WorldWideScience

Sample records for actinium 218

  1. CGD 218 Tutorials / cgd218dotcom

    nodutejakamsissss

    2015-01-01

    CGD 218 Entire Course For more course tutorials visit www.cgd218.com   CGD 218 Week 1 Assignment Why is Visual Literacy Important CGD 218 Week 1 Journal The Evolution of Media CGD 218 Week 1 DQ 1 Using Visuals to Communicate CGD 218 Week 2 Assignment Final Project - Step Two CGD 218 Week 2 DQ 1 Typography in Business CGD 218 Week 2 DQ 2 Bauhaus Manifesto CGD 218 Week 3 Assignment Using Photographs from the Web CGD 218 Week 3 Journal Visual Comm...

  2. Extraction of actinium with di-(2-ethylhexyl)phosphoric acid from hydrochloric and nitric acid solutions

    The extraction of actinium with HDEHP from Cl- and NO3- systems has been investigated. It was found that extraction of actinium from HCl solutions is much better than from HNO3 solutions. Stability constants of actinium complexes Ac(X-)+2 with Cl- and NO3- ligands were determined. Our results show that the actinium formed less stable complexes with Cl- than with NO3- ligands. 5 refs., 3 figs., 1 tab. (author)

  3. The sorption of polonium, actinium and protactinium onto geological materials

    This paper describes a combined experimental and modeling program of generic sorption studies to increase confidence in the performance assessment for a potential high-level radioactive waste repository in Japan. The sorption of polonium, actinium and protactinium onto geological materials has been investigated. Sorption of these radioelements onto bentonite, tuff and granodiorite from equilibrated de-ionized water was studied under reducing conditions at room temperature. In addition, the sorption of actinium and protactinium was investigated at 60 C. Thermodynamic chemical modeling was carried out to aid interpretation of the results

  4. Discovery of the actinium, thorium, protactinium, and uranium isotopes

    Fry, C; Thoennessen, M

    2012-01-01

    Currently, 31 actinium, 31 thorium, 28 protactinium, and 23 uranium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  5. Separation of Actinium 227 from the uranium minerals

    The purpose of this work was to separate Actinium 227, whose content is 18%, from the mineral carnotite found in Gomez Chihuahua mountain range in Mexico. The mineral before processing is is pre-concentrated and passed, first through anionic exchange resins, later the eluate obtained is passed through cationic resins. The resins were 20-50 MESH QOWEX and 100-200 MESH 50 X 8-20 in some cased 200-400 MESH AG 50W-X8, 1X8 in other cases. The eluates from the ionic exchange were electrodeposited on stainless steel polished disc cathode and platinum electrode as anode; under a current ODF 10mA for 2.5 to 5 hours and of 100mA for .5 of an hour. it was possible to identify the Actinium 227 by means of its descendents, TH-227 and RA-223, through alpha spectroscopy. Due to the radiochemical purity which the electro deposits were obtained the Actinium 227 was low and was not quantitatively determined. A large majority of the members of the natural radioactive series 3 were identified and even alpha energies reported in the literature with very low percentages of non-identified emissions were observed. We conclude that a more precise study is needed concerning ionic exchange and electrodeposit to obtain an Actinium 227 of radiochemical purity. (Author)

  6. Spectroscopic and computational investigation of actinium coordination chemistry.

    Ferrier, Maryline G; Batista, Enrique R; Berg, John M; Birnbaum, Eva R; Cross, Justin N; Engle, Jonathan W; La Pierre, Henry S; Kozimor, Stosh A; Lezama Pacheco, Juan S; Stein, Benjamin W; Stieber, S Chantal E; Wilson, Justin J

    2016-01-01

    Actinium-225 is a promising isotope for targeted-α therapy. Unfortunately, progress in developing chelators for medicinal applications has been hindered by a limited understanding of actinium chemistry. This knowledge gap is primarily associated with handling actinium, as it is highly radioactive and in short supply. Hence, Ac(III) reactivity is often inferred from the lanthanides and minor actinides (that is, Am, Cm), with limited success. Here we overcome these challenges and characterize actinium in HCl solutions using X-ray absorption spectroscopy and molecular dynamics density functional theory. The Ac-Cl and Ac-OH2O distances are measured to be 2.95(3) and 2.59(3) Å, respectively. The X-ray absorption spectroscopy comparisons between Ac(III) and Am(III) in HCl solutions indicate Ac(III) coordinates more inner-sphere Cl(1-) ligands (3.2±1.1) than Am(III) (0.8±0.3). These results imply diverse reactivity for the +3 actinides and highlight the unexpected and unique Ac(III) chemical behaviour. PMID:27531582

  7. CGD 218 COURSE TUTORIAL/ snaptutorial

    mounish

    2015-01-01

    For more classes visit www.snaptutorial.com CGD 218 Week 1 Assignment Why is Visual Literacy Important CGD 218 Week 1 Journal The Evolution of Media   CGD 218 Week 1 DQ 1 Using Visuals to Communicate   CGD 218 Week 2 Assignment Final Project - Step Two   CGD 218 Week 2 DQ 1 Typography in Business   CGD 218 Week 2 DQ 2 Bauhaus Manifesto   CGD 218 Week 3 Assignment Using Photographs from the Web   CGD 218 ...

  8. CGD 218 ASH Course Tutorial / cgd218dotcom

    vasanthi05

    2015-01-01

    CGD 218 Entire Course For more course tutorials visit www.cgd218.com   CGD 218 Week 1 Assignment Why is Visual Literacy Important CGD 218 Week 1 Journal The Evolution of Media CGD 218 Week 1 DQ 1 Using Visuals to Communicate CGD 218 Week 2 Assignment Final Project - Step Two CGD 218 Week 2 DQ 1 Typography in Business CGD 218 Week 2 DQ 2 Bauhaus Manifesto CGD 218 Week 3 Assignment Using Photographs from the Web CGD 218 Week 3 Journal Visual Comm...

  9. Production of high-purity radium-223 from legacy actinium-beryllium neutron sources.

    Soderquist, Chuck Z; McNamara, Bruce K; Fisher, Darrell R

    2012-07-01

    Radium-223 is a short-lived alpha-particle-emitting radionuclide with potential applications in cancer treatment. Research to develop new radiopharmaceuticals employing (223)Ra has been hindered by poor availability due to the small quantities of parent actinium-227 available world-wide. The purpose of this study was to develop innovative and cost-effective methods to obtain high-purity (223)Ra from (227)Ac. We obtained (227)Ac from two surplus actinium-beryllium neutron generators. We retrieved the actinium/beryllium buttons from the sources and dissolved them in a sulfuric-nitric acid solution. A crude actinium solid was recovered from the solution by coprecipitation with thorium fluoride, leaving beryllium in solution. The crude actinium was purified to provide about 40 milligrams of actinium nitrate using anion exchange in methanol-water-nitric acid solution. The purified actinium was then used to generate high-purity (223)Ra. We extracted (223)Ra using anion exchange in a methanol-water-nitric acid solution. After the radium was separated, actinium and thorium were then eluted from the column and dried for interim storage. This single-pass separation produces high purity, carrier-free (223)Ra product, and does not disturb the (227)Ac/(227)Th equilibrium. A high purity, carrier-free (227)Th was also obtained from the actinium using a similar anion exchange in nitric acid. These methods enable efficient production of (223)Ra for research and new alpha-emitter radiopharmaceutical development. PMID:22697483

  10. 49 CFR 571.218 - Standard No. 218; Motorcycle helmets.

    2010-10-01

    ... 49 Transportation 6 2010-10-01 2010-10-01 false Standard No. 218; Motorcycle helmets. 571.218 Section 571.218 Transportation Other Regulations Relating to Transportation (Continued) NATIONAL HIGHWAY... Motor Vehicle Safety Standards § 571.218 Standard No. 218; Motorcycle helmets. S1. Scope. This...

  11. Radium, thorium, and actinium extraction from seawater using an improved manganese-oxide-coated fiber

    Laboratory experiments were conducted to determine the efficiency with which improved manganese-oxide-coated acrylic fibers extract radium, thorium, and actinium from seawater. Tests were made using surface seawater spiked with 227Ac, 227Th and 223Ra. For sample volumes of approximately 30 liters and flow rates up to 0.5 liters per minute, radium and actinium are removed quantitatively. Approximately 80-95% of the thorium is removed under these same conditions. (Auth.)

  12. CGD 218 ash course tutorial / uophelp

    uophelp

    2015-01-01

    For more course tutorials visit www.uophelp.com CGD 218 Week 1 Assignment Why is Visual Literacy Important CGD 218 Week 1 Journal The Evolution of Media   CGD 218 Week 1 DQ 1 Using Visuals to Communicate   CGD 218 Week 2 Assignment Final Project - Step Two   CGD 218 Week 2 DQ 1 Typography in Business   CGD 218 Week 2 DQ 2 Bauhaus Manifesto   CGD 218 Week 3 Assignment Using Photographs from the Web   CGD ...

  13. CGD 218 ASH COURSES TUTORIAL/UOPHELP

    BROADY

    2015-01-01

    For more course tutorials visit www.uophelp.com       CGD 218 Week 1 Assignment Why is Visual Literacy Important CGD 218 Week 1 Journal The Evolution of Media   CGD 218 Week 1 DQ 1 Using Visuals to Communicate   CGD 218 Week 2 Assignment Final Project - Step Two   CGD 218 Week 2 DQ 1 Typography in Business   CGD 218 Week 2 DQ 2 Bauhaus Manifesto   CGD 218 Week 3 Assignment Using Photographs...

  14. Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232

    Harvey, James T.; Nolen, Jerry; Vandergrift, George; Gomes, Itacil; Kroc, Tom; Horwitz, Phil; McAlister, Dan; Bowers, Del; Sullivan, Vivian; Greene, John

    2011-12-30

    The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces {approx}100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 Ge

  15. Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232

    The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces ∼100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 GeV protons

  16. CGD 218 UOP Course Tutorial/ Tutorialrank

    SICEN

    2015-01-01

                      For more course tutorials visit www.tutorialrank.com Tutorial Purchased: 4 Times, Rating: A+     CGD 218 Week 1 Assignment Why is Visual Literacy Important CGD 218 Week 1 Journal The Evolution of Media CGD 218 Week 1 DQ 1 Using Visuals to Communicate CGD 218 Week 2 Assignment Final Project - Step Two CGD 218 Week 2 DQ 1 Typography in Business CGD 218 Week 2 DQ 2 Bauhaus Manife...

  17. Neutron-Induced Fission of Actinium-227, Protactinium-231 and Neptunium-237: Mass Distribution

    Results of radiochemical studies on the mass distribution in the neutron-induced fission of actinium-227, protactinium-231 and neptunium-237 have been presented. This work has been carried out as part of a programme to determine the mass distribution in the fission of heavy elements as a function of Z and A. All irradiations have been carried out in the core of the swimming-pool type reactor APSARA with cadmium shielding wherever necessary. Relative yields of several fission product nuclides have been obtained by a method involving a comparison of the fission product activities from the respective targets with those formed from uranium-235 simultaneously irradiated. Thermal-neutron fission yields of uranium-235 have been assumed. These results indicate a predominantly asymmetric mass distribution in all the three cases, and also a distinct though small symmetric peak in the case of actinium-227. (author)

  18. A new method for the determination of low-level actinium-227 in geological samples

    We developed a new method for the determination of 227Ac in geological samples. The method uses extraction chromatographic techniques and alpha-spectrometry and is applicable for a range of natural matrices. Here we report on the procedure and results of the analysis of water (fresh and seawater) and rock samples. Water samples were acidified and rock samples underwent total dissolution via acid leaching. A DGA (N,N,N',N'-tetra-n-octyldiglycolamide) extraction chromatographic column was used for the separation of actinium. The actinium fraction was prepared for alpha spectrometric measurement via cerium fluoride micro-precipitation. Recoveries of actinium in water samples were 80 ± 8 % (number of analyses n = 14) and in rock samples 70 ± 12 % (n = 30). The minimum detectable activities (MDA) were 0.017-0.5 Bq kg-1 for both matrices. Rock sample 227Ac activities ranged from 0.17 to 8.3 Bq kg-1 and water sample activities ranged from below MDA values to 14 Bq kg-1of 227Ac. From the analysis of several standard rock and water samples with the method we found very good agreement between our results and certified values. (author)

  19. 36 CFR 218.6 - Reviewing officer.

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Reviewing officer. 218.6 Section 218.6 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE PREDECISIONAL... Authorized by the Healthy Forests Restoration Act of 2003 § 218.6 Reviewing officer. The reviewing...

  20. 49 CFR 218.9 - Civil penalty.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Civil penalty. 218.9 Section 218.9 Transportation... TRANSPORTATION RAILROAD OPERATING PRACTICES General § 218.9 Civil penalty. Any person (an entity of any type... requirement of this part or causes the violation of any such requirement is subject to a civil penalty of...

  1. 49 CFR 218.35 - Yard limits.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Yard limits. 218.35 Section 218.35 Transportation... TRANSPORTATION RAILROAD OPERATING PRACTICES Protection of Trains and Locomotives § 218.35 Yard limits. (a) After August 1, 1977, yard limits must be designated by— (1) Yard limit signs, and (2) Timetable, train...

  2. 42 CFR 438.218 - Enrollee information.

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Enrollee information. 438.218 Section 438.218 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES... and Operation Standards § 438.218 Enrollee information. The requirements that States must meet...

  3. 36 CFR 21.8 - Employee certification.

    2010-07-01

    ... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Employee certification. 21.8 Section 21.8 Parks, Forests, and Public Property NATIONAL PARK SERVICE, DEPARTMENT OF THE INTERIOR HOT SPRINGS NATIONAL PARK; BATHHOUSE REGULATIONS § 21.8 Employee certification. (a) Employees engaged...

  4. 22 CFR 218.33 - Mediation.

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Mediation. 218.33 Section 218.33 Foreign... § 218.33 Mediation. (a) Referral of complaints for mediation. The agency will refer to the Federal Mediation and Conciliation Service all complaints that: (1) fall within the jurisdiction of...

  5. 27 CFR 24.218 - Other wine.

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Other wine. 24.218 Section 24.218 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Production of Other Than Standard Wine § 24.218 Other wine. (a) General. Other than standard wine not included in...

  6. Analysis of the gamma spectra of the uranium, actinium, and thorium decay series

    Momeni, M.H.

    1981-09-01

    This report describes the identification of radionuclides in the uranium, actinium, and thorium series by analysis of gamma spectra in the energy range of 40 to 1400 keV. Energies and absolute efficiencies for each gamma line were measured by means of a high-resolution germanium detector and compared with those in the literature. A gamma spectroscopy method, which utilizes an on-line computer for deconvolution of spectra, search and identification of each line, and estimation of activity for each radionuclide, was used to analyze soil and uranium tailings, and ore.

  7. Analysis of the gamma spectra of the uranium, actinium, and thorium decay series

    This report describes the identification of radionuclides in the uranium, actinium, and thorium series by analysis of gamma spectra in the energy range of 40 to 1400 keV. Energies and absolute efficiencies for each gamma line were measured by means of a high-resolution germanium detector and compared with those in the literature. A gamma spectroscopy method, which utilizes an on-line computer for deconvolution of spectra, search and identification of each line, and estimation of activity for each radionuclide, was used to analyze soil and uranium tailings, and ore

  8. Dicty_cDB: SLA218 [Dicty_cDB

    Full Text Available SL (Link to library) SLA218 (Link to dictyBase) - - - Contig-U16455-1 SLA218Z (Link... to Original site) - - SLA218Z 592 - - - - Show SLA218 Library SL (Link to library) Clone ID SLA218 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLA2-A/SLA218Q.Seq.d/ Representative seq. ID SLA21...8Z (Link to Original site) Representative DNA sequence >SLA218 (SLA218Q) /CSM/SL/SLA2-A/SLA218Q.Seq.d/ XXXXX...TAATAATTTT AA sequence update 1997. 5. 7 Translated Amino Acid sequence ---LSTEVKSVEMHHEQLPEARPGDNVGFNVKNVSV

  9. Neutralization kinetics for polonium-218

    In a well-defined experimental system the neutralization of polonium-218 ions was investigated as a function of the physical and chemical properties of the controlled composition atmosphere. The diffusion coefficient of polonium-218 under various concentrations of trace gas NO2 in nitrogen was measured. The mobilities of Po+ and PoO2+ are determined by combining experimental results with a computer model of the system. Three neutralization mechanisms were individually studied. The small-ion recombination rate has been found to be proportional to the square root of radon concentration. The electron-scavenging mechanism is responsible for the neutralization of Po+ in NO2 or H2O in nitrogen. When PoO2+ is formed, the electron-transfer mechanism dominates the neutralization process. The electron is transferred to PoO2+ from molecules with lower ionization potentials. The ionization molecules with lower ionization potentials. The ionization potential of PoO2+ is also determined to be 10.44 +/- 0.05 eV

  10. 22 CFR 218.11 - Standards.

    2010-04-01

    ... prohibited are set out in part 90 (primarily subpart B) of 45 CFR. ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Standards. 218.11 Section 218.11 Foreign... ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Standards for Determining Age Discrimination §...

  11. 10 CFR 218.32 - Review.

    2010-01-01

    ... requirements stated in 10 CFR 205.9 in addition to the requirements stated in this section. (2) If the... documents submitted under this subpart, the procedures set out in 10 CFR 205.9(f) shall apply. (c) When to... 10 Energy 3 2010-01-01 2010-01-01 false Review. 218.32 Section 218.32 Energy DEPARTMENT OF...

  12. 9 CFR 381.218 - Criminal offenses.

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Criminal offenses. 381.218 Section 381... CERTIFICATION POULTRY PRODUCTS INSPECTION REGULATIONS Detention; Seizure and Condemnation; Criminal Offenses § 381.218 Criminal offenses. The Act contains criminal provisions with respect to numerous...

  13. In-source laser spectroscopy developments at TRILIS—towards spectroscopy on actinium and scandium

    Resonance Ionization Laser Ion Sources (RILIS) have become a versatile tool for production and study of exotic nuclides at Isotope Separator On-Line (ISOL) facilities such as ISAC at TRIUMF. The recent development and addition of a grating tuned spectroscopy laser to the TRIUMF RILIS solid state laser system allows for wide range spectral scans to investigate atomic structures on short lived isotopes, e.g., those from the element actinium, produced in uranium targets at ISAC. In addition, development of new and improved laser ionization schemes for rare isotope production at ISAC is ongoing. Here spectroscopic studies on bound states, Rydberg states and autoionizing (AI) resonances on scandium using the existing off-line capabilities are reported. These results allowed to identify a suitable ionization scheme for scandium via excitation into an autoionizing state at 58,104 cm − 1 which has subsequently been used for ionization of on-line produced exotic scandium isotopes.

  14. CGD 218 ASHFORD Course Tutorial/TutorialRank

    makenz

    2015-01-01

    For more course tutorials visit www.tutorialrank.com Tutorial Purchased: 4 Times, Rating: A+   CGD 218 Week 1 Assignment Why is Visual Literacy Important CGD 218 Week 1 Journal The Evolution of Media CGD 218 Week 1 DQ 1 Using Visuals to Communicate CGD 218 Week 2 Assignment Final Project - Step Two CGD 218 Week 2 DQ 1 Typography in Business CGD 218 Week 2 DQ 2 Bauhaus Manifesto CGD 218 Week 3 Assignment Using Photographs from the Web CGD 218 We...

  15. Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL

    Raeder, S.; Bastin, B.; Block, M.; Creemers, P.; Delahaye, P.; Ferrer, R.; Fléchard, X.; Franchoo, S.; Ghys, L.; Gaffney, L. P.; Granados, C.; Heinke, R.; Hijazi, L.; Huyse, M.; Kron, T.; Kudryavtsev, Yu.; Laatiaoui, M.; Lecesne, N.; Luton, F.; Moore, I. D.; Martinez, Y.; Mogilevskiy, E.; Naubereit, P.; Piot, J.; Rothe, S.; Savajols, H.; Sels, S.; Sonnenschein, V.; Traykov, E.; Van Beveren, C.; Van den Bergh, P.; Van Duppen, P.; Wendt, K.; Zadvornaya, A.

    2016-06-01

    To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.

  16. 49 CFR 218.22 - Utility employee.

    2010-10-01

    ..., DEPARTMENT OF TRANSPORTATION RAILROAD OPERATING PRACTICES Blue Signal Protection of Workers § 218.22 Utility... uncouple air hoses and other electrical or mechanical connections; prepare rail cars for coupling; set... railroad rolling equipment must be provided with blue signal protection in accordance with §§...

  17. 49 CFR 218.80 - Movement of occupied camp cars.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Movement of occupied camp cars. 218.80 Section 218... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD OPERATING PRACTICES Protection of Occupied Camp Cars § 218.80 Movement of occupied camp cars. Occupied cars may not be humped or flat switched unless coupled...

  18. 32 CFR 724.218 - Limitation-Continuance and Postponements.

    2010-07-01

    ... 32 National Defense 5 2010-07-01 2010-07-01 false Limitation-Continuance and Postponements. 724.218 Section 724.218 National Defense Department of Defense (Continued) DEPARTMENT OF THE NAVY PERSONNEL NAVAL DISCHARGE REVIEW BOARD Authority/Policy for Departmental Discharge Review § 724.218 Limitation—Continuance and Postponements. (a)...

  19. 14 CFR 21.8 - Approval of articles.

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Approval of articles. 21.8 Section 21.8 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION AIRCRAFT CERTIFICATION PROCEDURES FOR PRODUCTS AND PARTS General § 21.8 Approval of articles. If an article is required to...

  20. 5 CFR 179.218 - Additional administrative collection action.

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Additional administrative collection action. 179.218 Section 179.218 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS CLAIMS COLLECTION STANDARDS Salary Offset § 179.218 Additional administrative collection...

  1. 7 CFR 2.18 - Under Secretary for Food Safety.

    2010-01-01

    ..., pesticide, and environmental contaminants in food products as covered by the Federal Insecticide, Fungicide... 7 Agriculture 1 2010-01-01 2010-01-01 false Under Secretary for Food Safety. 2.18 Section 2.18... Secretaries and Assistant Secretaries § 2.18 Under Secretary for Food Safety. (a) The following delegations...

  2. 30 CFR 218.201 - Method of payment.

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Method of payment. 218.201 Section 218.201... Method of payment. You must tender all payments in accordance with § 218.51, except as follows: (a) For... and your customer document identification numbers on your payment document, rather than...

  3. 30 CFR 218.301 - Method of payment.

    2010-07-01

    ... Method of payment. The payor shall tender all payments in accordance with 30 CFR 218.51. ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Method of payment. 218.301 Section 218.301 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE...

  4. Yeast Interacting Proteins Database: YJL218W, YJL218W [Yeast Interacting Proteins Database

    Full Text Available YJL218W - Putative pro tein o f unkno wn functio n, similar to ... bacterial galacto side O -acetyltransfe ... rases; induced by o leate in an O AF1/PIP2-dependent manner; pro mo ter co ... ntains an o leate respo nse element co nsensus sequence; no n-esse ... ntial gene Ro ws with this bait as bait (1) Ro ws with this bait a ... s prey (3) YJL218W - Putative pro tein o f unkno wn functio n, similar to ... bacterial gala ...

  5. Factor Analysis Applied the VFY-218 RCS Data

    Woo, Alex; Chancellor, Marisa K. (Technical Monitor)

    1997-01-01

    Present statistical factor analysis of computer simulations and measurement data for the VFY-218 configuration. Factor analysis try to quantify the statistical grouping of measurements and simulations.

  6. Kinetics of neutralization of Po-218

    In a well-defined experimental system the neutralization of polonium-218 ions was investigated as a function of the physical and chemical properties of the controlled composition atmosphere. The mobilities of Po+ and PoO2+ are determined by combining experimental results with a computer model of the system. Three neutralization mechanisms were individually studied. The small ion recombination rate has been found to be proportional to the square root of radon concentration. The electron scavenging mechanism is responsible for the neutralization of Po+ in NO2 or H2O in nitrogen. When PoO2+ is formed, the electron transfer mechanism dominates the neutralization process. The electron is transferred to PoO2+ from molecules with lower ionization potentials. The ionization potential of PoO2+ is also determined to be 10.44 +/- 0.05 eV

  7. 36 CFR 218.10 - Objection time periods and process.

    2010-07-01

    ... process. 218.10 Section 218.10 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE PREDECISIONAL ADMINISTRATIVE REVIEW PROCESSES Predecisional Administrative Review Process for... Objection time periods and process. (a) Time to file an objection. Written objections, including...

  8. Dicty_cDB: VFN218 [Dicty_cDB

    Full Text Available VF (Link to library) VFN218 (Link to dictyBase) - - - Contig-U13884-1 VFN218P (Link to Original ... AHHQGDKKAGLNMRDGCIGNAEELGVIESFKVKQQVLVSAHEAAERS*el mis *ellqdrevifnikk Translated Amino Acid sequence (All ... AHHQGDKKAGLNMRDGCIGNAEELGVIESFKVKQQVLVSAHEAAERS*el mis *ellqdrevifnikk Frame C: iilyi*qcqvn*lqyqf*vkmplkke ...

  9. 29 CFR 825.218 - Substantial and grievous economic injury.

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Substantial and grievous economic injury. 825.218 Section... Medical Leave Act § 825.218 Substantial and grievous economic injury. (a) In order to deny restoration to... cause “substantial and grievous economic injury” to the operations of the employer, not whether...

  10. 49 CFR 173.218 - Fish meal or fish scrap.

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Fish meal or fish scrap. 173.218 Section 173.218... Fish meal or fish scrap. (a) Except as provided in Column (7) of the HMT in § 172.101 of this subchapter, fish meal or fish scrap, containing at least 6%, but not more than 12% water, is authorized...

  11. Dicty_cDB: CHC218 [Dicty_cDB

    Full Text Available CH (Link to library) CHC218 (Link to dictyBase) - - - Contig-U16243-1 CHC218P (Link to Original ... o... 365 0.0 X75329_1( X75329 |pid:none) M.indica (Manila ) THMF5 mRNA for 3-ket... 215 e-102 AM474896_9( AM4 ...

  12. 30 CFR 218.155 - Method of payment.

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Method of payment. 218.155 Section 218.155....155 Method of payment. (a) Payment of royalties and rentals. With the exception of first-year rental... notice of each lease offering. EFT may be used as a method of payment for the one-fifth bonus bid...

  13. 50 CFR 218.184 - Requirements for monitoring and reporting.

    2010-10-01

    ... Surface Warfare Center Panama City Division § 218.184 Requirements for monitoring and reporting. (a) The... course/speed, floating on surface and not swimming, etc.); and (xv) An evaluation of the effectiveness...

  14. Snail-Killing Effects of Streptomyces 218 Powder

    V.O. Aina

    2012-12-01

    Full Text Available This study is aimed at finding out the snail-killing effects of Streptomyces 218 powder on Oncomelania hupensis snails which are the vectors or intermediate host of Schiltosoma Japonicum (intestinal schistosomiasis in china the tests were carried out in the laboratory and on the field. The snail-killing effects of Streptomyces218 powder, isolated from snail habitat at Anchang Village of Anxiang country in China was tested using the immersion and spraying methods. The tests on the Oncomelania hupensis snails which are intermediate host of Streptomyces japonicum infection were carried out in the laboratory and in the field. The mean corrected snail mortalities of the immersion technique in the laboratory were 81.70 and 98.63% in 10 ppm of 218 solutions after 24 and 48 h, respectively. The mean corrected snail mortalities of the spraying tests in the laboratory were 82.90 and 87.90% at 3 and 5 days, respectively with 10 g/m2 218 powders. The snail-killing ability of 218 powders on the field determines by immersion and spraying methods were comparable to that of the chemical molluscicide-Niclosamide. The corrected snail mortality at 150 ppm of 218 powder (g/m2 and at 2 ppm of Niclosamide by immersion was 100% at the second time test after 24, 48 and 72 h. In the field spraying test, the mean corrected snail mortality at 100 ppm of 218 powders were 61.96 and 70.00% after 3 and 7 days of spraying respectively. At 2 ppm niclosamide, this was found to be 65.58 and 63.81%, respectively. The effective ingredients for the snail-killing are found to be located in the spore chains. Streptomyces 218 powder, although at higher concentrations, seems to be a promising mollusciciding biological agent. If developed further, this could compliment existing mollusciciding agents.

  15. Snail-Killing Effects of Streptomyces 218 Powder

    V.O. Aina; A.A.J. Adewumi; C.O. Yao; M.Z. Shi; Hu, D. Y.; W.H. Chai

    2012-01-01

    This study is aimed at finding out the snail-killing effects of Streptomyces 218 powder on Oncomelania hupensis snails which are the vectors or intermediate host of Schiltosoma Japonicum (intestinal schistosomiasis) in china the tests were carried out in the laboratory and on the field. The snail-killing effects of Streptomyces218 powder, isolated from snail habitat at Anchang Village of Anxiang country in China was tested using the immersion and spraying methods. The tests on the Oncomelania...

  16. Groundwater seepage from the Ranger uranium mine tailings dam: radioisotopes of radium, thorium and actinium. Supervising Scientist report 106

    Monitoring of bores near the Ranger uranium mine tailings dam has revealed deterioration in water quality in several bores since 1983. In a group of bores to the north of the dam, increases have been observed of up to 500 times for sulphate concentrations and of up to 5 times for 226Ra concentrations. Results are presented here of measurements of members of the uranium, thorium and actinium decay series in borewater samples collected between 1985 and 1993. In particular, measurements of all four naturally-occurring radium isotopes have been used in an investigation of the mechanism of radium concentration changes. For the most seepage-affected bores the major findings of the study include: 228Ra/226Ra 223Ra /226Ra and 224Ra/228Ra ratios all increased over the course of the study; barium concentrations show high seasonal variability, being lower in November than May, but strontium concentrations show a steady increase with time. Calculations show that the groundwater is probably saturated with respect to barite but not with respect to celestite or anglesite; sulphide concentrations are low in comparison with sulphate, and are higher in November than in May; and 227Ac concentrations have increased with time, but do not account for the high 223Ra/226Ra ratios. It is concluded on the basis of these observations that increases in Ra isotope concentrations observed in a number of seepage-affected bores arise from increases in salinity leading to desorption of radium from adsorption sites in the vicinity of the bore rather by direct transport of radium from the tailings. Increased salinity is also causing the observed increases in 227Ac and strontium concentrations, while formation of a barite solid phase in the groundwater is causing the removal of some radium from solution. This is the cause of the increasing radium isotope ratios noted above

  17. 18 CFR 157.218 - Changes in customer name.

    2010-04-01

    ... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Changes in customer... Act for Certain Transactions and Abandonment § 157.218 Changes in customer name. (a) Automatic... reflect the change in the name of an existing customer, if the certificate holder has filed any...

