WorldWideScience

Sample records for actinium 217

  1. Extraction of actinium with di-(2-ethylhexyl)phosphoric acid from hydrochloric and nitric acid solutions

    The extraction of actinium with HDEHP from Cl- and NO3- systems has been investigated. It was found that extraction of actinium from HCl solutions is much better than from HNO3 solutions. Stability constants of actinium complexes Ac(X-)+2 with Cl- and NO3- ligands were determined. Our results show that the actinium formed less stable complexes with Cl- than with NO3- ligands. 5 refs., 3 figs., 1 tab. (author)

  2. The sorption of polonium, actinium and protactinium onto geological materials

    This paper describes a combined experimental and modeling program of generic sorption studies to increase confidence in the performance assessment for a potential high-level radioactive waste repository in Japan. The sorption of polonium, actinium and protactinium onto geological materials has been investigated. Sorption of these radioelements onto bentonite, tuff and granodiorite from equilibrated de-ionized water was studied under reducing conditions at room temperature. In addition, the sorption of actinium and protactinium was investigated at 60 C. Thermodynamic chemical modeling was carried out to aid interpretation of the results

  3. Discovery of the actinium, thorium, protactinium, and uranium isotopes

    Fry, C; Thoennessen, M

    2012-01-01

    Currently, 31 actinium, 31 thorium, 28 protactinium, and 23 uranium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  4. Separation of Actinium 227 from the uranium minerals

    The purpose of this work was to separate Actinium 227, whose content is 18%, from the mineral carnotite found in Gomez Chihuahua mountain range in Mexico. The mineral before processing is is pre-concentrated and passed, first through anionic exchange resins, later the eluate obtained is passed through cationic resins. The resins were 20-50 MESH QOWEX and 100-200 MESH 50 X 8-20 in some cased 200-400 MESH AG 50W-X8, 1X8 in other cases. The eluates from the ionic exchange were electrodeposited on stainless steel polished disc cathode and platinum electrode as anode; under a current ODF 10mA for 2.5 to 5 hours and of 100mA for .5 of an hour. it was possible to identify the Actinium 227 by means of its descendents, TH-227 and RA-223, through alpha spectroscopy. Due to the radiochemical purity which the electro deposits were obtained the Actinium 227 was low and was not quantitatively determined. A large majority of the members of the natural radioactive series 3 were identified and even alpha energies reported in the literature with very low percentages of non-identified emissions were observed. We conclude that a more precise study is needed concerning ionic exchange and electrodeposit to obtain an Actinium 227 of radiochemical purity. (Author)

  5. Spectroscopic and computational investigation of actinium coordination chemistry.

    Ferrier, Maryline G; Batista, Enrique R; Berg, John M; Birnbaum, Eva R; Cross, Justin N; Engle, Jonathan W; La Pierre, Henry S; Kozimor, Stosh A; Lezama Pacheco, Juan S; Stein, Benjamin W; Stieber, S Chantal E; Wilson, Justin J

    2016-01-01

    Actinium-225 is a promising isotope for targeted-α therapy. Unfortunately, progress in developing chelators for medicinal applications has been hindered by a limited understanding of actinium chemistry. This knowledge gap is primarily associated with handling actinium, as it is highly radioactive and in short supply. Hence, Ac(III) reactivity is often inferred from the lanthanides and minor actinides (that is, Am, Cm), with limited success. Here we overcome these challenges and characterize actinium in HCl solutions using X-ray absorption spectroscopy and molecular dynamics density functional theory. The Ac-Cl and Ac-OH2O distances are measured to be 2.95(3) and 2.59(3) Å, respectively. The X-ray absorption spectroscopy comparisons between Ac(III) and Am(III) in HCl solutions indicate Ac(III) coordinates more inner-sphere Cl(1-) ligands (3.2±1.1) than Am(III) (0.8±0.3). These results imply diverse reactivity for the +3 actinides and highlight the unexpected and unique Ac(III) chemical behaviour. PMID:27531582

