isotopes were discovered within the period 1899-1902 and at that time referred to as emanations because they came out (emanated) of sources/materials containing actinium, thorium and radium, respectively. The (somewhat mysterious) emanations appeared to disintegrate into radioactive decay products which by depositing at solid surfaces gave rise to 'induced' radioactivity i.e. radioactive substances with various half-lives. Following the discovery of the emanations the volume of the research involving them and their disintegration products grew steeply. The identity of a number of these radioactive products was soon established. Radium emanation was soon used as a source of RaD ( 210 Pb) to be applied as an 'indicator' (radiotracer) for lead in a study on the solubility of lead sulphide and lead chromate. Moreover, radium and its emanation were introduced into the medical practice. Inhaling radon and drinking radon-containing water became an accepted medicinal use (or misuse?) of that gas. Shortly after the turn of the century, the healing (?) action of natural springs (spas) was attributed to their radium emanation, i.e. radon. Bathing in radioactive spring water and drinking it became very popular. Even today, bathing in radon-containing water is still a common medical treatment in Jachymov, Czech Republic. (author)

Study of Soil Decontamination Method Using Supercritical Carbon Dioxide and TBP

International Nuclear Information System (INIS)

Park, Jihye; Park, Kwangheon; Jung, Wonyoung

2014-01-01

The result of this study means that we have a possible new method for cheap and less wasteful nuclear waste decontamination. When severe accidents such as the incident at the Fukushima nuclear site occur, the soil near the power plant is contaminated with fission products or the activation metal structure of the power plant. The soil pollution form depends on the environment and soil characteristics of the contaminated areas. Thus, a- single-decontamination method is not effective for site cleanup. In addition, some soil decontamination methods are expensive and large amounts of secondary waste are generated. Therefore, we need new soil decontamination methods. In this study, instead of using a conventional solvent method that generates secondary waste, supercritical carbon dioxide was used to remove metal ions from the soil. Supercritical carbon dioxide is known for good permeation characteristics. We expect that we will reduce the cost of soil pollution management. Supercritical carbon dioxide can decontaminate soil easily, as it has the ability to penetrate even narrow gaps with very good moisture permeability. We used TBP, which is a known for extractant of actinium metal. TBP is usually used for uranium and strontium extraction. Using TBP-HNO 3 complex and supercritical carbon dioxide, we did extraction experiments for several heavy metals in contaminated soil

Study of Soil Decontamination Method Using Supercritical Carbon Dioxide and TBP

Energy Technology Data Exchange (ETDEWEB)

Park, Jihye; Park, Kwangheon; Jung, Wonyoung [Kyunghee Univ., Yongin (Korea, Republic of)

2014-05-15

The result of this study means that we have a possible new method for cheap and less wasteful nuclear waste decontamination. When severe accidents such as the incident at the Fukushima nuclear site occur, the soil near the power plant is contaminated with fission products or the activation metal structure of the power plant. The soil pollution form depends on the environment and soil characteristics of the contaminated areas. Thus, a- single-decontamination method is not effective for site cleanup. In addition, some soil decontamination methods are expensive and large amounts of secondary waste are generated. Therefore, we need new soil decontamination methods. In this study, instead of using a conventional solvent method that generates secondary waste, supercritical carbon dioxide was used to remove metal ions from the soil. Supercritical carbon dioxide is known for good permeation characteristics. We expect that we will reduce the cost of soil pollution management. Supercritical carbon dioxide can decontaminate soil easily, as it has the ability to penetrate even narrow gaps with very good moisture permeability. We used TBP, which is a known for extractant of actinium metal. TBP is usually used for uranium and strontium extraction. Using TBP-HNO{sub 3} complex and supercritical carbon dioxide, we did extraction experiments for several heavy metals in contaminated soil.

ORF Alignment: NC_004631 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available PLYRDVETIVRVNALDSEWGVNDLEAVVRGGAD 60 ... Query: 159 GIALGAEDYVRNLRTERSPEGTELLFARCAILQAARSAGIQAFDTVYSDANNEAGFLQE...A 218 ... GIALGAEDYVRNLRTERSPEGTELLFARCAILQAARSAGIQAFDTVYSDANNEAGFLQEA Sbjct: 121 GIALGAEDYVRNLRTERSPEGTELLFARCAILQAARSAGIQAFDTVYSDANNEAGFLQEA 180 ...

ORF Alignment: NC_003197 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available PLYRDVETIVRVNALDSEWGVNDLEAVVRGGAD 60 ... Query: 159 GIALGAEDYVRNLRTERSPEGTELLFARCAILQAARSAGIQAFDTVYSDANNEAGFLQE...A 218 ... GIALGAEDYVRNLRTERSPEGTELLFARCAILQAARSAGIQAFDTVYSDANNEAGFLQEA Sbjct: 121 GIALGAEDYVRNLRTERSPEGTELLFARCAILQAARSAGIQAFDTVYSDANNEAGFLQEA 180 ...

ORF Alignment: NC_006905 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available AVVRGGAD 60 ... Query: 159 GIALGAEDYVRNLRTERSPEGTELLFARCAILQAARSAGIQAFDTVYSDANNEAGFL...QEA 218 ... GIALGAEDYVRNLRTERSPEGTELLFARCAILQAARSAGIQAFDTVYSDANNEAGFLQEA Sbjct: 121 GIALGAEDYVRNLRTERSPEGTELLFARCAILQAARSAGIQAFDTVYSDANNEAGFLQEA 180 ...

Collinear resonant ionization laser spectroscopy of rare francium isotopes

CERN Multimedia

Neyens, G; Flanagan, K; Rajabali, M M; Le blanc, F M; Ware, T; Procter, T J

2008-01-01

We propose a programme of collinear resonant ionization spectroscopy (CRIS) of the francium isotopes up to and including $^{201}$Fr and $^{218,219}$Fr. This work aims at answering questions on the ordering of quantum states, and effect of the ($\\pi s_{1/2}^{-1}$)1/2$^{+}$ intruder state, which is currently believed to be the ground state of $^{199}$Fr. This work will also study the edge of the region of reflection asymmetry through measurement of the moments and radii of $^{218,219}$Fr. This proposal forms the first part of a series of experiments that will study nuclei in this region of the nuclear chart. Based on the success of this initial proposal it is the intention of the collaboration to perform high resolution measurements on the isotopes of radium and radon that surround $^{201}$Fr and $^{218}$Fr and thus providing a comprehensive description of the ground state properties of this region of the nuclear chart. Recent in-source spectroscopy measurements of lead, bismuth and polonium have demonstrated a...

Ultraviolet inactivation and photoreactivation of the cholera phage 'Kappa'

International Nuclear Information System (INIS)

Samad, S.A.; Bhattacharyya, S.C.; Chatterjee, S.N.

1987-01-01

The lysogenic cholera phage, 'Kappa' is some ten to twenty folds more resistant to UV (254 nm) than are most of the T. phages of E. coli, or the cholera phage PL 163/10, or the host V. cholerae strain H218 Sm r , the 37% (D 37 ) and 10% (D 10 ) survival doses being 255.8 J/m 2 and 633.6 J/m 2 respectively. The UV-irradiated 'Kappa' phages could be photoreactivated in the host V. cholerae strain H218 Sm r to a maximum extent of 40%. The removal of the number of lethal hits per phage by the survival-enhancement treatment (photoreactivation) with time followed an exponential relation, the constant probability of removal of lethal hit per unit time being 2.8x10 -2 min -1 . The UV-irradiated phages could also be Weigle reactivated in the host strain of H218 Sm r by a small degree, the maximum reactivation factor (ratio of survivals in UV-irradiated and non-irradiated hosts) being 1.50. (orig.)

Radiation Area Remedial Action FY 1996 summary report

International Nuclear Information System (INIS)

Hayward, W.M.

1996-11-01

The Radiation Area Remedial Action (RARA) project is responsible for the interim stabilization and maintenance of the majority of the inactive waste sites at the Hanford Site. These waste sites include approximately 400 individual sites and 4,000 acres. Three facilities were removed from the RARA list near the end of fiscal year (FY) 1996P: the 218-W-4B, 218-E-10, and 218-E-12B Burial Grounds. These three facilities are treatment, storage, and disposal (TSD) sites assigned to Fluor Daniel Hanford. Therefore, the RARA project will no longer perform activities on the inactive portions to maintain clear lines of responsibility (fully with Fluor Daniel Hanford). RARA activities are broken into two broad categories: interim stabilization, and surveillance and maintenance (S and M). Interim stabilization addresses major corrective actions for sites with radioactive surface contamination. A site continues to require S and M once it has received interim stabilization. Vegetation management is a significant activity under the RARA project. The goal is to control vegetation that may grow and spread radioactive contamination

ORF Alignment: NC_006511 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available : 1 ... LMFDLEDSVALREKDAARRLVYHALQHPLYRDVETIVRVNALDSEWGVNDLEAVVRGGAD 60 ... Query: 159 GIALGAEDYVRNLRTERSPEGTELLFARC...AILQAARSAGIQAFDTVYSDANNEAGFLQEA 218 ... GIALGAEDYVRNLRTERSPEGTELLFARCAI...LQAARSAGIQAFDTVYSDANNEAGFLQEA Sbjct: 121 GIALGAEDYVRNLRTERSPEGTELLFARCAILQAARSAGIQAFDTVYSDANNEAGFLQEA 180 ...

ORF Alignment: NC_003198 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available IALGAEDYVRNLRTERSPEGTELLFARCAILQAARSAGIQAFDTVYSDANNEAGFLQEA 218 ... GIALGAEDYVRNLRTERSPEGTELLFARCAILQ...AARSAGIQAFDTVYSDANNEAGFLQEA Sbjct: 121 GIALGAEDYVRNLRTERSPEGTELLFARCAILQAARSAGIQAFDTVYSDANNEAGFLQEA 180 ... ...1 ... LMFDLEDSVALREKHAARRLVYHALQHPLYRDVETIVRVNALDSEWGVNDLEAVVRGGAD 60 ... Query: 159 G

{sup 123}I-MIBG imaging detects cardiac involvement and predicts cardiac events in Churg-Strauss syndrome

Energy Technology Data Exchange (ETDEWEB)

Horiguchi, Yoriko; Morita, Yukiko [National Hospital Organization Sagamihara National Hospital, Department of Cardiology, Sagamihara City, Kanagawa (Japan); Tsurikisawa, Naomi; Akiyama, Kazuo [National Hospital Organization Sagamihara National Hospital, Clinical Research Centre for Allergy and Rheumatology, Sagamihara City, Kanagawa (Japan)

2011-02-15

In Churg-Strauss syndrome (CSS) it is important to detect cardiac involvement, which predicts poor prognosis. This study evaluated whether {sup 123}I-metaiodobenzylguanidine (MIBG) scintigraphy could detect cardiac damage and predict cardiac events in CSS. {sup 123}I-MIBG scintigraphy was performed in 28 patients with CSS, 12 of whom had cardiac involvement. The early and delayed heart to mediastinum ratio (early H/M and delayed H/M) and washout rate were calculated by using {sup 123}I-MIBG scintigraphy and compared with those in control subjects. Early H/M and delayed H/M were significantly lower and the washout rate was significantly higher in patients with cardiac involvement than in those without and in controls (early H/M, p = 0.0024, p = 0.0001; delayed H/M, p = 0.0002, p = 0.0001; washout rate, p = 0.0012, p = 0.0052 vs those without and vs controls, respectively). Accuracy for detecting cardiac involvement was 86% for delayed H/M and washout rate and 79% for early H/M and B-type natriuretic peptide (BNP). Kaplan-Meier analysis showed significantly lower cardiac event-free rates in patients with early H/M {<=} 2.18 and BNP > 21.8 pg/ml than those with early H/M > 2.18 and BNP {<=} 21.8 pg/ml (log-rank test p = 0.006). Cardiac sympathetic nerve function was damaged in CSS patients with cardiac involvement. {sup 123}I-MIBG scintigraphy was useful in detecting cardiac involvement and in predicting cardiac events. (orig.)

ORF Alignment: NC_002936 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... Length = 218 ... Query: 167 GRHRLMCGDATSPEDVEKLMDGKKANLILTDPPYGVSFKASDGLTIQNDSLKGEEFYKFL 226 ... ... ... GRHRLMCGDATSPEDVEKLMDGKKANLILTDPPYGVSFKASDGLTIQNDSLKGEEFYKFL Sbjct: 1 ... GRHRLM...CGDATSPEDVEKLMDGKKANLILTDPPYGVSFKASDGLTIQNDSLKGEEFYKFL 60 ... Query: 287 QHEPVLYGFLQNGKHPWYSDRKQTTIWNYDKPKRNKDH

Protein (Viridiplantae): 746637 [PGDBj - Ortholog DB

Lifescience Database Archive (English)

Full Text Available 218 ... 38832:274 ... 38833:414 ... 564608:414 predicted protein Micromonas pusilla CCMP1545 MAQLPSYEVDDGEDSMPGAPGEGPMTDSMQGPPVEVPTSDSM...PGAPGEVPTMDSMHGPPVEVPTMDSMHGAPVEVPMMDSMPGAPVEVPTMDSMQGPPVEVPTMDSMQGAPGEGPMTDSMHGAPGEGPTMDSMNSGNPTKCVVPDWCSTYPPEMQKSKPECQCPDDSHP

Contributions of conserved residues at the gating interface of glycine receptors

DEFF Research Database (Denmark)

Pless, Stephan Alexander; Leung, Ada W Y; Galpin, Jason D

2011-01-01

and the in vivo nonsense suppression method to incorporate unnatural amino acids to probe the electrostatic and hydrophobic contributions of five highly conserved side chains near the interface, Glu-53, Phe-145, Asp-148, Phe-187, and Arg-218. Our results suggest a salt bridge between Asp-148 in loop 7 and Arg-218......Glycine receptors (GlyRs) are chloride channels that mediate fast inhibitory neurotransmission and are members of the pentameric ligand-gated ion channel (pLGIC) family. The interface between the ligand binding domain and the transmembrane domain of pLGICs has been proposed to be crucial...

Benzodiazepine receptor and neurotransmitter studies in the brain of suicides

Energy Technology Data Exchange (ETDEWEB)

Manchon, M.; Kopp, N.; Rouzioux, J.J.; Lecestre, D.; Deluermoz, S.; Miachon, S.

1987-12-14

The characteristics of benzodiazepine binding sites were studied on frozen sections of hippocampus of 7 suicides and 5 controls subjects, using biochemical and autoradiographic techniques. /sup 3/H flunitrazepam was used as ligand, clonazepam and CL 218,872 as displacing agents. Some neurotransmitters or their derivatives were evaluated quantitatively in parallel in the hippocampal tissue by liquid chromatography. The authors observed mainly an increase in the Ki of CL 218,872 subtype I binding sites in suicides, and an increase in % of type I binding sites. Among neurotransmitters, only norepinephrine differed significantly between controls and suicides. 36 references, 3 figures, 1 table.