  18. MiR-218 Mediates tumorigenesis and metastasis: Perspectives and implications

    Lu, Ying-fei [Institute Guangzhou of Advanced Technology, Chinese Academy of Sciences, Guangzhou (China); Department of Orthopaedics & Traumatology, The Chinese University of Hong Kong, Prince of Wales Hospital, Shatin, Hong Kong (China); Zhang, Li [School of Biomedical Sciences, Faculty of Medicine, The Chinese University of Hong Kong, Hong Kong (China); Department of Anatomical and Cellular Pathology, State Key Laboratory of Oncology in South China, Prince of Wales Hospital, The Chinese University of Hong Kong, Hong Kong (China); Waye, Mary Miu Yee [School of Biomedical Sciences, Faculty of Medicine, The Chinese University of Hong Kong, Hong Kong (China); Fu, Wei-ming, E-mail: wm.fu@giat.ac.cn [Institute Guangzhou of Advanced Technology, Chinese Academy of Sciences, Guangzhou (China); School of Biomedical Sciences, Faculty of Medicine, The Chinese University of Hong Kong, Hong Kong (China); Zhang, Jin-fang, E-mail: zhangjf06@cuhk.edu.hk [Department of Orthopaedics & Traumatology, The Chinese University of Hong Kong, Prince of Wales Hospital, Shatin, Hong Kong (China); School of Biomedical Sciences, Faculty of Medicine, The Chinese University of Hong Kong, Hong Kong (China); Shenzhen Research Institute, The Chinese University of Hong Kong, Shenzhen (China)

    2015-05-15

    MicroRNAs (miRNAs) are a class of small non-coding RNAs that negatively regulate gene expression at the post-transcriptional level. As a highly conserved miRNA across a variety of species, microRNA-218 (miR-218) was found to play pivotal roles in tumorigenesis and progression. A group of evidence has demonstrated that miR-218 acts as a tumor suppressor by targeting many oncogenes related to proliferation, apoptosis and invasion. In this review, we provide a complex overview of miR-218, including its regulatory mechanisms, known functions in cancer and future challenges as a potential therapeutic target in human cancers. - Highlights: • miR-218 is frequently down regulated in multiple cancers. • miR-218 plays pivotal roles in carcinogenesis. • miR-218 mediates proliferation, apoptosis, metastasis, invasion, etc. • miR-218 mediates tumorigenesis and metastasis via multiple pathways.

  19. MiR-218 Mediates tumorigenesis and metastasis: Perspectives and implications

    MicroRNAs (miRNAs) are a class of small non-coding RNAs that negatively regulate gene expression at the post-transcriptional level. As a highly conserved miRNA across a variety of species, microRNA-218 (miR-218) was found to play pivotal roles in tumorigenesis and progression. A group of evidence has demonstrated that miR-218 acts as a tumor suppressor by targeting many oncogenes related to proliferation, apoptosis and invasion. In this review, we provide a complex overview of miR-218, including its regulatory mechanisms, known functions in cancer and future challenges as a potential therapeutic target in human cancers. - Highlights: • miR-218 is frequently down regulated in multiple cancers. • miR-218 plays pivotal roles in carcinogenesis. • miR-218 mediates proliferation, apoptosis, metastasis, invasion, etc. • miR-218 mediates tumorigenesis and metastasis via multiple pathways

  20. 49 CFR 218.75 - Methods of protection for camp cars.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Methods of protection for camp cars. 218.75... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD OPERATING PRACTICES Protection of Occupied Camp Cars § 218.75 Methods of protection for camp cars. When camp cars requiring protection are on either main...

  1. 20 CFR 218.43 - When a surviving divorced spouse annuity ends.

    2010-04-01

    ... surviving divorced spouse attains full retirement age (the disability annuitant then becomes entitled based... the month in which the surviving divorced spouse attains full retirement age (the annuitant then.... 218.43 Section 218.43 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE...

  2. Reduced miRNA-218 expression in pancreatic cancer patients as a predictor of poor prognosis.

    Li, B-S; Liu, H; Yang, W-L

    2015-01-01

    microRNA-218 (miR-218) is a vertebrate-specific miRNA that plays a crucial role in tumorigenesis and tumor progression. This study analyzed the miR-218 expression level and clinical significance in pancreatic cancer. One hundred and seven pairs of pancreatic cancer and adjacent normal tissues were analyzed by quantitative reverse-transcriptase polymerase chain reaction. The correlation between miR-218 expression and clinicopathological characters was determined by the two-sample Student t-test. The survival correlations were analyzed by the Kaplan-Meier method and Cox proportional hazards model. The relative expression of miR-218 in pancreatic cancer tissues (2.63 ± 1.59) was significantly lower than that in matched noncancerous pancreatic tissues (6.52 ± 2.50, P level of miR-218 expression was significantly correlated with the shorter overall survival time of pancreatic cancer patients (5-year overall survival rate: 7.5 vs 34.9%; log-rank test: P level of miR-218 expression was an independent predictor of poor prognosis in pancreatic cancer patients (Hazard ratio: 7.24; 95% confidence interval: 2.01-18.28; P = 0.007). Our findings suggested a significant downregulation in the expression of miR-218; this might have considerable potential value in the prognosis for pancreatic cancer. PMID:26662432

  3. 15 CFR 280.218 - Decision of the administrative law judge.

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Decision of the administrative law judge. 280.218 Section 280.218 Commerce and Foreign Trade Regulations Relating to Commerce and Foreign Trade NATIONAL INSTITUTE OF STANDARDS AND TECHNOLOGY, DEPARTMENT OF COMMERCE ACCREDITATION...

  4. A theoretical approach to the study of saturation phenomena of electrostatic collection efficiency of 218Po

    Radon monitors based on electrostatic collection have been widely used in different radon studies. Collection efficiency of this kind of instrument first depends on the cell geometry and electrostatic field intensity. In the process of new instrument development, some researchers found that electrostatic collection efficiency of 218Po was almost saturated when the voltage between the cylindrical vessel and the detector was higher than 1500 V. In this paper, we analyze the physical processes of the freshly positively charged 218Po formed from the α decay of 222Rn and the neutralization kinetics for positively charged 218Po cluster. The analytical expressions of the collection probability of any freshly positively charged 218Po cluster and the total collection efficiency in electrostatic collection cell are obtained. The ratio of the relative growth rate of the collection efficiency to the relative growth rate of the voltage is inversely proportional to the voltage. Such an approach is useful to understand the mechanism of the electrostatic collection of 218Po. - Highlights: • Expression for collection probability of positively charged 218Po has been obtained. • Expression for total collection efficiency of 218Po has been obtained. • The mechanism of electrostatic collection efficiency of 218Po has been explained

  5. 14 CFR 417.218 - Hold-and-resume gate analysis.

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Hold-and-resume gate analysis. 417.218..., DEPARTMENT OF TRANSPORTATION LICENSING LAUNCH SAFETY Flight Safety Analysis § 417.218 Hold-and-resume gate... analysis must construct a hold-and-resume gate for each populated or otherwise protected area. After...

  6. microRNA-218 Inhibits Oxygen-induced Retinal Neovascularization via Reducing the Expression of Roundabout 1

    Shuang Han

    2016-01-01

    Conclusions: Our experiments showed that restoration of miR-218 inhibited retinal angiogenesis via targeting Robo1. MiR-218 contributed to the inhibition of retinal angiogenesis and miR-218 might be a new therapeutic target for preventing RNV.

  7. miR-218 Involvement in Cardiomyocyte Hypertrophy Is Likely through Targeting REST

    Jing-Jing Liu; Cui-Mei Zhao; Zhi-Gang Li; Yu-Mei Wang; Wei Miao; Xiu-Juan Wu; Wen-Jing Wang; Chang Liu; Duo Wang; Kang Wang; Li Li; Lu-Ying Peng

    2016-01-01

    MicroRNAs (miRNAs) have been identified as key players in cardiomyocyte hypertrophy, which is associated with significant risks of heart failure. However, many microRNAs are still not recognized for their functions in pathophysiological processes. In this study, we evaluated effects of miR-218 in cardiomyocyte hypertrophy using both in vitro and in vivo models. We found that miR-218 was evidently downregulated in a transverse aortic constriction (TAC) mouse model. Overexpression of miR-218 is...

  8. Report on sampling and analysis of air at trenches 218-W-4C and218-W-5 {number_sign}31 of the low level burial grounds

    Stauffer, M.

    1997-10-06

    This report presents analytical results of air samples collected from trenches at the Low Level Burial Grounds. The samples were collected with SUMMA canisters and were analyzed by gas chromatography-mass spectrometry using a modified EPA TO-14 procedure. The data suggest that the vent pipes of the 218-W-4C trenches had elevated concentrations of volatile organic compounds. The ambient air samples collected at the 218-W-5 {number_sign}31 facility, an open trench that does not contain any waste at this time, did not show any target compounds above the method detection limit.

  9. microRNA-218 inhibits prostate cancer cell growth and promotes apoptosis by repressing TPD52 expression

    Highlights: • miR-218 expression is downregulated in prostate cancer. • miR-218 inhibits prostate tumor cells proliferation partially through promoting apoptosis. • miR-218 targets TPD52 by binding to its 3′-UTR. • miR-218 suppresses prostate cancer cell growth through inhibiting TPD52 expression. - Abstract: The tumor protein D52 (TPD52) is an oncogene overexpressed in prostate cancer (PC) due to gene amplification. Although the oncogenic effect of TPD52 is well recognized, how its expression is regulated is still not clear. This study tried to explore the regulative role of miR-218, a tumor suppressing miRNA on TPD52 expression and prostate cancer cell proliferation. We found the expression of miR-218 was significantly lower in PC specimens. Based on gain and loss of function analysis, we found miR-218 significantly inhibit cancer cell proliferation by inducing apoptosis. These results strongly suggest that miR-218 plays a tumor suppressor role in PC cells. In addition, our data firstly demonstrated that miR-218 directly regulates oncogenic TPD52 in PC3 cells and the miR-218-TPD52 axis can regulate growth of this prostate cancer cell line. Knockdown of TPD52 resulted in significantly increased cancer cell apoptosis. Clearly understanding of oncogenic TPD52 pathways regulated by miR-218 might be helpful to reveal new therapeutic targets for PC

  10. 23 CFR 646.218 - Simplified procedure for accelerating grade crossing improvements.

    2010-04-01

    ... ENGINEERING AND TRAFFIC OPERATIONS RAILROADS Railroad-Highway Projects § 646.218 Simplified procedure for... preliminary engineering costs may include those incurred in selecting crossings to be improved,...

  11. PET radiochemistry: synthesis of 2-[18 F]-fluorine-2-deoxy-D-glucose

    The present work describes the method for the synthesis of the 2-[18F]-fluorine-2-deoxy-D-glucose, the radiopharmaceutical of more use in nuclear medicine for the diagnosis of cancer at world level. (Author)

  12. MiR-218 inhibits invasion and metastasis of gastric cancer by targeting the Robo1 receptor.

    Jun Tie

    2010-03-01

    Full Text Available MicroRNAs play key roles in tumor metastasis. Here, we describe the regulation and function of miR-218 in gastric cancer (GC metastasis. miR-218 expression is decreased along with the expression of one of its host genes, Slit3 in metastatic GC. However, Robo1, one of several Slit receptors, is negatively regulated by miR-218, thus establishing a negative feedback loop. Decreased miR-218 levels eliminate Robo1 repression, which activates the Slit-Robo1 pathway through the interaction between Robo1 and Slit2, thus triggering tumor metastasis. The restoration of miR-218 suppresses Robo1 expression and inhibits tumor cell invasion and metastasis in vitro and in vivo. Taken together, our results describe a Slit-miR-218-Robo1 regulatory circuit whose disruption may contribute to GC metastasis. Targeting miR-218 may provide a strategy for blocking tumor metastasis.

  13. A clinical positron emission tomography facility. 2-18FDG studies: Development and results

    Two different types of accelerators have been used for production of (18F)fluoride, and the isotope produced has been used for radiolabelling of 2-fluoro-2-deoxy-D-glucose (2-18FDG). A rotating PET scanner, based on two scintillation camera heads, has been developed and used for human 2-18FDG studies. The suitability of an energy window in the Compton region for imaging 511 keV photons in scintillation camera systems has been evaluated. A new simplified method for normalizing clinical 2-18FDG results has been developed and validated, using erythrocytes as a reference tissue, requiring only one blood sample in the middle of the PET scan to calculate the integrated 2-18FDG input function with an accuracy better than 8 percent. An investigation using 2-18FDG PET to monitor the effect of therapy in advanced head and neck cancer patients has been performed. We found that low initial metabolic rate of glucose (MRG) predicted a complete local response. The second PET examination gave no further information for this group. In the group of primary tumours and lymph node metastases representing a combination of high initial MRG and small decrease in MRG at he second PET examination, the outcome was unfavourable. An accurate normalization of 2-18FDG uptake was essential to evaluate the results of this study. 239 refs, 10 tabs

  14. A pri-miR-218 variant and risk of cervical carcinoma in Chinese women

    Shi Ting-Yan

    2013-01-01

    Full Text Available Abstract Background MicroRNA (miRNA-related single nucleotide polymorphisms (SNPs may compromise miRNA binding affinity and modify mRNA expression levels of the target genes, thus leading to cancer susceptibility. However, few studies have investigated roles of miRNA-related SNPs in the etiology of cervical carcinoma. Methods In this case–control study of 1,584 cervical cancer cases and 1,394 cancer-free female controls, we investigated associations between two miR-218-related SNPs involved in the LAMB3-miR-218 pathway and the risk of cervical carcinoma in Eastern Chinese women. Results We found that the pri-miR-218 rs11134527 variant GG genotype was significantly associated with a decreased risk of cervical carcinoma compared with AA/AG genotypes (adjusted OR=0.77, 95% CI=0.63-0.95, P=0.015. However, this association was not observed for the miR-218 binding site SNP (rs2566 on LAMB3. Using the multifactor dimensionality reduction analysis, we observed some evidence of interactions of these two SNPs with other risk factors, especially age at primiparity and menopausal status, in the risk of cervical carcinoma. Conclusions The pri-miR-218 rs11134527 SNP was significantly associated with the risk of cervical carcinoma in Eastern Chinese women. Larger, independent studies are warranted to validate our findings.

  15. A pri-miR-218 variant and risk of cervical carcinoma in Chinese women

    MicroRNA (miRNA)-related single nucleotide polymorphisms (SNPs) may compromise miRNA binding affinity and modify mRNA expression levels of the target genes, thus leading to cancer susceptibility. However, few studies have investigated roles of miRNA-related SNPs in the etiology of cervical carcinoma. In this case–control study of 1,584 cervical cancer cases and 1,394 cancer-free female controls, we investigated associations between two miR-218-related SNPs involved in the LAMB3-miR-218 pathway and the risk of cervical carcinoma in Eastern Chinese women. We found that the pri-miR-218 rs11134527 variant GG genotype was significantly associated with a decreased risk of cervical carcinoma compared with AA/AG genotypes (adjusted OR=0.77, 95% CI=0.63-0.95, P=0.015). However, this association was not observed for the miR-218 binding site SNP (rs2566) on LAMB3. Using the multifactor dimensionality reduction analysis, we observed some evidence of interactions of these two SNPs with other risk factors, especially age at primiparity and menopausal status, in the risk of cervical carcinoma. The pri-miR-218 rs11134527 SNP was significantly associated with the risk of cervical carcinoma in Eastern Chinese women. Larger, independent studies are warranted to validate our findings

  16. MicroRNA-218 inhibits the proliferation of human choriocarcinoma JEG-3 cell line by targeting Fbxw8

    Shi, Dazun; Tan, Zhihui; Lu, Rong; Yang, Wenqing; Zhang, Yi, E-mail: zhangyi5588@hotmail.com

    2014-08-08

    Highlights: • The miR-218 expression was decreased in choriocarcinoma cell lines. • The Fbxw8 protein expression was increased in choriocarcinoma cell lines. • We show that Fbxw8 is bona-fide target of miR-218 in JEG-3. • Ectopic miR-218 expression inhibits the proliferation of JEG-3 via Fbxw8. • Overexpression of miR-218 affected cyclin A and p27 expression via Fbxw8. - Abstract: MicroRNAs (miRNAs) are endogenous 19–25 nucleotide noncoding single-stranded RNAs that regulate gene expression by blocking the translation or decreasing the stability of mRNAs. In this study, we showed that miR-218 expression levels were decreased while Fbxw8 expression levels were increased in human choriocarcinoma cell lines, and identified Fbxw8 as a novel direct target of miR-218. Overexpression of miR-218 inhibited cell growth arrest at G2/M phase, suppressed the protein levels of cyclin A and up-regulated the expression levels of p27 through decreasing the levels of Fbxw8. On the other hand, forced expression of Fbxw8 partly rescued the effect of miR-218 in the cells, attenuated cell proliferation decrease the percentage of cells at G2/M phase, induced cyclin A protein expression and suppressed the protein level of p27 through up-regulating the levels of Fbxw8. Taken together, these findings will shed light the role to mechanism of miR-218 in regulating JEG-3 cells proliferation via miR-218/Fbxw8 axis, and miR-218 may serve as a novel potential therapeutic target in human choriocarcinoma in the future.

  17. 12 CFR 218.775 - Exemption from the definition of “broker” for banks effecting certain excepted or exempted...

    2010-01-01

    ... system has the same meaning as in 17 CFR 240.15c2-11. (3) Insurance company has the same meaning as in 15... banks effecting certain excepted or exempted transactions in investment company securities. 218.775 Section 218.775 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE...

  18. MicroRNA-218 promotes high glucose-induced apoptosis in podocytes by targeting heme oxygenase-1.

    Yang, Haibo; Wang, Qingjun; Li, Sutong

    2016-03-18

    Emerging evidence has demonstrated that microRNAs (miRNAs) play a mediatory role in the pathogenesis of diabetic nephropathy. In this study, we found that miR-218 was upregulated in high glucose (HG) treated podocytes, which are essential components of the glomerular filtration barrier and a major prognostic determinant in diabetic nephropathy. Additionally, up-regulation of miR-218 was accompanied by an increased rate of podocyte death and down-regulation in the level of nephrin, a key marker of podocytes. However, inhibition of miR-218 exerted the opposite effect. In addition, the dual-luciferase reporter assay showed that miR-218 directly targeted the 3'-untranslated region of heme oxygenase-1 (HO-1), and further study confirmed an increase of HO-1 in HG-treated podocytes transfected with anti-miR-218. Knockdown of HO-1 blocked the anti-apoptotic effect of anti-miR-218. Furthermore, inhibition of miR-218 was associated with decreased expression of the known pro-apoptotic molecule p38-mitogen-activated protein kinase (p38-MAPK) activation. Following preconditioning with SB203580, an inhibitor of p38-MAPK, the stimulatory effect of HG on podocyte apoptosis was strikingly ameliorated. These findings suggested that miR-218 accelerated HG-induced podocyte apoptosis through directly down-regulating HO-1 and facilitating p38-MAPK activation. PMID:26876575

  19. 12 CFR 218.700 - Defined terms relating to the networking exception from the definition of “broker.”

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Defined terms relating to the networking exception from the definition of âbroker.â 218.700 Section 218.700 Banks and Banking FEDERAL RESERVE SYSTEM... the annual value of the Employment Cost Index For Wages and Salaries, Private Industry Workers (or...

  20. 17 CFR 274.218 - Form N-8F, application for deregistration of certain registered investment companies.

    2010-04-01

    ...) (15 U.S.C. 80a-3(c)(7)) of the Act; or (d) Has become a business development company. Editorial Note... registered investment company; (b) Has distributed substantially all of its assets to its shareholders and... deregistration of certain registered investment companies. 274.218 Section 274.218 Commodity and...

  1. Radiation and chemical stability of 2-deoxy-2-[18F]fluoro-D-glucose radiopharmaceutical

    Qualitative and quantitative analytical technique of low-molecular components of chemical and radiation-chemical decomposition of 2-deoxy-2-[18F]fluoro-D-glucose, 2-[18F]FDG radiopharmaceutical was developed for its extended QC by HPLC with mass-spectrometric electro-spray ionisation detector (ESI MS). The analysis constituted from the LC on silica gel NH2 bonded column combined with MS, UV-VIS, refraction index and radiometric detectors, and TLC on silica gel and high-performance TLC (HPTLC) on silica gel NH2 bonded as at the LC column. Condition of analysis, the composition of mobile phase at HPLC and the regime of ESI MS were optimised on the maximal intensity of the signals of analytes, which were predicted for commercial 2-[18F]FDG and its decomposition products. A modern LC/MS system was demonstrated to be suitable not only for identification of unknown analytes, but also for complex analysis of solutes except [18F]F-. This was advantageous for the 2-[18F]FDG autoradiolysis assessment about which no data were published. For comparative purposes, were used a classic TLC on silica gel with mobile phase acetonitrile: water at 95:5 v/v, and HPTLC on NH2 modified silica gel like the LC column. Mobile phase was identical as by LC/MS method (acetonitrile: 4 mM aqueous solution of ammonium formate 80:20 v/v). Retention times of reference samples: fluorodeoxyglucose, glucose, mannose, arabinose, deoxyglucose, gluconic and glucuronic acids at HPLC were established. Equal composition of the inlet sample and mobile phase was found important to avoid increased background of the MS detector and asymmetry of the chromatographic peaks. Reference substance detectability was investigated for various detectors. Characteristic ions were established for the analytes under consideration. Optimal performance of the ESI MS detector was discovered in negative ions mode or single ion monitoring (SIM) regime. The most intensive signal was observed for all analyte molecules association

  2. 17 CFR 249.218 - Form 18, for foreign governments and political subdivisions thereof.

    2010-04-01

    ... Federal Register citations affecting Form 18, see the List of CFR Sections Affected, which appears in the... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Form 18, for foreign... for Registration of Securities on National Securities Exchanges and Similar Matters § 249.218 Form...

  3. 20 CFR 408.218 - Do you meet the SSI eligibility requirements?

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Do you meet the SSI eligibility requirements... CERTAIN WORLD WAR II VETERANS SVB Qualification and Entitlement Ssi Eligibility § 408.218 Do you meet the SSI eligibility requirements? For SVB purposes, you are eligible for SSI for a given month if all...

  4. 20 CFR 218.44 - When a remarried widow(er) annuity ends.

    2010-04-01

    ... the month in which the remarried widow(er) attains full retirement age (the disability annuitant then... widow attains full retirement age (the annuitant then becomes entitled to an annuity based upon age). ....44 Section 218.44 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE...

  5. 20 CFR 218.13 - When a widow(er) annuity begins.

    2010-04-01

    ... the month in which the claimant attains full retirement age; or (iii) The first day of the sixth month... 62 but under full retirement age. The earliest date permitted by law is the latest of— (A) The first... Section 218.13 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT...

  6. 20 CFR 218.36 - When an employee disability annuity ends.

    2010-04-01

    ... month in which the employee attains full retirement age (the disability annuity is changed to an age... becomes entitled. When a disability annuity ends before an employee attains full retirement age, any....36 Section 218.36 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE...

  7. 20 CFR 218.26 - Work started after annuity beginning date.

    2010-04-01

    ... RETIREMENT ACT ANNUITY BEGINNING AND ENDING DATES How Work and Special Payments Affect an Employee, Spouse, or Divorced Spouse Annuity Beginning Date § 218.26 Work started after annuity beginning date. (a... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Work started after annuity beginning...

  8. 30 CFR 218.101 - Royalty and rental remittance (naval petroleum reserves).

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Royalty and rental remittance (naval petroleum... INCENTIVES Oil and Gas, Onshore § 218.101 Royalty and rental remittance (naval petroleum reserves). Remittance covering payments of royalty or rental on naval petroleum reserves must be accomplished...

  9. miR-218 inhibits the invasive ability of glioma cells by direct downregulation of IKK-{beta}

    Song, Libing, E-mail: lb.song1@gmail.com [State Key Laboratory of Oncology in Southern China, Department of Experimental Research, Sun Yat-sen University Cancer Center, Guangzhou, Guangdong 510060 (China); Huang, Quan; Chen, Kun [Department of Neurosurgery, The First Affiliated Hospital of Sun Yat-sen University, Guangzhou, Guangdong 510080 (China); Liu, Liping [Department of Microbiology, Zhongshan School of Medicine, Sun Yat-sen University, Guangzhou, Guangdong 510080 (China); Lin, Chuyong; Dai, Ting [Department of Biochemistry, Zhongshan School of Medicine, Sun Yat-sen University, Guangzhou, Guangdong 510080 (China); Yu, Chunping [State Key Laboratory of Oncology in Southern China, Department of Experimental Research, Sun Yat-sen University Cancer Center, Guangzhou, Guangdong 510060 (China); Wu, Zhiqiang [Department of Biochemistry, Zhongshan School of Medicine, Sun Yat-sen University, Guangzhou, Guangdong 510080 (China); Li, Jun, E-mail: junli99@gmail.com [Department of Biochemistry, Zhongshan School of Medicine, Sun Yat-sen University, Guangzhou, Guangdong 510080 (China)

    2010-11-05

    Research highlights: {yields} miR-218 is markedly downregulated in glioma cell lines and in primary glioma tissues. {yields} Upregulation of miR-218 dramatically reduces the invasive ability of glioma cells. {yields} Ectopic expression of miR-218 inactivates IKK-{beta}/NF-{kappa}B signaling pathway. {yields} miR-218 directly targets the 3'-untranslated region (3'-UTR) of IKK-{beta}. -- Abstract: Aberrant activation of nuclear factor-kappa B (NF-{kappa}B) pathway has been proven to play important roles in the development and progression of cancers. Activation of NF-{kappa}B via the classical pathway is modulated by I{kappa}Bs kinase (IKK-{beta}). However, the mechanism underlying the epigenetic regulation of IKK-{beta}/NF-{kappa}B pathway remains largely unknown. In this study, we found that the expression level of miR-218 was markedly downregulated in glioma cell lines and in human primary glioma tissues. Upregulation of miR-218 dramatically reduced the migratory speed and invasive ability of glioma cells. Furthermore, we showed that ectopically expressing miR-218 in glioma cells resulted in downregulation of matrix metalloproteinase-9 (MMP-9) and reduction in NF-{kappa}B transactivity at a transcriptional level, but inhibition of miR-218 enhanced the expression of MMP-9 and transcriptional activity of NF-{kappa}B. Moreover, we showed that miR-218 inactivated the NF-{kappa}B pathway through downregulating IKK-{beta} expression by directly targeting the 3'-untranslated region (3'-UTR) of IKK-{beta}. Taken together, our results suggest that miR-218 plays an important role in preventing the invasiveness of glioma cells, and our results present a novel mechanism of miRNA-mediated direct suppression of IKK-{beta}/NF-{kappa}B pathway in gliomas.

  10. Synthesis and purification of 2-deoxy-2-[18F]fluoro-D-glucose and 2-deoxy-2-[18F]fluoro-D-mannose: characterization of products by 1H- and 19F-NMR spectroscopy

    A procedure has been developed that allows the separation 2-deoxy-2-[18F]fluoro-D-glucose from 2-deoxy-2-[18F]fluoro-D-mannose employing selectively optimized ion-moderated partition chromatography. Both compounds can be obtained with a >98% chemical and radiochemical purity in about one half-life of 18F. Both the α- and β-anomers of both sugars were completely characterized by high-resolution 1H- and 19F-NMR spectroscopy. Various convenient preparation methods for 2-deoxy-2-[18F]fluoro-D-glucose were compared. (author)

  11. MiR-218 Inhibited Growth and Metabolism of Human Glioblastoma Cells by Directly Targeting E2F2.

    Zhang, Yaxuan; Han, Dongfeng; Wei, Wenjin; Cao, Wenping; Zhang, Rui; Dong, Qingsheng; Zhang, Junxia; Wang, Yingyi; Liu, Ning

    2015-11-01

    In recent years, microRNA has become a hotspot in research on diseases, especially in the initiation and progression of different types of cancer. In this study, we found that miR-218 could inhibit growth and metabolism in gliomas by directly targeting E2F2. First, we obtained data from the Chinese Glioma Genome Atlas (CGGA) database to analyze miR-218 expression in different grades of gliomas. The effects of miR-218 on cell cycle progression and cell proliferation in U87 and U251 cell lines were investigated by flow cytometry, specifically CCK8 assay and tablet cloning, respectively. Glucose consumption and lactate production of glioma cell lines were measured by correlative test kits. Furthermore, we used Western blot analysis and luciferase reporter assay to identify the direct and functional target of miR-218. Data from the CGGA database and real-time quantitative reverse transcription-PCR demonstrated that miR-218 was obviously reduced in human glioblastoma tissues, as well as in the cell lines. When miR-218 level was elevated in vitro, cell cycle progression was arrested in the G1 phase, and cell proliferation was dramatically inhibited. Both glucose consumption and lactate production of glioma cells were significantly reduced. Western blot analysis and luciferase reporter assay revealed that E2F2 was a direct target of miR-218 in glioma cells. This investigation demonstrated that elevated E2F2 expression could partly weaken the effect of miR-218 in vitro. This study also showed that miR-218 may be a repressor in glioma by directly targeting E2F2, as well as a potential therapeutic target in gliomas. PMID:26012781

  12. Transient-diffusion measurements of radon. Fick's law confirmation and 218Po/214Po behavior determination

    Usually, radon diffusion coefficients in soils are measured based on the assumption that Fick's law holds true. But, unlike in a free volume, strictly speaking, there is no guarantee that Fick's law holds in soils. Transient-diffusion measurements of radon in soils are best employed in order to confirm Fick's law. Alpha-particles from 218Po/214Po and from 222Rn cannot be distinguished in the course of those measurements. Therefore, the relevant portions of the detector reading must be allocated to each of these nuclides. For that purpose, the behaviors of 218Po and 214Po in the detection volume were determined and their ratios of contribution to the detector reading were also determined by Monte Carlo calculations and a verification test. This information was used to confirm Fick's law for representative Japanese sand and loam samples through indicial transient-diffusion measurements and a theoretical interpretation of the measured data. (author)

  13. Synthesis of 2-18F-fluoroisonicotinic acid hydrazide and initial biological evaluation

    Isonicotinic acid hydrazide (isonizide) is one of the most effective agents in tuberculosis therapy. This agent rapidly permeates the bacterial cell membrane via passive diffusion. The central nervous system tuberculosis is being observed in patients who are intravenous drug abusers, with AIDS and AIDS-related complex. Therefore, radiopharmaceuticals for diagnosis of tuberculosis may become important. Very few attempts have been made to develop isonicotinic acid and derivatives for the same application. As part of an on-going research effort to develop radiotracers for fluorination of proteins and peptides via prosthetic groups approach, we have synthesized ethyl 2-[18F]-fluoroisonicotinate and 2-[18F]-fluoroisonicotinic acid hydrazide. The synthetic approach starts from treatment of ethyl-2-(trimethylammonium)-isonicotinate precursor using no-carrier-added radiofluoride produced by the 18O(p,n)18F nuclear reaction on 18O-enriched (95 %) water and Kryptofix 222 as nucleophilic catalyst in anhydrous acetonitrile at 1000C, gave ethyl 2-[18F]-fluoroisonicotinate in greater than 90% radiochemical yield (decay corrected) within two minutes reaction time. The ether extract of fluorinated ethylester evaporated and residue was re-dissolved in ethanol and treated with hydrazine for 15 minutes in boiling water to obtain 2-[18F]-fluoroisonicotinic acid hydrazide in excellent radiochemical yield. The overall radiochemical yield was greater that 70% with total synthesis time of approximately one hour. This synthetic approach hold considerable promise as a rapid and simple method for fluorination of radiopharmaceuticals of high radiochemical yield. Biological evaluation was performed in normal mice. The data obtained shown that the lungs appear to retain some activity that someone may presume that such radiotracer maybe useful in detection of tuberculosis

  14. An analysis of clinical characteristics,etiologies and prognosis of 218 patients with infective endocarditis

    谢红梅

    2014-01-01

    Objective To describe the profile of patients with infective endocarditis(IE)and assess prognostic factors of IE.Methods Clinical and etiology data of 218 patients with IE were collected retrospectively from January 2011to January 2013.The distribution and antimicrobial susceptibilities of pathogens causing IE were evaluated.Prognostic factors associated with IE were determined by univariate and multivariate regression analysis.Results

  15. Progress of research in miR-218 and cervical cancer

    Kangkang Zeng; Wei Zhang; Xiaoxia Hu

    2013-01-01

    MicroRNAs (miRNAs) are smal endogenous non-coding RNAs which can specifical y silence gene expression, and thereby alter cel and organism phenotype. Deregulation of miRNA expression has been discovered in a variety of tumors and it is now clear that they contribute to cancer development and progression. Previous studies have indicated that miRNAs are involved in developmental timing, cel proliferation, apoptosis, morphogenesis [1], antiviral defense [2], and tumorigenesis [3]. In cancer pathways, altered expression of tumor suppressive or oncogenic miRNAs can disrupt regulatory mechanisms normal. Altered miRNAs expression patterns have been observed in a variety of diseased tissues. Cervical cancer is the most common malignant tumor in female reproductive tract. Recently more and more study showed a large number of miRNAs were down-regulated or up-regulated in cervical cancer. Recent data revealed that miRNA-218 (miR-218) played important roles in tumor initiation and development. This review focuses on analysis of miR-218 and wil provide some insight into the progress of cervical cancer.