  6. Production of high-purity radium-223 from legacy actinium-beryllium neutron sources.

    Soderquist, Chuck Z; McNamara, Bruce K; Fisher, Darrell R

    2012-07-01

    Radium-223 is a short-lived alpha-particle-emitting radionuclide with potential applications in cancer treatment. Research to develop new radiopharmaceuticals employing (223)Ra has been hindered by poor availability due to the small quantities of parent actinium-227 available world-wide. The purpose of this study was to develop innovative and cost-effective methods to obtain high-purity (223)Ra from (227)Ac. We obtained (227)Ac from two surplus actinium-beryllium neutron generators. We retrieved the actinium/beryllium buttons from the sources and dissolved them in a sulfuric-nitric acid solution. A crude actinium solid was recovered from the solution by coprecipitation with thorium fluoride, leaving beryllium in solution. The crude actinium was purified to provide about 40 milligrams of actinium nitrate using anion exchange in methanol-water-nitric acid solution. The purified actinium was then used to generate high-purity (223)Ra. We extracted (223)Ra using anion exchange in a methanol-water-nitric acid solution. After the radium was separated, actinium and thorium were then eluted from the column and dried for interim storage. This single-pass separation produces high purity, carrier-free (223)Ra product, and does not disturb the (227)Ac/(227)Th equilibrium. A high purity, carrier-free (227)Th was also obtained from the actinium using a similar anion exchange in nitric acid. These methods enable efficient production of (223)Ra for research and new alpha-emitter radiopharmaceutical development. PMID:22697483

  7. Radium, thorium, and actinium extraction from seawater using an improved manganese-oxide-coated fiber

    Laboratory experiments were conducted to determine the efficiency with which improved manganese-oxide-coated acrylic fibers extract radium, thorium, and actinium from seawater. Tests were made using surface seawater spiked with 227Ac, 227Th and 223Ra. For sample volumes of approximately 30 liters and flow rates up to 0.5 liters per minute, radium and actinium are removed quantitatively. Approximately 80-95% of the thorium is removed under these same conditions. (Auth.)

  8. Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232

    Harvey, James T.; Nolen, Jerry; Vandergrift, George; Gomes, Itacil; Kroc, Tom; Horwitz, Phil; McAlister, Dan; Bowers, Del; Sullivan, Vivian; Greene, John

    2011-12-30

    The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces {approx}100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 Ge

  9. Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232

    The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces ∼100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 GeV protons

  10. Neutron-Induced Fission of Actinium-227, Protactinium-231 and Neptunium-237: Mass Distribution

    Results of radiochemical studies on the mass distribution in the neutron-induced fission of actinium-227, protactinium-231 and neptunium-237 have been presented. This work has been carried out as part of a programme to determine the mass distribution in the fission of heavy elements as a function of Z and A. All irradiations have been carried out in the core of the swimming-pool type reactor APSARA with cadmium shielding wherever necessary. Relative yields of several fission product nuclides have been obtained by a method involving a comparison of the fission product activities from the respective targets with those formed from uranium-235 simultaneously irradiated. Thermal-neutron fission yields of uranium-235 have been assumed. These results indicate a predominantly asymmetric mass distribution in all the three cases, and also a distinct though small symmetric peak in the case of actinium-227. (author)

  11. A new method for the determination of low-level actinium-227 in geological samples

    We developed a new method for the determination of 227Ac in geological samples. The method uses extraction chromatographic techniques and alpha-spectrometry and is applicable for a range of natural matrices. Here we report on the procedure and results of the analysis of water (fresh and seawater) and rock samples. Water samples were acidified and rock samples underwent total dissolution via acid leaching. A DGA (N,N,N',N'-tetra-n-octyldiglycolamide) extraction chromatographic column was used for the separation of actinium. The actinium fraction was prepared for alpha spectrometric measurement via cerium fluoride micro-precipitation. Recoveries of actinium in water samples were 80 ± 8 % (number of analyses n = 14) and in rock samples 70 ± 12 % (n = 30). The minimum detectable activities (MDA) were 0.017-0.5 Bq kg-1 for both matrices. Rock sample 227Ac activities ranged from 0.17 to 8.3 Bq kg-1 and water sample activities ranged from below MDA values to 14 Bq kg-1of 227Ac. From the analysis of several standard rock and water samples with the method we found very good agreement between our results and certified values. (author)

  12. 20 CFR 405.217 - Subpoenas.

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Subpoenas. 405.217 Section 405.217 Employees' Benefits SOCIAL SECURITY ADMINISTRATION ADMINISTRATIVE REVIEW PROCESS FOR ADJUDICATING INITIAL DISABILITY CLAIMS Review of Initial Determinations by a Federal Reviewing Official § 405.217 Subpoenas. (a) When it is reasonably necessary for the...

  13. 22 CFR 217.45 - Housing.

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Housing. 217.45 Section 217.45 Foreign... ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Postsecondary Education § 217.45 Housing. (a) Housing provided by the recipient. A recipient that provides housing to its nonhandicapped students shall...

  14. 47 CFR 97.217 - Telemetry.