Integration of Systems with Varying Levels of Autonomy (Integration de Systemes a Niveau d’Autonomie Variable)

Science.gov (United States)

2008-09-01

2.2.2.1 Theseus AUV 2-15 2.2.3 Air and Space 2-18 2.2.3.1 F-22A Flying Qualities Development 2-18 2.2.3.2 Apollo and Space Shuttle 2-19 2.2.3.3...Figure 2.14 The Multi-Mission Spartan Vehicle and the Remote Minehunting Vehicle Dorado 2-15 Figure 2.15 Theseus Schematic 2-16 Figure 2.16 The...Disciplines 6-3 RTO-TR-SCI-144 ix List of Tables Table Page Table 2.1 Thrust and Pitch Attitude Before the Accident 2-6 Table 2.2 Theseus

Benzodiazepine receptor and neurotransmitter studies in the brain of suicides

International Nuclear Information System (INIS)

Manchon, M.; Kopp, N.; Rouzioux, J.J.; Lecestre, D.; Deluermoz, S.; Miachon, S.

1987-01-01

The characteristics of benzodiazepine binding sites were studied on frozen sections of hippocampus of 7 suicides and 5 controls subjects, using biochemical and autoradiographic techniques. 3 H flunitrazepam was used as ligand, clonazepam and CL 218,872 as displacing agents. Some neurotransmitters or their derivatives were evaluated quantitatively in parallel in the hippocampal tissue by liquid chromatography. The authors observed mainly an increase in the Ki of CL 218,872 subtype I binding sites in suicides, and an increase in % of type I binding sites. Among neurotransmitters, only norepinephrine differed significantly between controls and suicides. 36 references, 3 figures, 1 table

Can 3'-Deoxy-3'-((18)F) Fluorothymidine Out Perform 2-Deoxy-2-((18)F) Fluoro-D-Glucose Positron Emission Tomography/Computed Tomography in the Diagnosis of Cervical Lymphadenopathy in Patients With Oral/Head and Neck Cancer?

Science.gov (United States)

Schaefferkoetter, Joshua D; Carlson, Eric R; Heidel, Robert E

2015-07-01

The present study investigated the performance of cellular metabolism imaging with 2-deoxy-2-((18)F) fluoro-D-glucose (FDG) versus cellular proliferation imaging with 3'-deoxy-3'-((18)F) fluorothymidine (FLT) in the detection of cervical lymph node metastases in oral/head and neck cancer. We conducted a prospective cohort study to assess a head-to-head performance of FLT imaging and clinical FDG imaging for characterizing cervical lymph node metastases in patients with squamous cell carcinoma (SCC) of the oral/head and neck region. The primary predictor variable of the study was the presence of FDG or FLT avidity within the cervical lymph nodes. The primary outcome variable was the histologic presence of metastatic SCC in the cervical lymph nodes. The performance was reported in terms of the sensitivity, specificity, accuracy, and positive and negative predictive values. The overall accuracy for discriminating positive from negative lymph nodes was evaluated as a function of the positron emission tomography (PET) standardized uptake value (SUV). Receiver operating characteristic (ROC) analyses were performed for both tracers. Eleven patients undergoing surgical resection of SCC of the oral/head and neck region underwent preoperative FDG and FLT PET-computed tomography (CT) scans on separate days. The interpretation of the FDG PET-CT imaging resulted in sensitivity, specificity, accuracy, positive predictive value, and negative predictive value of 43.2, 99.5, 94.4, 88.9, and 94.7%, respectively. The sensitivity, specificity, accuracy, positive predictive value, and negative predictive value for FLT PET-CT imaging was 75.7, 99.2, 97.1, 90.3, and 97.7%, respectively. The areas under the curve for the ROC curves were 0.9 and 0.84 for FDG and FLT, respectively. Poor correlation was observed between the SUV for FDG and FLT within the lymph nodes and tumors. FLT showed better overall performance for detecting lymphadenopathy on qualitative assessment within the total

Structural Basis for Redox Regulation of Cytoplasmic and Chloroplastic Triosephosphate Isomerases from Arabidopsis thaliana

Directory of Open Access Journals (Sweden)

Laura Margarita López-Castillo

2016-12-01

Full Text Available In plants triosephosphate isomerase (TPI interconverts glyceraldehyde 3-phosphate (G3P and dihydroxyacetone phosphate (DHAP during glycolysis, gluconeogenesis, and the Calvin-Benson cycle. The nuclear genome of land plants encodes two tpi genes, one gene product is located in the cytoplasm and the other is imported into the chloroplast. Herein we report the crystal structures of the TPIs from the vascular plant Arabidopsis thaliana (AtTPIs and address their enzymatic modulation by redox agents. Cytoplasmic TPI (cTPI and chloroplast TPI (pdTPI share more than 60% amino acid identity and assemble as (β-α8 dimers with high structural homology. cTPI and pdTPI harbor two and one accessible thiol groups per monomer respectively. cTPI and pdTPI present a cysteine at an equivalent structural position (C13 and C15 respectively and cTPI also contains a specific solvent accessible cysteine at residue 218 (cTPI-C218. Site directed mutagenesis of residues pdTPI-C15, cTPI-C13 and cTPI-C218 to serine substantially decreases enzymatic activity, indicating that the structural integrity of these cysteines is necessary for catalysis. AtTPIs exhibit differential responses to oxidative agents, cTPI is susceptible to oxidative agents such as diamide and H2O2, whereas pdTPI is resistant to inhibition. Incubation of AtTPIs with the sulfhydryl conjugating reagents methylmethane thiosulfonate (MMTS and glutathione inhibits enzymatic activity. However, the concentration necessary to inhibit pdTPI is at least two orders of magnitude higher than the concentration needed to inhibit cTPI. Western-blot analysis indicates that residues cTPI-C13, cTPI-C218, and pdTPI-C15 conjugate with glutathione. In summary, our data indicate that AtTPIs could be redox regulated by the derivatization of specific AtTPI cysteines (cTPI-C13 and pdTPI-C15 and cTPI-C218. Since AtTPIs have evolved by gene duplication, the higher resistance of pdTPI to redox agents may be an adaptive consequence to

Oxygen Atom Exchange between H2O and Non-Heme Oxoiron(IV) Complexes: Ligand Dependence and Mechanism.

Science.gov (United States)

Puri, Mayank; Company, Anna; Sabenya, Gerard; Costas, Miquel; Que, Lawrence

2016-06-20

Detailed studies of oxygen atom exchange (OAE) between H2(18)O and synthetic non-heme oxoiron(IV) complexes supported by tetradentate and pentadentate ligands provide evidence that they proceed by a common mechanism but within two different kinetic regimes, with OAE rates that span 2 orders of magnitude. The first kinetic regime involves initial reversible water association to the Fe(IV) complex, which is evidenced by OAE rates that are linearly dependent on [H2(18)O] and H2O/D2O KIEs of 1.6, while the second kinetic regime involves a subsequent rate determining proton-transfer step between the bound aqua and oxo ligands that is associated with saturation behavior with [H2(18)O] and much larger H2O/D2O KIEs of 5-6. [Fe(IV)(O)(TMC)(MeCN)](2+) (1) and [Fe(IV)(O)(MePy2TACN)](2+) (9) are examples of complexes that exhibit kinetic behavior in the first regime, while [Fe(IV)(O)(N4Py)](2+) (3), [Fe(IV)(O)(BnTPEN)](2+) (4), [Fe(IV)(O)(1Py-BnTPEN)](2+) (5), [Fe(IV)(O)(3Py-BnTPEN)](2+) (6), and [Fe(IV)(O)(Me2Py2TACN)](2+) (8) represent complexes that fall in the second kinetic regime. Interestingly, [Fe(IV)(O)(PyTACN)(MeCN)](2+) (7) exhibits a linear [H2(18)O] dependence below 0.6 M and saturation above 0.6 M. Analysis of the temperature dependence of the OAE rates shows that most of these complexes exhibit large and negative activation entropies, consistent with the proposed mechanism. One exception is complex 9, which has a near-zero activation entropy and is proposed to undergo ligand-arm dissociation during the RDS to accommodate H2(18)O binding. These results show that the observed OAE kinetic behavior is highly dependent on the nature of the supporting ligand and are of relevance to studies of non-heme oxoiron(IV) complexes in water or acetonitrile/water mixtures for applications in photocatalysis and water oxidation chemistry.

Heterologous expression of three Camellia sinensis small heat shock protein genes confers temperature stress tolerance in yeast and Arabidopsis thaliana.

Science.gov (United States)

Wang, Mingle; Zou, Zhongwei; Li, Qinghui; Xin, Huahong; Zhu, Xujun; Chen, Xuan; Li, Xinghui

2017-07-01

CsHSP17.7, CsHSP18.1, and CsHSP21.8 expressions are induced by heat and cold stresses, and CsHSP overexpression confers tolerance to heat and cold stresses in transgenic Pichia pastoris and Arabidopsis thaliana. Small heat shock proteins (sHSPs) are crucial for protecting plants against biotic and abiotic stresses, especially heat stress. However, knowledge concerning the functions of Camellia sinensis sHSP in heat and cold stresses remains poorly understood. In this study, three C. sinensis sHSP genes (i.e., CsHSP17.7, CsHSP18.1, and CsHSP21.8) were isolated and characterized using suppression subtractive hybridization (SSH) technology. The CsHSPs expression levels in C. sinensis leaves were significantly up-regulated by heat and cold stresses. Phylogenetic analyses revealed that CsHSP17.7, CsHSP18.1, and CsHSP21.8 belong to sHSP Classes I, II, and IV, respectively. Heterologous expression of the three CsHSP genes in Pichia pastoris cells enhanced heat and cold stress tolerance. When exposed to heat and cold treatments, transgenic Arabidopsis thaliana plants overexpressing CsHSP17.7, CsHSP18.1, and CsHSP21.8 had lower malondialdehyde contents, ion leakage, higher proline contents, and transcript levels of stress-related genes (e.g., AtPOD, AtAPX1, AtP5CS2, and AtProT1) compared with the control line. In addition, improved seed germination vigor was also observed in the CsHSP-overexpressing seeds under heat stress. Taken together, our results suggest that the three identified CsHSP genes play key roles in heat and cold tolerance.

TOB1 Deficiency Enhances the Effect of Bone Marrow-Derived Mesenchymal Stem Cells on Tendon-Bone Healing in a Rat Rotator Cuff Repair Model

Directory of Open Access Journals (Sweden)

Yulei Gao

2016-01-01

Full Text Available Background/Aims: This study investigated the effect of silencing TOB1 (Transducer of ERBB2, 1 expression in bone marrow-derived mesenchymal stem cells (MSCs on MSC-facilitated tendon-bone healing in a rat supraspinatus repair model. Methods: Rat MSCs were transduced with a recombinant lentivirus encoding short hairpin RNA (shRNA against TOB1. MSC cell proliferation was analyzed by 3-(4,5-dimethylthiazol-2-yl-2,5-diphenyltetrazolium bromide (MTT assays. The effect of MSCs with TOB1 deficiency on tendon-bone healing in a rat rotator cuff repair model was evaluated by biomechanical testing, histological analysis and collagen type I and II gene expression. An upstream regulator (miR-218 of TOB1 was determined in MSCs. Results: We found that knockdown of TOB1 significantly increased the proliferative activity of rat MSCs in vitro. When MSCs with TOB1 deficiency were injected into injured rat supraspinatus tendon-bone junctions, the effect on tendon-bone healing was enhanced compared to treatment with control MSCs with normal TOB1 expression, as evidenced by elevated levels of ultimate load to failure and stiffness, increased amount of fibrocartilage and augmented expression of collagen type I and type II genes. In addition, we found that the TOB1 3′ untranslated region is a direct target of miR-218. Similar to the effect of TOB1 deficiency, overexpression of miR-218 effectively promoted tendon-bone healing in rat. Conclusion: These results suggest that TOB1 may play a negative role in the effect of MSCs on tendon-bone healing, and imply that expression of TOB1 may be regulated by miR-218.

Assessing the deposition of radon progeny from a uranium glass necklace

International Nuclear Information System (INIS)

Hanse, M.F.; Moss, G.R.

2015-01-01

Could jewellery made from uranium glass beads pose an increased risk to skin cancer? The literature Eatough (Alpha-particle dosimetry for the basal layer of the skin and the radon progeny 218 Po and 214 Po. Phys. Med. Biol. 1997;42:1899-1911.) suggests that the alphas from the short-lived radon daughters, 218 Po and 214 Po, may reach the basal layer of the epidermis, which is believed to be important in the induction of skin cancers. The deposition of the alphas from the 218 Po and 214 Po daughters was investigated using PADC detector material. The expectation would be that no alpha particles would penetrate through the dead skin layer, assuming the average of 70 microns used in radiation protection, but the skin around the collar bone could potentially be thinner than the assumed average. It should be noticed that by inserting a slice of pig skin in between the necklace and the PADC, no great excess of alpha tracks were seen after 1 week of exposure in the freezer. There was, however, a clear signal through the pig skin from beta particles, confirming the potential of a uranium bead necklace posing a health risk. (authors)

Importance of secondary damage in downer cows.

Science.gov (United States)

Poulton, P J; Vizard, A L; Anderson, G A; Pyman, M F

2016-05-01

To investigate the relative importance in downer cows of the primary cause of recumbency in comparison with secondary complications. Downer dairy cows were monitored during their recumbency under field conditions in South Gippsland, Victoria, Australia. The cause of the original recumbency of the 218 cows was determined and secondary damage, status on day 7 and final outcome were recorded. Some type of secondary damage was found in 183/218 (84%) cows, of which 173/218 (79%) had damage deemed to be clinically important. By day 7, 52 (24%) had recovered and 69 (32%) eventually recovered. Of the 149 (68%) cows that were euthanased or died, 23 (15%) were deemed to have been lost solely from the primary cause, 107 (72%) from secondary damage and 19 (13%) from a combination of both. There was no difference in recovery among the five broad groups of causes of primary recumbency. Secondary damage was very common and presented in a large variety of ways, with many cows having multiple types of secondary damage concurrently. For most cows the secondary damage was more important than the initial primary damage in determining their fate. © 2016 Australian Veterinary Association.

ORF Alignment: NC_005004 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... epidermidis ATCC 12228] ... Length = 258 ... Query: 159 PNEIWQADHTLLDIYILDQTGNINRPWLTIIMDDYSRAIAGY...FISFEAPNAQNTALTLHQ 218 ... PNEIWQADHTLLDIYILDQTGNINRPWLTIIMDDYSRAIAGYFISFE...APNAQNTALTLHQ Sbjct: 1 ... PNEIWQADHTLLDIYILDQTGNINRPWLTIIMDDYSRAIAGYFISFEAPNAQNTALTLHQ 60 ... Query: 279 FQTVNQT

ORF Alignment: NC_005126 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available oduct ... [Photorhabdus luminescens subsp. laumondii TTO1] ... Length = 218 ... Query: 87 ... LEQKMTTDIPSAS...LTQKGVVQLTNVVGNSDTLAVTQKLVQEVINSLREYTREEIDNRMKT 146 ... LEQKMTTDIPSAS...LTQKGVVQLTNVVGNSDTLAVTQKLVQEVINSLREYTREEIDNRMKT Sbjct: 1 ... LEQKMTTDIPSASLTQKGVVQLTNVVGNSDTLAVTQKLVQEVINSLR

30 CFR 218.540 - How does MMS serve official correspondence?

Science.gov (United States)

2010-07-01

... agent; (ii) Any corporate officer; or (iii) The addressee of record shown in the files of any State Secretary; Corporate Commission; Federal or state agency that keeps official records of business entities or... delivery made pursuant to the law of the State in which the service is effected; or (3) Private mailing...