  16. Analysis of 218 cases of children's ADR reports%218例儿童药品不良反应报告分析

    董传婷; 赵孝林; 郝丽娜

    2014-01-01

    目的:分析笔者所在医院儿童药品不良反应( ADR)的发生特点及影响因素,保障儿童用药安全。方法采用回顾性分析法,对218例儿童ADR报告按照报告类型、患儿年龄、性别、体质量,药品种类、给药途径,临床表现等进行统计分析。结果218例ADR报告中,患儿的平均年龄为(2.99±2.89)岁,平均体质量为(14.18±8.51) kg,男女比例为1.32:1,0~3岁患儿占58.26%;新的和严重的ADR占33.03%;引发ADR最多的是抗微生物药,占67.89%;最主要的给药方式是静脉滴注,占92.20%;ADR累及器官或系统中皮肤及其附件与全身性占80.76%。结论为使儿童ADR监测工作得到持续改进,医院必须有重点的继续加强培训,增强行政监管力度,加大奖惩力度,加强药品的质量控制,临床上继续减少静脉给药频率,加强用药监护,做好急救措施。%Objective To analyze the characters and influencing factors of children ADR monitoring in our hospital, and ensure the medical safety for children. Methods Retrospective study was used to analyze 218 cases of children ADR reports statistically in 2012,in accordance with the type of report and children′s age,gender,weight,as well as drug types, routes of administration,clinical manifestation etc. Results In the 218 cases of ADR reports,the children′s average age was(2. 99 ± 2. 89)years,the average weight was(14. 18 ± 8. 51)kg,male to female ratio was 1. 32:1,children of 0~3 years old accounted for 58. 26%;new and severe ADR accounted for 33. 03%;most of the ADR was caused by antimicrobi-al drugs,which accounted for 67. 89%;intravenous infusion,the main route of administration,accounted for 92. 20%;ADR involving the skin and its appendages as well as systemic accounted for 80. 76%. Conclusion In order to get continuous improvement in children ADR monitoring,the hospital must continue to focus on enhancing training,and strengthening ad

  17. High sensitivity ICLAS of H218O in the 12,580-13,550 cm-1 transparency window

    High-sensitivity Intracavity Laser Absorption Spectroscopy (ICLAS) is used to measure the high resolution absorption spectrum of H218O between 12,580 and 13,550 cm-1. This spectral region covers the 3v+δ polyad of very weak absorption. Four isotopologues of water (H218O, H216O, H217O, HD18O) are found to contribute to the observed spectrum. Spectrum analysis is performed with the aid of variational calculations and allowed for assigning 1126 lines belonging to H218O, while only 160 H218O lines are included in the HITRAN-2008 database. Altogether, 823 accurate energy levels of H218O are determined from transitions attributed to 26 upper vibrational states, 438 of them being reported for the first time. New information includes energy levels of four newly observed vibrational states of H218O: (2 4 0), (1 4 1), (0 4 2) and (2 3 1) at 13,167.718, 13,212.678, 13,403.71 and 15,073.975 cm-1, respectively. H218O transitions involving highly excited bending states like (1 6 0), (0 6 1), (0 7 1), (1 7 0), (0 9 0) and even (0 10 0) have been identified as a result of an intensity borrowing from stronger bands via high-order resonance interactions. Thirty-six new energy levels of H217O, present with a 2% relative concentration in our sample, could be determined. The rotational structure of the (0 2 3) state of HD18O at 13,245.497 cm-1 is also reported for the first time.

  18. Production process validation of 2-[18F]-fluoro-2-deoxy-D-glucose

    The aim of production process validation of 2-[18F]-fluoro-2-deoxi-D-glucose (FDG) was to check: A) equipments and services implicated in the production process were correctly installed, well documented, and worked properly, and B) production of FDG was done in a repetitive way according to predefined parameters. The main document was the Validation Master Plan, and steps were: installation qualification, operational qualification, performance qualification and validation final report. After finalization of all tests established in qualification steps without deviations, we concluded that the production process was validated because consistently produced FDG meeting its pre-determined specifications and quality characteristics (Au)

  19. Yeast Interacting Proteins Database: YGL044C, YDL218W [Yeast Interacting Proteins Database

    Full Text Available starvation and aerobic conditions; expression also induced in cells treated with the mycotoxin patulin Rows ...duced by starvation and aerobic conditions; expression also induced in cells treated with the mycotoxin...imilarity (BRITE) - Alternative path with 1 intervening protein (YPD) 0 Alternative path with 2 intervening proteins (YPD) 0 IST hit 4 IST hit in the opposite bait/prey orientation - ... ...YGL044C RNA15 Cleavage and polyadenylation factor I (CF I) component involved in cl... of unknown function; YDL218W transcription is regulated by Azf1p and induced by

  20. Yeast Interacting Proteins Database: YML064C, YJL218W [Yeast Interacting Proteins Database

    Full Text Available ) 0 Synthetic lethality (0 or 1,YPD) 0 Co-induced by (YPD) - Co-repressed by (YPD) - Not affected by(YPD) - Interologs - Expression...ilar to bacterial galactoside O-acetyltransferases; induced by oleate in an OAF1/PIP2-dependent manner; promoter con...; induced by oleate in an OAF1/PIP2-dependent manner; promoter contains an oleate res...trols actomyosin and septin dynamics during cytokinesis Rows with this bait as bait (20) Rows with this bait as pre...y (0) YJL218W - Putative protein of unknown function, similar to bacterial galactoside O-acetyltransferases

  1. Mass flow rate correlation for two-phase flow of R218 through a capillary tube

    Vinš, Václav; Vacek, V.

    2009-01-01

    Roč. 29, 14-15 (2009), s. 2816-2823. ISSN 1359-4311 Institutional research plan: CEZ:AV0Z20760514 Keywords : artificial neural network * capillary tube * mass flow rate correlation * R218 Subject RIV: BK - Fluid Dynamics Impact factor: 1.922, year: 2009 http://www.sciencedirect.com/science?_ob=PublicationURL&_cdi=5687&_pubType=J&_acct=C000034318&_version=1&_urlVersion=0&_userid=640952&md5=fc314a471a010545ee185394a6c8f5f7&jchunk=29#29

  2. Production process validation of 2-[18F]-fluoro-2-deoxy-D-glucose

    The main of validation of production process of 2-[18F]-fluoro-2-deoxi-D-glucose (FDG) was to check: A) equipment's and services implicated in the production process were correctly installed, well documented, and worked properly, and B) production of FDG was done in a repetitive way according to predefined parameters. The main document was the Validation Master Plan, and steps were: installation qualification, operation qualification, process qualification and validation report. After finalization of all tests established in qualification steps without deviations, we concluded that the production process was validated because is done in a repetitive way according predefined parameters (Au)

  3. 2-deoxy-2-[18F]fluoro-D-mannose positron emission tomography imaging in atherosclerosis.

    Tahara, Nobuhiro; Mukherjee, Jogeshwar; de Haas, Hans J; Petrov, Artiom D; Tawakol, Ahmed; Haider, Nezam; Tahara, Atsuko; Constantinescu, Cristian C; Zhou, Jun; Boersma, Hendrikus H; Imaizumi, Tsutomu; Nakano, Masataka; Finn, Aloke; Fayad, Zahi; Virmani, Renu; Fuster, Valentin; Bosca, Lisardo; Narula, Jagat

    2014-02-01

    Progressive inflammation in atherosclerotic plaques is associated with increasing risk of plaque rupture. Molecular imaging of activated macrophages with 2-deoxy-2-[(18)F]fluoro-D-glucose ([(18)F]FDG) has been proposed for identification of patients at higher risk for acute vascular events. Because mannose is an isomer of glucose that is taken up by macrophages through glucose transporters and because mannose receptors are expressed on a subset of the macrophage population in high-risk plaques, we applied (18)F-labeled mannose (2-deoxy-2-[(18)F]fluoro-D-mannose, [(18)F]FDM) for targeting of plaque inflammation. Here, we describe comparable uptake of [(18)F]FDM and [(18)F]FDG in atherosclerotic lesions in a rabbit model; [(18)F]FDM uptake was proportional to the plaque macrophage population. Our FDM competition studies in cultured cells with 2-deoxy-2-[(14)C]carbon-D-glucose ([(14)C]2DG) support at least 35% higher [(18)F]FDM uptake by macrophages in cell experiments. We also demonstrate that FDM restricts binding of anti-mannose receptor antibody to macrophages by approximately 35% and that mannose receptor targeting may provide an additional avenue for imaging of plaque inflammation. PMID:24412923

  4. IC-218合金的再结晶织构及其形成机制%RECRYSTALLIZATION TEXTURE OF IC-218 ALLOY

    林一坚

    2004-01-01

    研究了IC-218合金冷轧60%后在1000℃退火中形成的织构,发现再结晶后晶粒取向分布漫散,这种情况早在再结晶形核阶段就已出现,并在随后的长时间退火中保持.相继出现几个弱的再结晶织构,它们都与冷轧织构之间存在与低∑重合点阵相近的位向关系.这些结果可与显微组织的观察很好地相互印证,表明导致再结晶织构这些特点的基本原因是一般大角晶界失去明显可动性而以位错运动为机制的界面迁移则相对活跃.将以上结果与单相Ni3Al的再结晶行为进行对比,发现两者极为相似.由此对76Ni-24Al-0.24B合金的晶界结构是否存在无序区的问题提供了新的信息.

  5. Alternating parity bands in doubly odd 218Ac129 and octupole instability in the light actinide region

    High-spin states of doubly odd 218Ac129 have been investigated using in-beam α, γ and conversion electron spectroscopy techniques through the 209Bi(12(13)C,3(4)n) fusion-evaporation reactions. The level scheme of 218Ac shows three interconnected, alternating parity structures, each one linked by strong E1 transitions. Two of these bands are strikingly similar to the known scheme of the isotone 217Ra and this analogy is shown to persist for the pair 220Ac, 219Ra. The relation between the structure of 218Ac and its neighbors is thoroughly discussed showing that the first signals of octupole collectivity appear for N = 129. (orig.)

  6. H_2^{16}O and H_2^{18}O Maser Emission from Gas-Dust Clouds

    Nesterenok, Aleksandr; 10.1134/S1063773711070036

    2011-01-01

    The collisional pumping of H_2^{16}O and H_2^{18}O masers in hot dense gas-dust clouds has been simulated numerically. New data on the rate coefficients for collisional transitions from Faure et al. (2007) were used in the calculations. The possibility of detecting H_2^{18}O emission in 22.2-GHz H_2^{16}O maser sources is investigated. The medium is shown to become optically thick in the H_2^{16}O lines for which an inverted level population is observed at H_2O column densities of ~10^{19}-10^{20} cm^{-2}. A simultaneous observation of H_2^{18}O emission and H_2^{16}O maser emission in the same source will allow the physical conditions in the gas-dust cloud to be refined.

  7. Synthesis of 2-deoxi-2[18F]fluoro-D-glucose and its precursors for human diagnostics

    The planned Debrecen PET center requires an intensive radiopharmaceutical development program. In the frame of this project 2-[18F]FDG, an important radiopharmaceutical in the PET technique was synthesized. In order to prepare the precursor 1,3,4,6-tetra-O-acetyl-2-O-trifluoromethanesulfonyl-β-D-mannopyranose (TATM) the standard preparation protocols were modified for achieving a better yield. Stereochemically pure 2-[18F]FDG was synthesized using high purity TATM and 18F produced by the MGC-20 E cyclotron. Beside the elaboration of the synthesis a detailed description is also given of the methods used for quality control of both TATM and 2-[18F]FDG. In addition to the usual conformational and configurational characterization of precursor compounds measured NMR parameters were also used to explore the anomeric structure of the acetylated sugar derivates. (author) 24 refs.; 4 figs.; 4 tabs

  8. A crucial role of Cys218 in configuring an unprecedented auto-inhibition form of MAP2K7.

    Sogabe, Yuri; Hashimoto, Takuma; Matsumoto, Takashi; Kirii, Yasuyuki; Sawa, Masaaki; Kinoshita, Takayoshi

    2016-04-29

    Mitogen-activated protein kinase kinase 7 (MAP2K7) is an indispensable kinase of the c-Jun N-terminal kinase signal cascade and is rigorously regulated via phosphorylation. To investigate the regulatory mechanism of the inactive non-phosphorylated state of MAP2K7, the crystal structures of the wild-type and C218S mutant were solved. The wild-type apo-structure revealed an unprecedented auto-inhibition form that occluded the ATP site. This closed form was configured by the n-σ* interaction of Cys218, a non-conserved residue among the MAP2K family kinases, with Gly145 in the glycine-rich loop. The interaction was unaltered in the presence of an ATP analog, whereas the C218S mutation precluded the closed configuration. These structural insights are potentially valuable for drug discovery of highly selective MAP2K7 inhibitors. PMID:26987717

  9. Malignant transformation of oral leukoplakia: a retrospective cohort study of 218 Chinese patients

    Oral leukoplakia (OL) is the best-known potentially malignant disorder. A new binary system to grade dysplasia was proposed by WHO, but the biological significance in predicting malignant transformation risk is unknown. The objective of this study is to estimate the rate of malignant transformation in a long-term follow-up cohort, explore the usefulness of the new binary system of grading dysplasia and identify significant risk factors of OL malignant transformation in China. A total of 218 patients with clinical and histopathologic diagnosis of OL were retrospectively reviewed. They were selected among all archived files at the Department of Oral Mucosal Diseases, Ninth People's Hospital, Shanghai Jiao Tong University School of Medicine. The mean follow-up period was 5.3 years. Among 218 cases, 39 (17.9%) OL patients developed oral cancer, with a mean duration of 5.2 years. Cox regression analysis revealed that dysplasia was an independent risk factor for OL malignant transformation, but age, gender, lesion site, diet habit, smoking and ethanol intake were not risk factors. High-risk dysplastic OL was associated with a 4.57-fold (95% confidence interval, 2.36-8.84; P < 0.001) increased risk of malignant transformation, compared with low-risk dysplasia. Consistent with this result, high-risk dysplastic OL had signicantly higher malignant incidence than low-risk dysplasia, particularly during the first 2-3 years of follow-up, by Kaplan-Meier analysis (Log-rank test, P < 0.001). The new binary system's function in predicting OL malignant transformation risk was investigated in this survey. The utilization of high-risk dysplasia as a significant indicator for evaluating malignant transformation risk in patients with OL was suggested, which may be helpful to guide treatment selection in clinical practice

  10. Malignant transformation of oral leukoplakia: a retrospective cohort study of 218 Chinese patients

    Zhou Zeng-Tong

    2010-12-01

    Full Text Available Abstract Background Oral leukoplakia (OL is the best-known potentially malignant disorder. A new binary system to grade dysplasia was proposed by WHO, but the biological significance in predicting malignant transformation risk is unknown. The objective of this study is to estimate the rate of malignant transformation in a long-term follow-up cohort, explore the usefulness of the new binary system of grading dysplasia and identify significant risk factors of OL malignant transformation in China. Methods A total of 218 patients with clinical and histopathologic diagnosis of OL were retrospectively reviewed. They were selected among all archived files at the Department of Oral Mucosal Diseases, Ninth People's Hospital, Shanghai Jiao Tong University School of Medicine. The mean follow-up period was 5.3 years. Results Among 218 cases, 39 (17.9% OL patients developed oral cancer, with a mean duration of 5.2 years. Cox regression analysis revealed that dysplasia was an independent risk factor for OL malignant transformation, but age, gender, lesion site, diet habit, smoking and ethanol intake were not risk factors. High-risk dysplastic OL was associated with a 4.57-fold (95% confidence interval, 2.36-8.84; P Conclusions The new binary system's function in predicting OL malignant transformation risk was investigated in this survey. The utilization of high-risk dysplasia as a significant indicator for evaluating malignant transformation risk in patients with OL was suggested, which may be helpful to guide treatment selection in clinical practice.

  11. Aberrant expression of miR-218 and miR-204 in human mesial temporal lobe epilepsy and hippocampal sclerosis-Convergence on axonal guidance

    Kaalund, Sanne Simone; Venø, Morten T; Bak, Mads;

    2014-01-01

    . Moreover, miR-204 and miR-218 showed strong changes in expression during fetal development of the hippocampus in pigs, and we identified four target genes, involved in axonal guidance and synaptic plasticity, ROBO1, GRM1, SLC1A2, and GNAI2, as bona fide targets of miR-218. GRM1 was also shown to be a...

  12. 5 CFR 792.218 - Does the law apply only to on-site Federal child care centers that are utilized by Federal families?

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Does the law apply only to on-site Federal child care centers that are utilized by Federal families? 792.218 Section 792.218 Administrative... law apply only to on-site Federal child care centers that are utilized by Federal families? The...

  13. Cooked oatmeal consumption is associated with better diet quality, better nutrient intakes, and reduced risk for central adiposity and obesity in Children 2-18 years

    The objective of this study was to assess the association between oatmeal consumption and nutrient intake, diet quality, and weight/adiposity of children aged 2-18. A nationally representative sample of children aged 2-18 (N=14,690) participating in National Health and Nutrition Examination Survey 2...

  14. 12 CFR 218.701 - Exemption from the definition of “broker” for certain institutional referrals.

    2010-01-01

    ... in a merger, acquisition, tender offer or similar transaction; providing venture capital, equity... a contractual or other written arrangement of the type specified in section 3(a)(4)(B)(i) of the Act... type of compensation that would not be considered incentive compensation under § 218.700(b)(1) or...

  15. 77 FR 69503 - Comment Request for Information Collection on the ETA 218, Benefit Rights and Experience Report...

    2012-11-19

    ... January 18, 2013. ADDRESSES: Submit written comments to Scott Gibbons, Office of Unemployment Insurance... determine eligibility for state unemployment compensation programs. The data in the ETA 218, Benefit Rights... submissions of responses. III. Current Actions Type of Review: Extension without changes. Title:...

  16. 34 CFR 685.218 - Discharge of student loan indebtedness for survivors of victims of the September 11, 2001, attacks.

    2010-07-01

    ... 34 Education 3 2010-07-01 2010-07-01 false Discharge of student loan indebtedness for survivors of... WILLIAM D. FORD FEDERAL DIRECT LOAN PROGRAM Borrower Provisions § 685.218 Discharge of student loan... present at the World Trade Center in New York City, New York, at the Pentagon in Virginia, or at...

  17. 49 CFR Appendix B to Part 218 - Statement of Agency Enforcement Policy on Blue Signal Protection for Utility Employees

    2010-10-01

    ... clarify FRA's enforcement policy. In the first four examples, the utility employee is properly attached to..., provided all the conditions specified in § 218.22 are met: Example 1: A utility employee assists a train crew by adding or reducing railroad cars to or from the train. The utility employee may perform...

  18. High frequency microphone measurements for transition detection on airfoils. Risø C2-18 appendix report

    Døssing, Mads

    pressure) and Tollmien-Schlichting frequencies. The tests were made at Reynolds and Mach numbers corresponding to the operating conditions of a typical horizontal axis wind turbine (HAWT). The Risø B1-18, Risø C2-18 and NACA0015 profiles were tested and the measured transition points are reported....

  19. 49 CFR 218.101 - Leaving rolling and on-track maintenance-of-way equipment in the clear.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Leaving rolling and on-track maintenance-of-way... Handling Equipment, Switches, and Fixed Derails § 218.101 Leaving rolling and on-track maintenance-of-way... requirements of this section. (b) Rolling and on-track maintenance-of-way equipment shall not be left where...

  20. In vitro evaluation of nicotinic acetylcholine receptors with 2-[18F]F-A85380 in Parkinson's disease

    Nicotinic acetylcholine receptors (nAChR) are involved in many physiological functions and appear to be affected in neurodegenerative diseases like Alzheimer's disease and Parkinson's disease (PD). Here, we describe the in vitro evaluation of nAChRs in PD with 2-[18F]F-A85380, a ligand with high affinity to the β2 nAChR subunit. Autoradiography with 2-[18F]F-A85380 in untreated rat brain corresponded to the known distribution of α4β2 nAChRs with high uptake in the thalamus, moderate uptake in the striatum and cortex and low uptake in the cerebellum (47%, 43% and 19% of the thalamus, respectively). The localization of α4β2 nAChRs in the striatum was investigated in rodents with unilateral lesion of the substantia nigra. 2-[18F]F-A85380 binding was significantly reduced in the striatum ipsilateral to the lesion side (to 64% of the contralateral side), indicating that a fraction of α4β2 nAChRs is located on dopaminergic terminals, whereas another fraction resides on striatal interneurons or cortical afferents. Similarly, in human brain sections of PD patients, 2-[18F]F-A85380 uptake was significantly reduced not only in the caudate and putamen but also in the thalamus (approximately 30% of the binding of control brain in all three regions); within the striatum, nAChRs in the putamen were significantly more severely affected as in the caudate. The observed pattern of α4β2* nAChR loss demonstrates the potential of 2-[18F]F-A85380 for further investigations of this positron emission tomography ligand for in vivo studies of α4β2* nAChRs in PD

  1. Tumor suppressive microRNA-218 inhibits cancer cell migration and invasion through targeting laminin-332 in head and neck squamous cell carcinoma.

    Kinoshita, Takashi; Hanazawa, Toyoyuki; Nohata, Nijiro; Kikkawa, Naoko; Enokida, Hideki; Yoshino, Hirofumi; Yamasaki, Takeshi; Hidaka, Hideo; Nakagawa, Masayuki; Okamoto, Yoshitaka; Seki, Naohiko

    2012-11-01

    Recent our microRNA (miRNA) expression signature revealed that expression of microRNA-218 (miR-218) was reduced in cancer tissues, suggesting a candidate of tumor suppressor in head and neck squamous cell carcinoma (HNSCC). The aim of this study was to investigate the functional significance of miR-218 and its mediated moleculer pathways in HNSCC. Restoration of miR-218 in cancer cells led to significant inhibition of cell migration and invasion activities in HNSCC cell lines (FaDu and SAS). Genome-wide gene expression analysis of miR-218 transfectants and in silico database analysis showed that focal adhesion pathway was a promising candidate of miR-218 target pathways. The laminins are an important and biologically active part of the basal lamina, the function of that are various such as influencing cell differentiation, migration and adhesion as well as proliferation and cell survival. Interestingly, all components of laminin-332 (LAMA3, LAMB3 and LAMC2) are listed on the candidate genes in focal adhesion pathway. Furthermore, we focused on LAMB3 which has a miR-218 target site and gene expression studies and luciferase reporter assays showed that LAMB3 was directly regulated by miR-218. Silencing study of LAMB3 demonstrated significant inhibition of cell migration and invasion. In clinical specimens with HNSCC, the expression levels of laminin-332 were significantly upregulated in cancer tissues compared to adjacent non-cancerous tissues. Our analysis data showed that tumor suppressive miR-218 contributes to cancer cell migration and invasion through regulating focal adhesion pathway, especially laminin-332. Tumor suppressive miRNA-mediated novel cancer pathways provide new insights into the potential mechanisms of HNSCC oncogenesis. PMID:23159910

  2. Binding properties of the cerebral α4β2 nicotinic acetylcholine receptor ligand 2-[18F]fluoro-A-85380 to plasma proteins

    Introduction: To determine the availability of nicotinic acetylcholine receptors in different human brain regions using the positron emission tomography (PET) radioligand 2-[18F]fluoro-A-85380 (2-[18F]FA) and invasive approaches for quantification, it is important to correct the arterial input function as well for plasma protein binding (PPB) of the radioligand as for radiolabeled metabolites accumulating in blood. This study deals with some aspects of PPB of 2-[18F]FA. Methods: Patients with different neurological disorders (n=72), such as Parkinson's disease, Alzheimer's disease and multiple sclerosis, and a group of healthy volunteers (n=15) subjected for PET imaging were analyzed for their PPB level of 2-[18F]FA using ultrafiltration. Protein gel electrophoresis of plasma samples was performed to identify the binding protein of 2-[18F]FA. The dependency of PPB on time and on free ligand concentration was analyzed to obtain the binding parameters B max and K d. Results: Albumin was identified to be the binding protein of 2-[18F]FA. PPB of 2-[18F]FA was low at 17±4% and did not show significant differences between the groups of patients. Corresponding to this, a narrow range of plasma albumin of 0.62±0.05 mM was observed. B max was determined as twice the albumin concentration, which indicates two binding sites for 2-[18F]FA on the protein. No time dependence of the PPB could be observed. By relating PPB to B max, an average K d value of 6.0±1.5 mM was obtained. Conclusion: This study shows the dependency of PPB of 2-[18F]FA on human albumin plasma concentration. An equation utilizing B max and K d to easily estimate PPB is presented

  3. Assessment of wire and tube penetration theories using a 218PoOx cluster aerosol

    Diffusion samplers are commonly used for the measurement of aerosol size distributions (dpp: 0.5-3 nm, such as those associated with radon decay products. The methods have relied upon the Cheng-Yeh wire screen penetration theory [Cheng, Y.S. and Yeh, H.C. (1980) J. Aerosol Sci. ll, 313.] that has been verified for particle sizes dp>3.5-4 nm. The validity of the theory in the ultrafine cluster size range has been assumed. In this study, a well-defined 218PoOx cluster aerosol Davg=0.078±0.0003 cm2s-1 (dp ≅ 0.6 nm) was generated for an assessment of the wire screen penetration theory for two low mesh number wire screens. The results indicated good agreement with the theory, within the domain of its underlying assumptions. In addition, a theoretical expression developed by Ingham [Ingham, D.B. (1975) J. Aerosol Sci. 6, 125.] for uniform flow tube penetration was investigated using the cluster aerosol for its applicability in the estimation of diffusional losses in the entrance of a tube. (author)

  4. Whole-body distribution and dosimetry of O-(2-[18F]fluoroethyl)-l-tyrosine

    The whole-body distribution of O-(2-[18F]fluoroethyl)-l-tyrosine (FET) was studied in seven patients with brain tumours by positron emission tomography (PET). Based on the IMEDOSE and MIRDOSE procedures, radiation absorbed doses were estimated from whole-body PET scans acquired approximately 70 and 200 min after i.v. injection of 400 MBq FET. After injection of FET, the peak of radioactivity in the blood was observed after 1.5 min, and a plateau of nearly constant radioactivity was reached at 20 min. The whole-body distribution of FET showed the highest activities in the urinary tract. All other organs exhibited only moderate FET uptake (SUV ≤1.6) which remained constant between early and late PET scans. No increased uptake was seen in the bone, the biliary tract or the pancreas. Twenty-two percent of the injected activity was excreted 5 h p.i. (approx. 5.3% ID/h). The highest absorbed dose was found for the urinary bladder wall. The effective dose according to ICRP 60 was 16.5 μSv/MBq for adults, which would lead to an effective dose of 6.1 mSv in a PET study using 370 MBq FET. (orig.)

  5. Measurement of the activity size distribution of the polonium-218 under laboratory conditions

    A number of investigators have reported the formation of the radiolytic ultrafine particles produced by the interaction of ionizing radiation with water vapor. Previous studies have suggested that a very high localized concentration of the OH radical produced by the radiolysis of water can react with trace gas like organic vapors and produce lower vapor pressure compounds that can then nucleate. In order to determine water vapor and trace gas dependence of the active, positive-charged, first radon daughter, an experiment was conducted using a radon chamber. The activity size distribution of the radon daughter in the range of 0.5 - 100 nm was measured using the stacked wire screens sampler. Measurements were taken for different relative humidity. The resultant activity size distributions were analyzed. The addition of water vapor to the radon carrier gases resulted in the formation of ultrafine particles by OH radicals formed radon radiolysis. It may be due to the neutralization of charged Po-218 ion with water vapor through the radiolysis

  6. Measurement of initial clustering on the radon decay product 218Po

    The formation of water clusters on 218Po ions is studied. The formation of the water clusters is discussed in the light of the classical theory of clustering, the clustering theory of Hawrynski and a kinetic model of clustering. The design of a specialized electric mobility spectrometer to measure the electric mobilities of the water clusters at various humidity levels is discussed. From the mobilities the radii of, and a number of water molecules in, the clusters are calculated using kinetic gas theory. The determinations were done for humidity levels between 0,16 and 96% relative humidity, and the results compared with the theoretical predictions. It was found that the classical theory underestimates the sizes of the clusters and the theory of Hawrynski overestimates the cluster sizes. It is concluded that the spectrometer is capable of high resolution measurement of the electric mobility of the small clusters. The underlying result of the clustering theories is that stable clusters with particular radii are formed at each humidity level. 91 refs., 70 figs., 11 tabs

  7. Fourier transform measurements of H218O and HD18O in the spectral range 1000-2300 cm-1

    The spectra of water vapor enriched by 18O were recorded in the 1000-2300 cm-1 spectral range, which corresponds to the spectral region studied by IASI instrument (Infrared Atmospheric Sounding Spectrometer) instrument. The spectra were recorded by a step by step Fourier Transform Spectrometer (FTS) at room temperature with absorption path lengths up to 36 m. Positions, intensities and self broadening coefficients of about 1800 lines of H218O and 900 of HD18O were analyzed and all the transitions were assigned. This paper focuses on lines intensities and comparisons with data from literature are presented. An average difference of 10% with HITRAN2008 database H218O line intensities is found with a maximum discrepancy of about 25% for the ν1-ν2 band.

  8. Familial Dysalbuminemic Hyperthyroxinemia in a Japanese Man Caused by a Point Albumin Gene Mutation (R218P)

    Osaki, Yoshinori; Hayashi, Yoshitaka; Nakagawa, Yoshinori; Yoshida, Katsumi; Ozaki, Hiroshi; Fukazawa, Hiroshi

    2016-01-01

    Familial dysalbuminemic hyperthyroxinemia (FDH) is a familial autosomal dominant disease caused by mutation in the albumin gene that produces a condition of euthyroid hyperthyroxinemia. In patients with FDH, serum-free thyroxine (FT4) and free triiodothyronine (FT3) concentrations as measured by several commercial methods are often falsely increased with normal thyrotropin (TSH). Therefore, several diagnostic steps are needed to differentiate TSH-secreting tumor or generalized resistance to thyroid hormone from FDH. We herein report a case of a Japanese man born in Aomori prefecture, with FDH caused by a mutant albumin gene (R218P). We found that a large number of FDH patients reported in Japan to date might have been born in Aomori prefecture and have shown the R218P mutation. In conclusion, FDH needs to be considered among the differential diagnoses in Japanese patients born in Aomori prefecture and showing normal TSH levels and elevated FT4 levels. PMID:27081329

  9. LED-based Fourier transform spectroscopy of H218O in the 15,000-16,000 cm-1 range

    Mikhailenko, S. N.; Serdyukov, V. I.; Sinitsa, L. N.

    2015-05-01

    The spectrum of Н218О has been recorded between 15,000 and 16,000 cm-1 by a Fourier transform spectrometer with spectral resolutions of 0.03 cm-1 and 0.05 cm-1 using high luminance LED light sources and a 60-cm multipath cell with a path length of 1920 and 3480 cm. A high signal-to-noise ratio (S/N=10,000) enabled us to register more than 1500 water vapor lines with intensities 1.0×10-27 to 2.2×10-24 cm/molecule at 296 K. 426 rotational-vibrational levels of the H218O molecule were assigned to eleven vibrational states: (014), (033), (052), (113), (132), (151), (212), (231), (311), (330) and (410). 72 Rotational-vibrational levels of the H217O molecule were assigned to six vibrational states: (014), (033), (113), (212), (311) and (410). An extended set of H218O transitions in the 15,000-16,000 cm-1 range was generated using the obtained energy level list and the results of a variational intensity calculation.

  10. Line lists for H218O and H217O based on empirical line positions and ab initio intensities

    New line lists for isotopically substituted water are presented. Most line positions were calculated from experimentally determined energy levels, while all line intensities were computed using an ab initio dipole moment surface. Transitions for which experimental energy levels are unavailable use calculated line positions. These line lists cover the range 0.05-20 000 cm-1 and are significantly more complete and potentially more accurate than the line lists available via standard databases. All lines with intensities (scaled by isotopologue abundance) greater than 10-29 cm/molecule at 296 K are included, augmented by weaker lines originating from pure rotational transitions. The final line lists contain 39 918 lines for H218O and 27 546 for H217O and are presented in standard HITRAN format. The number of experimentally determined H218O and H217O line positions is, respectively, 32 970 (83% of the total) and 17 073 (62%) and in both cases the average estimated uncertainty is 2×10-4 cm-1. The number of ab initio line intensities with an estimated uncertainty of 1% is 16 621 (42%) for H218O and 13 159 (48%) for H217O.

  11. Rapid Filament Supramolecular Chirality Reversal of HET-s (218-289) Prion Fibrils Driven by pH Elevation.

    Shanmugasundaram, Maruda; Kurouski, Dmitry; Wan, William; Stubbs, Gerald; Dukor, Rina K; Nafie, Laurence A; Lednev, Igor K

    2015-07-01

    Amyloid fibril polymorphism is not well understood despite its potential importance for biological activity and associated toxicity. Controlling the polymorphism of mature fibrils including their morphology and supramolecular chirality by postfibrillation changes in the local environment is the subject of this study. Specifically, the effect of pH on the stability and dynamics of HET-s (218-289) prion fibrils has been determined through the use of vibrational circular dichroism (VCD), deep UV resonance Raman, and fluorescence spectroscopies. It was found that a change in solution pH causes deprotonation of Asp and Glu amino acid residues on the surface of HET-s (218-289) prion fibrils and triggers rapid transformation of one supramolecular chiral polymorph into another. This process involves changes in higher order arrangements like lateral filament and fibril association and their supramolecular chirality, while the fibril cross-β core remains intact. This work suggests a hypothetical mechanism for HET-s (218-289) prion fibril refolding and proposes that the interconversion between fibril polymorphs driven by the solution environment change is a general property of amyloid fibrils. PMID:26023710

  12. A simplified method for the measurement of nonmetabolized 2-[18F]F-A-85380 in blood plasma using solid-phase extraction

    Quantification of α4β2* nicotinic acetylcholine receptors using 2-[18F]fluoro-3-(2(S)-azetidinylmethoxy)pyridine (2-[18F]FA) and positron emission tomography (PET) imaging requires measurement of nonmetabolized radioligand in blood plasma, which was previously accomplished using high-performance liquid chromatography (HPLC). Here, we introduce a one-step solid-phase extraction (SPE) method for measuring the concentration of nonmetabolized 2-[18F]FA. This method allows many samples to be processed in a short period of time. SPE effectively separated 2-[18F]FA from radioactive metabolites typically observed in blood plasma after administration of radioligand in humans. Measurements of the 2-[18F]FA parent fraction in healthy human volunteers obtained using the SPE method were nearly identical to those obtained using HPLC (1.3±5% average underestimation of SPE), and reproducibility was good within and between runs (2% and 6% coefficient of variation, respectively). SPE recovery of 2-[18F]FA from blood plasma was not appreciably diminished (3±0.6%) by a larger volume of blood plasma loaded onto the cartridge, suggesting the possibility of increasing the plasma sample volume at later times in a PET study to improve measurement sensitivity. 2-[18F]FA was stable in blood stored on ice over 8 h and in saline at low concentrations (18F]FA in healthy human volunteers were estimated as 4.2±0.8 h and 220±70 L, respectively. These results suggest that SPE is the method of choice for the determination of the plasma 2-[18F]FA concentration when measurement of individual metabolites is not required

  13. MnBr2/18-crown-6 coordination complexes showing high room temperature luminescence and quantum yield.

    Hausmann, David; Kuzmanoski, Ana; Feldmann, Claus

    2016-04-12

    The reaction of manganese(ii) bromide and the crown ether 18-crown-6 in the ionic liquid [(n-Bu)3MeN][N(Tf)2] under mild conditions (80-130 °C) resulted in the formation of three different coordination compounds: MnBr2(18-crown-6) (), Mn3Br6(18-crown-6)2 () and Mn3Br6(18-crown-6) (). In general, the local coordination and the crystal structure of all compounds are driven by the mismatch between the small radius of the Mn(2+) cation (83 pm) and the ring opening of 18-crown-6 as a chelating ligand (about 300 pm). This improper situation leads to different types of coordination and bonding. MnBr2(18-crown-6) represents a molecular compound with Mn(2+) coordinated by two bromine atoms and only five oxygen atoms of 18-crown-6. Mn3Br6(18-crown-6)2 falls into a [MnBr(18-crown-6)](+) cation - with Mn(2+) coordinated by six oxygen atoms and Br - and a [MnBr(18-crown-6)MnBr4](-) anion. In this anion, Mn(2+) is coordinated by five oxygen atoms of the crown ether as well as by two bromine atoms, one of them bridging to an isolated (MnBr4) tetrahedron. Mn3Br6(18-crown-6), finally, forms an infinite, non-charged [Mn2(18-crown-6)(MnBr6)] chain. Herein, 18-crown-6 is exocyclically coordinated by two Mn(2+) cations. All compounds show intense luminescence in the yellow to red spectral range and exhibit remarkable quantum yields of 70% (Mn3Br6(18-crown-6)) and 98% (Mn3Br6(18-crown-6)2). The excellent quantum yield of Mn3Br6(18-crown-6)2 and its differentiation from MnBr2(18-crown-6) and Mn3Br6(18-crown-6) can be directly correlated to the local coordination. PMID:26956783

  14. Imaging of central nAChReceptors with 2-[18F]F-A85380: optimized synthesis and in vitro evaluation in Alzheimer's disease

    In vivo labeling of the nicotinic acetylcholine receptors (nAChR) could be a useful tool for early diagnosis of neurodegenerative disorders. 2-[18F]F-A85380 (2-[18F]Fluoro-3-[2(S)-2-azetidinylmethoxy]pyridine), a ligand with high affinity to the β2 subunit of the nAChRs, has been shown to label neurons in the nAChR-rich thalamus, cortex and striatum in baboons. We report an optimized synthesis resulting in an uncorrected yield of 58% in 45 min (precursor 2), enabling efficient production intended for clinical use. Incubation of normal rat brain sections with 2-[18F]F-A85380 with subsequent autoradiographic analyses showed the expected distribution in nAChR areas. In human brain sections of Alzheimer's disease (AD) a decrease of 2-[18F]F-A85380 uptake to 36% of the control group was measured in the thalamus and also in the occipital cortex. These findings suggest that 2-[18F]F-A85380 is a promising PET-ligand in the diagnosis of AD

  15. The First Circumstellar Disk Imaged in Silhouette with Adaptive Optics: MagAO Imaging of Orion 218-354

    Follette, Katherine B; Males, Jared R; Kopon, Derek; Wu, Ya-Lin; Morzinski, Katie M; Hinz, Philip; Rodigas, Timothy J; Puglisi, Alfio; Esposito, Simone; Riccardi, Armando; Pinna, Enrico; Xompero, Marco; Briguglio, Runa

    2013-01-01

    We present high resolution adaptive optics (AO) corrected images of the silhouette disk Orion 218-354 taken with Magellan AO (MagAO) and its visible light camera, VisAO, in simultaneous differential imaging (SDI) mode at H-alpha. This is the first image of a circumstellar disk seen in silhouette with adaptive optics and is among the first visible light adaptive optics results in the literature. We derive the disk extent, geometry, intensity and extinction profiles and find, in contrast with previous work, that the disk is likely optically-thin at H-alpha. Our data provide an estimate of the column density in primitive, ISM-like grains as a function of radius in the disk. We estimate that only ~10% of the total sub-mm derived disk mass lies in primitive, unprocessed grains. We use our data, Monte Carlo radiative transfer modeling and previous results from the literature to make the first self-consistent multiwavelength model of Orion 218-354. We find that we are able to reproduce the 1-1000micron SED with a ~2...

  16. Spatially extended absorption around the z=2.63 radio galaxy MRC 2025-218: outflow or infall?

    Humphrey, A; Sánchez, S F; Alighieri, S di Serego; De Breuck, C; Binette, L; Tadhunter, C; Vernet, J; Fosbury, R; Stasielak, J

    2008-01-01

    We present an investigation into the absorber in front of the z=2.63 radio galaxy MRC 2025-218, using integral field spectroscopy obtained at the Very Large Telescope, and long slit spectroscopy obtained at the Keck II telescope. The properties of MRC 2025-218 are particularly conducive to study the nature of the absorbing gas, i.e., this galaxy shows bright and spatially extended Ly-alpha emission, along with bright continuum emission from the active nucleus. Ly-alpha absorption is detected across ~40x30 kpc^2, has a covering factor of ~1, and shows remarkably little variation in its properties across its entire spatial extent. This absorber is kinematically detached from the extended emission line region (EELR). Its properties suggest that the absorber is outside of the EELR. We derive lower limits to the HI, HII and H column densities for this absorber of 3x10^16, 7x10^17 and 2x10^18 cm^-2, respectively. Moreover, the relatively bright emission from the active nucleus has allowed us to measure a number of ...

  17. Synthesis of 2-[18F]fluoro-2-deoxy-L-glucose and positron emission tomography studies in monkeys

    2-[18F]Fluoro-2-deoxy-L-glucose was synthesized from its trifluoromethanesulfonyl precursor. The precursor was prepared by selective acetylation and triflation of L-mannose. L-Mannose was first treated with acetic anhydride in the presence of a catalytic amount of perchloric acid and then reacted with phosphorus tribromide followed by aqueous sodium acetate to produce pure 1,3,4,6-tetra-O-acetyl-a-L-mannopyranose in 32% yield. This compound was treated with trifluoromethanesulfonic anhydride and pyridine in methylene chloride to form 1,3,4,6-tetra-O-acetyl-2-O-trifluoromethanesulfonyl-a-L-mannopyranose in 77% yield. Nucleophilic substitution of the triflate with 18F- in the presence of Kryptofix 2.2.2. followed by acid hydrolysis produced 2-[18F]fluoro-2-deoxy-L-glucose with a radiochemical yield of 20-30% (EOS) within 90 min. Biodistribution studies in rats and PET imaging in Rhesus monkeys demonstrated that this sugar analog distributes in the extracellular space of most organs but is excluded from the CNS. (author)

  18. Removal of actinium from europium for the determination of specific radioactivity of ultra low-level Eu-152 in a sample exposed to atomic-bomb neutrons in Nagasaki

    Measurements of specific radioactivities of residual neutron-induced radionuclides such as 152Eu and 60Co have been carried out to check the validity of a series of computer calculations employed for the atomic-bomb neutron dosimetry in Hiroshima (exposed to uranium bomb) and Nagasaki (exposed to plutonium bomb). The use of these nuclides for atomic-bomb neutron dosimetry, however, has been limited by the following difficulties: (1) today, these radionuclides are found only at extremely low concentrations in materials exposed to the atomic-bomb and (2) the neutrons that induced these radionuclides were thermal and epithermal, while the neutron dose received in Hiroshima and Nagasaki is attributable to fast neutrons. In order to overcome the first difficulty, we established a chemical procedure to extract Eu and Co from materials exposed to the atomic-bomb, and the chemical procedure has been successful for the materials exposed to atomic-bomb within 1400 m in slant distance from the explosion point. As for Nagasaki, materials exposed in the distances farther than 1200 m have never been subjected to the measurement of residual neutron-induced radionuclides. In this work, determination of specific radioactivity of 152Eu (half-life: 13.542 y) in a sample exposed to Nagasaki atomic-bomb at a distant place from the explosion point was undertaken. But, because of radioactive decay during this ∝60 years since 1945 and long distance from the explosion point, the present specific radioactivity of 152Eu in the sample is extremely low (estimated to be ∝3 x 10-4 Bq-152Eu/mg-Eu), and a serious problem is interferences from daughters of 227Ac (half-life: 21.8 y) in the measurement of ultra low-level radioactivity of 152Eu. Hence, our chemical procedure to obtain Eu-enriched counting source should be improved, and much attention is being denoted to removal of Ac from Eu. (orig.)

  19. Radiation and chemical stability of 2-deoxy-2-[18F]fluoro-D-glucose radiopharmaceutical. Author-review of thesis

    A qualitative and quantitative analytical technique of low-molecular components of chemical and radiation-chemical decomposition of 2-deoxy-2-[18F]fluoro-D-glucose, 2-[18F]FDG radiopharmaceutical was developed for its extended quality control by HPLC with mass-spectrometric electro-spray ionisation detector (ESI MS). The analysis constituted from the liquid chromatography on silica gel NH2 bonded column combined with mass-spectrometric, UV-VIS, refraction index and radiometric detectors. A modern LC/MS system (Agilent 1100) was demonstrated to be suitable not only for identification of unknown analytes, but also for complex analysis of solutes except [18F]F-. This was advantageous for the 2-[18F]FDG autoradiolysis assessment about which no data were published. For comparative purposes, were used a classic thin layer chromatography (TLC) on silica gel with mobile phase acetonitril: water at 95:5 v/v, and HPTLC on NH2 modified silica gel like the LC column. Mobile phase was identical as by LC/MS method (acetonitril: 4 mM aqueous solution of ammonium formate 80:20 v/v). Retention times of reference samples: fluorodeoxyglucose, glucose, mannose, arabinose, deoxyglucose, gluconic and glucuronic acids at HPLC were established. Optimal performance of the ESI MS detector was discovered in negative ions mode or single ion monitoring (SIM) regime. The most intensive signal was observed for all analyte molecules association with formate anion HCOO- and also for negative ions of deprotonised molecules. All acids appeared in the form of their lactones. FDG and Glc exhibited tendency for formation of a mixed associate charged by HCOO- anion. On the amine bond silica gel HPTLC column, FDG is poorly separated from fluoride, which even in presence of Kryptofix 2.2.2 remains on the start like on the silica gel layer. At LC-MS Kryptofix provides a very well measurable signals of associates with NH4+ a H+ ions in positive mode of ESI MS. Concentration of (19F)FDG carrier in 2-[18F

  20. 节能BCD-248/H、BCD-218/H电冰箱的研究开发%Research and development the super energy- saving fridge BCD-218/H and BCD-248/H

    赵先美

    2002-01-01

    运用项目管理方法及ERA电冰箱分析设计软件来科学决策BCD-248/H、BCD-218/H超级节能冰箱的开发设计方案,对采用压缩机、发泡层厚度、门封结构、门一体发泡、电子温控及数显、采用二位三通电磁阀及制冷系统最优化设计等进行了详细的经济技术分析,根据成本与性能综合最优化原则确定了上述两种冰箱的开发设计方案,据此开发出的样机总体能效水平处于国内领先水平.

  1. Environmental assessment for Trench 33 widening in 218-W-5 Low-Level Burial Ground, Hanford Site, Richland, Washington

    This environmental assessment (EA) has been prepared to assess potential environmental impacts associated with the US Department of Energy''s proposed action: to widen and operated the unused Trench 33 in the 218-W-5 Low-Level Burial Ground. Information contained herein will be used by the US Department of Energy, Richland Operations Office Manager, to determine if the Proposed Action is a major federal action significantly affecting the quality of the human environment. If the Proposed Action is determined to be major and significant, an environmental impact statement will be prepared. If the Proposed Action is determined not to be major and significant, a Finding of No significant Impact will be issued and the action may proceed

  2. Estimating the Nucleotide Diversity in Ceratodon purpureus (Ditrichaceae from 218 Conserved Exon-Primed, Intron-Spanning Nuclear Loci

    Stuart F. McDaniel

    2013-04-01

    Full Text Available Premise of the study: We developed and tested primers for 218 nuclear loci for studying population genetics, phylogeography, and genome evolution in bryophytes. Methods and Results: We aligned expressed sequence tags (ESTs from Ceratodon purpureus to the Physcomitrella patens genome sequence, and designed primers that are homologous to conserved exons but span introns in the P. patens genome. We tested these primers on four isolates from New York, USA; Otavalo, Ecuador; and two laboratory isolates from Austria (WT4 and GG1. The median genome-wide nucleotide diversity was 0.008 substitutions/site, but the range was large (0–0.14, illustrating the among-locus heterogeneity in the species. Conclusions: These loci provide a valuable resource for finely resolved, genome-wide population genetic and species-level phylogenetic analyses of C. purpureus and its relatives.

  3. Erratum; A Three-Position Spectral Line Survey of Sagittarius B2 between 218 and 263 GHz. II. Data Analysis

    Nummelin, A.; Bergman, P.; Hjalmarson, Å.; Friberg, P.; Irvine, W. M.; Millar, T. J.; Ohishi, M.; Saito, S.

    2001-01-01

    In the paper ``A Three-Position Spectral Line Survey of Sagittarius B2 between 218 and 263 GHz. II. Data Analysis'' by A. Nummelin, P. Bergman, Å. Hjalmarson, P. Friberg, W. M. Irvine, T. J. Millar, M. Ohishi, and S. Saito (ApJS, 128, 213 [2000]), the affiliations for M. Ohishi and S. Saito were set incorrectly. The correct affiliation for M. Ohishi is National Astronomical Observatory of Japan, 2-21-1, Osawa, Mitaka, Tokyo 181-8588, Japan; ohishi@nao.ac.jp. The correct affiliation for S. Saito is Research Center for Development of Far-Infrared Region, Fukui University, 3-9-1 Bunkyo, Fukui 901-8507, Japan; saito@maxwell.apphy.fukui-u.ac.jp. The Press sincerely regrets this error.

  4. [18F]norchlorofluorohomoepibatidine. Synthesis, radiosynthesis, evaluation in vitro and comparison with 2-[18F]fluoro-A-85380 in mice

    In this abstract we describe synthesis, radiosynthesis and biological evalution of both stereoisomers of NCFHEB (norchlorofluorohomoepibatidine) and compare the biodistribution data with 2-[18F]fluoro-A-85380, a tracer currently used for imaging nicotinic receptors with PET. (orig.)

  5. MiR-495 and miR-218 regulate the expression of the Onecut transcription factors HNF-6 and OC-2

    Simion, Alexandru; Laudadio, Ilaria; Prevot, Pierre-Paul; Raynaud, Peggy; Lemaigre, Frederic P. [Universite catholique de Louvain, de Duve Institute, 75 Avenue Hippocrate 7529, B-1200 Brussels (Belgium); Jacquemin, Patrick, E-mail: patrick.jacquemin@uclouvain.be [Universite catholique de Louvain, de Duve Institute, 75 Avenue Hippocrate 7529, B-1200 Brussels (Belgium)

    2010-01-01

    MicroRNAs are small, non-coding RNAs that posttranscriptionally regulate gene expression mainly by binding to the 3'UTR of their target mRNAs. Recent data revealed that microRNAs have an important role in pancreas and liver development and physiology. Using cloning and microarray profiling approaches, we show that a unique repertoire of microRNAs is expressed at the onset of liver and pancreas organogenesis, and in pancreas and liver at key stages of cell fate determination. Among the microRNAs that are expressed at these stages, miR-495 and miR-218 were predicted to, respectively, target the Onecut (OC) transcription factors Hepatocyte Nuclear Factor-6 (HNF-6/OC-1) and OC-2, two important regulators of liver and pancreas development. MiR-495 and miR-218 are dynamically expressed in developing liver and pancreas, and by transient transfection, we show that they target HNF-6 and OC-2 3'UTRs. Moreover, when overexpressed in cultured cells, miR-495 and miR-218 decrease the endogenous levels of HNF-6 and OC-2 mRNA. These results indicate that the expression of regulators of liver and pancreas development is modulated by microRNAs. They also suggest a developmental role for miR-495 and miR-218.

  6. MiR-495 and miR-218 regulate the expression of the Onecut transcription factors HNF-6 and OC-2

    MicroRNAs are small, non-coding RNAs that posttranscriptionally regulate gene expression mainly by binding to the 3'UTR of their target mRNAs. Recent data revealed that microRNAs have an important role in pancreas and liver development and physiology. Using cloning and microarray profiling approaches, we show that a unique repertoire of microRNAs is expressed at the onset of liver and pancreas organogenesis, and in pancreas and liver at key stages of cell fate determination. Among the microRNAs that are expressed at these stages, miR-495 and miR-218 were predicted to, respectively, target the Onecut (OC) transcription factors Hepatocyte Nuclear Factor-6 (HNF-6/OC-1) and OC-2, two important regulators of liver and pancreas development. MiR-495 and miR-218 are dynamically expressed in developing liver and pancreas, and by transient transfection, we show that they target HNF-6 and OC-2 3'UTRs. Moreover, when overexpressed in cultured cells, miR-495 and miR-218 decrease the endogenous levels of HNF-6 and OC-2 mRNA. These results indicate that the expression of regulators of liver and pancreas development is modulated by microRNAs. They also suggest a developmental role for miR-495 and miR-218.

  7. 31 CFR 585.218 - Trade in United Nations Protected Areas of Croatia and those areas of the Republic of Bosnia and...

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Trade in United Nations Protected... HERZEGOVINA SANCTIONS REGULATIONS Prohibitions § 585.218 Trade in United Nations Protected Areas of Croatia... importation from, exportation to, or transshipment of goods through the United Nations Protected Areas in...

  8. 75 FR 32773 - Auction of 218-219 MHz Service and Phase II 220 MHz Service Licenses Scheduled for December 7...

    2010-06-09

    ... and impede the deployment of service to the public, and an additional default payment of more than... COMMISSION Auction of 218-219 MHz Service and Phase II 220 MHz Service Licenses Scheduled for December 7... overnight U.S. Postal Service mail. All filings must be addressed to the Commission's Secretary, Attn:...

  9. Prediction of outcome in head-and-neck cancer patients using the standardized uptake value of 2-[18F]fluoro-2-deoxy-D-glucose

    Allal, Abdelkarim Said; Slosman, Daniel O.; Kebdani, Tayeb; Allaoua, Mohamed Ghoulem; Lehmann, Willy; Dulguerov, Pavel

    2004-01-01

    Tumor uptake of 2-[(18)F] fluoro-2-deoxy-D-glucose (FDG) may relate to outcome in cancer patients. Pretreatment FDG uptake was evaluated as a predictor of local control (LC) and disease-free survival (DFS) in patients with head-and-neck cancer managed primarily either by radiotherapy (RT) or surgery.

  10. Dynamic 2-[18F]fluoro-2-deoxy-D-glucose positron emission tomography of liver tumours without blood sampling

    Keiding, S; Munk, O L; Schiøtt, K M;

    2000-01-01

    Positron emission tomography (PET) using 2-[18F]fluoro-2-deoxy-D-glucose (FDG) is a useful diagnostic tool for the detection of tumours. Using dynamic FDG PET, net metabolic clearance of FDG, K, can be calculated by Gjedde-Patlak analysis of the time course of the radioactivity concentrations in...

  11. Downregulation of miR-185 and upregulation of miR-218 expression may be potential diagnostic and prognostic biomarkers of human chondrosarcoma.

    Goudarzi, Peyman Karimi; Taheriazam, Afshin; Asghari, Saeid; Jamshidi, Mohammad; Shakeri, Mohammadreza; Yahaghi, Emad; Mirghasemi, Alireza

    2016-05-01

    Increasing evidence has confirmed that dysregulation of microRNAs (miRNAs) can contribute to the progression and metastasis of human tumors. Chondrosarcoma is the most common primary malignant bone tumor in adults and has no effective systemic treatment, and patients with this disease have poor survival. Thus, it is important to find new diagnostic markers and improve treatment options. In the current study, we are interested to examine the role of miR-185 and miR-218 expression in patients with chondrosarcoma using real-time PCR. Moreover, the association of the two miRNAs with clinicopathological features and prognosis was evaluated. Survival and Cox proportional hazards analyses were performed to find the association of miR-185 expression and miR-218 levels with prognosis in the patients. Our results indicated that the miR-185 expression was significantly downexpressed in clinical chondrosarcoma bone tissues compared with adjacent normal tissues (P = 0.001). MiR-218 expression level was increased in clinical chondrosarcoma bone tissue than those adjacent normal tissues (P = 0.001). Decreased expression of miR-185 showed remarkable correlation with advanced tumor stage (P = 0.019), tumor grade (P < 0.001), and distant metastasis (P = 0.001). Moreover, high expression of miR-218 was strongly correlated with advanced tumor stage (P = 0.014), tumor grade (P < 0.001), and distant metastasis (P = 0.002). Kaplan-Meier survival analysis revealed that the low miR-185 expression group and the high miR-218 expression group had remarkably shorter overall survival (log-rank test P = 0.007, P = 0.004). The multivariate Cox proportional hazards model indicated that decreased expression of miR-185 and increased expression of miR-218 (P = 0.017, P = 0.012), advanced tumor stage (P = 0.006, P = 0.012), tumor grade (P = 0.032, P = 0.016), and distant metastasis (P = 0.004, P = 0.015) were independently related

  12. Biodegradation and surfactant-mediated biodegradation of diesel fuel by 218 microbial consortia are not correlated to cell surface hydrophobicity

    Owsianiak, Mikolaj; Szulc, Alicja; Chrzanowski, Lukasz; Bogacki, Mariusz [Poznan Univ. of Technology (Poland). Inst. of Chemical Technology and Engineering; Cyplik, Pawel; Olejnik-Schmidt, Agniezka K. [Poznan Univ. of Life Sciences (Poland). Dept. of Biotechnology and Food Microbiology; Heipieper, Hermann J. [Helmholtz Centre for Environmental Research - UFZ, Leipzig (Germany). Dept. of Environmental Biotechnology

    2009-09-15

    In this study, we elucidated the role of cell surface hydrophobicity (microbial adhesion to hydrocarbons method, MATH) and the effect of anionic rhamnolipids and nonionic Triton X-100 surfactants on biodegradation of diesel fuel employing 218 microbial consortia isolated from petroleum-contaminated soils. Applied enrichment procedure with floating diesel fuel as a sole carbon source in liquid cultures resulted in consortia of varying biodegradation potential and diametrically different cell surface properties, suggesting that cell surface hydrophobicity is a conserved parameter. Surprisingly, no correlations between cell surface hydrophobicity and biodegradation of diesel fuel were found. Nevertheless, both surfactants altered cell surface hydrophobicity of the consortia in similar manner: increased for the hydrophilic and decreased for the hydrophobic cultures. In addition to this, the surfactants exhibited similar influence on diesel fuel biodegradation: Increase was observed for initially slow-degrading cultures and the opposite for fast degraders. This indicates that in the surfactant-mediated biodegradation, effectiveness of surfactants depends on the specification of microorganisms and not on the type of surfactant. In contrary to what was previously reported for pure strains, cell surface hydrophobicity, as determined by MATH, is not a good descriptor of biodegrading potential for mixed cultures. (orig.)

  13. Elastic scattering for 16O + 12C at 140 MeV and 218 MeV

    In this work, angular distribution of cross sections have been measured for 12C(16O,16O)12C at two energies. The measurements were carried out in 0.50 intervals between 50-19.50C (lab.) at 140 MeV, 4.50-14.50 at 218 MeV. An optical model analysis of these strong structure angular distributions was done. Good fits of the data were obtained using the optical model search code GENOA with a full Woods-Saxon potential form. This yielded parameters subject to considerable ambiguities as it is known to occur for strongly absorbed particles. These ambiguities were explored in detail and it was found that both the real and the imaginary parts present some characteristics that have been found before for the real potential (as Igo relation for continous ambiguities and the fact that potentials with different diffusivities tend to have the same value at the strong absorption radii). It was found, among other results, that the real volume integral, the mean square radius, as well as the total reaction cross section (σsub(r)) cannot be determined unambiguously. A strong correlation was found between σsub(r) and the imaginary diffusivity. A systematic study of how the variation of the potential parameters affects the angular distribution is presented and some features of the diffraction structure of the angular distribution are discussed. (author)

  14. 2-deoxy-2-(18F)fluoro-D-glucose positron emission tomography/computed tomography imaging in paediatric oncology

    John; Freebody; Eva; A; Wegner; Monica; A; Rossleigh

    2014-01-01

    Positron emission tomography(PET) is a minimally in-vasive technique which has been well validated for the diagnosis, staging, monitoring of response to therapy, and disease surveillance of adult oncology patients. Tra-ditionally the value of PET and PET/computed tomogra-phy(CT) hybrid imaging has been less clearly defined for paediatric oncology. However recent evidence has emerged regarding the diagnostic utility of these mo-dalities, and they are becoming increasingly important tools in the evaluation and monitoring of children with known or suspected malignant disease. Important indi-cations for 2-deoxy-2-(18F)fluoro-D-glucose(FDG) PET in paediatric oncology include lymphoma, brain tumours, sarcoma, neuroblastoma, Langerhans cell histiocytosis, urogenital tumours and neurofibromatosis type Ⅰ. This article aims to review current evidence for the use of FDG PET and PET/CT in these indications. Attention will also be given to technical and logistical issues, the description of common imaging pitfalls, and dosimetric concerns as they relate to paediatric oncology.

  15. A Tape Method for Fast Characterization and Identification of Active Pharmaceutical Ingredients in the 2-18 THz Spectral Range

    Kissi, Eric Ofosu; Bawuah, Prince; Silfsten, Pertti; Peiponen, Kai-Erik

    2015-03-01

    In order to find counterfeit drugs quickly and reliably, we have developed `tape method' a transmission spectroscopic terahertz (THz) measurement technique and compared it with a standard attenuated total reflection (ATR) THz spectroscopic measurement. We used well-known training samples, which include commercial paracetamol and aspirin tablets to check the validity of these two measurement techniques. In this study, the spectral features of some active pharmaceutical ingredients (APIs), such as aspirin and paracetamol are characterized for identification purpose. This work covers a wide THz spectral range namely, 2-18 THz. This proposed simple but novel technique, the tape method, was used for characterizing API and identifying their presence in their dosage forms. By comparing the spectra of the APIs to their dosage forms (powder samples), all distinct fingerprints present in the APIs are also present in their respective dosage forms. The positions of the spectral features obtained with the ATR techniques were akin to that obtained from the tape method. The ATR and the tape method therefore, complement each other. The presence of distinct fingerprints in this spectral range has highlighted the possibility of developing fast THz sensors for the screening of pharmaceuticals. It is worth noting that, the ATR method is applicable to flat faced tablets whereas the tape method is suitable for powders in general (e.g. curved surface tablets that require milling before measurement). Finally, we have demonstrated that ATR techniques can be used to screen counterfeit antimalarial tablets.

  16. Novel application of 2-[18F]fluoro-2-deoxy-D-glucose to study plant defenses

    Introduction: Since its first use in humans in 1976, 2-[18F]fluoro-2-deoxy-D-glucose (18FDG) continues to serve as a tracer to measure tissue glucose metabolism in medical imaging. Here we demonstrate a novel use for this tracer to study glycoside biosynthesis in plants as a measure of plant response to defense induction. Methods: Coupling autoradiography with radio high-performance liquid chromatography analysis of tissue extracts, we examined the combined effects of leaf wounding and treatment using the potent plant defense hormone, methyl jasmonate (MeJA), to measure tracer distribution and tracer use in secondary defense chemistry in Arabidopsis thaliana. We hypothesized that competing sinks like roots and reproductive tissues, as well as vascular architecture, would impact the induction of phenolic defenses of the plant that make use of glucose in glycoside formation by altering distribution and metabolic utilization of 18FDG. Results: Our studies showed that leaf orthostichy defined the major route of 18FDG transport in both vegetative and reproductive plants when a single petiole was cut as the entry point for tracer introduction. However, when nonorthostichous leaves were damaged and treated with MeJA, 18FDG was transported in its intact form to these leaves 3 h later, where it was incorporated into phenolic glycosides. Conclusions: Our work demonstrates a new use for 18FDG in plant science with insights into carbohydrate allocation that contradict conclusions of previous studies showing transport of resources away from damaged sites.