218. Asistencia circulatoria de larga duración. Experiencia inicial

Directory of Open Access Journals (Sweden)

J. Otero

2012-04-01

Conclusiones: La asistencia ventricular de larga duración es una terapia segura y efectiva en pacientes con cardiopatías terminales, ya sea como puente a trasplante, recuperación o terapia de destino.

ORF Alignment: NC_005126 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available oduct ... [Photorhabdus luminescens subsp. laumondii TTO1] ... Length = 104 ... Query: 218 QDLQRWAQANLQGISGLQDMATH...MNLSIRHLGRLFRQELNMKAGVWLEHARIEKARTLLE 277 ... QDLQRWAQANLQGISGLQDMATH...MNLSIRHLGRLFRQELNMKAGVWLEHARIEKARTLLE Sbjct: 1 ... QDLQRWAQANLQGISGLQDMATHMNLSIRHLGRLFRQELNMKAGVWLEHARIEKARTLLE 60 ...

ORF Alignment: NC_006677 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available aC family ... [Gluconobacter oxydans 621H] ... Length = 94 ... Query: 159 RVANTLSDNPADNRDQKDWAELA...AMSLRSFVRHFTLETGLPFSVWRQRLRILNAQEKLAR 218 ... RVANTLSDNPADNRDQKDWAELAAMSLR...SFVRHFTLETGLPFSVWRQRLRILNAQEKLAR Sbjct: 1 ... RVANTLSDNPADNRDQKDWAELAAMSLRSFVRHFTLETGLPFSVWRQRLRILNAQEKLAR 60 ...

ORF Alignment: NC_004193 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available s ... iheyensis HTE831] ... Length = 156 ... Query: 98 ... FIEEDVKNLKQMKNIIDVDVLNDVIERILDSEKVIVAGYYH...SFSFAHWFSFNLNYIVGNA 157 ... FIEEDVKNLKQMKNIIDVDVLNDVIERILDSEKVIVAGYYHSFSFA...HWFSFNLNYIVGNA Sbjct: 1 ... FIEEDVKNLKQMKNIIDVDVLNDVIERILDSEKVIVAGYYHSFSFAHWFSFNLNYIVGNA 60 ... Query: 218 YADFVI

DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS

Energy Technology Data Exchange (ETDEWEB)

NA

2004-11-22

The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) important to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are in the form of tabulated functions with pH and log (line integral) CO{sub 2} as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. The output data from this report are fundamental inputs for Total System Performance Assessment for the License Application (TSPA-LA) to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for all of the actinides. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or otherwise addressed.

Generalized phase diagram for the rare-earth elements: Calculations and correlations of bulk properties

International Nuclear Information System (INIS)

Johansson, B.; Rosengren, A.

1975-01-01

A ''generalized'' phase diagram is constructed empirically for the lanthanides. This diagram makes it possible, not only in one picture, to assemble a lot of information but also to predict phase transitions not yet experimentally accessible. Further, it clearly illustrates the close relation between the members of the lanthanide group. To account for some of its features, the pseudopotential method is applied. The trend in crystal structure through the lanthanide series can thereby be qualitatively accounted for, as can the trend in crystal structure for an individual element, when compressed. A scaling procedure makes it possible to extend the treatment to elements neighboring the lanthanides in the Periodic Table. In total 25 elements are considered. An atomic parameter f (relatable to the pseudopotential) is introduced, by means of which different phase transitions, both for an individual rare-earth element and intra-rare-earth alloys, can be correlated to certain critical values of this parameter. A nonmagnetic rare-earth series (Sc, Lu, Y, La, and Ac) is introduced and the occurrence of superconductivity is discussed with special emphasis on the pressure dependence of the transition temperature. This temperature can be correlated to the above-mentioned parameter f, both for intra-rare-earth alloys and pure elements at different pressures. The correlation implies that actinium is a superconductor with a critical temperature which could be as high as (11--12) degree K

Spent sealed radioactive sources conditioning technology for the disposal at the national repository Baita-Bihor

International Nuclear Information System (INIS)

Bujoreanu, D.; Popescu, I.V.

2006-01-01

A spent sealed radioactive source(SRS) is a high integrity capsule which contains a small amount of concentrated radionuclide with an activity which ranges from a few MBq up to levels of hundreds TBq. Presently, there are now many spent and unusable SRS in Romania, which have been used a long time in various industrial applications (smoke detectors, weld testing etc.). Considering the activity of the Radioactive Waste Treatment Plant (STDR) at the Institute for Nuclear Research Pitesti regarding radioactive source collecting from various economic agents, several radioactive sources are held in the intermediate storage deposit facility on the institute platform awaiting conditioning for the final disposal. This paper presents the conditioning technology for this sources, which has as ultimate purpose to completion of a product which matches the waste acceptance requirements imposed by the National Authority Control of Nuclear Activities, CNCAN, for the disposal site DNDR Baita - Bihor. The technology used for obtaining the final product allows two options for the immobilization of the sources in the 218 L steel drum and these are: Sources placed in the original packages and which can not be dismantled will be isolated by encapsulation in 10 litters metal capsules and then conditioned in 218 l steel drum, with a concrete biological shielding; Sources removed from the initial package are isolated in stainless steel capsules, which are to be conditioned in the same 218 L steel drum. The final product obtained as a result of the concrete conditioning operations of the spent SRS in 218 L steel drum is the steel drum - concrete - low radioactive waste assembly which presents itself as a concrete block which includes one or more capsules containing SRS. (author)

Preliminary assessment of errors of radon daughters concentration in air; Wstepna ocena bledow miernika koncentracji produktow rozpadu radonu w powietrzu

Energy Technology Data Exchange (ETDEWEB)

Machaj, B. [Institute of Nuclear Chemistry and Technology, Warsaw (Poland)

1996-12-31

Employing an earlier elaborated computer program for simulation of depositing radon decay products: {sup 214}Po, {sup 214}Pb, {sup 214}Bi ({sup 214}Po) on air filter and for computing variation of their activity against time, an assessment of errors was carried out of a methods employing measurement of {sup 218}Po + {sup 214}Po alpha activity in three time intervals. Additionally errors of the methods measuring {sup 218}Po + {sup 214}Po alpha activity in three, two and one time intervals, were assessed. A few attempts were also made to measure the alpha activity in different time intervals and to assess their measuring errors. (authors). 10 refs, 4 figs, 14 tabs.

The Atacama Cosmology Telescope: Dusty Star-Forming Galaxies and Active Galactic Nuclei in the Southern Survey

Science.gov (United States)

Marsden, Danica; Gralla, Megan; Marriage, Tobias A.; Switzer, Eric R.; Partridge, Bruce; Massardi, Marcella; Morales, Gustavo; Addison, Graeme; Bond, J. Richard; Crighton, Devin;

Regional aerosol deposition in human upper airways

International Nuclear Information System (INIS)

Swift, D.L.

1991-01-01

During the current report experimental studies of upper respiratory deposition of radon progeny aerosols and stimulant aerosols were carried out in replicate casts of nasal and oral passages of adults and children. Additionally, preliminary studies of nasal passage deposition of unattached Po 218 particles was carried out in four human subjects. Data on nasal inspiratory deposition in replicate models of adults and infants from three collaborating laboratories were compared and a best-fit curve of deposition efficiency for both attached and unattached particles was obtained, showing excellent inter-laboratory agreement. This curve demonstrates that nasal inspiratory deposition of radon progeny is weakly dependent upon flow rate over physiologically realistic ranges of flow, does not show a significant age effect, and is relatively independent of nasal passage dimensions for a given age range. Improved replicate models of the human adult oral passage extending to the mid-trachea were constructed for medium and higher flow mouth breathing states; these models were used to assess the deposition of unattached Po 218 particles during oronasal breathing in the oral passage and demonstrated lower deposition efficiency than the nasal passage. Measurements of both Po 218 particle and attached fraction particle size deposition were performed in replicate nasal passage of a four week old infant. 5 refs., 1 fig

Measurement of airborne radon daughters - a Bayesian approach

International Nuclear Information System (INIS)

Groer, P.G.; Lo, Y.

1997-01-01

The standard mathematical treatment of the build-up and decay of airborne radionuclides on a filter paper uses the solutions of the so-called Bateman equations adapted to the sampling process. These equations can be interpreted as differential equations for the expectation of an underlying stochastic process, which describes the random fluctuations in the accumulation and decay of the sampled radioactive atoms. The probability distribution for the number of 218 Po, 214 Pb and 214 Bi atoms, accumulated after sampling time t, is the product of three Poisson distributions. It is shown that the distribution of the number of counts, registered by a detector with efficiency ε during a counting period T after the end of sampling, is also the product of three Poisson distributions. Its mean is dependent on ε, t, T, flow rate, and N A 0 , N B 0 and N C 0 , the number of 218 Po, 214 Pb and 214 Bi atoms per unit volume. This joint Poisson distribution was used to construct the likelihood given the observed number of counts. Using Bayes' Theorem posterior densities were obtained for N A 0 , N B 0 and N C 0 . These densities characterise the remaining uncertainty about the unknown airborne concentrations of 218 Po, 214 Pb and 214 Bi atoms. (author)

Ecuadorian Cancer Patients’ Preference for Information and Communication Technologies: Cross-Sectional Study

Science.gov (United States)

2018-01-01

Background The instantaneous spread of information, low costs, and broad availability of information and communication technologies (ICTs) make them an attractive platform for managing care, patient communication, and medical interventions in cancer treatment. There is little information available in Latin America about the level of usage of ICTs for and by cancer patients. Our study attempts to fill this gap. Objective The aim of this study was to assess the level of ICT use and patterns of preferences among cancer patients. Methods We conducted an anonymous cross-sectional survey study in 500 Ecuadorian cancer patients. This questionnaire consisted of 22 items about demographic and clinical data, together with the preferences of people who use ICTs. Chi-square, crude, and adjusted logistic regressions were performed. Results Of the total, 43.2% (216/500) of participants reported that they had access to the Internet, and 25.4% (127/500) reported that they neither owned a cell phone nor did they have access to the Internet. The Internet constituted the highest usage rate as a source of information about malignant diseases (74.3%, 162/218) regardless of age (PWhatsApp (66.5%, 145/218) and short message service (SMS) text messaging (61.0%, 133/218) were widely reported as interesting communication channels. Similarly, WhatsApp (72.0%, 157/218) followed by SMS (63.8%, 139/218) were reported as the preferred ICTs through which patients would like to ask physicians about diseases. Adjusted regression analysis showed that patients aged between 40 and 64 years were more likely to be interested in receiving information through SMS (odds ratio, OR 5.09, 95% CI 1.92-13.32), as well as for asking questions to physicians through this same media (OR 9.78, CI 3.45-27.67) than the oldest group. Conclusions WhatsApp, SMS, and email are effective and widely used ICTs that can promote communication between cancer patients and physicians. According to age range, new ICTs such as

Experimental study on the effects of channel gap size on mixed convection heat transfer characteristics in vertical rectangular channels heated from both sides

International Nuclear Information System (INIS)

Sudo, Y.; Kaminaga, M.

1990-01-01

The effects of channel gap size on mixed forced and free convective heat transfer characteristics were experimentally investigated for water flowing near atmospheric pressure in a 750 mm long and 50 mm wide channel heated from both sides. The channel gap sizes investigated were 2.5, 6, 18 and 50 mm. Experiments were carried out for both aiding and opposing forced convective flows with a Reynolds number Re x of 4x10 to 6x10 6 and a Grashof number Gr x of 2x10 4 to 6x10 11 , where the distance x from the inlet of the channel is adopted as the characteristic length in Re x and Gr x . As for the results, the following were revealed for the parameters ranges investigated in this study. (1) When the dimensionless parameter, Gr x /Re x 21/8 Pr 1/2 is less than 10 -4 , the flow shows the nature of forced convective heat transfer for a channel with any channel gap size in both aiding and opposing flows. (2) When Gr x /Re x 21/8 Pr 1/2 is larger than 10 -2 , the flow shows the nature of free convective heat transfer for a channel with any channel gap size in both aiding and opposing flows. (3) When Gr x /Re x 21/8 Pr 1/2 is between 10 -4 and 10 -2 for the channel with a channel gap size equal to or larger than 6 mm, the heat transfer coefficients in both aiding and opposing flows become, on the average, higher than those predicted by the previous correlations for either the pure turbulent forced convection or the pure free convection, and can be expressed in simple forms with a combination of Gr x /Re x 21/8 Pr 1/2 and the previous correlation for either the pure turbulent forced convection or the free convection along a flat plate. (4) When Gr x /Re x 21/8 Pr 1/2 is between 10 -4 and 10 -2 for the channel with a channel gap size of 2.5 mm, the heat transfer coefficients in both aiding and opposing flows also become, on the average, higher than those predicted by the previous correlations for either the pure turbulent forced convection or the pure free convection. (orig./GL)

40 CFR 79.68 - Salmonella typhimurium reverse mutation assay.

Science.gov (United States)

2010-07-01

...) AIR PROGRAMS (CONTINUED) REGISTRATION OF FUELS AND FUEL ADDITIVES Testing Requirements for... of E. coli: partial purification and some properties,” Journal of Biological Chemistry. 218:97-106...

Using positron emission tomography (PET) response criteria in solid tumours (PERCIST) 1.0 for evaluation of 2'-deoxy-2'-[18F] fluoro-D-glucose-PET/CT scans to predict survival early during treatment of locally advanced non-small cell lung cancer (NSCLC).

Science.gov (United States)

Fledelius, Joan; Khalil, Azza Ahmed; Hjorthaug, Karin; Frøkiaer, Jørgen

2016-04-01

The demand for early-response evaluation with 2'-deoxy-2'-[18F] fluoro-D-glucose (F-18-FDG) positron emission tomography combined with whole body CT (PET/CT) is rapidly growing. This study was initiated to evaluate the applicability of the PET response criteria in solid tumours (PERCIST 1.0) for response evaluation. We performed a retrospective study of 21 patients with locally advanced non-small cell lung cancer (NSCLC), who had undergone both a baseline and a follow-up F-18-FDG-PET/CT scan during their treatments. The scans were performed at our institution in the period September 2009 and March 2011 and were analysed visually and according to PERCIST 1.0 by one board-certified nuclear medicine physician. The response was compared with overall survival (OS) and progression-free survival (PFS). The variation in key parameters affecting the F-18-FDG uptake was assessed. A kappa of 0.94 corresponding to an almost perfect agreement was found for the comparison of the visual evaluation with PERCIST. Patients with partial metabolic response and stable metabolic disease (as evaluated by PERCIST 1.0) had statistically significant longer median time to progression: 8.4 months (confidence interval (CI) 5.1-11.8 months) as compared with 2.7 months (CI 0-5.6 months) in patients classified with progression. The variation in uptake time between baseline and follow-up scans was more than the recommended 15 min in 48% of patients. PERCIST 1.0 is readily implementable and highly comparable with visual evaluation of response using early F-18-FDG-PET/CT scanning for locally advanced NSCLC patients. In spite of variations in parameters affecting F-18-FDG uptake, evaluation of F-18-FDG-PET/CT during treatment with PERCIST 1.0 is shown to separate non-responders from responders, each with statistically significant differences in both OS and PFS. © 2015 The Royal Australian and New Zealand College of Radiologists.