  17. Synthesis and evaluation of N-(2-[18F]fluoro-4-nitrobenzoyl)glucosamine. A preliminary report

    D-glucosamine at concentration of certain range could kill tumor cells without influencing normal cells. There are also some reports on the antitumor activity of d-glucosamine and its derivatives in murine models. It was therefore postulated that d-glucosamine might have the potential to invade tumor cells. We designed and radiosynthesized a glucosamine derivative, N-(2-[18F]fluoro-4-nitrobenzoyl)glucosamine ([18F]FNBG([18F]7)). Evaluations in vitro and in vivo were performed on tumor bearing mice. Excitingly, the radiochemical purity of [18F]FNBG([18F]7) was 99%, and besides the best radiochemical yield was up to 35%. The best T/Bl (Tumor/Blood) and T/M (Tumor/Muscle) ratios of [18F]FNBG([18F]7) were 4.40 and 4.84. Although [18F]FNBG([18F]7) deserved further studies, the results revealed it might become a potential PET imaging agent for detecting tumors. (author)

  18. Adduct of 2-[18F]FDG and 2-nitroimidazole as a putative radiotracer for the detection of hypoxia with PET: synthesis, in vitro- and in vivo-characterization

    A new sugar-coupled 2-nitroimidazole derivative ([18F]1) has been prepared in good radiochemical yields starting from peracetylated 2-[18F]FDG obtained from an automated 2-[18F]FDG production module. The corresponding glucose derivative 2 has proved to be able to inhibit 2-[18F]FDG uptake into tumor cells in a concentration dependent way. However, [18F]1 failed to show a retention in hypoxic tumor tissue thus excluding itself from further investigations

  19. Quantification of Kryptofix 2.2.2 in 2-[18F]FDG and other radiopharmaceuticals by LC/MS/MS

    A high-performance liquid chromatography-tandem mass spectrometric method (LC/MS/MS) was developed and validated for the quantitative analysis of Kryptofix (K-222) in the radiopharmaceuticals of 2-deoxy-2-[18F] fluoro-D-glucose (2-[18F]FDG) and 3-(3-((3-fluoropropyl)thio)-1,2,5-thiadiazol-4-yl)-1,2,5,6-tetrahydro -1-methylpyridine (FPTZTP). With an internal standard, the limit of quantitation for K-222 was 1.0 ng/ml. This is so far the most sensitive method for the quantification of K-222. Excellent linearity (RSQ=0.9997) was obtained over the range of 1.0-100 ng/ml. Good precision and accuracy were also observed. The method is amenable to the validation of radiosynthetic methods

  20. Fiber Diffraction of the Prion-Forming Domain HET-s(218-289) Shows Dehydration-Induced Deformation of a Complex Amyloid Structure

    Wan, William; Stubbs, Gerald [Vanderbilt

    2014-05-01

    Amyloids are filamentous protein aggregates that can be formed by many different proteins and are associated with both disease and biological functions. The pathogenicities or biological functions of amyloids are determined by their particular molecular structures, making accurate structural models a requirement for understanding their biological effects. One potential factor that can affect amyloid structures is hydration. Previous studies of simple stacked β-sheet amyloids have suggested that dehydration does not impact structure, but other studies indicated dehydration-related structural changes of a putative water-filled nanotube. Our results show that dehydration significantly affects the molecular structure of the fungal prion-forming domain HET-s(218–289), which forms a β-solenoid with no internal solvent-accessible regions. The dehydration-related structural deformation of HET-s(218–289) indicates that water can play a significant role in complex amyloid structures, even when no obvious water-accessible cavities are present.

  1. Collision-induced dissociation of Co+n (n=2--18) with Xe: Bond energies of cationic and neutral cobalt clusters, dissociation pathways, and structures

    The kinetic energy dependence of collision-induced dissociation (CID) of Co+n (n=2--18) with xenon is studied by using a guided ion beam mass spectrometer. Examination of the general dissociation behavior over a broad collision energy range shows that cobalt cluster cations dissociate exclusively by loss of single atoms (cluster ''evaporation''), with no evidence found for elimination of molecular cluster fragments. Bond dissociation energies for cobalt cluster cations, Co+n (n=2--18), are determined from measurements of the CID thresholds. Bond energies for neutral cobalt clusters, Con (n=4--18), are derived by combining these cationic bond energies with ionization energies for Con from the literature. The dependence of binding energy on cluster size is similar to that observed for iron clusters, and inspires some speculation regarding cluster ion structures

  2. Diurnal variations of 218Po, 214Pb, and 214Po and their effect on atmospheric electrical conductivity in the lower atmosphere at Mysore

    The short-lived radon daughters (218Po, 214Pb, 214Bi and 214Po) are natural tracers in the troposphere in particular near the ground surface. They are electrically charged particles and are chemically reactive. As soon as they are formed they get attached to the aerosol particles of the atmosphere. Their behaviour is similar to that of aerosols with respect to their growth, transport, removal processes in the atmosphere. The electrical conductivity of the atmosphere is mainly due to the presence of highly mobile (small) ions. Hence the electrical conductivity of air at near the surface of the earth mainly due to 222Rn, 218Po, 214Pb, 214Bi and 214Po concentrations, and depends on aerosol concentrations and meteorological parameters. The individual radon progeny concentrations (218Po, 214Pb, and 214Po) are measured using Air Flow meter. The concentration of radon in the atmospheric air is measured using Low Level Radon Detection System. The total energy released due to both radon and its progeny is computed in energy units (eV cm-3s-1) and is converted into ion-pair production rate (No. cm-3 s-1), 32 eV being the energy producing one-ion pair. The atmospheric electrical conductivity (both positive and negative) is measured using a Gerdien's apparatus with two identical tubes. The average values of 218Po, 214Pb, and 214Po are respectively 13.70, 1.45 and 1.92 Bq m-3 respectively. The average value of positive and negative electrical conductivity are 5.08 x 10-14U-1 m-1 and 4.67 x 10-14 U-1 m-1. The concentrations of radon, its progeny, and positive and negative conductivity show a similar kind of diurnal variations with maximum in the early morning hours and a minimum during day time. The activity is higher in winter than in summer and rainy season. (author)

  3. Schwangerschaftsabbruch als sprachliches Problem : eine linguistische Textanalyse ausgewählter Gesetzentwürfe zur Reform des § 218 StGB

    Beckmann, Pia

    2004-01-01

    Die Arbeit stellt eine linguistische Textanalyse von Gesetzentwürfen zur Reform des § 218 StGB aus dem Jahr 1991 dar. Mitspieler (Aktanten) in den jeweiligen Handlungsframes der Gesetzentwürfe sind die Frau als Entscheidungsträgerin für die Handlung "Schwangerschaftsabbruch", der Arzt, der den Schwangerschaftsabbruch vornimmt, und der Embryo, der abgetrieben wird. Unter Rückgriff auf die Prototypensemantik werden die Handlung und die Aktanten in dem jeweiligen Textzusammenhang der einzelnen G...

  4. Two-way shape memory effect and mechanical properties of Pulse Discharge Sintered Ni2.18Mn0.82Ga

    Takagi, T; Khovailo, V.; Nagatomo, T.; Matsumoto, M.; Ohtsuka, M; T. Abe; Miki, H

    2003-01-01

    Mechanical and shape memory properties of a polycrystalline Ni2.18Mn0.82Ga alloy prepared by a PDS (Pulse Discharge Sintering) method were investigated. It was found that the material demonstrates the two-way shape memory effect after a loading - unloading cycle performed in the martensitic state, i. e. essentially without special training. The samples exhibiting the two-way shape memory effect show a significant enhancement in the magnitude of magnetic-field-induced strain.

  5. Heterogeneous Seeding of a Prion Structure by a Generic Amyloid Form of the Fungal Prion-forming Domain HET-s(218-289)

    Wan, William; Bian, Wen; McDonald, Michele; Kijac, Aleksandra; Wemmer, David E.; Stubbs, Gerald [UCB; (Vanderbilt); (LBNL)

    2013-11-13

    The fungal prion-forming domain HET-s(218–289) forms infectious amyloid fibrils at physiological pH that were shown by solid-state NMR to be assemblies of a two-rung β-solenoid structure. Under acidic conditions, HET-s(218–289) has been shown to form amyloid fibrils that have very low infectivity in vivo, but structural information about these fibrils has been very limited. We show by x-ray fiber diffraction that the HET-s(218–289) fibrils formed under acidic conditions have a stacked β-sheet architecture commonly found in short amyloidogenic peptides and denatured protein aggregates. At physiological pH, stacked β-sheet fibrils nucleate the formation of the infectious β-solenoid prions in a process of heterogeneous seeding, but do so with kinetic profiles distinct from those of spontaneous or homogeneous (seeded with infectious β-solenoid fibrils) fibrillization. Several serial passages of stacked β-sheet-seeded solutions lead to fibrillization kinetics similar to homogeneously seeded solutions. Our results directly show that structural mutation can occur between substantially different amyloid architectures, lending credence to the suggestion that the processes of strain adaptation and crossing species barriers are facilitated by structural mutation.

  6. IUPAC critical evaluation of the rotational-vibrational spectra of water vapor. Part I-Energy levels and transition wavenumbers for H217O and H218O

    This is the first part of a series of articles reporting critically evaluated rotational-vibrational line positions, transition intensities, pressure dependence and energy levels, with associated critically reviewed assignments and uncertainties, for all the main isotopologues of water. The present article contains energy levels and data for line positions of the singly substituted isotopologues H217O and H218O. The procedure and code MARVEL, standing for measured active rotational-vibrational energy levels, is used extensively in all stages of determining the validated levels and lines and their self-consistent uncertainties. The spectral regions covered for both isotopologues H217O and H218O are 0-17125cm-1. The energy levels are checked against ones determined from accurate variational calculations. The number of critically evaluated and recommended levels and lines are, respectively, 2687 and 8614 for H217O, and 4839 and 29 364 for H218O. The extensive lists of MARVEL lines and levels obtained are deposited in the Supplementary Material, as well as in a distributed information system applied to water, W-DIS, where they can easily be retrieved. A distinguishing feature of the present evaluation of water spectroscopic data is the systematic use of all available experimental data and validation by first-principles theoretical calculations.

  7. Dual-time-point O-(2-[18F]fluoroethyl)-L-tyrosine PET for grading of cerebral gliomas

    We aimed to evaluate the diagnostic potential of dual-time-point imaging with positron emission tomography (PET) using O-(2-[18F]fluoroethyl)-L-tyrosine (18F-FET) for non-invasive grading of cerebral gliomas compared with a dynamic approach. Thirty-six patients with histologically confirmed cerebral gliomas (21 primary, 15 recurrent; 24 high-grade, 12 low-grade) underwent dynamic PET from 0 to 50 min post-injection (p.i.) of 18F-FET, and additionally from 70 to 90 min p.i. Mean tumour-to-brain ratios (TBRmean) of 18F-FET uptake were determined in early (20-40 min p.i.) and late (70-90 min p.i.) examinations. Time-activity curves (TAC) of the tumours from 0 to 50 min after injection were assigned to different patterns. The diagnostic accuracy of changes of 18F-FET uptake between early and late examinations for tumour grading was compared to that of curve pattern analysis from 0 to 50 min p.i. of 18F-FET. The diagnostic accuracy of changes of the TBRmean of 18F-FET PET uptake between early and late examinations for the identification of HGG was 81 % (sensitivity 83 %; specificity 75 %; cutoff - 8 %; p < 0.001), and 83 % for curve pattern analysis (sensitivity 88 %; specificity 75 %; p < 0.001). Dual-time-point imaging of 18F-FET uptake in gliomas achieves diagnostic accuracy for tumour grading that is similar to the more time-consuming dynamic data acquisition protocol. (orig.)

  8. Radiation dosimetry estimation of N-(2-[18F]fluoropropionyl)- L-glutamate based on the mice distribution data

    N-(2-[18F]fluoropropionyl)-L-glutamate([18F]FPGLU) was a recently developed potential amino acid tracer for tumor imaging with positron emission tomography–computer tomography (PET–CT). The absorbed and effective radiation doses resulting from the intravenous administration of [18F]FPGLU were estimated using biodistribution data from normal mice. The methodology recommended by Medical Internal Radiation Dose Committee (MIRD) was used to estimate the doses. The highest uptake of [18F]FPGLU was found in the kidneys, followed by the liver and lung. The kidneys were the organ received the highest absorbed dose, 58.4 μGy/MBq, the brain received the lowest dose, 5.5 μGy/MBq, and other organs received doses in the range of 8.3–11.9 μGy/MBq. The effective dose was 17.0 μSv/MBq. The data show that a 370 MBq (10 mCi) injection of [18F]FPGLU would lead to an estimated effective dose of 6.3 mSv, which is within the accepted range of routine nuclear medicine investigations. - Highlights: • The absorbed and effective radiation dosimetry of [18F]FPGLU was estimated using the biodistribution data from normal mice. • A 370 MBq (10 mCi) injection of [18F] FPGLU would lead to an estimated effective dose of 6.3 mSv, which is within the accepted range of routine nuclear medicine investigations. • [18F]FPGLU is a safe amino acid PET tracer for imaging and can be used in further clinical study

  9. Response of the unattached 218Po activity size distribution in H2O-SO2-N2 atmospheres

    The response of the unattached 218Po activity size distribution to variations in H2O and SO2 concentration was investigated in a high-purity N2 atmosphere. Lognormal size distributions were reconstructed from screen diffusion battery data using a random search and optimization procedure. For relative humidities of 1% to 90%, SO2 concentrations of 0-6 ppm, and residence times of 38 s, median diameters of the unattached mode ranged from 0.50 (± 0.04) to 0.80 (± 0.06) nm, corresponding to diffusion coefficients of 0.1-0.05 cm2 s-1. Increases in water vapor concentration resulted in an enhanced rate of ion neutralization and suppression of ion cluster formation. Decreases in cluster diameter with increasing humidity were therefore observed. Addition of SO2 at constant relative humidity resulted in an initial increase in diameter, with a subsequent decrease. Geometric standard deviations averaged 1.05 (± 0.01) to 1.06 (± 0.01) in all cases, with the unattached fraction comprising 83% to 88% of the total distribution. Results suggest that increases in water vapor concentration enhance neutralization in the immediate vicinity of the recoil path through water radiolysis. Conversion of OH to H2OSO4 on addition of SO2 provides a binary condensable phase capable of clustering around the ion at low relative humidities, increasing particle size. High H2O and SO2 concentrations enhance neutralization through electron scavenging and subsequent ion collision near the end of the recoil path, decreasing the number of available cluster sites and suppressing cluster formation. This reduction is more significant than the increasing size of the stable ion cluster, with increasing H2O and H2SO4 concentrations as predicted by Raes, resulting in decreases in both median diameter and distribution spread

  10. The propagation of a soil H218O labeling through the atmosphere-plant-soil system under drought using H218O and C18OO as two independent proxies

    Barthel, Matthias; Sturm, Patrick; Hammerle, Albin; Siegwolf, Rolf; Gentsch, Lydia; Buchmann, Nina; Knohl, Alexander

    2013-04-01

    Above- and belowground processes in plants are tightly coupled via carbon and water flows through the atmosphere-plant-soil system. While recent studies elucidated the influence of drought on the carbon flow through plant and soil using 13C, much less is known about the propagation of 18O. Therefore, this study aimed to examine the timing and intensity of 18O enrichment in soil and shoot CO2 and H2O vapor fluxes of European beech saplings (Fagus sylvatica L.) after applying 18O-labeled water to the soil. A custom-made chamber system, separating shoot from soil compartments, allowed independent measurements of shoot and soil related processes in a controlled climate chamber environment. Gas-exchange of oxygen stable isotopes in CO2 and H2O-vapor served as the main tool for investigation and was monitored in real-time using laser spectroscopy. This is the first study measuring concurrently and continuously the enrichment of 18O in CO2 and H2O in shoot- and soil gas-exchange after applying 18O-labeled water to the soil. Photosynthesis (A) and stomatal conductance (gs) of drought-stressed plants showed an immediate coinciding small increase to the H218O irrigation event after only ~30 min. This rapid information transfer, however, was not accompanied by the arrival of 18O labeled water molecules within the shoot. The actual label induced 18O enrichment in transpired water and CO2 occurred not until ~4h after labeling. Further, the timing of the enrichment of 18O in the transpirational flux was similar in both treatments, thus pointing to similar transport rates. However, drought reduced the 18O exchange rate between H2O and CO2at the shoot level, likely caused by a smaller leaf CO2retroflux. Moreover, 18O exchange between H2O and CO2 occurred also in the soil. However, the there was no difference observed between the treatments.

  11. Uptake of O-(2-[18F]fluoroethyl)-L-tyrosine in reactive astrocytosis in the vicinity of cerebral gliomas

    PET using O-(2-[18F]fluoroethyl)-L-tyrosine (18F-FET) allows improved imaging of tumor extent of cerebral gliomas in comparison to MRI. In experimental brain infarction and hematoma, an unspecific accumulation of 18F-FET has been detected in the area of reactive astrogliosis which is a common cellular reaction in the vicinity of cerebral gliomas. The aim of this study was to investigate possible 18F-FET uptake in the area of reactive gliosis in the vicinity of untreated and irradiated rat gliomas. Methods: F98-glioma cells were implanted into the caudate nucleus of 33 Fisher CDF rats. Sixteen animals remained untreated and in 17 animals the tumor was irradiated by Gamma Knife 5–8 days after implantation (2/50 Gy, 3/75 Gy, 6/100 Gy, 6/150 Gy). After 8–17 days of tumor growth the animals were sacrificed following injection of 18F-FET. Brains were removed, cut in coronal sections and autoradiograms of 18F-FET distribution were produced and compared with histology (toluidine blue) and reactive astrogliosis (GFAP staining). 18F-FET uptake in the tumors and in areas of reactive astrocytosis was evaluated by lesion to brain ratios (L/B). Results: Large F98-gliomas were present in all animals showing increased 18F-FET-uptake which was similar in irradiated and non-irradiated tumors (L/B: 3.9 ± 0.8 vs. 4.0 ± 1.3). A pronounced reactive astrogliosis was noted in the vicinity of all tumors that showed significantly lower 18F-FET-uptake than the tumors (L/B: 1.5 ± 0.4 vs. 3.9 ± 1.1). The area of 18F-FET-uptake in the tumor was congruent with histological tumor extent in 31/33 animals. In 2 rats irradiated with 150 Gy, however, high 18F-FET uptake was noted in the area of astrogliosis which led to an overestimation of the tumor size. Conclusions: Reactive astrogliosis in the vicinity of gliomas generally leads to only a slight 18F-FET-enrichment that appears not to affect the correct definition of tumor extent for treatment planning

  12. Evaluation of lymphocyte levels in a random sample of 218 elderly individuals from São Paulo city

    Daniela Teixeira

    2011-10-01

    Full Text Available BACKGROUND: Age-associated changes in the immune system cause decreased protection after vaccination and increased rates of infections and tumor development. METHODS: Lymphocyte percentages were compared by gender and age to establish differences between subtypes. Three mL blood samples were obtained from 218 randomly selected individuals (60-101 years old who live in São Paulo city. Blood was lysed with Tris phosphate buffer and stained for 30 minutes with monoclonal antibodies (CD3PerCP, CD4FITC, CD8Pe, CD19Pe for analysis by flow cytometry. Statistical analysis was by ANOVA. RESULTS: The percentage of CD4+ T cells (p-value = 0.005 and the CD4/CD8 ratio (p-value = 0.010 were lower in men, whereas the percentage of CD8+ T cells was lower (p-value = 0.002 in women; the percentage of B cells (CD19+ was similar between groups. Individuals grouped by gender and age range and compared showed a drop in CD4+ cells in 75 to 79-year-old men (female: 46.1% ± 8.1% and male: 38.8% ± 10.5%; p-value = 0.023. Also, the 80 to 84-year-old group of men had a higher percentage of CD8+ (female: 20.8% ± 8.2%, and male: 27.2% ± 8.2%; p-value = 0.032. Low percentages of B cells were detected in men in the 75 to 79-year-old (p-value = 0.003, 85 to 89-year-old (p-value = 0.020 and older than 90 year old (p-value = 0.002 age ranges. CONCLUSION: Elderly men present with more changes in lymphocyte subsets compared to elderly women. These findings could demonstrate impairment in the immune response since the lower CD4+ in men would provide less help to B cells (also lower in men in terms of antibody production. In addition, the increase in CD8+ cells in this group could represent chronic inflammation observed during the aging process.

  13. Diagnosis of pseudoprogression in patients with glioblastoma using O-(2-[18F]fluoroethyl)-l-tyrosine PET

    The follow-up of glioblastoma patients after radiochemotherapy with conventional MRI can be difficult since reactive alterations to the blood-brain barrier with contrast enhancement may mimic tumour progression (i.e. pseudoprogression, PsP). The aim of this study was to assess the clinical value of O-(2-18F-fluoroethyl)-l-tyrosine (18F-FET) PET in the differentiation of PsP and early tumour progression (EP) after radiochemotherapy of glioblastoma. A group of 22 glioblastoma patients with new contrast-enhancing lesions or lesions showing increased enhancement (>25 %) on standard MRI within the first 12 weeks after completion of radiochemotherapy with concomitant temozolomide (median 7 weeks) were additionally examined using amino acid PET with 18F-FET. Maximum and mean tumour-to-brain ratios (TBRmax, TBRmean) were determined. 18F-FET uptake kinetic parameters (i.e. patterns of time-activity curves, TAC) were also evaluated. Classification as PsP or EP was based on the clinical course (no treatment change at least for 6 months), follow-up MR imaging and/or histopathological findings. Imaging results were also related to overall survival (OS). PsP was confirmed in 11 of the 22 patients. In patients with PsP, 18F-FET uptake was significantly lower than in patients with EP (TBRmax 1.9 ± 0.4 vs. 2.8 ± 0.5, TBRmean 1.8 ± 0.2 vs. 2.3 ± 0.3; both P < 0.001) and presence of MGMT promoter methylation was significantly more frequent (P = 0.05). Furthermore, a TAC type II or III was more frequently present in patients with EP (P = 0.04). Receiver operating characteristic analysis showed that the optimal 18F-FET TBRmax cut-off value for identifying PsP was 2.3 (sensitivity 100 %, specificity 91 %, accuracy 96 %, AUC 0.94 ± 0.06; P < 0.001). Univariate survival analysis showed that a TBRmax <2.3 predicted a significantly longer OS (median OS 23 vs. 12 months; P = 0.046). 18F-FET PET may facilitate the diagnosis of PsP following radiochemotherapy of glioblastoma. (orig.)

  14. A program for calculating load coefficient matrices utilizing the force summation method, L218 (LOADS). Volume 2: Supplemental system design and maintenance document

    Anderson, L. R.; Miller, R. D.

    1979-01-01

    The LOADS computer program L218 which calculates dynamic load coefficient matrices utilizing the force summation method is described. The load equations are derived for a flight vehicle in straight and level flight and excited by gusts and/or control motions. In addition, sensor equations are calculated for use with an active control system. The load coefficient matrices are calculated for the following types of loads: (1) translational and rotational accelerations, velocities, and displacements; (2) panel aerodynamic forces; (3) net panel forces; and (4) shears, bending moments, and torsions.

  15. Positron emission tomography with 2-deoxy-2-[18F]fluoro-d -glucose in patients with thyroid diseases : FDG PET in thyroid diseases

    2011-01-01

    The aim of this thesis was to contribute to the field of positron emission tomography (PET) with 2-deoxy-2-[18F]fluoro-D-glucose (FDG) in benign and malignant diseases of the thyroid gland. The primary method used was review of retrospectively or prospectively enrolled patients referred for FDG PET at the Mayo Clinic, Rochester, MN, USA. PET findings were compared with the results of all other imaging, laboratory results and clinical information, as well as, extensive recording of follow-up i...

  16. The usefulness of dynamic O-(2-18F-fluoroethyl)-L-tyrosine PET in the clinical evaluation of brain tumors in children and adolescents

    Dunkl, Veronika; Cleff, Corvin; Stoffels, Gabriele; Judov, Natalie; Sarikaya-Seiwert, Sevgi; Law, Ian; Bøgeskov, Lars; Nysom, Karsten; Andersen, Sofie B; Steiger, Hans-Jakob; Fink, Gereon R; Reifenberger, Guido; Shah, Nadim J; Coenen, Heinz H; Langen, Karl-Josef; Galldiks, Norbert

    2015-01-01

    UNLABELLED: Experience regarding O-(2-(18)F-fluoroethyl)-L-tyrosine ((18)F-FET) PET in children and adolescents with brain tumors is limited. METHODS: Sixty-nine (18)F-FET PET scans of 48 children and adolescents (median age, 13 y; range, 1-18 y) were analyzed retrospectively. Twenty-six scans to...... by receiver-operating-characteristic curve analyses using histology or clinical course as a reference. RESULTS: In patients with newly diagnosed cerebral lesions, the highest accuracy (77%) to detect neoplastic tissue (19/26 patients) was obtained when the maximum TBR was 1.7 or greater (area under...

  17. Continuous monitoring α-activity on aerosol filters by the pseudo-coincidence-technique. Explicitly taking into account the short lived Po-218 activity

    Pseudo-coincidence-technique is applied to continuous monitoring of α-activity on aerosolfilters by proportional counters. Filter activity can markedly increase or decrease by changing air conditions especially by the amount of short lived Po-218 activity. Conditions of constant proportions of activity concentrations for the short lived species for operating this technique are seldom fulfilled. The dynamic behavior of artificial (long lived) and natural (short lived) activity is mathematically modelled and the measured moving count rates are analyzed under this model by a multivariate regression analysis for activity concentrations of artificial resp. short lived activity. Results are compared to standard recommendations of DIN ISO 11929.

  18. Estimation of the release and migration of lead through soils and groundwater at the Hanford Site 218-E-12B Burial Ground. Volume 2, Appendices

    Rhoads, K.; Bjornstad, B.N.; Lewis, R.E.; Teel, S.S.; Cantrell, K.J.; Serne, R.J.; Smoot, J.L.; Kincaid, C.T.; Wurstner, S.K.

    1992-10-01

    This report describes the technical basis for a groundwater transport analysis that was conducted to evaluate migration of potentially hazardous materials from the Hanford Site 218-E-12B burial ground. The analysis characterized the geologic, chemical, and hydrologic properties of the disposal site, and used that information to perform a screening analysis for transport of materials from the burial ground to downgradient groundwater locations and to the Columbia River. Subsequent sections of the appendix describe the geologic setting, geochemistry, and hydrology of the disposal site and their relationship to the transport analysis.

  19. Estimation of the release and migration of lead through soils and groundwater at the Hanford Site 218-E-12B Burial Ground

    Rhoads, K.; Bjornstad, B.N.; Lewis, R.E.; Teel, S.S.; Cantrell, K.J.; Serne, R.J.; Smoot, J.L.; Kincaid, C.T.; Wurstner, S.K.

    1992-10-01

    This report describes the technical basis for a groundwater transport analysis that was conducted to evaluate migration of potentially hazardous materials from the Hanford Site 218-E-12B burial ground. The analysis characterized the geologic, chemical, and hydrologic properties of the disposal site, and used that information to perform a screening analysis for transport of materials from the burial ground to downgradient groundwater locations and to the Columbia River. Subsequent sections of the appendix describe the geologic setting, geochemistry, and hydrology of the disposal site and their relationship to the transport analysis.

  20. The use of C-18 SEP PAK cartridges to simplify routine production of 2-deoxy-2-[18F]fluoro-D-glucose

    The synthesis of 2-deoxy-2[18F]fluoro-D-glucose has been simplified by the use of C-18 SEP PAK cartridges. The fluorinated sugar produced from the reaction of acetyl hypofluorite and tri-acetyl glucal (TAG) was extracted from the neutralized reaction mixture with C-18 SEP PAK cartridges. The product was washed off the cartridge with diethyl ether and hydrolyzed by HCl. After hydrolysis the product was purified by passage through ion retardation resin, alumina and another C-18 cartridge. The radiochemical purity was 98% and the radiochemical yield was 28%, decay corrected to EOB, with a total synthesis time of 50 min from EOB. (author)

  1. THE FIRST CIRCUMSTELLAR DISK IMAGED IN SILHOUETTE AT VISIBLE WAVELENGTHS WITH ADAPTIVE OPTICS: MagAO IMAGING OF ORION 218-354

    We present high-resolution adaptive optics (AO) corrected images of the silhouette disk Orion 218-354 taken with Magellan AO (MagAO) and its visible light camera, VisAO, in simultaneous differential imaging mode at Hα. This is the first image of a circumstellar disk seen in silhouette with AO and is among the first visible light AO results in the literature. We derive the disk extent, geometry, intensity, and extinction profiles and find, in contrast with previous work, that the disk is likely optically thin at Hα. Our data provide an estimate of the column density in primitive, ISM-like grains as a function of radius in the disk. We estimate that only ∼10% of the total submillimeter derived disk mass lies in primitive, unprocessed grains. We use our data, Monte Carlo radiative transfer modeling, and previous results from the literature to make the first self-consistent multiwavelength model of Orion 218-354. We find that we are able to reproduce the 1-1000 μm spectral energy distribution with a ∼2-540 AU disk of the size, geometry, small versus large grain proportion, and radial mass profile indicated by our data. This inner radius is a factor of ∼15 larger than the sublimation radius of the disk, suggesting that it is likely cleared in the very interior

  2. THE FIRST CIRCUMSTELLAR DISK IMAGED IN SILHOUETTE AT VISIBLE WAVELENGTHS WITH ADAPTIVE OPTICS: MagAO IMAGING OF ORION 218-354

    Follette, Katherine B.; Close, Laird M.; Males, Jared R.; Wu, Ya-Lin; Morzinski, Katie M.; Hinz, Philip; Rodigas, Timothy J. [Steward Observatory, The University of Arizona, 933 N Cherry Avenue, Tucson, AZ 85721 (United States); Kopon, Derek [Max Planck Institute for Astronomy, Königstuhl 17, D-69117 Heidelberg (Germany); Puglisi, Alfio; Esposito, Simone; Riccardi, Armando; Pinna, Enrico; Xompero, Marco; Briguglio, Runa [INAF - Osservatorio Astrofisico di Arcetri, Largo E. Fermi 5, I-50125 Firenze (Italy)

    2013-09-20

    We present high-resolution adaptive optics (AO) corrected images of the silhouette disk Orion 218-354 taken with Magellan AO (MagAO) and its visible light camera, VisAO, in simultaneous differential imaging mode at Hα. This is the first image of a circumstellar disk seen in silhouette with AO and is among the first visible light AO results in the literature. We derive the disk extent, geometry, intensity, and extinction profiles and find, in contrast with previous work, that the disk is likely optically thin at Hα. Our data provide an estimate of the column density in primitive, ISM-like grains as a function of radius in the disk. We estimate that only ∼10% of the total submillimeter derived disk mass lies in primitive, unprocessed grains. We use our data, Monte Carlo radiative transfer modeling, and previous results from the literature to make the first self-consistent multiwavelength model of Orion 218-354. We find that we are able to reproduce the 1-1000 μm spectral energy distribution with a ∼2-540 AU disk of the size, geometry, small versus large grain proportion, and radial mass profile indicated by our data. This inner radius is a factor of ∼15 larger than the sublimation radius of the disk, suggesting that it is likely cleared in the very interior.