Morphine sparing effect of low dose ketamine during patient ...

African Journals Online (AJOL)

Adele

2003-09-12

Sep 12, 2003 ... KEY WORDS: Ketamine, morphine sparing effect, patient controlled intravenous analgesia. ... Measurements: Morphine consumption, visual analogue pain score (VAPS), pulse ..... Brain Research, 1990; 518: 218-222. 7.

76 FR 18861 - Food Distribution Program on Indian Reservations: Amendments Related to the Food, Conservation...

Science.gov (United States)

2011-04-06

... state non-profit/advocacy organizations. One letter was submitted by a private company, and 218 letters... Guidelines. Non-cash benefits could include such services as employment assistance, childcare, or...

78 FR 20106 - Ocean Transportation Intermediary License Applicants

Science.gov (United States)

2013-04-03

... M. Tsai, President (QI). Application Type: New NVO License. American International Shipping Company... Type: New NVO License. Nippon Concept America, LLC (OFF), 2203 Timberloch Place, Suite 218D, The...

Victor Hugo, ‚Les Misérables´ (1862)

OpenAIRE

Krauss, Henning

1999-01-01

Victor Hugo, ‚Les Misérables´ (1862). - In: 19. Jahrhundert - Roman / Friedrich Wolfzettel (Hrsg.). - Tübingen : Stauffenburg-Verl., 1999. - S. 185-218. - (Stauffenburg Interpretation : Französische Literatur)

29 CFR 501.5 - Waiver of rights prohibited.

Science.gov (United States)

2010-07-01

... OF CONTRACTUAL OBLIGATIONS FOR TEMPORARY ALIEN AGRICULTURAL WORKERS ADMITTED UNDER SECTION 218 OF THE... public policy except as follows: (a) Waivers or modifications of rights or obligations hereunder in favor...

29 CFR 502.0 - Introduction.

Science.gov (United States)

2010-07-01

... CONTRACTUAL OBLIGATIONS FOR TEMPORARY ALIEN AGRICULTURAL WORKERS ADMITTED UNDER SECTION 218 OF THE IMMIGRATION... cover the enforcement of all contractual obligation provisions applicable to the employment of H-2A...

29 CFR 501.9 - Surety bond.

Science.gov (United States)

2010-07-01

... CONTRACTUAL OBLIGATIONS FOR TEMPORARY ALIEN AGRICULTURAL WORKERS ADMITTED UNDER SECTION 218 OF THE IMMIGRATION... demonstrating its ability to discharge financial obligations under the H-2A program. The original bond...

29 CFR 502.32 - Contents of notice.

Science.gov (United States)

2010-07-01

... CONTRACTUAL OBLIGATIONS FOR TEMPORARY ALIEN AGRICULTURAL WORKERS ADMITTED UNDER SECTION 218 OF THE IMMIGRATION... covered contractual obligation, the amount of any civil money penalty assessment and the reason or reasons...

Stereotactic radiosurgery using the gamma knife

Energy Technology Data Exchange (ETDEWEB)

Kawamoto, Shunsuke; Sasaki, Tomio; Matsutani, Masao; Takakura, Kintomo; Terahara, Atsuro (Tokyo Univ. (Japan). Faculty of Medicine)

1992-03-01

Since stereotactic radiosurgery using a gamma knife was developed in 1968 by Leksell, it has been used with increasing frequency in Japan. During the period from June 19, 1990 through December 20, 1991, 218 patients have been treated with stereotactic radiosurgery using a gamma knife. Of them, 116 had vascular lesions (116), including arteriovenous malformation (114), dural arteriovenous malformation (one), and cerebral aneurysm (one); and the other 102 had tumorous lesions, including acoustic neurinoma (48), meningioma (26), pituitary tumor (11), metastatic tumor (7), germ cell tumor (3), glioma (2), hemangioblastoma (2), chordoma (one), craniopharyngioma (one), and trigeminal neurinoma (one). In this article, candidates of stereotactic radiosurgery using a gamma knife are discussed, with particular attention to clinical results of the aforementioned 218 patients. (N.K.) 54 refs.

Solid oxide fuel cell power plant with an anode recycle loop turbocharger

Science.gov (United States)

Saito, Kazuo; Skiba, Tommy; Patel, Kirtikumar H.

2015-07-14

An anode exhaust recycle turbocharger (100) has a turbocharger turbine (102) secured in fluid communication with a compressed oxidant stream within an oxidant inlet line (218) downstream from a compressed oxidant supply (104), and the anode exhaust recycle turbocharger (100) also includes a turbocharger compressor (106) mechanically linked to the turbocharger turbine (102) and secured in fluid communication with a flow of anode exhaust passing through an anode exhaust recycle loop (238) of the solid oxide fuel cell power plant (200). All or a portion of compressed oxidant within an oxidant inlet line (218) drives the turbocharger turbine (102) to thereby compress the anode exhaust stream in the recycle loop (238). A high-temperature, automotive-type turbocharger (100) replaces a recycle loop blower-compressor (52).

Disease: H01502 [KEGG MEDICUS

Lifescience Database Archive (English)

Full Text Available LE ... Aspects of innate immunity in Sjogren's syndrome. ... JOURNAL ... Arthritis Res Ther 13:218 (2011) DOI:10... Sjogren's syndrome and other sicca syndromes. ... JOURNAL ... Arthritis Res Ther 13:

77 FR 72827 - Corrosion-Resistant Carbon Steel Flat Products From Germany and the Republic of Korea: Final...

Science.gov (United States)

2012-12-06

... States Steel Corporation (``U.S. Steel''); ArcelorMittal USA LLC (``AMUSA''); and Nucor Corporation (``Nucor''), within the deadline specified in 19 CFR 351.218(d)(1)(i). The domestic interested parties...

Läänemere-ruum uurimisainese ja mõistena / Juhan Kreem

Index Scriptorium Estoniae

Kreem, Juhan

2007-01-01

Rets. rmt.: The Baltic as a Multicultural World : Sea, Region and Peoples. Marko Lehti (ed.). (The Baltic Sea Region : Nordic Dimensions - European Perspectives 4). Berliner Wissenschafts-Verlag, Berlin, 2005. 218 lk.

29 CFR 502.8 - Surety bond.

Science.gov (United States)

2010-07-01

... CONTRACTUAL OBLIGATIONS FOR TEMPORARY ALIEN AGRICULTURAL WORKERS ADMITTED UNDER SECTION 218 OF THE IMMIGRATION... the Administrator, WHD after notice and an opportunity for hearing when it is shown based on objective...

29 CFR 501.2 - Coordination between Federal agencies.

Science.gov (United States)

2010-07-01

... ENFORCEMENT OF CONTRACTUAL OBLIGATIONS FOR TEMPORARY ALIEN AGRICULTURAL WORKERS ADMITTED UNDER SECTION 218 OF.... (a) Complaints received by ETA or any State Workforce Agency (SWA) regarding contractual H-2A labor...

29 CFR 502.4 - Waiver of rights prohibited.

Science.gov (United States)

2010-07-01

... OF CONTRACTUAL OBLIGATIONS FOR TEMPORARY ALIEN AGRICULTURAL WORKERS ADMITTED UNDER SECTION 218 OF THE... public policy, except that a waiver or modification of rights or obligations hereunder in favor of the...

23 CFR 450.218 - Self-certifications, Federal findings, and Federal approvals.

Science.gov (United States)

2010-04-01

... discrimination on the basis of race, color, creed, national origin, sex, or age in employment or business... involvement of disadvantaged business enterprises in USDOT funded projects; (5) 23 CFR part 230, regarding... consideration will be given to projects and strategies involving the operation and management of the multimodal...

Routine plasma analysis for 2-[18F]fluorotyrosine by SAX-cartridges

International Nuclear Information System (INIS)

Kling, P.; Coenen, H.H.; Stoecklin, G.

1990-01-01

There is a great necessity for simple, reliable, and fast methods of plasma analysis. While HPLC is generally the most effective method, it is rather time consuming and expensive in a routine setting with numerous plasma samples. The authors have developed a new method for determination of the amino acid analogue 2-[ 18 F]fluorotyrosine using SAX columns (Adsorbex R SAX, 400 mg, Merck). The results obtained agree within 5% with those determined by reverse phase HPLC

29 CFR 779.218 - Methods to accomplish “unified operation.”

Science.gov (United States)

2010-07-01

..., join together to perform some or all of their activities as a unified business or business system. They may accomplish such unification through agreements, franchises, grants, leases, or other arrangements... others so that they constitute a single business or unified business system. Whether in any particular...

Ultrafast Wiggling and Jiggling: Ir2(1,8-diisocyanomenthane)4 2+

Czech Academy of Sciences Publication Activity Database

Pižl, Martin; Hunter, B. M.; Greetham, G. M.; Towrie, M.; Záliš, Stanislav; Gray, H. B.; Vlček, Antonín

2017-01-01

Roč. 121, č. 48 (2017), s. 9275-9283 ISSN 1089-5639 R&D Projects: GA ČR GA17-01137S; GA MŠk(CZ) LTC17052 Institutional support: RVO:61388955 Keywords : Coherent oscillations * Inter-system crossings * Optical spectroscopic Subject RIV: CF - Physical ; Theoretical Chemistry OBOR OECD: Physical chemistry Impact factor: 2.847, year: 2016

38 CFR 1.218 - Security and law enforcement at VA facilities.

Science.gov (United States)

2010-07-01

... physician) is prohibited. The introduction or possession of alcoholic beverages or any narcotic drug... soliciting and vending of all kinds, displaying or distributing commercial advertising, or collecting private... activities. (10) Photographs for news, advertising, or commercial purposes. Photographs for advertising or...

20 CFR 218.44 - When a remarried widow(er) annuity ends.

Science.gov (United States)

2010-04-01

...(er)— (1) Dies; (2) Becomes entitled to an old age benefit under the Social Security Act that is equal...) remarries unless the marriage is to an individual entitled to a retirement, disability, widow(er)'s, father...

20 CFR 218.43 - When a surviving divorced spouse annuity ends.

Science.gov (United States)

2010-04-01

... Act that is equal to or larger than the amount of the full surviving divorced spouse annuity before... which the surviving divorced spouse remarries unless the marriage is to an individual entitled to a...

2-18F-fluoro-2-deoxyglucose positron emission tomography in delirium.

Science.gov (United States)

Haggstrom, Lucy R; Nelson, Julia A; Wegner, Eva A; Caplan, Gideon A

2017-11-01

Delirium is a common, serious, yet poorly understood syndrome. Growing evidence suggests cerebral metabolism is fundamentally disturbed; however, it has not been investigated using 2- 18 F-fluoro-2-deoxyglucose (FDG) positron emission tomography (PET) in delirium. This prospective study thus explored FDG PET patterns of cerebral glucose metabolism in older inpatients with delirium. A particular emphasis was on the posterior cingulate cortex (PCC), a key region for attention, which is a central feature of delirium. Delirium scans were compared with post-delirium scans using visual analysis and semi-quantitative analysis with NeuroQ; 13 participants (8 female, median 84 y) were scanned during delirium, and 6 scanned again after resolution. On visual analysis, cortical hypometabolism was evident in all participants during delirium (13/13), and improved with delirium resolution (6/6). Using NeuroQ, glucose metabolism was higher post-delirium in the whole brain and bilateral PCC compared to during delirium ( p delirium duration. This research found widespread, reversible cortical hypometabolism during delirium and PCC hypometabolism was associated with inattention during delirium.

75 FR 339 - Antidumping or Countervailing Duty Order, Finding, or Suspended Investigation; Advance...

Science.gov (United States)

2010-01-05

... Department contact Tissue Paper Products from the People's Brandon Farlander (202) 482-0182. Republic of... Sunset Reviews are set forth in 19 CFR 351.218. Guidance on methodological or analytical issues relevant...

Polymer Concentration-Controlled Substrate Specificity in Solvolysis of p-Nitrophenyl Alkanoates Catalyzed by 4-(Dialkylamino)pyridine- Functionalized Polymer in Aqueous Methanol Solution

National Research Council Canada - National Science Library

Wang, Guang-Jia

1996-01-01

The substrate specificity in solvolysis reactions of p-nitrophenyl alkanoates 2 (n=2-18) catalyzed by 4-(dialkylamino)pyridine-functionalized polymer 1 can be controlled by the concentration of 1 in 1...

Empirická krajina v románové krajinné vizi. Reprezentace prostoru v Balzakových Šuanech

Czech Academy of Sciences Publication Activity Database

Hrbata, Zdeněk

2012-01-01

Roč. 22, č. 45 (2012), s. 218-241 ISSN 0862-8440 Institutional support: RVO:68378068 Keywords : historical novel * narrative situation * mimetic landscape * semiotic area Subject RIV: AJ - Letters, Mass-media, Audiovision

Regional aerosol deposition in human upper airways

Energy Technology Data Exchange (ETDEWEB)

Swift, D.L.

1991-11-01

During the current report experimental studies of upper respiratory deposition of radon progeny aerosols and stimulant aerosols were carried out in replicate casts of nasal and oral passages of adults and children. Additionally, preliminary studies of nasal passage deposition of unattached Po{sup 218} particles was carried out in four human subjects. Data on nasal inspiratory deposition in replicate models of adults and infants from three collaborating laboratories were compared and a best-fit curve of deposition efficiency for both attached and unattached particles was obtained, showing excellent inter-laboratory agreement. This curve demonstrates that nasal inspiratory deposition of radon progeny is weakly dependent upon flow rate over physiologically realistic ranges of flow, does not show a significant age effect, and is relatively independent of nasal passage dimensions for a given age range. Improved replicate models of the human adult oral passage extending to the mid-trachea were constructed for medium and higher flow mouth breathing states; these models were used to assess the deposition of unattached Po{sup 218} particles during oronasal breathing in the oral passage and demonstrated lower deposition efficiency than the nasal passage. Measurements of both Po{sup 218} particle and attached fraction particle size deposition were performed in replicate nasal passage of a four week old infant. 5 refs., 1 fig.

Evaluation of a Specialized Yoga Program for Persons Admitted to a Complex Continuing Care Hospital: A Pilot Study

Directory of Open Access Journals (Sweden)

Kathryn Curtis

2016-01-01

Full Text Available Introduction. The purpose of this study was to evaluate a specialized yoga intervention for inpatients in a rehabilitation and complex continuing care hospital. Design. Single-cohort repeated measures design. Methods. Participants (N=10 admitted to a rehabilitation and complex continuing care hospital were recruited to participate in a 50–60 min Hatha Yoga class (modified for wheelchair users/seated position once a week for eight weeks, with assigned homework practice. Questionnaires on pain (pain, pain interference, and pain catastrophizing, psychological variables (depression, anxiety, and experiences with injustice, mindfulness, self-compassion, and spiritual well-being were collected at three intervals: pre-, mid-, and post-intervention. Results. Repeated measures ANOVAs revealed a significant main effect of time indicating improvements over the course of the yoga program on the (1 anxiety subscale of the Hospital Anxiety and Depression Scale, F(2,18 = 4.74, p<.05, and ηp2 = .35, (2 Self-Compassion Scale-Short Form, F(2,18 = 3.71, p<.05, and ηp2 = .29, and (3 Magnification subscale of the Pain Catastrophizing Scale, F(2,18 = 3. 66, p<.05, and ηp2 = .29. Discussion. The results suggest that an 8-week Hatha Yoga program improves pain-related factors and psychological experiences in individuals admitted to a rehabilitation and complex continuing care hospital.

Increasing DNA reactivity and in vitro antitumor activity of trans diiodido Pt(II) complexes with UVA light

Czech Academy of Sciences Publication Activity Database

Navas, F.; Perfahl, S.; Garino, C.; Salassa, L.; Nováková, Olga; Navarro-Ranninger, C.; Bednarski, P.J.; Malina, Jaroslav; Quiroga, Adoración G.

2015-01-01

Roč. 153, DEC2015 (2015), s. 211-218 ISSN 0162-0134 Institutional support: RVO:68081707 Keywords : Metallodrug photoactivaton * Platinum drugs * DNA interactions Subject RIV: BO - Biophysics Impact factor: 3.205, year: 2015

77 FR 4582 - National Register of Historic Places; Notification of Pending Nominations and Related Actions

Science.gov (United States)

2012-01-30

... ask us in your comment to withhold your personal identifying information from public review, we cannot... Theatre, (Movie Theaters of Iowa MPS) 218 Main St., Sioux Rapids, 12000030 OHIO Cuyahoga County Jones Home...

Soil and river sediments radionuclides monitoring at Aramar Experimental Center: an historical overview

International Nuclear Information System (INIS)

Segre, Nadia; Fagundes, Rosane Correa

2013-01-01

In order to evaluate possible effects to the environment resulting from the implementation of the Centro Tecnologico da Marinha - Centro Experimental Aramar (CTMSP-CEA) at Ipero in Sao Paulo state, Brazil, which came into operation in 1989, an Environmental Monitoring Program (PMA) was established in October, 1987. One of the aims of this program is to monitor the soil and river sediments radionuclides levels at CEA and beyond its boundary. The utilization of statistical tools to evaluate the results of radiometric environmental monitoring is a procedure required by National Nuclear Energy Commission (CNEN). The box plot is a simple statistical tool for displaying data. The central tendency and dispersion of the results as well as the observation of unusual results (outliers) in the dataset are easily visualized. Control chart is a graph that maps data and provides a picture of how a process is performing over time. A control chart always has a central line for the mean, an upper line for the upper control limit and a lower line for the lower control limit. Box plots and control charts were used to visualize the annual amount of natural uranium, lead-214, actinium-228 and lead-212 in soil and river sediment detected between 1987 and 2011, considering the measurements of all monitored places each year. This historical observation shows that, in average, the results obtained are below than the 1987-1988 levels (CEA's pre-operational) or below than the backgrounds radionuclides values. (author)

Selective Decontamination Effect of Metal Ions in Soil Using Supercritical CO2 and TBP Complex

International Nuclear Information System (INIS)

Park, Jihye; Park, Kwangheon; Jung, Wonyoung

2014-01-01

Decontamination of soil pollution is difficult because the type of contamination largely depends on the characteristics of the pollutant and the area. Also, existing soil decontamination methods generate large quantities of secondary waste and additional process costs. For this reason, new decontamination methods are always under active investigation. A method involving the use of supercritical carbon dioxide with excellent permeability in place of chemical solvents is currently being studied. Unlike other heavy metals in fission products, uranium is used as fuel, and must be handled carefully. Therefore, in this paper, we studied a supercritical carbon dioxide method for decontaminating heavy metal ions in soil using tri-n-butyl phosphate(TBP), which is well known as a ligand for the extraction of metal ions of actinium. We investigated the decontamination effect of heavy metal ions in the soil using TBP-HNO 3 Complex and supercritical carbon dioxide. The study results showed that when heavy metals in soil are extracted using supercritical carbon dioxide, the extraction efficiency is different according to the type of pollutant metal ions in the soil. When TBP-HNO 3 Complex is used with an extractant, uranium extraction is very effective, but lithium, strontium, and cesium extraction is not effective. Therefore, in the case of a mixture of uranium and other metals such as lithium, strontium, cesium, and so on in soil contaminated by fission product leaks from nuclear power plants, we can selectively decontaminate uranium with supercritical carbon dioxide and TBP-HNO 3 Complex

Alpha-emitting nuclides in the marine environment

Science.gov (United States)

Pentreath, R. J.

1984-06-01

The occurrence of alpha-emitting nuclides and their daughter products in the marine environment continues to be a subject of study for many reasons. Those nuclides which occur naturally, in the uranium, thorium and actinium series, are of interest because of their value in determining the rates of geological and geochemical processes in the oceans. Studies of them address such problems as the determination of rates of transfer of particulate matter, deposition rates, bioturbation rates, and so on. Two of the natural alpha-series nuclides in which a different interest has been expressed are 210Po and 226Ra, because their concentrations in marine organisms are such that they contribute to a significant fraction of the background dose rates sustained both by the organisms themselves and by consumers of marine fish and shellfish. To this pool of naturally-occurring nuclides, human activities have added the transuranium nuclides, both from the atmospheric testing of nuclear devices and from the authorized discharges of radioactive wastes into coastal waters and the deep sea. Studies have therefore been made to understand the chemistry of these radionuclides in sea water, their association with sedimentary materials, and their accumulation by marine organisms, the last of these being of particular interest because the transuranics are essentially "novel" elements to the marine fauna and flora. The need to predict the long-term behaviour of these nuclides has, in turn, stimulated research on those naturally-occurring nuclides which may behave in a similar manner.

Determination of radium in water

International Nuclear Information System (INIS)

Hohorst, F.A.; Huntley, M.W.; Hartenstein, S.D.

1995-10-01

These detailed work instructions (DWIs) are tailored for the analysis of radium-226 and radium-228 in drinking water supplies from ground water and surface water sources and composites derived from them. The instructions have been adapted from several sources, including a draft EPA method. One objective was to minimize the generation of mixed wastes. Quantitative determinations of actinium-228 are made at 911 keV. The minimum detection level (MDL) for the gamma spectrometric measurements at this energy vary with matrix, volume, geometry, detector, background, and counting statistics. The range of MDL's for current detectors is 0.07 to 0.5 Bq/sample. Quantitative determinations of radium-226 are made by counting the high energy alpha particles which radium-226 progeny emit using liquid scintillation counting (LSC). The minimum detectable activity (MDA) is 3.8 E-3 Bq/sample. The maximum concentration which may be counted on available instruments without dilution is about 2 E + 5 Bq/sample. Typically, this determination of radium in a 2 L sample has a yield of 80%. If radium-228 is determined using a 16 h count after 50 h grow-in, the typical MDL is 1 E-9 to 8 E-9 μCi/mL (1 to 8 pCi/L). If radium-226 is determined using a 2.5 h count after 150 h grow-in, the typical MDA is about 1 E-10 μCi/mL (0. 1 pCi/L)

Soil and river sediments radionuclides monitoring at Aramar Experimental Center: an historical overview

Energy Technology Data Exchange (ETDEWEB)

Segre, Nadia; Fagundes, Rosane Correa, E-mail: nadia.segre@ctmsp.mar.mil.br [Centro Tecnologico da Marinha (CTM-SP/CEA/LARE), Ipero, SP (Brazil). Centro Experimental Aramar. Lab. Radioecologico; Moraes, Marco Antonio P.V. [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

2013-07-01

In order to evaluate possible effects to the environment resulting from the implementation of the Centro Tecnologico da Marinha - Centro Experimental Aramar (CTMSP-CEA) at Ipero in Sao Paulo state, Brazil, which came into operation in 1989, an Environmental Monitoring Program (PMA) was established in October, 1987. One of the aims of this program is to monitor the soil and river sediments radionuclides levels at CEA and beyond its boundary. The utilization of statistical tools to evaluate the results of radiometric environmental monitoring is a procedure required by National Nuclear Energy Commission (CNEN). The box plot is a simple statistical tool for displaying data. The central tendency and dispersion of the results as well as the observation of unusual results (outliers) in the dataset are easily visualized. Control chart is a graph that maps data and provides a picture of how a process is performing over time. A control chart always has a central line for the mean, an upper line for the upper control limit and a lower line for the lower control limit. Box plots and control charts were used to visualize the annual amount of natural uranium, lead-214, actinium-228 and lead-212 in soil and river sediment detected between 1987 and 2011, considering the measurements of all monitored places each year. This historical observation shows that, in average, the results obtained are below than the 1987-1988 levels (CEA's pre-operational) or below than the backgrounds radionuclides values. (author)

Mitigation of radiation nephropathy after internal α-particle irradiation of kidneys

International Nuclear Information System (INIS)

Jaggi, Jaspreet Singh; Seshan, Surya V.; McDevitt, Michael R.; Sgouros, George; Hyjek, Elizabeth; Scheinberg, David A.

2006-01-01

Purpose: Internal irradiation of kidneys as a consequence of radioimmunotherapy, radiation accidents, or nuclear terrorism can result in radiation nephropathy. We attempted to modify pharmacologically, the functional and morphologic changes in mouse kidneys after injection with the actinium ( 225 Ac) nanogenerator, an in vivo generator of α- and β-particle emitting elements. Methods and Materials: The animals were injected with 0.35 μCi of the 225 Ac nanogenerator, which delivers a dose of 27.6 Gy to the kidneys. Then, they were randomized to receive captopril (angiotensin-converting enzyme inhibitor), L-158,809 (angiotensin II receptor-1 blocker), spironolactone (aldosterone receptor antagonist), or a placebo. Results: Forty weeks after the 225 Ac injection, the placebo-control mice showed a significant increase in blood urea nitrogen (BUN) (87.6 ± 6.9 mg/dL), dilated Bowman spaces, and tubulolysis with basement membrane thickening. Captopril treatment accentuated the functional (BUN 119.0 ± 4.0 mg/dL; p <0.01 vs. placebo controls) and histopathologic damage. In contrast, L-158,809 offered moderate protection (BUN 66.6 ± 3.9 mg/dL; p = 0.02 vs. placebo controls). Spironolactone treatment, however, significantly prevented the development of histopathologic and functional changes (BUN 31.2 ± 2.5 mg/dL; p <0.001 vs. placebo controls). Conclusions: Low-dose spironolactone and, to a lesser extent, angiotensin receptor-1 blockade can offer renal protection in a mouse model of internal α-particle irradiation

Selective alpha-particle mediated depletion of tumor vasculature with vascular normalization.

Directory of Open Access Journals (Sweden)

Jaspreet Singh Jaggi

2007-03-01

Full Text Available Abnormal regulation of angiogenesis in tumors results in the formation of vessels that are necessary for tumor growth, but compromised in structure and function. Abnormal tumor vasculature impairs oxygen and drug delivery and results in radiotherapy and chemotherapy resistance, respectively. Alpha particles are extraordinarily potent, short-ranged radiations with geometry uniquely suitable for selectively killing neovasculature.Actinium-225 ((225Ac-E4G10, an alpha-emitting antibody construct reactive with the unengaged form of vascular endothelial cadherin, is capable of potent, selective killing of tumor neovascular endothelium and late endothelial progenitors in bone-marrow and blood. No specific normal-tissue uptake of E4G10 was seen by imaging or post-mortem biodistribution studies in mice. In a mouse-model of prostatic carcinoma, (225Ac-E4G10 treatment resulted in inhibition of tumor growth, lower serum prostate specific antigen level and markedly prolonged survival, which was further enhanced by subsequent administration of paclitaxel. Immunohistochemistry revealed lower vessel density and enhanced tumor cell apoptosis in (225Ac-E4G10 treated tumors. Additionally, the residual tumor vasculature appeared normalized as evident by enhanced pericyte coverage following (225Ac-E4G10 therapy. However, no toxicity was observed in vascularized normal organs following (225Ac-E4G10 therapy.The data suggest that alpha-particle immunotherapy to neovasculature, alone or in combination with sequential chemotherapy, is an effective approach to cancer therapy.

Determination of radium in water

Energy Technology Data Exchange (ETDEWEB)

Hohorst, F.A.; Huntley, M.W.; Hartenstein, S.D.

1995-10-01

These detailed work instructions (DWIs) are tailored for the analysis of radium-226 and radium-228 in drinking water supplies from ground water and surface water sources and composites derived from them. The instructions have been adapted from several sources, including a draft EPA method. One objective was to minimize the generation of mixed wastes. Quantitative determinations of actinium-228 are made at 911 keV. The minimum detection level (MDL) for the gamma spectrometric measurements at this energy vary with matrix, volume, geometry, detector, background, and counting statistics. The range of MDL`s for current detectors is 0.07 to 0.5 Bq/sample. Quantitative determinations of radium-226 are made by counting the high energy alpha particles which radium-226 progeny emit using liquid scintillation counting (LSC). The minimum detectable activity (MDA) is 3.8 E-3 Bq/sample. The maximum concentration which may be counted on available instruments without dilution is about 2 E + 5 Bq/sample. Typically, this determination of radium in a 2 L sample has a yield of 80%. If radium-228 is determined using a 16 h count after 50 h grow-in, the typical MDL is 1 E-9 to 8 E-9 {mu}Ci/mL (1 to 8 pCi/L). If radium-226 is determined using a 2.5 h count after 150 h grow-in, the typical MDA is about 1 E-10 {mu}Ci/mL (0. 1 pCi/L).

Natural radionuclides in soils of a forest fragment of Atlantic Forest under ecological restoration process

International Nuclear Information System (INIS)

Ferreira, F.S.; Lira, M.B.; Souza, E.M.; França, E.J.

2017-01-01

The natural radioactive isotopes come from the radioactive series of the 238 U (Uranium Series), the 235 U (Actinium Series) and the 232 Th (Thorium Series) series, or they can occur in isolation as is the case with the 40 K. Primordial radionuclides such as 40 K, 232 Th, 235 U and 238 U exist since the formation of the earth, being found in appreciable amounts in nature and in some cases may present a mass activity above the acceptable of environmental radiation. The objective of this work was to evaluate the mass activity of 40 K, 226 Ra and 228 Ra in the soils of a fragment of Atlantic Forest under ecological restoration process located in the Municipality of Paulista, PE, Brazil. Soil samples (0 - 15 cm) were collected under the projection of the treetops of the most abundant trees in the region. After drying and comminution, analytical portions of 40 g were transferred to polyethylene petri dishes, sealed and stored for 30 days to ensure secular equilibrium. Radioactivity was quantified by High Resolution Gamma Spectrometry - EGAR. The mean physical activities of 40 K, 226 Ra and 228 Ra were 12, 15 and 20 Bq kg -1 , respectively, for the surface soil of the Parque Natural Municipal Mata do Frio. The values found were lower than those found in mangroves in the state of Pernambuco and those considered normal for soils worldwide

Evaluation of the agronomic effectiveness of rock phosphates from the Polpino deposit in the Russian federation and their potential to reduce 137Cs accumulation in plants

International Nuclear Information System (INIS)

Kuznetsov, V.K.; Sanzharova, N.I.; Alexakhin, R.M.