  3. Interactions of Neuropathogenic Escherichia coli K1 (RS218) and Its Derivatives Lacking Genomic Islands with Phagocytic Acanthamoeba castellanii and Nonphagocytic Brain Endothelial Cells

    Yousuf, Farzana Abubakar; Yousuf, Zuhair; Iqbal, Junaid; Siddiqui, Ruqaiyyah; Khan, Hafsa; Khan, Naveed Ahmed

    2014-01-01

    Here we determined the role of various genomic islands in E. coli K1 interactions with phagocytic A. castellanii and nonphagocytic brain microvascular endothelial cells. The findings revealed that the genomic islands deletion mutants of RS218 related to toxins (peptide toxin, α-hemolysin), adhesins (P fimbriae, F17-like fimbriae, nonfimbrial adhesins, Hek, and hemagglutinin), protein secretion system (T1SS for hemolysin), invasins (IbeA, CNF1), metabolism (D-serine catabolism, dihydroxyacetone, glycerol, and glyoxylate metabolism) showed reduced interactions with both A. castellanii and brain microvascular endothelial cells. Interestingly, the deletion of RS218-derived genomic island 21 containing adhesins (P fimbriae, F17-like fimbriae, nonfimbrial adhesins, Hek, and hemagglutinin), protein secretion system (T1SS for hemolysin), invasins (CNF1), metabolism (D-serine catabolism) abolished E. coli K1-mediated HBMEC cytotoxicity in a CNF1-independent manner. Therefore, the characterization of these genomic islands should reveal mechanisms of evolutionary gain for E. coli K1 pathogenicity. PMID:24818136

  4. Interactions of Neuropathogenic Escherichia coli K1 (RS218 and Its Derivatives Lacking Genomic Islands with Phagocytic Acanthamoeba castellanii and Nonphagocytic Brain Endothelial Cells

    Farzana Abubakar Yousuf

    2014-01-01

    Full Text Available Here we determined the role of various genomic islands in E. coli K1 interactions with phagocytic A. castellanii and nonphagocytic brain microvascular endothelial cells. The findings revealed that the genomic islands deletion mutants of RS218 related to toxins (peptide toxin, α-hemolysin, adhesins (P fimbriae, F17-like fimbriae, nonfimbrial adhesins, Hek, and hemagglutinin, protein secretion system (T1SS for hemolysin, invasins (IbeA, CNF1, metabolism (D-serine catabolism, dihydroxyacetone, glycerol, and glyoxylate metabolism showed reduced interactions with both A. castellanii and brain microvascular endothelial cells. Interestingly, the deletion of RS218-derived genomic island 21 containing adhesins (P fimbriae, F17-like fimbriae, nonfimbrial adhesins, Hek, and hemagglutinin, protein secretion system (T1SS for hemolysin, invasins (CNF1, metabolism (D-serine catabolism abolished E. coli K1-mediated HBMEC cytotoxicity in a CNF1-independent manner. Therefore, the characterization of these genomic islands should reveal mechanisms of evolutionary gain for E. coli K1 pathogenicity.

  5. Stability study of 2-[18F]Fluoro-2-Deoxy-D-Glucose (18FDG) stored at room temperature by physicochemical and microbiological assays

    The most widely used radiopharmaceutical in the expanding medical imaging technology of Positron Emission Tomography (PET) is 2-[18F]fluoro-2-deoxy-D-glucose (18FDG). The increasing demand for 18FDG requires reliable production in large amounts. The synthesis of 18FDG is based on a nucleophilic substitution of the triflate-leaving group from the precursor, mannose triflate, in the presence of Crypt and 2.2.2, as a phase-transfer agent. After labeling, the removal of the acetyl protecting groups from resulting 2-[18F]fluoro-1,3,4,6-tetra-Oacetyl- D-glucose is performed by alkaline hydrolysis, followed by purification and final filtration (0.22 μm). It was reported that 18FDG decomposes in vitro, resulting in the degradation of the radiochemical purity with time. The aim of this study was to evaluate physicochemical and microbiological stability of 18FDG, stored at room temperature (15-30 deg C), at different time intervals. It was investigated how the quality of this radiopharmaceutical varies with time under the influence of environmental factors. 18FDG pH, radionuclidic identity and purity, radiochemical identity and purity, chemical purity, residual solvents, bacterial endotoxins and sterility were evaluated according to the United States Pharmacopeia 31th edition analytical methods and acceptance criteria. The results suggest that 18FDG has physicochemical and microbiological stability up to 10 hours after the end of synthesis, under experimental conditions. (author)

  6. An Ammonia Spectral Map of the L1495-B218 Filaments in the Taurus Molecular Cloud : I. Physical Properties of Filaments and Dense cores

    Seo, Young Min; Goldsmith, Paul; Ward-Thompson, Derek; Kirk, Jason M; Schmalzl, Markus; Lee, Jeong-Eun; Friesen, Rachel; Langston, Glen; Masters, Joe; Garwood, Robert W

    2015-01-01

    We present deep NH$_3$ observations of the L1495-B218 filaments in the Taurus molecular cloud covering over a 3 degree angular range using the K-band focal plane array on the 100m Green Bank Telescope. The L1495-B218 filaments form an interconnected, nearby, large complex extending over 8 pc. We observed NH$_3$ (1,1) and (2,2) with a spectral resolution of 0.038 km/s and a spatial resolution of 31$"$. Most of the ammonia peaks coincide with intensity peaks in dust continuum maps at 350 $\\mu$m and 500 $\\mu$m. We deduced physical properties by fitting a model to the observed spectra. We find gas kinetic temperatures of 8 $-$ 15 K, velocity dispersions of 0.05 $-$ 0.25 km/s, and NH$_3$ column densities of 5$\\times$10$^{12}$ $-$ 1$\\times$10$^{14}$ cm$^{-2}$. The CSAR algorithm, which is a hybrid of seeded-watershed and binary dendrogram algorithms, identifies a total of 55 NH$_3$ structures including 39 leaves and 16 branches. The masses of the NH$_3$ sources range from 0.05 M$_\\odot$ to 9.5 M$_\\odot$. The masses...

  7. Herschel/HIFI search for H2-17O and H2-18O in IRC+10216: constraints on models for the origin of water vapor

    Neufeld, David A; Agúndez, Marcelino; González-Alfonso, Eduardo; Decin, Leen; Daniel, Fabien; Cernicharo, José; Melnick, Gary J; Schmidt, Miroslaw; Szczerba, Ryszard

    2013-01-01

    We report the results of a sensitive search for the minor isotopologues of water, H2-17O and H2-18O, toward the carbon-rich AGB star IRC+10216 (a.k.a. CW Leonis) using the HIFI instrument on the Herschel Space Observatory. This search was motivated by the fact that any detection of isotopic enhancement in the H2-17O and H2-18O abundances would have strongly implicated CO photodissociation as the source of the atomic oxygen needed to produce water in a carbon-rich circumstellar envelope. Our observations place an upper limit of 1/470 on the H2-17O/H2-16O abundance ratio. Given the isotopic 17O/16O ratio of 1/840 inferred previously for the photosphere of IRC+10216, this result places an upper limit of a factor 1.8 on the extent of any isotope-selective enhancement of H2-17O in the circumstellar material, and provides an important constraint on any model that invokes CO photodissociation as the source of O for H2O production. In the context of the clumpy photodissociation model proposed previously for the origi...

  8. MicroRNAs MiR-218, MiR-125b, and Let-7g predict prognosis in patients with oral cavity squamous cell carcinoma.

    Shih-Chi Peng

    Full Text Available MicroRNAs (miRNAs have a major impact on regulatory networks in human carcinogenesis. In this study, we sought to investigate the prognostic significance of miRNAs in patients with oral cavity squamous cell carcinoma (OSCC. In a discovery phase, RNA was extracted from 58 OSCC tumor samples and paired normal tissues. MiRNAs expression was evaluated with TaqMan Array Card and TaqMan MicroRNA assays. The prognostic significance of the miRNA signature identified in the discovery phase was validated by qRT-PCR in a replication set consisting of 141 formalin-fixed, paraffin-embedded (FFPE samples. We identified a miRNA regulatory network centered on the three hub genes (SP1, MYC, and TP53 that predicted distinct clinical endpoints. Three miRNAs (miR-218, miR-125b, and let-7g and their downstream response genes had a concordant prognostic significance on disease-free survival and disease-specific survival rates. In addition, patients with a reduced expression of miR-218, miR-125b, and let-7g have a higher risk of poor outcomes in presence of specific risk factors (p-stage III-IV, pT3-4, or pN+. Our findings indicate that specific miRNAs have prognostic significance in OSCC patients and may improve prognostic stratification over traditional risk factors.

  9. Measurement of the α4β2* nicotinic acetylcholine receptor ligand 2-[18F]Fluoro-A-85380 and its metabolites in human blood during PET investigation: a methodological study

    2-[18F]fluoro-A-85380 (2-[18F]FA) is a new radioligand for noninvasive imaging of α4β2* nicotinic acetylcholine receptors (nAChRs) by positron emission tomography (PET) in human brain. In most cases, quantification of 2-[18F]FA receptor binding involves measurement of free nonmetabolized radioligand concentration in blood. This requires an efficient and reliable method to separate radioactive metabolites from the parent compound. In the present study, three analytical methods, thin layer chromatography (TLC), high-performance liquid chromatography (HPLC) and solid phase extraction (SPE) have been tested. Reversed-phase TLC of deproteinized aqueous samples of plasma provides good estimates of 2-[18F]FA and its metabolites. However, because of the decreased radioactivity in plasma samples, this method can be used in humans over the first 2 h after radioligand injection only. Reliable quantification of the parent radioligand and its main metabolites was obtained using reversed-phase HPLC, followed by counting of eluted fractions in a well gamma counter. Three main and five minor metabolites of 2-[18F]FA were detected in human blood using this method. On average, the unchanged 2-[18F]FA fraction in plasma of healthy volunteers measured at 14, 60, 120, 240 and 420 min after radioligand injection was 87.3±2.2%, 74.4±3%, 68.8±5%, 62.3±8% and 61.0±8%, respectively. In patients with neurodegenerative disorders, the values corresponding to the three last time points were significantly lower. The fraction of nonmetabolized 2-[18F]FA in plasma determined using SPE did not differ significantly from that obtained by HPLC (+gamma counting) (n=73, r=.95). Since SPE is less time-consuming than HPLC and provides comparable results, we conclude that SPE appears to be the most suitable method for measurement of 2-[18F]FA parent fraction during PET investigations

  10. Diurnal variations of 218Po, 214Pb, and 214Po and their effect on atmospheric electrical conductivity in the lower atmosphere at Mysore city, Karnataka State, India

    The short-lived radon daughters (218Po, 214Pb, 214Bi and 214Po) are natural tracers in the troposphere, in particular near the ground surface. They are electrically charged particles and are chemically reactive. As soon as they are formed they get attached to the aerosol particles of the atmosphere. The behavior of radon daughters is similar to that of aerosols with respect to their growth, transport and removal processes in the atmosphere. The electrical conductivity of the atmosphere is mainly due to the presence of highly mobile ions. Galactic cosmic rays are the main source of ionization in the planetary boundary layer; however, near the surface of the earth, ions are produced mainly by decays of natural radioactive gases emanating from the soil surface and by radiations emitted directly from the surface. Hence the electrical conductivity of air near the surface of the earth is mainly due to radiations emitted by 222Rn, 218Po, 214Pb, 214Bi and 214Po, and depends on aerosol concentrations and meteorological parameters. In the present work the diurnal and seasonal variations of radon and its progeny concentrations are studied using Low Level Radon Detection System and Airflow Meter respectively. Atmospheric electrical conductivity of both positive and negative polarities is measured using a Gerdien Condenser. All the measurements were carried out simultaneously at one location in Mysore city (12°N, 76°E), India. The diurnal variation of atmospheric electrical conductivity was found to be similar to that of ion pair production rate estimated from radon and its progeny concentrations with a maximum in the early morning hours and minimum during day time. The annual average concentrations of 222Rn, 218Po, 214Pb, and 214Po at the study location were found to be 21.46, 10.88, 1.78 and 1.80 Bq m−3 respectively. The annual average values of positive and negative atmospheric electrical conductivity were found to be 18.1 and 16.6 f S m−1 respectively. The radon and

  11. Diurnal variations of (218)Po, (214)Pb, and (214)Po and their effect on atmospheric electrical conductivity in the lower atmosphere at Mysore city, Karnataka State, India.

    Pruthvi Rani, K S; Paramesh, L; Chandrashekara, M S

    2014-12-01

    The short-lived radon daughters ((218)Po, (214)Pb, (214)Bi and (214)Po) are natural tracers in the troposphere, in particular near the ground surface. They are electrically charged particles and are chemically reactive. As soon as they are formed they get attached to the aerosol particles of the atmosphere. The behavior of radon daughters is similar to that of aerosols with respect to their growth, transport and removal processes in the atmosphere. The electrical conductivity of the atmosphere is mainly due to the presence of highly mobile ions. Galactic cosmic rays are the main source of ionization in the planetary boundary layer; however, near the surface of the earth, ions are produced mainly by decays of natural radioactive gases emanating from the soil surface and by radiations emitted directly from the surface. Hence the electrical conductivity of air near the surface of the earth is mainly due to radiations emitted by (222)Rn, (218)Po, (214)Pb, (214)Bi and (214)Po, and depends on aerosol concentrations and meteorological parameters. In the present work the diurnal and seasonal variations of radon and its progeny concentrations are studied using Low Level Radon Detection System and Airflow Meter respectively. Atmospheric electrical conductivity of both positive and negative polarities is measured using a Gerdien Condenser. All the measurements were carried out simultaneously at one location in Mysore city (12°N, 76°E), India. The diurnal variation of atmospheric electrical conductivity was found to be similar to that of ion pair production rate estimated from radon and its progeny concentrations with a maximum in the early morning hours and minimum during day time. The annual average concentrations of (222)Rn, (218)Po, (214)Pb, and (214)Po at the study location were found to be 21.46, 10.88, 1.78 and 1.80 Bq m(-3) respectively. The annual average values of positive and negative atmospheric electrical conductivity were found to be 18.1 and 16.6 f S m(-1

  12. 2-[18F]fluoro-2-deoxyglucose positron-emission tomography in staging, response evaluation, and treatment planning of lymphomas

    Specht, Lena

    2007-01-01

    2-[18F]fluoro-2-deoxyglucose positron-emission tomography (FDG-PET) is used increasingly in the clinical management of lymphomas. With regard to staging, FDG-PET is more sensitive and specific than conventional staging methods in FDG avid lymphomas (ie, Hodgkin lymphoma and most aggressive non-Hodgkin...... lymphomas). Despite methodological problems, in particular the lack of a valid reference test, FDG-PET is approved and generally used for this purpose. With regard to response evaluation, FDG-PET at the end of treatment seems to aid considerably in differentiating between residual masses with or without...... residual lymphoma. Hence, new revised response criteria have been proposed, incorporating the result of FDG-PET at the end of treatment. An early interim FDG-PET scan after 1 to 3 cycles of chemotherapy is a very strong predictor of outcome, and trials are now in progress testing treatment modifications on...

  13. The Atacama Cosmology Telescope: A Measurement of the Cosmic Microwave Background Power Spectrum at 148 AND 218 GHz from the 2008 Southern Survey

    Das, Sudeep; Marriage, Tobias A.; Ade, Peter A. R.; Aguirre, Paula; Amiri, Mandana; Appel, John W.; Barrientos, L. Felipe; Battistelli, Elia A.; Bond, J. Richard; Brown, Ben; Burger, Bryce; Chervenak, Jay; Devlin, Mark J.; Dicker, Simon R.; Doriese, W. Bertrand; Dunkley, Joanna; Duenner, Rolando; Essinger-Hileman, Thomas; Fisher, Ryan P.; Fowler, Joseph W.; Hajian, Amir; Halpern, Mark; Hasselfield, Matthew; Hernandez-Monteagudo, Carlos; Wollack, Ed

    2010-01-01

    We present measurements of the cosmic microwave background (CMB) power spectrum made by the Atacama Cosmology Telescope at 148 GHz and 218 GHz, as well as the cross-frequency spectrum between the two channels. Our results dearly show the second through the seventh acoustic peaks in the CMB power spectrum. The measurements of these higher-order peaks provide an additional test of the ACDM cosmological model. At l > 3000, we detect power in excess of the primary anisotropy spectrum of the CMB. At lower multipoles 500 < l < 3000, we find evidence for gravitational lensing of the CMB in the power spectrum at the 2.8(sigma) level. We also detect a low level of Galactic dust in our maps, which demonstrates that we can recover known faint, diffuse signals.

  14. THE ATACAMA COSMOLOGY TELESCOPE: A MEASUREMENT OF THE COSMIC MICROWAVE BACKGROUND POWER SPECTRUM AT 148 AND 218 GHz FROM THE 2008 SOUTHERN SURVEY

    We present measurements of the cosmic microwave background (CMB) power spectrum made by the Atacama Cosmology Telescope at 148 GHz and 218 GHz, as well as the cross-frequency spectrum between the two channels. Our results clearly show the second through the seventh acoustic peaks in the CMB power spectrum. The measurements of these higher-order peaks provide an additional test of the ΛCDM cosmological model. At l>3000, we detect power in excess of the primary anisotropy spectrum of the CMB. At lower multipoles 500 < l < 3000, we find evidence for gravitational lensing of the CMB in the power spectrum at the 2.8σ level. We also detect a low level of Galactic dust in our maps, which demonstrates that we can recover known faint, diffuse signals.

  15. Measurement of glucose and 2-deoxy-2-[18F]fluoro-D-glucose transport and phosphorylation rates in myocardium using dual-tracer kinetic experiments

    To examine the use of 2-deoxy-2-[18F]fluoro-D-glucose (2-FDG) as a glucose analog for measuring glucose utilization rate in myocardium, dual-tracer kinetic experiments with 2-FDG and 2-[3H]glucose were performed in the perfused, isolated rabbit interventricular septum to measure simultaneously the transport and phosphorylation rates of glucose and 2-FDG. Results of the present study indicated that, in the septum, (i) the transport rate constants of 2-FDG and glucose were similar in magnitude, (ii) the phosphorylation rate constant for 2-FDG was about 60% of that of glucose, (iii) hypoxia caused an increase in phosphorylation rates of glucose and 2-FDG without affecting transport. 9 refs.; 1 figure; 3 tabs

  16. All-solid-state dual end pumped YVO4:Nd/LBO blue laser with 21.8 W output power at 457 nm

    Ling, Zhao; Yi, Yao; Yang, Zhao; Quan, Zheng

    2014-03-01

    It is reported the efficient compact deep-blue laser at 457 nm generation by intracavity frequency doubling of a continuous wave (CW) laser operation of a diode-pumped YVO4:Nd laser on the 4 F 3/2 → 4 I 9/2 transition at 914 nm. An LBO crystal, cut for critical type I phase matching at room temperature is used for second harmonic generation (SHG) of the laser. With dual end pump configurations at total incident pump power of 60 W, as high as 21.8 W of CW output power at 457 nm is achieved with 20-mm-long LBO. The optical-to-optical conversion efficiency is up to 36.3%, and the power stability in 8 h is better than 2.36%.

  17. Estimation of the release and migration of lead through soils and groundwater at the Hanford Site 218-E-12B Burial Ground. Volume 1, Final report

    Rhoads, K.; Bjornstad, B.N.; Lewis, R.E.; Teel, S.S.; Cantrell, K.J.; Serne, R.J.; Smoot, J.L.; Kincaid, C.T.; Wurstner, S.K.

    1992-10-01

    This study was performed to evaluate the potential for transport of lead from the Hanford Site 218-E-12B Burial Ground to the surrounding surface- and groundwater. Burial of metal components containing nickel alloy steel and lead at this location may eventually result in release of lead to the subsurface environment, including groundwater aquifers that may be used for domestic and agricultural purposes in the future and, ultimately, to the Columbia River. The rate at which lead is transported to downgradient locations depends on a complex set of factors, such as climate, soil and groundwater chemistry, and the geologic and hydrologic configuration of the subsurface region between the burial ground and a potential receptor location. The groundwater transport analysis was conducted using a one-dimensional screening model with a relatively conservative matrix of parameters obtained from the hydrogeologic and geochemical studies.

  18. Estimation of the release and migration of lead through soils and groundwater at the Hanford Site 218-E-12B Burial Ground

    Rhoads, K.; Bjornstad, B.N.; Lewis, R.E.; Teel, S.S.; Cantrell, K.J.; Serne, R.J.; Smoot, J.L.; Kincaid, C.T.; Wurstner, S.K.

    1992-10-01

    This study was performed to evaluate the potential for transport of lead from the Hanford Site 218-E-12B Burial Ground to the surrounding surface- and groundwater. Burial of metal components containing nickel alloy steel and lead at this location may eventually result in release of lead to the subsurface environment, including groundwater aquifers that may be used for domestic and agricultural purposes in the future and, ultimately, to the Columbia River. The rate at which lead is transported to downgradient locations depends on a complex set of factors, such as climate, soil and groundwater chemistry, and the geologic and hydrologic configuration of the subsurface region between the burial ground and a potential receptor location. The groundwater transport analysis was conducted using a one-dimensional screening model with a relatively conservative matrix of parameters obtained from the hydrogeologic and geochemical studies.

  19. Guided ion beam studies of the reactions of Nin+ (n=2-18) with O2: Nickel cluster oxide and dioxide bond energies

    The kinetic energy dependences of the reactions of Nin+ (n=2-18) with O2 are studied in a guided ion beam tandem mass spectrometer. A variety of NimO2+, NimO+, and Nim+ product ions, where m≤n, are observed, with the dioxide cluster ions dominating the products for all larger reactant cluster ions. Reaction efficiencies are near unity for all but the smallest clusters. The energy dependences of the product cross sections are analyzed in several different ways to determine thermochemistry for both the first and second oxygen atom binding to nickel cluster ions. These values show little dependence on cluster size for clusters larger than three atoms. The trends in this thermochemistry are discussed and compared to bulk phase oxidation values

  20. Estimation of the release and migration of nickel through soils and groundwater at the Hanford Site 218-E-12B Burial Ground

    An assessment was performed to evaluate release and transport of nickel from large metal components containing nickel-bearing alloys at the Hanford Site 218-E-12B Burial Ground. The potential for nickel within the components to enter groundwater under the burial site was investigated by examining available data on the site's geology, geochemistry, and geohydrology to develop a conceptual model for release and transport of nickel from the components. In addition, laboratory studies were performed to provide information needed for the model, but which was not available from existing databases. Estimates of future concentrations of nickel radioisotopes (59Ni and 63Ni) and total elemental nickel in the unconfined aquifer and in the Columbia River were developed based on this information

  1. HERSCHEL/HIFI SEARCH FOR H217O AND H218O IN IRC+10216: CONSTRAINTS ON MODELS FOR THE ORIGIN OF WATER VAPOR

    We report the results of a sensitive search for the minor isotopologues of water, H217O and H218O, toward the carbon-rich asymptotic giant branch star IRC+10216 (a.k.a. CW Leonis) using the HIFI instrument on the Herschel Space Observatory. This search was motivated by the fact that any detection of isotopic enhancement in the H217O and H218O abundances would have strongly implicated CO photodissociation as the source of the atomic oxygen needed to produce water in a carbon-rich circumstellar envelope. Our observations place an upper limit of 1/470 on the H217O/H216O abundance ratio. Given the isotopic 17O/16O ratio of 1/840 inferred previously for the photosphere of IRC+10216, this result places an upper limit of a factor 1.8 on the extent of any isotope-selective enhancement of H217O in the circumstellar material, and provides an important constraint on any model that invokes CO photodissociation as the source of O for H2O production. In the context of the clumpy photodissociation model proposed previously for the origin of water in IRC+10216, our limit implies that 12C16O (not 13C16O or SiO) must be the dominant source of 16O for H2O production, and that the effects of self-shielding can only have reduced the 12C16O photodissociation rate by at most a factor ∼2.

  2. Nucleophilic radiosynthesis of 2-[18F]fluoro-2-deoxy-D-galactose from Talose triflate and biodistribution in a porcine model

    Introduction: The galactose analogue 2-[18F]fluoro-2-deoxy-D-galactose (FDGal) is a promising positron emission tomography (PET) tracer for studies of regional differences in liver metabolic function and for clinical evaluation of patients with liver cirrhosis and patients undergoing treatment of liver diseases. However, there is an unmet need for routine production of FDGal from readily available starting material. In this study, we present the preparation of FDGal with high radiochemical purity and in amounts sufficient for clinical investigations from commercially available Talose triflate (1,3,4,6-tetra-O-acetyl-2-O-trifluoromethanesulfonyl-β-D-talopyranose). In addition, the biodistribution of FDGal in the pig is presented. Methods: FDGal was prepared by nucleophilic fluorination of Talose triflate followed by basic hydrolysis. The entire synthesis was performed using the GE TRACERlab MX 2-[18F]fluoro-2-deoxy-D-glucose (FDG) synthesizer and existing methods for quality control of FDG were applied. Biodistribution of FDGal was studied by successive whole-body PET recordings of two anaesthetized 37-kg pigs. Results: Up to 3.7 GBq sterile, pyrogen-free and no-carrier-added FDGal was produced with a radiochemical yield of 3.8±1.2% and a radiochemical purity of 98±1% (42 productions; yield is decay corrected). The adopted quality control methods for FDG were directly applicable for FDGal. Biodistribution studies in the pig revealed the liver and the urinary bladder as critical organs in terms of radiation dose. Conclusion: Commercially available Talose triflate is a suitable starting material for routine productions of FDGal. The presented radiosynthesis and quality control methods allow for the production of pure, no-carrier-added FDGal in sufficient amounts for clinical PET-investigations of the liver.

  3. Herschel/HIFI Search for H_2^{17}O and H_2^{18}O in IRC+10216: Constraints on Models for the Origin of Water Vapor

    Neufeld, David A.; Tolls, Volker; Agúndez, Marcelino; González-Alfonso, Eduardo; Decin, Leen; Daniel, Fabien; Cernicharo, José; Melnick, Gary J.; Schmidt, Miroslaw; Szczerba, Ryszard

    2013-04-01

    We report the results of a sensitive search for the minor isotopologues of water, H_2^{17}O and H_2^{18}O, toward the carbon-rich asymptotic giant branch star IRC+10216 (a.k.a. CW Leonis) using the HIFI instrument on the Herschel Space Observatory. This search was motivated by the fact that any detection of isotopic enhancement in the H_2^{17}O and H_2^{18}O abundances would have strongly implicated CO photodissociation as the source of the atomic oxygen needed to produce water in a carbon-rich circumstellar envelope. Our observations place an upper limit of 1/470 on the H_2^{17}O/H_2^{16}O abundance ratio. Given the isotopic 17O/16O ratio of 1/840 inferred previously for the photosphere of IRC+10216, this result places an upper limit of a factor 1.8 on the extent of any isotope-selective enhancement of H_2^{17}O in the circumstellar material, and provides an important constraint on any model that invokes CO photodissociation as the source of O for H2O production. In the context of the clumpy photodissociation model proposed previously for the origin of water in IRC+10216, our limit implies that 12C16O (not 13C16O or SiO) must be the dominant source of 16O for H2O production, and that the effects of self-shielding can only have reduced the 12C16O photodissociation rate by at most a factor ~2. Herschel is an ESA space observatory with science instruments provided by European-led Principal Investigator consortia and with important participation from NASA.

  4. EFSA Panel on Food Contact Materials, Enzymes, Flavourings and Processing Aids (CEF); Scientific Opinion on Flavouring Group Evaluation 218, Revision 1 (FGE.218Rev1): alpha,beta-Unsaturated aldehydes and precursors from subgroup 4.2 of FGE.19: Furfural derivatives

    Larsen, John Christian; Nørby, Karin Kristiane; Beltoft, Vibe Meister;

    and aliphatic saturated carboxylic acids [FL-no: 13.057, 13.062, 13.067, 13.068 and 13.128]. In the previous version of this Opinion, FGE.218, the Panel had expressed the following view. The five furfuryl esters are anticipated to be hydrolysed to furfuryl alcohol (and carboxylic acids). Furfuryl...... that 5-methylfurfural [FL-no: 13.001] can be oxidised to the primary alcohol 5-hydroxymethylfurfural [FL-no: 13.139]. 5-Hydroxymethylfurfural has been evaluated by EFSA in FGE.13 dealing with furfuryl and furan derivatives. In the latter Opinion, it was concluded that since 5-hydroxymethylfurfural may...

  5. Continuous monitoring α-activity on aerosol filters by the pseudo-coincidence-technique. Explicitly taking into account the short lived Po-218 activity; Kontinuierliche Ueberwachung der α-Aktivitaet eines Aerosolfilters mit der Pseudokoinzidenzmesstechnik. Explizite Beruecksichtigung der kurzlebigen Po-218 Aktivitaetsbeitraaege

    Kraut, W.; Schwarz, W. [Duale Hochschule Baden-Wuerttemberg (DHBW), Karlsruhe (Germany). Studiengang Sicherheitswesen; Kraut, B. [Berthold Technologies GmbH und Co.KG, Bad Wildbad (Germany)

    2015-07-01

    Pseudo-coincidence-technique is applied to continuous monitoring of α-activity on aerosolfilters by proportional counters. Filter activity can markedly increase or decrease by changing air conditions especially by the amount of short lived Po-218 activity. Conditions of constant proportions of activity concentrations for the short lived species for operating this technique are seldom fulfilled. The dynamic behavior of artificial (long lived) and natural (short lived) activity is mathematically modelled and the measured moving count rates are analyzed under this model by a multivariate regression analysis for activity concentrations of artificial resp. short lived activity. Results are compared to standard recommendations of DIN ISO 11929.

  6. Standardized uptake value of 2-[(18)F] fluoro-2-deoxy-D-glucose in predicting outcome in head and neck carcinomas treated by radiotherapy with or without chemotherapy

    Allal, Abdelkarim Said; Dulguerov, Pavel; Allaoua, Mohamed Ghoulem; Haenggeli, Charles-André; El-Ghazi, El Abbes; Lehmann, Willy; Slosman, Daniel O.

    2002-01-01

    In patients with head and neck cancer enrolled onto a prospective study of positron emission tomography (PET), pretreatment 2-[(18)F] fluoro-2- deoxy-D-glucose (FDG) uptake was evaluated as a predictor of local control and disease-free survival (DFS) after treatment by radiotherapy (RT) with or without chemotherapy.

  7. Cortical synaptic transmission in CaV2.1 knockin mice with the S218L missense mutation which causes a severe familial hemiplegic migraine syndrome in humans.