2002-01-01

The ability to supply P to plants (agronomic effectiveness) of local rock phosphates (RP) from the Polpino deposit in the Bryansk region was determined in a Sod-podzolic acid soil. In addition, the effectiveness of using the RP to reduce 137 Cs accumulation in barley was also studied. A series of greenhouse experiments were carried out using 32 P and 137 Cs as tracers. Standard methods for soil analysis and evaluation of chemical status of RP in soil were employed. The grain yield increased by 17.7, 44.3 and 57.5% compared to the control at rates of 21.8, 43.6 and 87.2 mg P/kg soil, respectively. The relative availability of phosphorus from RP applied at a rate of 21.8 P mg/kg soil was 56.1% compared to superphosphate and reached 74.5 and 81.3% at rates of 43.6 and 87.2 mg P/kg soil. The uptake of P by plants was increased with the increase in the rates of the fertilizers applied, but the percent of P fertilizer utilization decreased. The amount of P used by plants from fertilizers depended on the type and rates of P fertilizers. With an increase in SP rates from 21.8 to 87.2 mg/kg soil, the use of fertilizer P by plants dropped from 32.6 to 21.9%. For local RP, these differences were less pronounced with the percent of the total amount of P used by plants 2.1 times less than that from SP. The application of local RP at rates of 43.6 and 87.2 mg P/ kg soil resulted in a 1.3-fold decrease in 137 Cs accumulation in grain and straw of crops. At a rate of 21.8 mg P/kg soil, the differences in 137 Cs accumulation between grain and straw were insignificant compared to the control. (author)

Cell Phones, Tablets, and Other Mobile Technology for Users with Visual Impairments

Science.gov (United States)

... research. Share: Email Print Like (218 Likes) Cell Phones, Tablets, and Other Mobile Technology Touchscreen Smartphone Accessibility for People with Visual Impairments and Blindness The Benefits of Accessible Touchscreen Mobile Devices for People with ...

77 FR 9627 - Marine Mammals

Science.gov (United States)

2012-02-17

... Robin Baird, Ph.D., Cascadia Research, 218\\1/2\\ W. 4th Avenue, Olympia, WA 98501, has applied in due...) social organization, (5) feeding ecology, and (6) disease monitoring of the targeted species. Harassment...

76 FR 10560 - Marine Mammals; File No. 15530

Science.gov (United States)

2011-02-25

... Robin Baird, PhD, Cascadia Research, 218 [frac12] W. 4th Avenue, Olympia, WA 98501, has applied in due...) social organization, (5) feeding ecology, and (6) disease monitoring. Harassment of all species of...

Ecuadorian Cancer Patients' Preference for Information and Communication Technologies: Cross-Sectional Study.

Science.gov (United States)

Cherrez Ojeda, Ivan; Vanegas, Emanuel; Torres, Michell; Calderón, Juan Carlos; Calero, Erick; Cherrez, Annia; Felix, Miguel; Mata, Valeria; Cherrez, Sofia; Simancas, Daniel

2018-02-20

The instantaneous spread of information, low costs, and broad availability of information and communication technologies (ICTs) make them an attractive platform for managing care, patient communication, and medical interventions in cancer treatment. There is little information available in Latin America about the level of usage of ICTs for and by cancer patients. Our study attempts to fill this gap. The aim of this study was to assess the level of ICT use and patterns of preferences among cancer patients. We conducted an anonymous cross-sectional survey study in 500 Ecuadorian cancer patients. This questionnaire consisted of 22 items about demographic and clinical data, together with the preferences of people who use ICTs. Chi-square, crude, and adjusted logistic regressions were performed. Of the total, 43.2% (216/500) of participants reported that they had access to the Internet, and 25.4% (127/500) reported that they neither owned a cell phone nor did they have access to the Internet. The Internet constituted the highest usage rate as a source of information about malignant diseases (74.3%, 162/218) regardless of age (PWhatsApp (66.5%, 145/218) and short message service (SMS) text messaging (61.0%, 133/218) were widely reported as interesting communication channels. Similarly, WhatsApp (72.0%, 157/218) followed by SMS (63.8%, 139/218) were reported as the preferred ICTs through which patients would like to ask physicians about diseases. Adjusted regression analysis showed that patients aged between 40 and 64 years were more likely to be interested in receiving information through SMS (odds ratio, OR 5.09, 95% CI 1.92-13.32), as well as for asking questions to physicians through this same media (OR 9.78, CI 3.45-27.67) than the oldest group. WhatsApp, SMS, and email are effective and widely used ICTs that can promote communication between cancer patients and physicians. According to age range, new ICTs such as Facebook are still emerging. Future studies should

Homophobia in a University Community: Attitudes and Experiences of Heterosexual Freshmen.

Science.gov (United States)

D'Augelli, Anthony R.; Rose, Melissa L.

1990-01-01

Examined attitudes toward homosexuals in college freshmen (n=218). Found widespread hostile attitudes about homosexuals. Results indicated men knew fewer homosexual men, were more homophobic, and made more derogatory remarks than did women. (Author/ABL)

African Journal of Biomedical Research - Vol 13, No 3 (2010)

African Journals Online (AJOL)

Effects of Extracts of Portulaca oleracea on Reproductive Functions in Female Albino Rats · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. KO Oyedeji, AF Bolarinwa, 213-218 ...

77 FR 19623 - Antidumping or Countervailing Duty Order, Finding, or Suspended Investigation; Advance...

Science.gov (United States)

2012-04-02

... contact Polyester Staple Fiber from the Jennifer Moats, (202) 482-5047. People's Republic of China (A-570... Reviews are set forth in 19 CFR 351.218. Guidance on methodological or analytical issues relevant to the...

Search Results | Page 8 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

... Mexico 218 Apply Mexico filter · United States 203 Apply United States filter ... RESEARCH filter · POLITICAL REFORM 2 Apply POLITICAL REFORM filter ... Networked Economies filter · Growth and Economic Opportunities for Women 1 ...

Prostor básně (triptychy Dům daleko a Ianus tří tváří)

Czech Academy of Sciences Publication Activity Database

Košnarová, Veronika

2010-01-01

Roč. 58, č. 2 (2010), s. 218-230 ISSN 0009-0468 Institutional research plan: CEZ:AV0Z90560517 Keywords : Czech literature * poetry * Linhartová, Věra Subject RIV: AJ - Letters, Mass-media, Audiovision

A note on the occurrence of reef inhabiting, red-bellied yellow tail fusilier, Caesio cuning from outside its known geographical array

Digital Repository Service at National Institute of Oceanography (India)

Padate, V.P.; Rivonker, C.U.; Anil, A.C.

. Current Science 83(3), 214-218. Anon. (1989) Loss of biological diversity: A global crisis requiring international solutions. Washington DC: National Science Foundation. Ansari Z.A., Chatterji A., Ingole B.S., Sreepada R.A., Rivonkar C...

"Protože mám jenom svůj hlas..." (Rozhlasové hry Věry Linhartové)

Czech Academy of Sciences Publication Activity Database

Košnarová, Veronika

2010-01-01

Roč. 2, č. 1 (2010), s. 218-225 ISSN 1803-876X Institutional research plan: CEZ:AV0Z90560517 Keywords : Czech literature * drama * Linhartová, Věra Subject RIV: AJ - Letters, Mass-media, Audiovision

Effects of worked examples, example-problem, and problem-example pairs on novices’ learning

NARCIS (Netherlands)

Van Gog, Tamara; Kester, Liesbeth; Paas, Fred

2010-01-01

Van Gog, T., Kester, L., & Paas, F. (2011). Effects of worked examples, example-problem, and problem-example pairs on novices’ learning. Contemporary Educational Psychology, 36(3), 212-218. doi:10.1016/j.cedpsych.2010.10.004

How difficult is it to reintroduce a dragonfly? Fifteen years monitoring Leucorrhinia dubia at the receiving site

Czech Academy of Sciences Publication Activity Database

Dolný, A.; Šigutová, H.; Ožana, S.; Choleva, Lukáš

2018-01-01

Roč. 218, č. 3 (2018), s. 110-117 ISSN 0006-3207 Institutional support: RVO:67985904 Keywords : conservation translocation * dragonfly reintroduction * odonata Subject RIV: EH - Ecology, Behaviour OBOR OECD: Ecology Impact factor: 4.022, year: 2016

Understanding of the risk of HIV infection among the elderly in Ga ...

African Journals Online (AJOL)

Eucebious Lekalakala-Mokgele

2014-06-24

Medunsa. Campus) ..... Sex. All females. 32. 100.0. Marital status. Single. 7. 21.8. Married. 17. 53.1 ..... younger generation and is associated with gender inequalities ... stereotypes which perpetuate the myth that the elderly are not.

Hrozba „vyprázdněného“ centra

Czech Academy of Sciences Publication Activity Database

Kanda, Roman

2017-01-01

Roč. 34, č. 108 (2017), s. 218-223 ISSN 0862-7045 Institutional support: RVO:68378068 Keywords : political philosophy * European Left * ideology * universalism and particularism Subject RIV: AJ - Letters, Mass-media, Audiovision OBOR OECD: Specific literatures

AcEST: DK946532 [AcEST

Lifescience Database Archive (English)

Full Text Available FV Structural polyprotein OS=Barmah forest virus... 29 6.3 >sp|Q12594|DMAW_CLAFS ...+ + + C++ PPS S L HF Sbjct: 218 HCAVSTTHQTPDWFPLLCVQSPPSTSPFLGHF 249 >sp|P89946|POLS_BFV Structural polyprotein OS=Barmah forest

African Health Sciences - Vol 13, No 2 (2013)

African Journals Online (AJOL)

African Health Sciences. ... African Health Sciences - Vol 13, No 2 (2013) ... S Musisi, D Akena, E Nakimuli-Mpungu, C Abbo, J Okello, 205-218 .... Alcohol consumption and cigarette smoking pattern among brothelbased female sex workers in ...

Bioaccumulation of heavy metals, metalloids, and chlorine in ectomycorrhizae from smelter-polluted area

Czech Academy of Sciences Publication Activity Database

Cejpková, J.; Gryndler, M.; Hršelová, H.; Kotrba, P.; Řanda, Z.; Synková, I.; Borovička, Jan

2016-01-01

Roč. 218, November (2016), s. 176-185 ISSN 0269-7491 Institutional support: RVO:67985831 Keywords : cadmium * ectomycorrhiza * ectomycorrhizal fungi * quantitative real-time PCR * roots * silver * soil Subject RIV: DD - Geochemistry Impact factor: 5.099, year: 2016

76 FR 11198 - Antidumping or Countervailing Duty Order, Finding, or Suspended Investigation; Advance...

Science.gov (United States)

2011-03-01

.... Romania (A-485-805) (2nd Review). Sulfanilic Acid from the People's Republic Julia Hancock of China (A-570... Reviews are set forth in 19 CFR 351.218. Guidance on methodological or analytical issues relevant to the...

Eluruumi kvaliteedi mittevastavus lepingutingimustele müüja ja kinnisvaramaakleri vastutuse alusena : [magistritöö] / Monika Pihlak ; Tartu Ülikool, õigusteaduskond ; juhendaja: Irene Kull

Index Scriptorium Estoniae

Pihlak, Monika, 1990-

2015-01-01

Kinnisasjadele eluruumidena esitatavatest nõuetest, ostja teadmisest või teadma pidamisest asja mittevastavusest, müüja teavitamiskohustusest, VÕS § 218 lg 1 kui vastutusstandardist ja rikkumisele tuginemisest, maakleri teavitamiskohustusest ja selle rikkumise tagajärgedest

American Society of Nuclear Cardiology

Science.gov (United States)

... Course ASNC2018 Advocacy Value Based Payment (MACRA) & Alternative Payment Models Take Action Appropriate Use Criteria Mandate (section 218 ... Merit-Based Incentive Payment System (MIPS) and Alternative Payment Models (APMs) for the 2018 performance year which begins ...

78 FR 60376 - Agency Information Collection Activities; Information Collection Renewal; Submission for OMB...

Science.gov (United States)

2013-10-01

... Currency, 400 7th Street SW., Suite 3E-218, Mailstop 9W-11, Washington, DC 20219. FDIC: Michael R. Evans... collection, including the validity of the methodology and assumptions used; (c) Ways to enhance the quality...

Epimerisation of 2-[18F]-Fluoro-2-Deoxy-D-Glucose under alkaline conditions. A convenient method for the preparation of 2-[18F]-Fluoro-2-Deoxy-D-Mannose

International Nuclear Information System (INIS)

Varelis, P.

1998-01-01

Full text: The intended goal of our study into the epimerisation of 2-[ 18 F]- fluoro-2-deoxy-D-glucose ([ 18 F]-FDG) was to obtain 2-[ 18 F]-fluoro- 2-deoxy-D-mannose ([ 18 F]-FDM) for the purpose of both development and validation of our analytical methods used to determine the diastereoisomeric excess of [ 18 F]-FDG prepared in our facility. The epimerisation of [ 18 F]-FDG is smoothly effected by heating an aqueous solution of this radiochemical with 1 M aqueous sodium hydroxide at 50-60 deg C for 30 min, which provides an ∼ 1:1 mixture of [ 18 F]-FDG and [ 18 F]-FDM. In addition to the value of this mixture in analytical method development, we also found it useful for gauging the performance of the HPLC column used in the analysis of [ 18 F]-FDG. The aqueous sample matrix can be conveniently changed by azeotropic evaporation of the water with dry acetonitrile. In summary, the base catalysed epimerisation of 2-[ 18 F]-fluoro-2- deoxy-D-glucose provides a convenient and reliable procedure for the preparation 2-[ 18 F]-fluoro-2-deoxy-D-mannose, the stable analogue of which is not commercially available

On the redshift distribution and physical properties of ACT-selected DSFGs

Science.gov (United States)

Su, T.; Marriage, T. A.; Asboth, V.; Baker, A. J.; Bond, J. R.; Crichton, D.; Devlin, M. J.; Dünner, R.; Farrah, D.; Frayer, D. T.; Gralla, M. B.; Hall, K.; Halpern, M.; Harris, A. I.; Hilton, M.; Hincks, A. D.; Hughes, J. P.; Niemack, M. D.; Page, L. A.; Partridge, B.; Rivera, J.; Scott, D.; Sievers, J. L.; Thornton, R. J.; Viero, M. P.; Wang, L.; Wollack, E. J.; Zemcov, M.

2017-01-01

We present multi-wavelength detections of nine candidate gravitationally lensed dusty star-forming galaxies (DSFGs) selected at 218 GHz (1.4 mm) from the Atacama Cosmology Telescope (ACT) equatorial survey. Among the brightest ACT sources, these represent the subset of the total ACT sample lying in Herschel SPIRE fields, and all nine of the 218 GHz detections were found to have bright Herschel counterparts. By fitting their spectral energy distributions (SEDs) with a modified blackbody model with power-law temperature distribution, we find the sample has a median redshift of z=4.1^{+1.1}_{-1.0} (68 per cent confidence interval), as expected for 218 GHz selection, and an apparent total infrared luminosity of log _{10}(μ L_IR/L_{odot }) = 13.86^{+0.33}_{-0.30}, which suggests that they are either strongly lensed sources or unresolved collections of unlensed DSFGs. The effective apparent diameter of the sample is sqrt{μ }d= 4.2^{+1.7}_{-1.0} kpc, further evidence of strong lensing or multiplicity, since the typical diameter of DSFGs is 1.0-2.5 kpc. We emphasize that the effective apparent diameter derives from SED modelling without the assumption of optically thin dust (as opposed to image morphology). We find that the sources have substantial optical depth (tau = 4.2^{+3.7}_{-1.9}) to dust around the peak in the modified blackbody spectrum (λobs ≤ 500 μm), a result that is robust to model choice.

Knowledge, attitude, and practices of oral health care in prevention of early childhood caries among parents of children in Belagavi city: A Questionnaire study.

Science.gov (United States)

Suma Sogi, H P; Hugar, Shivayogi M; Nalawade, Triveni Mohan; Sinha, Anjali; Hugar, Shweta; Mallikarjuna, Rachappa M

2016-01-01

The aim of this study was to assess the existing knowledge, attitude, and practices of "oral health care" in the prevention of early childhood caries (ECCs) among parents of children in Belagavi city. A cross-sectional study was conducted in the outpatient Department of Pedodontics and Preventive Dentistry, KLE VK Institute of Dental Sciences, Belagavi, Karnataka. Institutional Ethical Clearance was obtained. The study was conducted during the month of April 2014 to October 2014 after taking prior informed consent from the 218 parents. Inclusion criteria were parents getting their children treated for dental caries and who were willing to participate. Parents who could not read and write were excluded from the study. The self-administered, close-ended questionnaire was written in English. It was then translated in local languages, i.e. Kannada and Marathi, and a pilot study was conducted on 10 parents to check for its feasibility and any changes if required were done. The response rate was 100% as all 218 parents completed the questionnaire. Of 218 parents, 116 were mothers and 102 were fathers. The overall mean knowledge score was 69.5%. The overall mean attitude score was 53.5%. The overall attitude toward prevention of ECC was not in accordance to knowledge. The overall mean of "good" practices and "bad" practices score was 33.5% and 18.5%, respectively. Good knowledge and attitude toward oral health do not necessarily produce good practices.

On the Redshift Distribution and Physical Properties of ACT-Selected DSFGs

Science.gov (United States)

Su, T.; Marriage, T. A.; Asboth, V.; Baker, A. J.; Bond, J. R.; Crichton, D.; Devlin, M. J.; Dunner, R.; Farrah, D.; Frayer, D. T.;

Search Results | Page 28 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 271 - 280 of 869 ... Canada 850 Apply Canada filter · Mexico 218 Apply Mexico filter · United ... Apply WOMEN'S RIGHTS filter · ADMINISTRATIVE REFORM 16 Apply ... Growth and Economic Opportunities for Women 4 Apply Growth and ...

Search Results | Page 35 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 341 - 350 of 869 ... Canada 850 Apply Canada filter · Mexico 218 Apply Mexico filter · United ... Apply WOMEN'S RIGHTS filter · ADMINISTRATIVE REFORM 16 Apply ... Growth and Economic Opportunities for Women 4 Apply Growth and ...

Heparin binding sites on Ross River virus revealed by electron cryo-microscopy

International Nuclear Information System (INIS)

Zhang Wei; Heil, Marintha; Kuhn, Richard J.; Baker, Timothy S.

2005-01-01

Cell surface glycosaminoglycans play important roles in cell adhesion and viral entry. Laboratory strains of two alphaviruses, Sindbis and Semliki Forest virus, have been shown to utilize heparan sulfate as an attachment receptor, whereas Ross River virus (RRV) does not significantly interact with it. However, a single amino acid substitution at residue 218 in the RRV E2 glycoprotein adapts the virus to heparan sulfate binding and expands the host range of the virus into chicken embryo fibroblasts. Structures of the RRV mutant, E2 N218R, and its complex with heparin were determined through the use of electron cryo-microscopy and image reconstruction methods. Heparin was found to bind at the distal end of the RRV spikes, in a region of the E2 glycoprotein that has been previously implicated in cell-receptor recognition and antibody binding

Radiation shielding design for DECY-13 cyclotron using Monte Carlo method

International Nuclear Information System (INIS)

Rasito T; Bunawas; Taufik; Sunardi; Hari Suryanto

2016-01-01

DECY-13 is a 13 MeV proton cyclotron with target H_2"1"8O. The bombarding of 13 MeV protons on target H_2"1"8O produce large amounts of neutrons and gamma radiation. It needs the efficient radiation shielding to reduce the level of neutrons and gamma rays to ensure safety for workers and public. Modeling and calculations have been carried out using Monte Carlo method with MCNPX code to optimize the thickness for the radiation shielding. The calculations were done for radiation shielding of rectangular space room type with the size of 5.5 m x 5 m x 3 m and thickness of 170 cm made from lightweight concrete types of portland. It was shown that with this shielding the dose rate outside the wall was reduced to 1 μSv/h. (author)

The tryptophan hydroxylase 1 (TPH1) gene, schizophrenia susceptibility, and suicidal behavior: a multi-centre case-control study and meta-analysis

DEFF Research Database (Denmark)

Saetre, Peter; Lundmark, Per; Wang, August

2010-01-01

Serotonin (5-hydroxytryptamin; 5-HT) alternations has since long been suspected in the pathophysiology of schizophrenia. Tryptophan hydroxylase (tryptophan 5-monooxygenase; TPH) is the rate-limiting enzyme in the biosynthesis of 5-HT, and sequence variation in intron 6 of the TPH1 gene has been...... associated with schizophrenia. The minor allele (A) of this polymorphism (A218C) is also more frequent in patients who have attempted suicide and individuals who died by suicide, than in healthy control individuals. In an attempt to replicate previous findings, five single nucleotide polymorphisms (SNPs......) were genotyped in 837 Scandinavian schizophrenia patients and 1,473 controls. Three SNPs spanning intron 6 and 7, including the A218C and A779C polymorphisms, were associated with schizophrenia susceptibility (P = 0.019). However there were no differences in allele frequencies of these loci between...

Nutrient Values of Chrysophyllum Albidum Linn African Star Apple ...

African Journals Online (AJOL)

FIRST LADY

reported that fruit pulp of Chrysophyllum albidum contains 21.8mg/100gm ascorbic ... Eight to ten fruits of differing morphological features were characterized and identified as .... might offer better health services than the sweet types. Thus type ...

Effects of Acute and Recurrent Stress During Adolescence on Subsequent Indices of Adult Behavioral Health in Rats

Science.gov (United States)

2009-04-10

environmental enrichment on amphetamine-stimulated locomotor activity, dopamine synthesis and dopamine release. Neuropharmacology, 32(9), 885-893...Disorders, 45(1-2), 19- 30. 218 Kirby, L., & Lucki, I. (1997). Interaction between the forced swimming test and fluoxetine treatment on

IrC2/Bf - A yeast and Borrelia responsive component of the complement system from the hard tick Ixodes ricinus

Czech Academy of Sciences Publication Activity Database

Urbanová, V.; Hajdušek, O.; Šíma, R.; Franta, Z.; Hönig Mondeková, Helena; Grunclová, L.; Bartošová-Sojková, P.; Jalovecká, M.; Kopáček, P.

2018-01-01

Roč. 76, FEB 2018 (2018), s. 86-94 ISSN 0145-305X Institutional support: RVO:61388971 Keywords : Borrelia * C3-complement convertase * Factor B Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 3.218, year: 2016

Prototypic corium oxidation and hydrogen release during the Fuel-Coolant Interaction

Czech Academy of Sciences Publication Activity Database

Tyrpekl, J.; Piluso, P.; Bakardjieva, Snejana; Nižňanský, D.; Rehspringer, J.L.; Bezdička, Petr; Dugne, O.

2015-01-01

Roč. 75, JAN (2015), s. 210-218 ISSN 0306-4549 Institutional support: RVO:61388980 Keywords : Corium * Fuel -Coolant Interaction * Hydrogen release * Material effect * Nuclear reactor severe accident Subject RIV: CA - Inorganic Chemistry Impact factor: 1.174, year: 2015

Dissecting geographic variation in population synchrony using the common vole in central Europe as a test bed

Czech Academy of Sciences Publication Activity Database

Gouveia, A. R.; Bjornstad, O. N.; Tkadlec, Emil

2016-01-01

Roč. 6, č. 1 (2016), s. 212-218 ISSN 2045-7758 Institutional support: RVO:68081766 Keywords : Altitudinal gradient * LISA * Microtus arvalis * partial nonparametric correlation function * spatiotemporal dynamics Subject RIV: EH - Ecology, Behaviour Impact factor: 2.440, year: 2016

Analýza chyb při určování jednosložkových permeabilit a ideálních selektivit membránových materiálů s nízkou propustností

Czech Academy of Sciences Publication Activity Database

Prokopová, Olga; Bernauer, B.; Fíla, V.; Čapek, P.; Sysel, P.; Hrabánek, Pavel; Zikánová, Arlette; Brabec, Libor; Kočiřík, Milan

2013-01-01

Roč. 107, č. 3 (2013), s. 214-218 E-ISSN 1213-7103 R&D Projects: GA ČR GA203/09/1353 Institutional support: RVO:61388955 Keywords : permeability * composite membranes * molecular sieves Subject RIV: CF - Physical ; Theoretical Chemistry

Hypervitaminosis A

Science.gov (United States)

... much vitamin A, or you have symptoms of excess vitamin A. Prevention How much vitamin A you need ... Saunders; 2015:chap 218. Ross AC, Tan L. Vitamin A deficiencies and excess. In: Kliegman RM, Stanton BF, St. Geme JW, ...

5. Anaemia in Pregnancy among Pregnant Women in Lusaka ...

African Journals Online (AJOL)

user

University Teaching Hospitals, Women and Newborn Hospital, Private Bag, RW1X, Lusaka, Zambia. Medical .... (21.8%) were single, one hundred and sixty nine. (78.2%) were .... were employed could have had long working hours with a very ...

A microkernel middleware architecture for distributed embedded real-zime systems

OpenAIRE

Pfeffer, Matthias

2001-01-01

A microkernel middleware architecture for distributed embedded real-zime systems / T. Ungerer ... - In: Symposium on Reliable Distributed Systems : Proceedings : October 28 - 31, 2001, New Orleans, Louisiana, USA. - Los Alamitos, Calif. [u.a.] : IEEE Computer Soc., 2001. - S. 218-226

Extrapulmonary tuberculosis among adults: Experience at Chris ...

African Journals Online (AJOL)

31.0%), blood (21.8%), meninges (7.3%), and peritoneum (2.9%). Disseminated tuberculosis occurred in 25.0%. The median age was 33 years (range 18 - 87 years). Males comprised 53.2% overall, with a female majority in the peritonitis group.

Digitali purpureae-Epilobietum in the Czech Republic

Czech Academy of Sciences Publication Activity Database

Neuhäuslová, Zdenka; Härtel, Handrij

2001-01-01

Roč. 46, č. 2 (2001), s. 211-218 ISSN 1641-8190 R&D Projects: GA ČR GA206/96/0592 Institutional research plan: CEZ:AV0Z6005908 Keywords : Digitali purpureae-Epilobietum * phytocenology * ecology Subject RIV: EF - Botanics

Spatial heterogeneity and habitat permanence affect community assembly, structure and phenology of mayflies (Ephemeroptera) in sandpit pools

Czech Academy of Sciences Publication Activity Database

Sroka, Pavel; Klečka, Jan; Boukal S., David

2016-01-01

Roč. 11, NOV 18 (2016), s. 205-218 ISSN 1178-9905 R&D Projects: GA ČR(CZ) GA14-29857S EU Projects: European Commission(XE) 239543 Institutional support: RVO:60077344 Keywords : community ecology * population dynamics * colonization experiment

Tělo a morální fenomenologie

Czech Academy of Sciences Publication Activity Database

Urban, Petr

2011-01-01

Roč. 59, č. 7 (2011), s. 203-218 ISSN 0015-1831 R&D Projects: GA ČR(CZ) GAP401/10/1164 Institutional research plan: CEZ:AV0Z90090514 Keywords : body * phenomenology * intersubjectivity * ethics Subject RIV: AA - Philosophy ; Religion

Single-species models of the allee effect: Extinction boundaries, sex ratios and mate encounters

Czech Academy of Sciences Publication Activity Database

Boukal S., David; Berec, Luděk

2002-01-01

Roč. 218, - (2002), s. 375-394 ISSN 0022-5193 R&D Projects: GA AV ČR IAB1007201 Institutional research plan: CEZ:AV0Z5007907 Keywords : Allee effect Subject RIV: EH - Ecology, Behaviour Impact factor: 1.552, year: 2002

Surface and permeability properties of membranes from polyelectrolyte complexes and polyelectrolyte surfactant complexes

Czech Academy of Sciences Publication Activity Database

Schwarz, H. H.; Lukáš, Jaromír; Richau, K.

2003-01-01

Roč. 218, 1-2 (2003), s. 1-9 ISSN 0376-7388 R&D Projects: GA AV ČR KSK4050111 Keywords : polyelectrolyte complex membranes * pervaporation * dehydration of organics Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.081, year: 2003

75 FR 60084 - Purified Carboxymethylcellulose from Mexico: Preliminary Results of the First Five-year (“Sunset...

Science.gov (United States)

2010-09-29

..., Quimica Amtex S.A. de C.V. (Quimica Amtex), within the 30-day deadline specified in 19 CFR 351.218(d)(3)(i... of dumping at the following weighted-average margins: Quimica Amtex 12.61 percent All Others 12.61...

77 FR 16940 - Approval and Promulgation of Air Quality Implementation Plans; Illinois; Volatile Organic...

Science.gov (United States)

2012-03-23

... at the Environmental Protection Agency, Region 5, Air and Radiation Division, 77 West Jackson... reference, Intergovernmental relations, Nitrogen dioxide, Ozone, Reporting and recordkeeping requirements... plant exemption in Subpart TT of Parts 218 and 219 does not apply to industrial wastewater. This...

Browse Title Index

African Journals Online (AJOL)

Items 101 - 150 of 218 ... Vol 14, No 2 (2015), Enhancing inorganic fertilizer use in Imo State, Nigeria, Abstract ... Vol 16, No 2 (2017), Extraction and characterization of essential ... structural policies on the wheat market – comparative static and ...

Draft Genome Sequence of Lactobacillus plantarum XJ25 Isolated from Chinese Red Wine.