    Dania eVecchia

    2015-02-01

    Full Text Available Familial hemiplegic migraine type 1 (FHM1 is caused by gain-of-function mutations in CaV2.1 (P/Q-type Ca2+ channels. Knockin (KI mice carrying the FHM1 R192Q missense mutation show enhanced cortical excitatory synaptic transmission at pyramidal cell synapses but unaltered cortical inhibitory neurotransmission at fast-spiking interneuron synapses. Enhanced cortical glutamate release was shown to cause the facilitation of cortical spreading depression (CSD in R192Q KI mice. It, however, remains unknown how other FHM1 mutations affect cortical synaptic transmission. Here, we studied neurotransmission in cortical neurons in microculture from KI mice carrying the S218L mutation, which causes a severe FHM syndrome in humans and an allele-dosage dependent facilitation of experimental CSD in KI mice, which is larger than that caused by the R192Q mutation. We show gain-of-function of excitatory neurotransmission, due to increased action-potential evoked Ca2+ influx and increased probability of glutamate release at pyramidal cell synapses, but unaltered inhibitory neurotransmission at multipolar interneuron synapses in S218L KI mice. In contrast with the larger gain-of-function of neuronal CaV2.1 current in homozygous than heterozygous S218L KI mice, the gain-of-function of evoked glutamate release, the paired-pulse ratio and the Ca2+ dependence of the EPSC were all similar in homozygous and heterozygous S218L KI mice, suggesting compensatory changes in the homozygous mice. Furthermore, we reveal a unique feature of S218L KI cortical synapses which is the presence of a fraction of mutant CaV2.1 channels being open at resting potential. Our data suggest that, while the gain-of-function of evoked glutamate release may explain the facilitation of CSD in heterozygous S218L KI mice, the further facilitation of CSD in homozygous S218L KI mice is due to other CaV2.1-dependent mechanisms, that likely include Ca2+ influx at voltages sub-threshold for action

  8. Low-Level Burial Grounds dangerous waste permit application: Request for exemption from lined trench requirements and from land disposal restrictions for residual liquid at 218-E-12B Burial Ground Trench 94

    This document has been prepared and is being submitted to the respective agencies to satisfy three objectives of the US Department of Energy (DOE) Richland Field Office (DOE-RL) concerning Trench 94 of the 218-E-12B Burial Ground. The 218-E-12B Burial Ground is located in the 200 East Area of the Hanford Facility. Figure 1-1 shows the general location of the Hanford Site. The 218-E-12B Burial Ground is one of eight burial grounds included in the Low-Level Burial Grounds (LLBG), a treatment, storage and/or disposal (TSD) unit. Decommissioned, defueled naval submarine reactor compartments (SRCs) contain radioactivity caused by exposure of structural components to neutrons during normal operation of the submarines. After all the alternatives were evaluated in the US Department of the Navy 1984 environmental impact statement (EIS) (USN 1984), land burial of the SRCs was selected as the preferred disposal option. The SRCs currently are sent to Trench 94 of the 218-E-12B Burial Ground. In addition to radioactivity, the SRCs disposed in. The DOE-RL's three objectives in preparing and submitting this document are as follows. Request from Ecology an exemption from dangerous waste landfill liner and leachate collection and removal system (hereinafter referred to as liner/leachate system) requirements for Trench 94 of the 218-E-12B Burial Ground. Petition Ecology to exempt residual liquid in the SRCs from land disposal restrictions. Obtain EPA Region 10 review and comment on the request to Ecology for exemption from liner/leachate system requirements

  9. The Ks-band Tully–Fisher Relation – A Determination of the Hubble Parameter from 218 ScI Galaxies and 16 Galaxy Clusters

    David G. Russell

    2009-06-01

    The value of Hubble parameter (H0) is determined using the morphologically type dependent Ks-band Tully–Fisher Relation (K-TFR). The slope and zero point are determined using 36 calibrator galaxies with ScI morphology. Calibration distances are adopted from direct Cepheid distances, and group or companion distances derived with the Surface Brightness Fluctuation Method or Type Ia Supernova. It is found that a small morphological type effect is present in the K-TFR such that ScI galaxies are more luminous at a given rotational velocity than Sa/Sb galaxies and Sbc/Sc galaxies of later luminosity classes. Distances are determined to 16 galaxy clusters and 218 ScI galaxies with minimum distances of 40.0 Mpc. From the 16 galaxy clusters a weighted mean Hubble parameter of H0 = 84.2 ± 6 km s-1 Mpc-1 is found. From the 218 ScI galaxies a Hubble parameter of H0 = 83.4 ± 8 km s-1 Mpc-1 is found. When the zero point of K-TFR is corrected to account for recent results that find a Large Magellanic Cloud distance modulus of 18.39 × 0.05, a Hubble parameter of 88.0 ± 6 km s-1 Mpc-1 is found. Effects from Malmquist bias are shown to be negligible in this sample as galaxies are restricted to a minimum rotational velocity of 150 km s-1. It is also shown that the results of this study are negligibly affected by the adopted slope for the K-TFR, inclination binning, and distance binning. A comparison with the results of the Hubble Key Project (Freedman et al. 2001) is made. Discrepancies between the K-TFR distances and the HKP I-TFR distances are discussed. Implications for -CDM cosmology are considered with H0 = 84 km s-1 Mpc-1. It is concluded that it is very difficult to reconcile the value of H0 found in this study with ages of the oldest globular clusters and matter density of the universe derived from galaxy clusters in the context of -CDM cosmology.

  10. The L1495-B218 filaments in Taurus seen in NH3 & CCS and Dynamical Stability of Filaments and Dense Cores

    Seo, Youngmin

    2016-01-01

    We present deep NH3 map of L1495-B218 filaments and the dense cores embedded within the filaments in Taurus. The L1495-B218 filaments form an interconnected, nearby, large complex extending 8 pc. We observed the filaments in NH3 (1,1) & (2,2) and CCS 21-10 with spectral resolution of 0.038 km/s and spatial resolution of 31". The CSAR algorithm, which is a hybrid of seeded-watershed and binary dendrogram algorithm, identifies 39 leaves and 16 branches in NH3 (1,1). Applying a virial analysis for the 39 NH3 leaves, we find only 9 out of 39 leaves are gravitationally bound, and 12 out of 30 gravitationally unbound leaves are pressure-confined. Our analysis suggests that a dense core may form as a pressure-confined structure, evolve to a gravitationally bound core, and then undergo collapse to form a protostar (Seo et al. 2015).We also present more realistic dynamic stability conditions for dense cores with converging motions and under the influence of radiation pressure. The critical Bonnor-Ebert sphere and the isothermal cylinder have been widely used to test stability of dense cores and filaments; however, these assume a quiescent environment while actual star forming regions are turbulent and illuminated by radiation. In a new analysis of stability conditions we account for converging motions which have been modeled toward starless cores (Seo et al. 2011) and the effect of radiation fields into account. We find that the critical size of a dense core having a homologous converging motion with its peak speed being the sound speed is roughly half of the critical size of the Bonnor-Ebert sphere (Seo et al. 2013). We also find that the critical mass/line density of a dense core/filament irradiated by radiation are considerably smaller than that of the Bonnor-Ebert sphere/isothermal cylinder when the radiation pressure is stronger than the central gas pressure of dense core/isothermal cylinder. For inner Galactic regions and regions near OB associations, the critical

  11. Titan's surface at 2.18-cm wavelength imaged by the Cassini RADAR radiometer: Results and interpretations through the first ten years of observation

    Janssen, M. A.; Le Gall, A.; Lopes, R. M.; Lorenz, R. D.; Malaska, M. J.; Hayes, A. G.; Neish, C. D.; Solomonidou, A.; Mitchell, K. L.; Radebaugh, J.; Keihm, S. J.; Choukroun, M.; Leyrat, C.; Encrenaz, P. J.; Mastrogiuseppe, M.

    2016-05-01

    A comprehensive calibration and mapping of the thermal microwave emission from Titan's surface is reported based on radiometric data obtained at 2.18-cm wavelength by the passive radiometer included in the Cassini RADAR instrument. Compared to previous work, the present results incorporate the much larger data set obtained in the approximately ten years following Saturn Orbit Insertion. Brightness temperature data including polarization were accumulated by segments in Titan passes from Ta (October 2004) through T98 (February 2014). The observational segments were analyzed to produce a mosaic of effective dielectric constant based on the measurement of thermal polarization covering 76% of the surface, and brightness temperature at normal incidence covering Titan's entire surface. As part of the mosaicking process we also solved for the seasonal variation of physical temperature with latitude, which we found to be smaller by a factor of 0.87 ± 0.05 in relative amplitude compared to that reported in the thermal infrared by Cassini's Composite Infrared Spectrometer (CIRS). We used the equatorial temperature obtained by the Huygens probe and the seasonal dependence with latitude from CIRS to convert the brightness mosaic to absolute emissivity, from which we could infer global thermophysical properties of the surface in combination with the dielectric mosaic. We see strong evidence for subsurface (volume) scattering as a dominant cause of the radar reflectivity in bright regions, and elsewhere a surface composition consistent with the slow deposition and processing of organic compounds from the atmosphere. The presence of water ice in the near subsurface is strongly indicated by the high degree of volume scattering observed in radar-bright regions (e.g., Hummocky/mountainous terrains) constituting ∼10% of Titan's surface. A thermal analysis allowed us to infer a mean 2.18-cm emission depth in the range 40-100 cm for the dominant radar-dark terrains (the remainder of

  12. Validity of positron emission tomography (PET) using 2-deoxy-2-[18F]fluoro-D-glucose (FDG) in patients with renal cell carcinoma (preliminari report)

    Positron emission tomography (PET) using 2-deoxy-2-[18F]fluoro-D-glucose (FDG) was carried out in 6 patients with renal tumors (5 renal cell carcinomas including one patient in whom the primary renal lesion was nephrectomized and 1 angiomyolipoma) and FDG accumulation was evaluated in the tumor lesion as a ''hot spot''. In dynamic images after 16 min. FDG accumulated in the tumor portion in 3 out of 4 patients with renal cell carcinoma. However, there was no accumulation in one renal cell carcinoma in which marked necrosis was histologically found. FDG accumulation was not evident in the tumorous lesion of angiomyolipoma. FDG accumulation was also noticed in the metastatic lesion of renal cell carcinoma in the liver or retroperitoneal lymph node. A gradual increase of FDG activity in the lesion of renal cell carcinoma was clearly demonstrated in the time-radioactivity curve, while activities rapidly decreased in renal cortex and pelvis, and liver. In the healthy portion of the kidney, FDG is filtered from the glomerulus and is not reabsorbed from the tubulus and is excreted in the collecting system. On the contrary, FDG, catalyzed by hexokinase, is phospholylated to FDG-6-phosphate which accumulates in the tumor tissue. PET using FDG can provide a new insight for understanding biological activity of renal cell carcinoma from the point of glucose metabolism in tumor tissue. (author)

  13. Crossed cerebellar diaschisis. A positron emission tomography study with L-[methyl-11C]methionine and 2-deoxy-2-[18F]fluoro-D-glucose

    Crossed cerebellar diaschisis (CCD) is defined as a depression of blood flow and oxidative metabolism of glucose in the cerebellum contralateral to a supratentorial brain lesion, as detected with positron emission tomography (PET) and single photon emission computed tomography. We examined whether L-[methyl-11C]methionine (MET) uptake is affected in CCD. In 12 patients with a unilateral supratentorial brain tumor, we evaluated the uptake of 2-deoxy-2-[18F]fluoro-D-glucose (FDG) and MET in the cerebellar hemispheres by means of PET. Asymmetry index (AI) was defined as a difference in the average count between the ipsilateral and contralateral cerebellar hemispheres divided by the average count in both cerebellar hemispheres. Patients with AI of FDG PET more than 0.1 and those with AI equal to 0.1 or less than 0.1 were classified as CCD-positive and CCD-negative, respectively. Six patients were CCD-positive and others were CCD-negative in the FDG PET study. Between CCD-positive and CCD-negative patients, mean AI of MET was not significantly different (0.017±0.023 and 0.014±0.039, respectively). Different from glucose metabolism, cerebellar MET uptake was not affected in CCD. The present study may indicate that cerebellar MET uptake is independent of suppression of cerebellar neuronal activity. (author)

  14. Synthesis of O-(2-[18F]fluoroethyl)-L-tyrosine and its biological evaluation in B16 melanoma-bearing mice as PET tracer for tumor imaging

    2007-01-01

    O-(2-[18F]fluoroethyl) -L-tyrosine([18F]FET) ,a fluorine-18 labeled analogue of tyrosine,has been syn-thesized and biologically evaluated in tumor-bearing mice. The whole synthesis procedure is com-pleted within 50 min. The radiochemical yield is about 40%(no decay corrected) and radiochemical purity more than 97% after simplified solid phase extraction. [18F]FET shows rapid,high uptake and long retention in the tumor as well as low uptake in the brain. The ratios of tumor-to-muscle(T/M) and tumor-to-blood(T/B) of [18F]FET are similar to those of [18F]FDG,but the ratios of tumor-to-brain(T/Br) are 2-3 times higher than that of [18F]FDG. Autoradiography of [18F]FET demonstrates a remarkable accumulation in melanoma with high contrast. It appears to be a probable competitive candidate for melanoma imaging with PET.

  15. Synthesis of O-(2-[18F]fluoroethyl)-L-tyrosine and its biological evaluation in B16 melanoma-bearing mice as PET tracer for tumor imaging

    WANG MingWei; YIN DuanZhi; LI ShiQiang; WANG YongXian

    2007-01-01

    O-(2-[18F]fluoroethyl)-L-tyrosine ([18F]FET), a fluorine-18 labeled analogue of tyrosine, has been synthesized and biologically evaluated in tumor-bearing mice. The whole synthesis procedure is completed within 50 min. The radiochemical yield is about 40% (no decay corrected) and radiochemical purity more than 97% after simplified solid phase extraction. [18F]FET shows rapid, high uptake and long retention in the tumor as well as low uptake in the brain. The ratios of tumor-to-muscle (T/M) and tumor-to-blood (T/B) of [18F]FET are similar to those of [18F]FDG, but the ratios of tumor-to-brain (T/Br)are 2-3 times higher than that of [18F]FDG. Autoradiography of [18F]FET demonstrates a remarkable accumulation in melanoma with high contrast. It appears to be a probable competitive candidate for melanoma imaging with PET.

  16. Early Treatment Response Monitoring Using 2-Deoxy-2-[18F]fluoro-D-glucose Positron Emission Tomography Imaging during Fractionated Radiotherapy of Head Neck Cancer Xenografts

    Jiayi Huang

    2014-01-01

    Full Text Available Background. To determine the optimal timing and analytic method of 2-deoxy-2-[18F]fluoro-D-glucose positron emission tomography (PET imaging during fractionated radiotherapy (RT to predict tumor control. Methods. Ten head neck squamous cell carcinoma xenografts derived from the UT-14-SCC cell line were irradiated with 50 Gy at 2 Gy per day over 5 weeks. Dynamic PET scans were acquired over 70 minutes at baseline (week 0 and weekly for seven weeks. PET data were analyzed using standard uptake value (SUV, retention index (RI, sensitivity factor (SF, and kinetic index (Ki. Results. Four xenografts had local failure (LF and 6 had local control. Eighty scans from week 0 to week 7 were analyzed. RI and SF after 10 Gy appeared to be the optimal predictors for LF. In contrast, SUV and Ki during RT were not significant predictors for LF. Conclusion. RI and SF of PET obtained after the first week of fractionated RT were the optimal methods and timing to predict tumor control.

  17. Chelator-Accelerated One-Pot ‘Click’ Labeling of Small Molecule Tracers with 2-[18F]Fluoroethyl Azide

    Erik Årstad

    2013-05-01

    Full Text Available 2-[18F]Fluoroethyl azide ([18F]FEA can readily be obtained by nucleophilic substitution of 2-azidoethyl-4-toluenesulfonate with [18F]fluoride (half-life 110 min, and has become widely used as a reagent for ‘click’ labeling of PET tracers. However, distillation of [18F]FEA is typically required, which is time-consuming and unpractical for routine applications. In addition, copper(I-catalyzed cycloaddition of [18F]FEA with non-activated alkynes, and with substrates containing labile functional groups, can be challenging. Herein, we report a highly efficient and practical ligand-accelerated one-pot/two-step method for ‘click’ labeling of small molecule tracers with [18F]FEA. The method exploits the ability of the copper(I ligand bathophenanthrolinedisulfonate to accelerate the rate of the cycloaddition reaction. As a result, alkynes can be added directly to the crude reaction mixture containing [18F]FEA, and as cyclisation occurs almost immediately at room temperature, the reaction is tolerant to labile functional groups. The method was demonstrated by reacting [18F]FEA with a series of alkyne-functionalized 6-halopurines to give the corresponding triazoles in 55–76% analytical radiochemical yield.

  18. Functional analysis of three amino acid residues of purR re-pressor, Trp147, Gln-218 and Gln-292 in Salmonella typhi-murium

    2001-01-01

    The amber mutation sites of 6 purR(am) mutants were determined bycloning and DNA sequencing. The results showed that the mutations were distributed at three different sites in PurR coding region, G721(→A), C933(→T) and C1155(→T), which respectively turn Trp-147,Gln-218 and Gln-292 of PurR into TAG terminal codon. To determine the effect of the three amino acid residues on regulatory function of PurR protein 5 different kinds of tRNA suppressor genes, Su3, Su4, Su6, Su7 and Su9 were used for creating the PurR protein variants with single amino acid substitution. The results indicated that Cys, Glu, Gly, His and Arg which substituted Trp-147 respectively all could not recover the regulation function of PurR. It confirmed that Trp-147 is a critical amino acid for the PurR function. Gln-292 substituted respectively by the same amino acids also could not recover the PurR function, demonstrating that Gln-292 is also an important amino acid residue in PurR.

  19. Preliminary Thermal Modeling of Hi-Storm 100S-218 Version B Storage Modules at Hope Creek Nuclear Power Station ISFSI

    Cuta, Judith M.; Adkins, Harold E.

    2013-08-30

    This report fulfills the M3 milestone M3FT-13PN0810022, “Report on Inspection 1”, under Work Package FT-13PN081002. Thermal analysis is being undertaken at Pacific Northwest National Laboratory (PNNL) in support of inspections of selected storage modules at various locations around the United States, as part of the Used Fuel Disposition Campaign of the U.S. Department of Energy, Office of Nuclear Energy (DOE-NE) Fuel Cycle Research and Development. This report documents pre-inspection predictions of temperatures for four modules at the Hope Creek Nuclear Generating Station ISFSI that have been identified as candidates for inspection in late summer or early fall/winter of 2013. These are HI-STORM 100S-218 Version B modules storing BWR 8x8 fuel in MPC-68 canisters. The temperature predictions reported in this document were obtained with detailed COBRA-SFS models of these four storage systems, with the following boundary conditions and assumptions.

  20. A novel radiochemical approach to 1-(2'-deoxy-2'-[(18) F]fluoro-β-d-arabinofuranosyl)cytosine ((18) F-FAC).

    Meyer, Jan-Philip; Probst, Katrin C; Trist, Iuni M L; McGuigan, Christopher; Westwell, Andrew D

    2014-09-01

    (18) F-FAC (1-(2'-deoxy-2'-[(18) F]fluoro-β-D-arabinofuranosyl)-cytosine) is an important 2'-fluoro-nucleoside-based positron emission tomography (PET) tracer that has been used for in vivo prediction of response to the widely used cancer chemotherapy drug gemcitabine. Previously reported synthetic routes to (18) F-FAC have relied on early introduction of the (18) F radiolabel prior to attachment to protected cytosine base. Considering the (18) F radiochemical half-life (110 min) and the technical challenges of multi-step syntheses on PET radiochemistry modular systems, late-stage radiofluorination is preferred for reproducible and reliable radiosynthesis with in vivo applications. Herein, we report the first late-stage radiosynthesis of (18) F-FAC. Cytidine derivatives with leaving groups at the 2'-position are particularly prone to undergo anhydro side-product formation upon heating because of their electron density at the 2-carbonyl pyrimidone oxygen. Our rationally developed fluorination precursor showed an improved reactivity-to-stability ratio at elevated temperatures. (18) F-FAC was obtained in radiochemical yields of 4.3-5.5% (n = 8, decay-corrected from end of bombardment), with purities ≥98% and specific activities ≥63 GBq/µmol. The synthesis time was 168 min. PMID:25257474

  1. Preparation of a fine powder of 2-deoxy-2-[18F]fluoro-D-glucose suitable for inhalation to diagnose lung diseases by means of PET

    Fine 2-deoxy-2[18F]fluoro-D-glucose (18FDG) powder was obtained by adding diethyl ether into a methyl alcohol solution of 18FDG and other sugar as seed. When micronized particles of sodium N-acetyl-neuraminate (Neu5Ac-Na) were used as seed crystals, particles containing 18FDG were obtained and 80% of them were smaller than 10μm in size. More than 60% of these crystals were 4-6μm in size. In a preclinical study of forced inhalation in a dog, the 18FDG fine powder was mainly distributed in the trachea. The radioactivity in the trachea then increased once and a gradual decrease followed. The radioactivity was transferred into the blood and radioactivity incorporation into the heart was observed. After a normal volunteer inhaled 18FDG dry powder aerosol, the radioactivity was found in the respiratory tract and the peripheral area of the lung by means of PET. Absorption and in vivo dynamics of the 18FDG were also analysed. (author)

  2. Assessment of diffuse Lewy body disease by 2-[18F]fluoro-2-deoxy-D-glucose positron emission tomography (FDG PET)

    Lewy body disease is, after Alzheimer's disease, the second most common cause of senile degenerative dementia with progressive cognitive deterioration, fluctuation of cognitive and motoric functions and psychotic symptoms. It is characterized histologically by the occurrence of Lewy bodies in allocortical, neocortical and subcortical structures. The aim of this study was to measure the cortical glucose metabolism using FDG PET (2-[18F]fluoro-2-deoxy-D-glucose position emission tomography) compared to normal subjects. Five patients (5 m, mean age 75 y) with clinically suspected diffuse Lewy body disease (DLB) were studied with FDG PET. PET studies of the head were performed with a Siemens ECAT-ART PET-scanner with attenuation correction using 137-Cs point sources. We found the same distribution pattern of diffuse glucose hypometabolism in the entire cortical region with relative sparing of the primary sensory-motor cortex in all the patients. The few cases reported in the literature so far describe findings similar to ours. The pattern of diffuse glucose hypometabolism in the entire cortex including the occipital region seems to be a typical feature of DLB that is distinctive from dementia of Alzheimer's disease

  3. Line position and line intensity analyses of the high-resolution spectrum of H218O up to the First Triad and J = 17

    Coudert, L. H.; Chelin, P.

    2016-08-01

    Line position and line intensity analyses of the high-resolution spectrum of the H218O isotopic species of the water molecule are performed with the Bending-Rotation approach up to J = 17 and the First Triad of interacting states, (0 2 0), (1 0 0), and (0 0 1). The line position analysis involves microwave and terahertz transitions, ground state combination differences, far infrared and infrared lines, and experimental energy levels which were reproduced with a 1.2 unitless standard deviation. The data set considered in the line intensity analysis consists of 3707 infrared transitions recorded using absorption spectroscopy at room temperature which were fitted with a 1.4 unitless standard deviation. The results of both analyses are compared with previous investigations and are used to build a line position and line intensity database to update the HITRAN and GEISA databases. A comparison with the HITRAN 2012 database reveals that the new database yields intensity values closer to the experimental ones.

  4. Documentation associated with the shipping of Hot-Cell Waste from WESF 225-B to the 200W (218-W-3AE) burial grounds under shipment number RSR-37338

    The purpose of this report is to compile the records generated during the Packaging and Shipping of WESF Hot-Cell Waste from the 225-B Facility to 200W (218-W-3AE) burial grounds. A total of six 55-gallon drums were packaged and shipped using the Chem-Nuc Cask in accordance with WHC-SD-TP-SARP-025, Rev.0 ''Safety Analysis Report for Packaging (Onsite) for Type B Material in the CNS-14-215H Cask''

  5. miR-7 and miR-218 epigenetically control tumor suppressor genes RASSF1A and Claudin-6 by targeting HoxB3 in breast cancer

    Highlights: ► Both miR-7 and miR-218 down-regulates HoxB3 expression by targeting the 3′-UTR of HoxB3 mRNA. ► A reverse correlation between the levels of endogenous miR-7, miR218 and HoxB3 expression. ► Epigenetic changes involve in the reactivation of HoxB3. ► Both miRNAs inhibits the cell cycle and clone formation of breast cancer cells. -- Abstract: Many microRNAs have been implicated as key regulators of cellular growth and differentiation and have been found to dysregulate proliferation in human tumors, including breast cancer. Cancer-linked microRNAs also alter the epigenetic landscape by way of DNA methylation and post-translational modifications of histones. Aberrations in Hox gene expression are important for oncogene or tumor suppressor during abnormal development and malignancy. Although recent studies suggest that HoxB3 is critical in breast cancer, the putative role(s) of microRNAs impinging on HoxB3 is not yet fully understood. In this study, we found that the expression levels of miR-7 and miR-218 were strongly and reversely associated with HoxB3 expression. Stable overexpression of miR-7 and miR-218 was accompanied by reactivation of tumor suppressor genes including RASSF1A and Claudin-6 by means of epigenetic switches in DNA methylation and histone modification, giving rise to inhibition of the cell cycle and clone formation of breast cancer cells. The current study provides a novel link between overexpression of collinear Hox genes and multiple microRNAs in human breast malignancy.

  6. IUPAC critical evaluation of the rotational–vibrational spectra of water vapor. Part IV. Energy levels and transition wavenumbers for D216O, D217O, and D218O

    This paper is the fourth of a series of papers reporting critically evaluated rotational–vibrational line positions, transition intensities, pressure dependences, and energy levels, with associated critically reviewed assignments and uncertainties, for all the main isotopologues of water. This paper presents energy level and transition data for the following doubly and triply substituted isotopologues of water: D216O, D217O, and D218O. The MARVEL (Measured Active Rotational–Vibrational Energy Levels) procedure is used to determine the levels, the lines, and their self-consistent uncertainties for the spectral regions 0–14 016, 0–7969, and 0–9108 cm−1 for D216O, D217O, and D218O, respectively. For D216O, D217O, and D218O, 53 534, 600, and 12 167 lines are considered, respectively, from spectra recorded in absorption at room temperature and in emission at elevated temperatures. The number of validated energy levels is 12 269, 338, and 3351 for D216O, D217O, and D218O, respectively. The energy levels have been checked against the ones determined, with an average accuracy of about 0.03 cm−1, from variational rovibrational computations employing exact kinetic energy operators and an accurate potential energy surface. Furthermore, the rovibrational labels of the energy levels have been validated by an analysis of the computed wavefunctions using the rigid-rotor decomposition (RRD) scheme. The extensive list of MARVEL lines and levels obtained is deposited in the Supplementary Material of this paper, in a distributed information system applied to water, W@DIS, and on the official MARVEL website, where they can easily be retrieved. - Highlights: • All published transitions are collected and analyzed. • A set of validated rovibrational transitions are presented. • Experimental energy levels for all three D2O isotopologues are determined. • Synthetic spectra are presented using these validated energy levels

  7. Efficient automated one-step synthesis of 2-[18F]fluoroethylcholine for clinical imaging: optimized reaction conditions and improved quality controls of different synthetic approaches

    [18F]-labelled choline analogues, such as 2-[18F]fluoroethylcholine (18FECH), have suggested to be a new class of choline derivatives highly useful for the imaging of prostate and brain tumours. In fact, tumour cells with enhanced proliferation rate usually exhibit an improved choline uptake due to the increased membrane phospholipids biosynthesis. The aim of this study was the development of a high yielding synthesis of 18FECH. The possibility of shortening the synthesis time by reacting all the reagents in a convenient and rapid one-step reaction was specially considered. Methods: 18FECH was synthesized by reacting [18F]fluoride with 1,2-bis(tosyloxy)ethane and N,N-dimethylaminoethanol. The synthesis was carried out using both a one- and a two-step reaction in order to compare the two procedures. The effects on the radiochemical yield and purity by using different [18F]fluoride phase transfer catalysts, reagents amounts and purification methods were assessed. Quality controls on the final products were performed by means of radio-thin-layer chromatography, gas chromatography and high-performance liquid chromatography equipped with conductimetric, ultraviolet and radiometric detectors. Results: In the optimized experimental conditions, 18FECH was synthesized with a radiochemical yield of 43±3% and 48±1% (not corrected for decay) when the two-step or the one-step approach were used, respectively. The radiochemical purity was higher than 99% regardless of the different synthetic pathways or purification methods adopted. The main chemical impurity was due to N,N-dimethylmorpholinium. The identity of this impurity in 18FECH preparations was not previously reported. Conclusion: An improved two-step and an innovative one-step reaction for synthesizing 18FECH in a high yield were reported. The adaptation of a multistep synthesis to a single step process, opens further possibilities for simpler and more reliable automations.

  8. Positron Emission Tomography with 2-Deoxy-2-[18F] Fluoro-DGlucose in the Detection of Malignancy in Intraductal Papillary Mucinous Neoplasms of the Pancreas

    Brian KP Goh

    2007-05-01

    Full Text Available A 79-year-old Indian male was admitted with upper abdominal discomfort of 1-year duration which was associated with loss of weight and appetite. Clinical examination of the abdomen did not reveal any palpable masses. Laboratory investigations including a complete blood count, liver function tests and serum amylase were unremarkable. Standard serum tumor markers were within normal limits: carbohydrate antigen (CA 19-9, 13.4 U/mL (reference range: 3-45 U/mL; carcinoembryonic antigen (CEA, 1.4 μg/L (reference range: 0.5-3.5 μg/L and alphafetoprotein, 1.3 μg/L (reference range: 1-10 μg/L. A contrast-enhanced computed tomographic (CT scan demonstrated a cystically dilated and tortuous pancreatic duct measuring 1.9 cm, suggestive of an intraductal papillary mucinous neoplasm (IPMN. The common bile duct was dilated up to the level of the ampulla and a 3.2x2.0 cm heterogeneous soft tissue mass was observed in the head of the pancreas which extended into the duodenum, suggestive of a malignant lesion (Images 1 and 2. Fusion positron emission tomography/computed tomography (PET/CT was subsequently performed with 12.7 mCi of 2-deoxy-2-[18F] fluoro-D-glucose (18F-FDG administered intravenously. A whole body PET/CT scan was performed 60 minutes later with CT data used for attenuation correction and anatomical correlation. This confirmed a metabolically active focus within the pancreatic head mass with a standard uptake value (SUVmax of 3.5 compatible with carcinoma (Image 3.

  9. N-(N-benzylpiperidin-4-yl)-2-[18F]fluorobenzamide: A potential ligand for PET imaging of σ receptors

    Four nitro- and fluorobenzamides (1-4) have been synthesized in good yields from nitro- and fluoro-substituted benzoyl chloride with 4-amino-1-benzylpiperidine. In vitro studies showed that these compounds have high affinities to σ receptors. N-(N-Benzylpiperidin-4-yl)-2-fluorobenzamide (3), in particular, bound to σ receptors with high affinity (Ki = 3.4 nM, guinea pig brain membranes) and high selectivity (σ-2/σ-1 = 120). It was, therefore, labeled with 18F and evaluated as a σ receptor radioligand. N-(N-Benzylpiperidin-4-yl)-2-[18F]fluorobenzamide (3a) was synthesized in one step by nucleophilic substitution of the 2-nitro precursor (1) with [18F]fluoride in DMSO at 140 deg. C for 20 min followed by purification with HPLC in 4-10% yield (decay corrected). The synthesis time was 90 min and the specific activity was 0.4-1.0 Ci/μmol. Tissue distribution in mice revealed that the uptakes of 3a in the brain, heart, liver, lungs, spleen, kidneys and small intestine were high, and the radioactivity in these organs remained constant from 60 to 120 min post-injection. The radioactivity in the bone did not significantly increase, suggesting in vivo defluorination may not be the major route of metabolism of 3a in mice. Blocking studies with haloperidol in rats indicated that the uptake of compound 3a in the rat brain was selective to haloperidol-sensitive σ sites. These results suggest that compound 3a is a potent σ receptor radioligand and may be a potential ligand for PET imaging of σ receptors in humans

  10. Sick-leave track record and other potential predictors of a disability pension. A population based study of 8,218 men and women followed for 16 years

    Rosengren Annika

    2009-04-01

    Full Text Available Abstract Background A number of previous studies have investigated various predictors for being granted a disability pension. The aim of this study was to test the efficacy of sick-leave track record as a predictor of being granted a disability pension in a large dataset based on subjects sampled from the general population and followed for a long time. Methods Data from five ongoing population-based Swedish studies was used, supplemented with data on all compensated sick leave periods, disability pensions granted, and vital status, obtained from official registers. The data set included 8,218 men and women followed for 16 years, generated 109,369 person years of observation and 97,160 sickness spells. Various measures of days of sick leave during follow up were used as independent variables and disability pension grant was used as outcome. Results There was a strong relationship between individual sickness spell duration and annual cumulative days of sick leave on the one hand and being granted a disability pension on the other, among both men and women, after adjustment for the effects of marital status, education, household size, smoking habits, geographical area and calendar time period, a proxy for position in the business cycle. The interval between sickness spells showed a corresponding inverse relationship. Of all the variables studied, the number of days of sick leave per year was the most powerful predictor of a disability pension. For both men and women 245 annual sick leave days were needed to reach a 50% probability of transition to disability. The independent variables, taken together, explained 96% of the variation in disability pension grantings. Conclusion The sick-leave track record was the most important predictor of the probability of being granted a disability pension in this study, even when the influences of other variables affecting the outcome were taken into account.