Science.gov (United States)

Zhao, Meijing; Liu, Shuwen; He, Ling; Tian, Yu

2016-11-17

Here, we present the draft genome sequence of Lactobacillus plantarum XJ25, isolated from Chinese red wine that had undergone spontaneous malolactic fermentation, which consists of 25 contigs and is 3,218,018 bp long. Copyright © 2016 Zhao et al.

Breech delivery at term in Denmark, 1982-92

DEFF Research Database (Denmark)

Krebs, L; Langhoff-Roos, J

1999-01-01

,476) in Denmark, 1982-92, a review of medical records of all (n = 218) cases with Apgar score controls, was performed. Planned vaginal delivery was associated with a 15 times greater risk of low Apgar score than elective Caesarean section...

Niche construction in evolutionary theory: the construction of an ...

Indian Academy of Sciences (India)

MANAN GUPTA

2017-07-06

Jul 6, 2017 ... 81, SAS Nagar, P.O. Manauli, Mohali, Punjab 140 306, India .... living or dying, affects the environment, NC would appear .... ing from the deterioration of the food environment in a ...... Oikos 119, 210–218. .... Health Technol.

Stopové prvky v křemeni z pegmatitu Věžná I (Česká republika)

Czech Academy of Sciences Publication Activity Database

Breiter, Karel; Svojtka, Martin; Ackerman, Lukáš; Ďurišová, Jana; Matoušková, Šárka; Švecová, K.; Loun, J.

2012-01-01

Roč. 20, č. 2 (2012), s. 218-222 ISSN 1211-0329 R&D Projects: GA ČR GAP210/10/1105 Institutional support: RVO:67985831 Keywords : quartz * trace elements * pegmatite * Věžná locality Subject RIV: DB - Geology ; Mineralogy

Measurement of radon daughters in air samples by alpha spectroscopy

International Nuclear Information System (INIS)

Acena, M.L.; Crespo, M.T.

1989-01-01

The concentration of radon progeny in air has been determined by alpha spectrometry measurement of polonium 214 and polonium 218. A known volume of air was passed through a filter, then the alpha activity was directly measured on this filter (Author)

Disease: H01797 [KEGG MEDICUS

Lifescience Database Archive (English)

Full Text Available pituitarism, post-natal microcephaly, visual and renal anomalies. ... JOURNAL ... Brain 136:3096-105 (2013) DOI:10.1093/brain/awt218 ..., Chong WK, Alkuraya FS, Martinez-Barbera JP, Sowden JC, Dattani MT ... TITLE ... ARNT2 mutation causes hypo

African Journal of Biotechnology - Vol 2, No 8 (2003)

African Journals Online (AJOL)

Stable gene transformation in cowpea (Vigna unguiculata L. walp.) using particle gun method · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. J. Ikea, I. Ingelbrecht, A. Uwaifo, G. Thottappilly, 211-218 ...

PET radiochemistry: synthesis of 2-[18 F]-fluorine-2-deoxy-D-glucose

International Nuclear Information System (INIS)

Lopez D, F.A.; Flores M, A.; Zarate M, A.; Romo, E.

2005-01-01

The present work describes the method for the synthesis of the 2-[ 18 F]-fluorine-2-deoxy-D-glucose, the radiopharmaceutical of more use in nuclear medicine for the diagnosis of cancer at world level. (Author)

MO-A-218-01: CT Protocol Review - Practical Tips for Imaging Physicists.

Science.gov (United States)

Pizzutiello, R

2012-06-01

In the 1980's and 90's, when every mammography department had a wet film processor and a sundial to keep the schedule, medical physicists performing mammography surveys were primarily focused on measuring machine performance and image quality. As our professional experience matured, medical physicists began to learn that they were uniquely qualified to help to recommend technique factors that would balance dose and image quality. Technique charts using different kVp, target-filter combinations and AEC modes gradually became common and patients benefitted from our input. With the revolutionary change in CT Scanner technology and utilization, medical physicists have begun to contribute their expertise to developing and improving CT protocols. This presentation will present practical challenges and offer some directions for the practicing medical physicist who desires to participate in this critical and emerging aspect of imaging physics practice: CT Protocol Review. © 2012 American Association of Physicists in Medicine.

22 CFR Appendix A to Part 218 - List of Federal Financial Assistance

Science.gov (United States)

2010-04-01

... Department of State Subject to Age Discrimination Regulations Resettlement of Refugees in the United States Under the Migration and Refugee Assistant Act of 1962, as amended (22 U.S.C. 2601 et seq.). Diplomat in...

Adjustable valves in normal-pressure hydrocephalus: a retrospective study of 218 patients

DEFF Research Database (Denmark)

Zemack, G.; Rommer, Bertil Roland

2008-01-01

OBJECTIVE: We sought to assess the value of adjusting shunt valve opening pressure, complications, and outcomes with the use of an adjustable shunt valve in the treatment of patients with normal-pressure hydrocephalus (NPH). METHODS: In a single-center retrospective study, 231 adjustable valves...

Transuranic (TRU) Waste Phase I Retrieval Plan

International Nuclear Information System (INIS)

MCDONALD, K.M.

2000-01-01

From 1970 to 1987, TRU and suspect TRU wastes at Hanford were placed in the SWBG. At the time of placement in the SWBG these wastes were not regulated under existing Resource Conservation and Recovery Act (RCRA) regulations, since they were generated and disposed of prior to the effective date of RCRA at the Hanford Site (1987). From the standpoint of DOE Order 5820.2A1, the TRU wastes are considered retrievably stored, and current plans are to retrieve these wastes for shipment to WIPP for disposal. This plan provides a strategy for the Phase I retrieval that meets the intent of TPA milestone M-91 and Project W-113, and incorporates the lessons learned during TRU retrieval campaigns at Hanford, LANL, and SRS. As in the original Project W-113 plans, the current plan calls for examination of approximately 10,000 suspect-TRU drums located in the 218-W-4C burial ground followed by the retrieval of those drums verified to contain TRU waste. Unlike the older plan, however, this plan proposes an open-air retrieval scenario similar to those used for TRU drum retrieval at LANL and SRS. Phase I retrieval consists of the activities associated with the assessment of approximately 10,000 55-gallon drums of suspect TRU-waste in burial ground 218-W-4C and the retrieval of those drums verified to contain TRU waste. Four of the trenches in 218-W-4C (Trenches 1, 4, 20, and 29) are prime candidates for Phase I retrieval because they contain large numbers of suspect TRU drums, stacked from 2 to 5 drums high, on an asphalt pad. In fact, three of the trenches (Trenches 1 , 20, and 29) contain waste that has not been covered with soil, and about 1500 drums can be retrieved without excavation. The other three trenches in 218-W-4C (Trenches 7, 19, and 24) are not candidates for Phase I retrieval because they contain significant numbers of boxes. Drums will be retrieved from the four candidate trenches, checked for structural integrity, overpacked, if necessary, and assayed at the burial

SU-F-T-327: Total Body Irradiation In-Vivo Dose Measurements Using Optically Stimulated Luminescence (OSL) NanoDots and Farmer Type Ion Chamber

International Nuclear Information System (INIS)

Kaur, H; Kumar, S; Sarkar, B; Ganesh, T; Giri, U; Jassal, K; Rathinamuthu, S; Gulia, G; Gopal, V; Mohanti, B; Munshi, A

2016-01-01

Purpose: This study was performed to analyze the agreement between optically stimulated luminescence (OSL) nanoDots measured doses and 0.6 cc Farmer type ionization chamber measured doses during total body irradiation (TBI). Methods: In-vivo dose measurements using OSL nanoDots and Farmer chamber were done in a total of twelve patients who received TBI at our center by bilateral parallel-opposed beams technique. In this technique, the patient is kept inside the TBI box which is filled with rice bags and irradiated using two bilateral parallel opposed beams of 40×40 cm"2 size with 45° collimator rotation at an SSD of 333.5 cm in an Elekta Synergy linear accelerator. All patients received a dose of 2 Gy in single fraction as conditioning regimen. The beams were equally weighted at the midplane of the box. The nanoDots were placed over forehead, right and left neck, right and left lung, umbilicus, right and left abdomen, medial part of thigh, knee and toe. A 0.6 cc Farmer chamber was placed in between the thighs of the patient. Measured doses are reported along with the statistical comparisons using paired sample t-test. Results: For the above sites the mean doses were 212.2±21.1, 218.2±7.6, 218.7±9.3, 215.6±9.5, 217.5±11.5, 214.5±7.7, 218.3±6.8, 221.5±15, 229.1±11.0, 220.5±7.7 and 223.3±5.1 cGy respectively. For all OSL measurements the mean dose was 218.6±11.8 cGy. Farmer chamber measurements yielded a mean dose of 208.8±15.6 cGy. Statistical analysis revealed that there was no significant difference between OSL measured doses in forehead, right and left neck, right and left lung, umbilicus, right and left abdomen and toe and Farmer chamber measured doses (0.72≤p≤0.06). However the mean OSL doses at thigh and knee were statistically different (p<0.05) from the Farmer chamber measurements. Conclusion: OSL measurements were found to be in agreement with Farmer type ionization chamber measurements in in-vivo dosimetry of TBI.

Patterns in moss element concentrations in fens across species, habitats, and regions

Czech Academy of Sciences Publication Activity Database

Hájek, Michal; Plesková, Z.; Syrovátka, V.; Peterka, T.; Laburdová, J.; Kintrová, K.; Jiroušek, M.; Hájek, Tomáš

2014-01-01

Roč. 16, č. 5 (2014), s. 203-218 ISSN 1433-8319 R&D Projects: GA ČR GAP505/10/0638 Institutional support: RVO:67985939 Keywords : bryophyte * calcicole-calcifuge behaviour * ionome Subject RIV: EF - Botanics Impact factor: 3.606, year: 2014

Experiment list: SRX020768 [Chip-atlas[Archive

Lifescience Database Archive (English)

Full Text Available cells or in CF tests against SV40, RSV or adenoviruses, mycoplasma contamination was detected and elimina...ted in 1972, (PMID: 6081590) 7420650,78.4,4.2,218 GSM545811: p53-pS46 ActD ChIPSeq

Blunt Head Trauma and Headache

Directory of Open Access Journals (Sweden)

Ana B Chelse

2015-04-01

Full Text Available Investigators from New York Presbyterian Morgan Stanley Children’s Hospital examined whether having an isolated headache following minor blunt head trauma was suggestive of traumatic brain injury (TBI among a large cohort of children 2-18 years of age.

Revisiting Parental Monitoring : Evidence that Parental Solicitation Can be Effective When Needed Most

NARCIS (Netherlands)

Laird, Robert D.; Marrero, Matthew D.; Sentse, Miranda

2010-01-01

Studies using valid measures of monitoring activities have not found the anticipated main effects linking greater monitoring activity with fewer behavioral problems. This study focused on two contexts in which monitoring activities may be particularly influential. Early adolescents (n = 218, M age =

Genetic variants in SLC22A17 and SLC22A7 are associated with anthracycline-induced cardiotoxicity in children

NARCIS (Netherlands)

Visscher, Henk; Rassekh, S. Rod; Sandor, George S.; Caron, Huib N.; van Dalen, Elvira C.; Kremer, Leontien C.; van der Pal, Helena J.; Rogers, Paul C.; Rieder, Michael J.; Carleton, Bruce C.; Hayden, Michael R.; Ross, Colin J.; Hayden, Michael; Carleton, Bruce; Ross, Colin; MacLeod, Stuart; Wasserman, Wyeth; Mitton, Craig; Smith, Anne; Hildebrand, Claudette; Pastrana, Lucila Castro; Ghannadan, Reza; Rassekh, Rod; Miao, Fudan; Higginson, Michelle; Borrie, Adrienne; Amstutz, Ursula; Bhavsar, Amit; Nijssen-Jordan, Cheri; Johnson, David; Verbeek, Linda; Kaczowka, Rick; Grundy, Paul; Stobart, Kent; Wilson, Bev; Desai, Sunil; Spavor, Maria; Churcher, Linda; Chow, Terence; Hall, Kevin; Honcharik, Nick; Israels, Sara; Chan, Shanna; Garnham, Byron; Staub, Michelle; Rieder, Michael; Malkin, Becky; Portwine, Carol; Cranston, Amy; Koren, Gideon

2015-01-01

To identify novel variants associated with anthracycline-induced cardiotoxicity and to assess these in a genotype-guided risk prediction model. Two cohorts treated for childhood cancer (n = 344 and 218, respectively) were genotyped for 4578 SNPs in drug ADME and toxicity genes. Significant

Bentonite Modification with Manganese Oxides and Its Characterization

Czech Academy of Sciences Publication Activity Database

Dolinská, S.; Schütz, T.; Znamenáčková, I.; Lovás, M.; Vaculíková, Lenka

2015-01-01

Roč. 35, č. 1 (2015), s. 213-218 ISSN 1640-4920 Institutional support: RVO:68145535 Keywords : bentonite * natrification * manganese oxide Subject RIV: CB - Analytical Chemistry, Separation http://www.potopk.com.pl/ Full _text/2015_full/IM%202-2015-a35.pdf

Dicyclopentadiene Hydrogenation in Trickle Bed Reactor under Forced Periodic Control

Czech Academy of Sciences Publication Activity Database

Skála, D.; Hanika, Jiří

2008-01-01

Roč. 62, č. 2 (2008), s. 215-218 ISSN 1336-7242 R&D Projects: GA MPO(CZ) FT-TA/039 Institutional research plan: CEZ:AV0Z40720504 Keywords : periodic control * trickle -bed reactor * dicyclopentadiene Subject RIV: CI - Industrial Chemistry, Chemical Engineering

Phenotypes of sleeplessness : stressing the need for psychodiagnostics in the assessment of insomnia

NARCIS (Netherlands)

van de Laar, M.; Leufkens, T.; Bakker, B.; Pevernagie, D.; Overeem, S.

2017-01-01

Insomnia is a too general term for various subtypes that might have different etiologies and therefore require different types of treatment. In this explorative study we used cluster analysis to distinguish different phenotypes in 218 patients with insomnia, taking into account several factors

A Probabilistic Cost Estimation Model for Unexploded Ordnance Removal

Science.gov (United States)

1999-09-01

clearance of the former Fort Ord costly and difficult [Meuser, and Szasz 1997]. Finally, soil type affects the maximum depth that ordnance...Correlated Random Variables from partially-specified Distributions." Management Science. 44(1998): 203- 218. Meuser, M, and A. Szasz . "Stakeholder

Bias and error in understanding plant invasion impacts

Czech Academy of Sciences Publication Activity Database

Hulme, P. E.; Pyšek, Petr; Jarošík, Vojtěch; Pergl, Jan; Schaffner, U.; Vila, M.

2013-01-01

Roč. 28, č. 4 (2013), s. 212-218 ISSN 0169-5347 R&D Projects: GA ČR(CZ) GAP504/11/1028 Institutional support: RVO:67985939 Keywords : biodiversity * invasions * ecosystem processes Subject RIV: EF - Botanics Impact factor: 15.353, year: 2013