  11. 2-[18F]-fluoro-2-desoxy-D-glucose positron emission tomography initial staging impacts on survival in Hodgkin lymphoma

    Juliano; J; Cerci; Camila; C; G; Linardi; Luís; F; Pracchia; José; Soares; Junior; Evelinda; Trindade; Dominique; Delbeke; Rodrigo; J; Cerci; Robert; Carr; José; C; Meneghetti; Valeria; Buccheri

    2013-01-01

    AIM:To assess the prognostic value and risk classification improvement of metabolic staging(MS)with Initial2-[18F]-fluoro-2-desoxy-D-glucose positron emission tomography(FDG-PET)in initial staging of Hodgkin’s Lymphoma(HL)patients to predict 5 years overall survival(5y-OS)and event free survival(EFS).METHODS:A total of 275 patients were included in this retrospective study,155 patients were staged with conventional anatomical staging(AS),and 120 also submitted to MS(FDG-PET).Prognostic analysis compared 5y-OS and 5y-EFS of patients staged with AS and MS.Risk-adjusted models incorporated clinical risk factors,computed tomography and FDG-PET staging.RESULTS:During the follow up of 267 evaluated patients,220(122 AS and 98 MS)achieved complete remission after first-line therapy(median follow-up:70±29 mo),treatment failure occurred in 79 patients and 34 died.The 5y-EFS for early vs advanced disease in AS patients was 79.3%and 66.7%,and 85.6%and53.6%in MS patients,respectively(P<0.01).The5y-OS for early and advanced disease with AS was91.3%and 81.5%,and 97.5%and 80.7%for patients staged with MS,respectively.Cox proportional hazards analysis demonstrated that FDG-PET added signifcant prognostic information and improved risk prediction(P=0.02).CONCLUSION:Initial staging FDG-PET could be used as an accurate and independent predictor of OS and EFS in HL,with impact in 5y-EFS and OS.

  12. Reproducibility of O-(2-18F-fluoroethyl)-L-tyrosine uptake kinetics in brain tumors and influence of corticoid therapy: an experimental study in rat gliomas

    Positron emission tomography (PET) using O-(2-18F-fluoroethyl)-L-tyrosine (18F-FET) is a well-established method for the diagnostics of brain tumors. This study investigates reproducibility of 18F-FET uptake kinetics in rat gliomas and the influence of the frequently used dexamethasone (Dex) therapy. F98 glioma or 9L gliosarcoma cells were implanted into the striatum of 31 Fischer rats. After 10-11 days of tumor growth, the animals underwent dynamic PET after injection of 18F-FET (baseline). Thereafter, animals were divided into a control group and a group receiving Dex injections, and all animals were reinvestigated 2 days later. Tumor-to-brain ratios (TBR) of 18F-FET uptake (18-61 min p.i.) and the slope of the time-activity-curves (TAC) (18-61 min p.i.) were evaluated using a Volume-of-Interest (VOI) analysis. Data were analyzed by two-way repeated measures ANOVA and reproducibility by the intraclass correlation coefficient (ICC). The slope of the tumor TACs showed high reproducibility with an ICC of 0.93. A systematic increase of the TBR in the repeated scans was noted (3.7 ± 2.8 %; p < 0.01), and appeared to be related to tumor growth as indicated by a significant correlation of TBR and tumor volume (r = 0.77; p < 0.0001). After correction for tumor growth TBR showed high longitudinal stability with an ICC of 0.84. Dex treatment induced a significant decrease of the TBR (-8.2 ± 6.1 %; p < 0.03), but did not influence the slope of the tumor TAC. TBR of 18F-FET uptake and tracer kinetics in brain tumors showed high longitudinal stability. Dex therapy may induce a minor decrease of the TBR; this needs further investigation. (orig.)

  13. Pharmacokinetics and metabolism of 2-[18F]fluoro-2-deoxy-d-glucose (FDG) in mammary tumors of antiestrogen-treated rats

    Attempts are being made to evaluate 2-[18F]fluoro-2-deoxy-d-glucose (FDG) as a noninvasive marker of therapy response in malignant tumors. We studied rats with 7,12-dimethylbenzanthracene (DMBA)-induced mammary carcinomas by measuring the differential absorption ratio (DAR) and the metabolites of FDG in tumor homogenates. Half the rats were treated with the antiestrogen toremifene for 14 days and half were untreated. The histology of the tumors was studied by morphometry. The animals were killed 15, 45 or 240 min after injection. Regardless of whether the rats received toremifene or not, the fractional change in tumor volume correlated better with the DAR at 15 min [r = 0.284 (untreated) and r = 0.721 (treated)] and at 240 min [r 0.932 (untreated)], than at 45 min [r = -0.137 (untreated) and r = 0.265 (treated)]. Inverse relations were found for the fraction of unmetabolized FDG and change in tumor volume [r = 0.070 (45 min) and r = -0.872 (240 min) for untreated tumors and r = -0.963 (15 min) and r = -0.715 (45 min) for treated tumors]. The DAR and the fraction of unmetabolized FDG correlated also [r = -0.420 (15 min), r = -0.647 (45 min) and r = -0.976 (240 min) for untreated tumors, and r = -0.963 (15 min) and r = -0.213 (45 min) for treated tumors]. No significant therapy-induced morphometrical changes were observed. These findings imply that the FDG-derived uptake of radioactivity (= DAR) does relate to the tumor's speed of growth shortly after injection and also after some time, but there is a time period in between (a 'twilight zone') when this correlation is poor. These findings may have implications for FDG-PET studies in cancer patients: the optimal imaging time may have to be reconsidered

  14. Physical activity attenuates the influence of FTO variants on obesity risk: a meta-analysis of 218,166 adults and 19,268 children.

    Tuomas O Kilpeläinen

    2011-11-01

    Full Text Available The FTO gene harbors the strongest known susceptibility locus for obesity. While many individual studies have suggested that physical activity (PA may attenuate the effect of FTO on obesity risk, other studies have not been able to confirm this interaction. To confirm or refute unambiguously whether PA attenuates the association of FTO with obesity risk, we meta-analyzed data from 45 studies of adults (n = 218,166 and nine studies of children and adolescents (n = 19,268.All studies identified to have data on the FTO rs9939609 variant (or any proxy [r(2>0.8] and PA were invited to participate, regardless of ethnicity or age of the participants. PA was standardized by categorizing it into a dichotomous variable (physically inactive versus active in each study. Overall, 25% of adults and 13% of children were categorized as inactive. Interaction analyses were performed within each study by including the FTO×PA interaction term in an additive model, adjusting for age and sex. Subsequently, random effects meta-analysis was used to pool the interaction terms. In adults, the minor (A- allele of rs9939609 increased the odds of obesity by 1.23-fold/allele (95% CI 1.20-1.26, but PA attenuated this effect (p(interaction  = 0.001. More specifically, the minor allele of rs9939609 increased the odds of obesity less in the physically active group (odds ratio  = 1.22/allele, 95% CI 1.19-1.25 than in the inactive group (odds ratio  = 1.30/allele, 95% CI 1.24-1.36. No such interaction was found in children and adolescents.The association of the FTO risk allele with the odds of obesity is attenuated by 27% in physically active adults, highlighting the importance of PA in particular in those genetically predisposed to obesity.

  15. Positron emission tomography agent 2-deoxy-2-[18F]fluoro-D-glucose has a therapeutic potential in breast cancer

    Novel approaches are needed for breast cancer patients in whom standard therapy is not effective. 2-Deoxy-2-[18F]fluoro-D-glucose (18F-FDG) was evaluated as a potential radiomolecular therapy agent in breast cancer animal models and, retrospectively, in patients with metastatic breast cancer. Polyoma middle T antigen (PyMT) and mouse mammary tumor virus-NeuT transgenic mice with tumors 0.5–1 cm in diameter were imaged with 18F-FDG, and tumor to liver ratios (TLRs) were calculated. The radiotoxicity of 18F-FDG administration was determined in healthy mice. PyMT mice with small (0.15–0.17 cm) and large (more than 1 cm) tumors were treated with 2–4 mCi of 18F-FDG, and control C3H/B6 mice with 3 mCi of 18F-FDG. At 10 days after treatment the tumors and control mammary glands were analyzed for the presence of apoptotic and necrotic cells. Five patients with breast cancer and metastatic disease were evaluated and standardized uptake values (SUVs) in tumors, maximum tolerated dose, and the doses to the tumor were calculated. Doses up to 5 mCi proved to be non-radiotoxic to normal organs. The 18F-FDG uptake in mouse tumors showed an average TLR of 1.6. The treatment of mice resulted in apoptotic cell death in the small tumors. Cell death through the necrotic pathway was seen in large tumors, and was accompanied by tumor fragmentation and infiltration with leukocytes. Normal mammary tissues were not damaged. A human 18F-FDG dose delivering 200 rad to the red marrow (less than 5% damage) was calculated to be 4.76 Ci for a 70 kg woman, and the dose to the tumors was calculated to be 220, 1100 and 2200 rad for SUVs of 1, 5 and 10, respectively. We have shown that positrons delivered by 18F-FDG to mammary tumors have a tumoricidal effect on cancer cells. The study of breast cancer patients suggests that the tumor and normal organ dosimetry of 18F-FDG makes it suitable for therapy of this malignancy

  16. Positron emission tomography with 2-[18F]-Fluoro-2-Deoxy-D-Glucose for initial staging of hodgkin lymphoma: a single center experience in Brazil

    Juliano Julio Cerci

    2009-06-01

    Full Text Available BACKGROUND: 2-[18F]-Fluoro-2-Deoxy-D-Glucose (FDG-PET is a well established functional imaging modality for the initial staging of Hodgkin lymphoma (HL in patients from Western Europe and North America. The reliability of FDG-PET in populations of different ethnic groups is unclear, as all investigations published to date have come from developed countries. PURPOSE: The aim of the present study was to investigate the effectiveness of FDG-PET in the initial staging of HL patients in a Brazilian population. METHODS: Eighty-two patients with newly diagnosed HL were prospectively included in the study. All patients were staged with both conventional clinical staging (CCS methods, including computed tomography (CT and whole-body FDG-PET methods. A standard of reference for the nodal regions and the extranodal organs was determined using all available information, including the CCS methods, FDG-PET, the diagnostic histology and the follow-up examinations. The results of the CCS were then compared to the FDG-PET results. RESULTS: The sensitivity of FDG-PET was higher for nodal staging than that of CT (87.8% vs. 61.6%, respectively. FDG-PET was also more sensitive than CT in regard to evaluating the extranodal organs for lymphomatous involvement (96.2% vs. 40.0%, respectively. FDG-PET detected all 16 patients who were characterized by a positive bone marrow biopsy and identified an additional 4 patients with bone marrow disease. The incorporation of FDG-PET coupled with CCS in the staging procedure upstaged 20% (17/82 of the patients and downstaged 11% (9/82 of the patients. As a result of these changes in staging, 15% (13/82 of the patients would have received a different therapeutic regimen. CONCLUSIONS: The FDG-PET method is superior to CT for the detection of nodal and extra-nodal HL. The observation that the FDG-PET method upstaged the disease was the most common result (20% of patients brought about by the addition of PET to the staging algorithm

  17. Investigating the impact of light and water status on the exchange of COS, 13CO2, CO18O and H218O from bryophytes

    Gimeno, Teresa; Royles, Jessica; Ogee, Jerome; Jones, Samuel; Burlett, Regis; West, Jason; Sauze, Joana; Wohl, Steven; Genty, Bernard; Griffiths, Howard; Wingate, Lisa

    2016-04-01

    Terrestrial surfaces are often covered by photoautotrophic communities that play a significant role in the biological fixation of C and N at the global scale. Bryophytes (mosses, liverworts and hornworts) are key members in these communities and are especially adapted to thrive in hostile environments, by growing slowly and surviving repeated dehydration events. Consequently, bryophyte communities can be extremely long-lived (>1500yrs) and can serve as valuable records of historic climate change. In particular the carbon and oxygen isotope compositions of mosses can be used as powerful proxies describing how growing season changes in atmospheric CO2 and rainfall have changed in the distant past over the land surface. Interpreting the climate signals of bryophyte biomass requires a robust understanding of how changes in photosynthetic activity and moisture status regulate the growth and isotopic composition of bryophyte biomass. Thus theoretical models predicting how changes in isotopic enrichment and CO2 discrimination respond to dehydration and rehydration are used to tease apart climatic and isotopic source signals. Testing these models with high resolution datasets obtained from new generation laser spectrometers can provide more information on how these plants that lack stomata cope with water loss. In addition novel tracers such as carbonyl sulfide (COS) can also be measured at high resolution and precision (CO2, CO18O and H218O fluxes by a bryophyte species (Marchantia sp.) in the light and during the dark, through complete desiccation cycles. Our measurements consistently reveal a strong enrichment dynamic in the oxygen isotope composition of transpired water over the dessication cycle that caused an increase in the oxygen isotope discrimination of CO2. These data followed closely values predicted by our process-based model. We also observed a consistent pattern in the fluxes of CO2 and COS during the desiccation cycle. Initially when the bryophyte was wet

  18. Glacial-interglacial changes in H218O, HDO and deuterium excess - results from the fully coupled ECHAM5/MPI-OM Earth system model

    Werner, M.; Haese, B.; Xu, X.; Zhang, X.; Butzin, M.; Lohmann, G.

    2016-02-01

    In this study we present the first results of a new isotope-enabled general circulation model set-up. The model consists of the fully coupled ECHAM5/MPI-OM atmosphere-ocean model, enhanced by the JSBACH interactive land surface scheme and an explicit hydrological discharge scheme to close the global water budget. Stable water isotopes H218O and HDO have been incorporated into all relevant model components. Results of two equilibrium simulations under pre-industrial and Last Glacial Maximum conditions are analysed and compared to observational data and paleoclimate records for evaluating the model's performance in simulating spatial and temporal variations in the isotopic composition of the Earth's water cycle. For the pre-industrial climate, many aspects of the simulation results of meteoric waters are in good to very good agreement with both observations and earlier atmosphere-only simulations. The model is capable of adequately simulating the large spread in the isotopic composition of precipitation between low and high latitudes. A comparison to available ocean data also shows a good model-data agreement; however, a strong bias of overly depleted ocean surface waters is detected for the Arctic region. Simulation results under Last Glacial Maximum boundary conditions also fit to the wealth of available isotope records from polar ice cores, speleothems, as well as marine calcite data. Data-model evaluation of the isotopic composition in precipitation reveals a good match of the model results and indicates that the temporal glacial-interglacial isotope-temperature relation was substantially lower than the present spatial gradient for most mid- to high-latitudinal regions. As compared to older atmosphere-only simulations, a remarkable improvement is achieved for the modelling of the deuterium excess signal in Antarctic ice cores. Our simulation results indicate that cool sub-tropical and mid-latitudinal sea surface temperatures are key for this progress. A recently

  19. Glacial–interglacial changes of H218O, HDO and deuterium excess – results from the fully coupled Earth System Model ECHAM5/MPI-OM

    M. Werner

    2015-10-01

    Full Text Available In this study we present first results of a new isotope-enabled general circulation model setup. The model consists of a fully coupled atmosphere–ocean model ECHAM5/MPI-OM, enhanced by the interactive land surface scheme JSBACH and an explicit hydrological discharge scheme to close the global water budget. Stable water isotopes H218O and HDO have been incorporated into all relevant model components. Results of two equilibrium simulations under pre-industrial and last glacial maximum conditions are analysed and compared to observational data and paleoclimate records for evaluating the model's performance of simulating spatial and temporal variations in the isotopic composition of the Earth's water cycle. For the pre-industrial climate, many aspects of the simulation results of meteoric waters are in good to very good agreement with both observations and earlier atmosphere-only simulations. The model is capable of adequately simulating the large spread in the isotopic composition of precipitation between low and high latitudes. A comparison to available ocean data also shows a good model-data agreement, however a strong bias of too depleted ocean surface waters is detected for the Arctic region. Simulation results under last glacial maximum boundary conditions also fit to the wealth of available isotope records from polar ice cores, speleothems, as well as marine calcite data. Data-model evaluation of the isotopic composition in precipitation reveals a good match of the model results and indicates that the temporal glacial–interglacial isotope–temperature relation was substantially lower than the present spatial gradient for most mid- to high-latitudinal regions. As compared to older atmosphere-only simulations, a remarkable improvement is achieved for the modelling of the deuterium excess signal in Antarctic ice cores. Our simulation results indicate that cool sub-tropical and mid-latitudinal sea surface temperatures are key for this

  20. Environmental Assessment and Finding of No Significant Impact: Widening Trench 36 of the 218-E-12B Low-Level Burial Ground, Hanford Site, Richland, Washington

    N/A

    1999-02-11

    This environmental assessment was prepared to assess potential environmental impacts associated with the proposed action to widen and operate unused Trench 36 in the 218-E-12B Low-Level Burial Ground for disposal of low-level waste. Information contained herein will be used by the Manager, U.S. Department of Energy, Richland Operations Office, to determine if the Proposed Action is a major federal action significantly affecting the quality of the human environment. If the Proposed Action is determined to be major and significant, an environmental impact statement will be prepared. If the Proposed Action is determined not to be major and significant, a Finding of No Significant Impact will be issued and the action may proceed. Criteria used to evaluate significance can be found in Title 40, Code of Federal Regulations 1508.27. This environmental assessment was prepared in compliance with the ''National Environmental Policy Act of1969'', as amended, the Council on Environmental Quality Regulations for Implementing the Procedural Provisions of ''National Environmental Policy Act'' (Title 40, Code of Federal Regulations 1500-1508), and the U.S. Department of Energy Implementing Procedures for ''National Environmental Polio Act'' (Title 10, Code of Federal Regulations 1021). The following is a description of each section of this environmental assessment. (1) Purpose and Need for Action. This section provides a brief statement concerning the problem or opportunity the U.S, Department of Energy is addressing with the Proposed Action. Background information is provided. (2) Description of the Proposed Action. This section provides a description of the Proposed Action with sufficient detail to identify potential environmental impacts. (3) Alternatives to the Proposed Action. This section describes reasonable,alternative actions to the Proposed Action, which addresses the Purpose and Need. A No Action Alternative

  1. New radiosynthesis of 2-deoxy-2-[18F]fluoroacetamido-D-glucopyranose and its evaluation as a bacterial infections imaging agent

    Introduction: The diagnosis of infection and the ability to distinguish bacterial infection from nonbacterial inflammation by positron emission tomography (PET) have gained interest in recent years, but still few specific radiopharmaceuticals are available for use. In this study, we developed a new radiosynthesis method of 2-deoxy-2-[18F]fluoroacetamido-D-glucopyranose ([18F]FAG) by applying microwave irradiation and demonstrated that [18F]FAG could be a potential radiopharmaceutical to distinguish bacterial infection from nonbacterial inflammation. Methods: 1,3,4,6-Tetra-O-acetyl-2-deoxy-2-bromoacetamido-D-glucopyranose was used as precursor, and labeling was performed under microwave irradiation conditions followed by alkaline hydrolysis and high-performance liquid chromatography (HPLC) purification. In vitro uptake of [18F]FAG by Escherichia coli was performed. Tissue biodistribution of [18F]FAG was performed in mice. Moreover, PET imaging acquisition of E. coli infection and nonbacterial inflammation models was performed in rats. Tissue radiotracer-accumulated sites were analyzed by hematoxylin and eosin staining and anti-E.coli immunostaining. Results: The radiosynthesis of [18F]FAG was achieved with microwave irradiation, and the radiochemical yield was 9.7%±2.8% end of bombardment (EOB); the radiochemical purity was more than 98%, and the total synthesis time was 62 min. Compared with control group, in vitro uptake of [18F]FAG by E. coli was significantly decrease in inhibition group (P18F]FAG from the animal body. [18F]FAG clearly visualized the infection areas but not nonbacterial inflammation areas in PET studies. Quantitative analysis revealed that the uptake of [18F]FAG into infection areas was significantly higher than that of [18F]FAG into inflammation areas (P18F]FAG. Conclusions: Using 1,3,4,6-tetra-O-acetyl-2-deoxy-2-bromoacetamido-D-glucopyranose as a precursor, the new radiosynthesis method of [18F]FAG was achieved in fewer steps and with a

  2. Comparing 2-[18F]fluoro-2-deoxy-D-glucose and [68Ga]gallium-citrate translocation in Arabidopsis thaliana

    2-[18F]fluoro-2-deoxy-D-glucose (18FDG) is a glucose surrogate commonly used in clinical or animal imaging but rarely in plant imaging to trace glucose metabolism. Recently, 18FDG has been employed in plant imaging for studying photoassimilate translocation and glycoside biosynthesis. There is growing evidence that 18FDG could be used as a tracer in plant imaging studies to trace sugar dynamics. However, to confirm this hypothesis, it was necessary to show that the observed 18FDG distribution in an intact plant is an outcome of the chemical nature of the introduced radiotracer and not of the plant vascular architecture or radiotracer introduction method. Methods: In the present work, we fed 18FDG and [68Ga]gallium-citrate (68Ga-citrate) solution through mature Arabidopsis thaliana leaf and monitored subsequent radioactivity distribution using positron autoradiography. The possible route of radioactivity translocation was elucidated through stem-girdling experiments. We also employed a bi-functional positron emission tomography/computed tomography (PET/CT) modality to capture 18FDG radiotracer dynamics in one of the plants in order to assess applicability of PET/CT for 4-D imaging in an intact plant. Results: Autoradiography results showed that [18F] radioactivity accumulated mostly in roots and young growing parts such as the shoot apex, which are known to act as sinks for photoassimilate. [18F] radioactivity translocation, in this case, occurred mainly via phloem. PET/CT results corroborated with autoradiography. [68Ga] radioactivity, on the other hand, was mainly translocated to neighboring leaves and its translocation occurred via both xylem and phloem. Conclusion: The radioactivity distribution pattern and translocation route observed after 18FDG feeding is markedly different from that of 68Ga-citrate. [18F] radioactivity distribution pattern in an intact plant is found similar to the typical distribution pattern of photoassimilates. Despite its limitations in

  3. A Fully Automated Radiosynthesis of [18F]Fluoroethyl-Diprenorphine on a Single Module by Use of SPE Cartridges for Preparation of High Quality 2-[18F]Fluoroethyl Tosylate

    Gjermund Henriksen

    2013-06-01

    Full Text Available We have developed a new method for automated production of 2-[18F]fluoroethyl tosylate ([18F]FETos that enables 18F-alkylation to provide PET tracers with high chemical purity. The method is based on the removal of excess ethylene glycol bistosylate precursor by precipitation and subsequent filtration and purification of the filtrate by means of solid phase extraction cartridges (SPE. The method is integrated to a single synthesis module and thereby provides the advantage over previous methods of not requiring HPLC purification, as demonstrated by the full radiosynthesis of the potent opioid receptor PET tracer [18F]fluoroethyldiprenorphine.

  4. Early interim 2-[18F]fluoro-2-deoxy-D-glucose positron emission tomography is prognostically superior to international prognostic score in advanced-stage Hodgkin's lymphoma: a report from a joint Italian-Danish study

    Loft, Annika; Gallamini, Andrea; Hutchings, Martin; Rigacci, Luigi; Specht, Lena; Merli, Francesco; Hansen, Mads; Patti, Caterina; Jakobsen, Annika Loft; Di Raimondo, Francesco; D'Amore, Francesco; Biggi, Alberto; Vitolo, Umberto; Stelitano, Caterina; Sancetta, Rosario; Trentin, Livio; Luminari, Stefano; Iannitto, Emilio; Viviani, Simonetta; Pierri, Ivana; Levis, Alessandro

    2007-01-01

    PURPOSE: Starting from November 2001, 260 newly diagnosed patients with Hodgkin's lymphoma (HL) were consecutively enrolled in parallel Italian and Danish prospective trials to evaluate the prognostic role of an early interim 2-[(18)F]fluoro-2-deoxy-D-glucose positron emission tomography (FDG...... adverse prognostic factors. All but 11 patients were treated with standard ABVD therapy followed by consolidation radiotherapy in case of bulky presentation or residual tumor mass. Conventional radiologic staging was performed at baseline. FDG-PET scan was performed at baseline and after two courses of...

  5. An efficient, one-pot synthesis of 2-deoxy-2-[18F]fluoro-acetamido-D-glucopyranose (N-[18F]fluoroacetyl-D-glucosamine), potential diagnostic imaging agent

    A rapid, one-pot synthesis of 2-deoxy-2-[18F]fluoroacetamido-D-glucopyranose (N-[18F]fluoroacetyl-D-glucosamine) starting from [18F]fluoride and ethyl bromoacetate is described. The synthesis was accomplished by a combination of halogen exchange, alkaline hydrolysis, and condensation. [18F]Fluoride was produced by the 18O (p, n) 18F nuclear reaction using the cyclotron. The total synthesis time, the radiochemical yield, and purity are ca. 90 min, ca. 9.1%, and >98%, respectively. This sugar showed diagnostic tumor-imaging activity. (author)

  6. Synthesis and comparison of 4-[18F]F-ADAM, 2-[18F]F-ADAM, N-Desmethyl-4-[18F]F-ADAM and [18F]F-AFM as serotonin transporter imaging agents

    4-[18F]F-ADAM (1a), 2-[18F]F-ADAM (2a), N-Desmethyl-4-[18F]F-ADAM (3a) and [18F]F-AFM (4a ) were synthesized in 1.7, 3.9, 2.9 and 0.6% yield (EOS), respectively, in a synthesis time of ∼120 min from EOB. PET studies in rats showed that the maximum specific uptake ratios of 1a, 2a, 3a and 4a in midbrain were 3.86, 0.73, 0.35 and 2.23, respectively. Thus, in terms of radiochemical yield, specific binding and in vivo stability, 4-[18F]F-ADAM may be the most appropriate SERT imaging agent for human studies. - Highlights: ► Four 18F-labeled radioligands were synthesized and evaluated as SERT imaging agents. ► 4-[18F]F-ADAM and [18F]F-AFM had high specific uptake in SERT-rich brain regions. ► 2-[18F]F-ADAM and N-Desmethyl-4-[18F]F-ADAM had low specific uptake in brain. ► 4-[18F]F-ADAM may be the most appropriate SERT imaging agent for human studies.

  7. Refsiréttur : um 2. mgr. 218. gr. almennra hegningarlaga nr. 19/1940 : þegar ekki hlýst bani af atlögu

    Aldís Ýr Ólafsdóttir 1983

    2009-01-01

    Með lögum um breytingar á almennum hegningarlögum nr. 20/1981 var annarri málsgrein bætt við 218. gr. almennra hegningarlaga nr. 19/1940. Var þetta gert þar sem of ólík brot voru heimfærð undir ákvæðið sem tók til allt frá minniháttar líkamsmeiðingum, t.d. beinbrot, og allt til stórfelldra líkamsmeiðinga þar með talið þegar bani hlaust af líkamsárás. Ritgerð þessi fjallar um líkamsárásir sem valda stórfelldu líkams- eða heilsutjóni sbr. 2. mgr. 218. gr. þegar ekki hlýst bani af. Farið verður ...

  8. Manndráp og meiriháttar líkamsmeiðingar - Mörk 211. gr. og 2. mgr. 218. gr. hgl. þegar bani hlýst af atlögu

    Sonja Hjördís Berndsen 1986

    2011-01-01

    Efni ritgerðar þessarar eru skilin milli ákvæðis 211. gr. um manndráp af ásetningi og ákvæðis 2. mgr. 218. gr. almennra hegningarlaga nr. 19/1940 um meiriháttar líkamsárás, þegar bani hlýst af atlögu. Verknaður sem leiðir til dauða er felldur undir 211. gr. hgl. nái ásetningur geranda bæði til frumverknaðar og þess dauðdaga sem fylgir verknaðinum. Verði afleiðingarnar sem í dauðdaganum felast eingöngu raktar til gáleysis geranda, er háttsemi felld undir 2. mgr. 218. gr. hgl. Við athugun á...

  9. Synthesis of O-[2-[18F]fluoro-3-(2-nitro-1H-imidazole-1-yl)propyl]tyrosine ([18F]FNT]) as a new class of tracer for imaging hypoxia

    For detection of hypoxic tumor tissue, all radiotracers synthesized until now, are based on the concept that cellular uptake is being controlled by diffusion. As a new approach, we chose the concept to have the tracer hypothetically transported into the cells by well known carrier systems like the amino acid transporters. For this purpose, radiosynthesis of O-[2-[18F]fluoro-3-(2-nitro-1H-imidazole-1yl)propyl]tyrosine ([18F]FNT]) was carried out from methyl 2-(benzyloxycarbonyl)-3-(4-3-(2-nitro-1H-imidazol-1-yl) -2-(tosyloxy)propoxy) phenyl)propanoate via no-carrier-added nucleophilic aliphatic substitution. After labelling, 81 ± 0.9% of labelled intermediate i.e. methyl 2-(benzyloxycarbonyl)-3-(4-(2-[18F]fluoro-3- (2-nitro-1H-imidazole-1-yl)propoxy) phenyl)propanoate was obtained at 140 deg C. At the end of radiosynthesis, [18F]FNT was obtained in an overall radiochemical yield of 40 ± 0.9% (not decay corrected) within 90 min in a radiochemical purity of >98% in a formulation ready for application in the clinical studies for PET imaging of hypoxia. (author)

  10. Preparation and radiosynthesis of [18F]FE rate at CFN (2-[18F]fluoroethyl 4-[N-(1-oxopropyl)-N-phenylamino]-1- (2-phenylethyl)-4-piperidinecarboxylate): a potential μ-opioid receptor imaging agent

    PET imaging of the μ-opioid receptor (OR) is still restricted to [11C]carfentanil ([11C]CFN) but its use is limited due to its short half-life and high agonistic potency. Recently, the radiosynthesis of [18F]fluoroalkyl esters of CFN was proposed, unfortunately yielding products not suitable for human PET due to their low specific activities. Therefore, our rationale was to develop a reliable radiosynthesis of a [18F]fluoroethylated CFN derivative overcoming these drawbacks. The [18F]fluoroethyl ester of carfentanil, [18F]FE rate at CFN (2-[18F]fluoroethyl 4-[N-(1-oxopropyl)-N-phenylamino]-1- (2-phenylethyl)-4-piperidinecarboxylate), and its corresponding inactive standard compound were prepared. Purification of [18F]FE rate at CFN was achieved via a simple solid phase extraction method. [18F]FE rate at CFN was prepared with excellent purity (> 98%) and sufficient yields. Specific activity surpassed the level required for safe administration. We therefore conclude that our simplified synthesis of [18F]FE rate at CFN, for the first time, overcomes the shortcomings of [11C]CFN and the previously suggested alternatives, namely, (1) longer half-life; (2) easy production and (3) adequate specific activity, should make a wider application possible. Hence, [18F]FE rate at CFN may become a valuable PET tracer for the imaging of the μ-OR in human brain and heart. (orig.)