    2010-10-01

    ... 47 Telecommunication 5 2010-10-01 2010-10-01 false Telemetry. 97.217 Section 97.217 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) SAFETY AND SPECIAL RADIO SERVICES AMATEUR RADIO SERVICE Special Operations § 97.217 Telemetry. Telemetry transmitted by an amateur station on or within...

  15. 31 CFR 800.217 - Hold.

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Hold. 800.217 Section 800.217 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF INVESTMENT... FOREIGN PERSONS Definitions § 800.217 Hold. The terms hold(s) and holding mean legal or...

  16. 22 CFR 217.4 - Discrimination prohibited.

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Discrimination prohibited. 217.4 Section 217.4... PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE General Provisions § 217.4 Discrimination... participation in, be denied the benefits of, or otherwise be subjected to discrimination under any program...

  17. 48 CFR 252.217-7010 - Performance.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Performance. 252.217-7010... Clauses 252.217-7010 Performance. As prescribed in 217.7104(a), use the following clause: Performance (JUL..., scrap or other ship's material of the Government resulting from performance of the work as items...

  18. 8 CFR 217.2 - Eligibility.

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Eligibility. 217.2 Section 217.2 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS VISA WAIVER PROGRAM § 217.2 Eligibility..., Portugal, Republic of Korea, San Marino, Singapore, Slovak Republic, Slovenia, Spain, Sweden,...

  19. Analysis of the gamma spectra of the uranium, actinium, and thorium decay series

    Momeni, M.H.

    1981-09-01

    This report describes the identification of radionuclides in the uranium, actinium, and thorium series by analysis of gamma spectra in the energy range of 40 to 1400 keV. Energies and absolute efficiencies for each gamma line were measured by means of a high-resolution germanium detector and compared with those in the literature. A gamma spectroscopy method, which utilizes an on-line computer for deconvolution of spectra, search and identification of each line, and estimation of activity for each radionuclide, was used to analyze soil and uranium tailings, and ore.

  20. Analysis of the gamma spectra of the uranium, actinium, and thorium decay series

    This report describes the identification of radionuclides in the uranium, actinium, and thorium series by analysis of gamma spectra in the energy range of 40 to 1400 keV. Energies and absolute efficiencies for each gamma line were measured by means of a high-resolution germanium detector and compared with those in the literature. A gamma spectroscopy method, which utilizes an on-line computer for deconvolution of spectra, search and identification of each line, and estimation of activity for each radionuclide, was used to analyze soil and uranium tailings, and ore

  1. Dicty_cDB: SSI217 [Dicty_cDB

    Full Text Available SS (Link to library) SSI217 (Link to dictyBase) - - - Contig-U15348-1 SSI217Z (Link... to Original site) - - SSI217Z 662 - - - - Show SSI217 Library SS (Link to library) Clone ID SSI217 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSI2-A/SSI217Q.Seq.d/ Representative seq. ID SSI21...7Z (Link to Original site) Representative DNA sequence >SSI217 (SSI217Q) /CSM/SS/SSI2-A/SSI217Q.Seq.d/ XXXXX...Frames) Frame A: ---itlepilwplssivililqrn*lisygimgfqnknfscqlmvgi*lprspttillts ivisln*pfqqlkilqeyqcnl**pmmvii

  2. 22 CFR 217.44 - Academic adjustments.

    2010-04-01

    ... PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Postsecondary Education § 217.44 Academic... recipient's education program or activity. (c) Course examinations. In its course examinations or...

  3. 14 CFR 145.217 - Contract maintenance.

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Contract maintenance. 145.217 Section 145...) SCHOOLS AND OTHER CERTIFICATED AGENCIES REPAIR STATIONS Operating Rules § 145.217 Contract maintenance. (a) A certificated repair station may contract a maintenance function pertaining to an article to...

  4. 22 CFR 217.21 - Discrimination prohibited.

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Discrimination prohibited. 217.21 Section 217... Discrimination prohibited. No qualified handicapped person shall, because a recipient's facilities within the... excluded from participation in, or otherwise be subjected to discrimination under any program or...

  5. 22 CFR 217.11 - Discrimination prohibited.

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Discrimination prohibited. 217.11 Section 217... Discrimination prohibited. (a) General. (1) No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment under any program or activity to which this part applies. (2)...

  6. 48 CFR 217.204 - Contracts.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Contracts. 217.204 Section... DEFENSE CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Options 217.204 Contracts. (e)(i) Notwithstanding FAR 17.204(e), the ordering period of a task order or delivery order...

  7. 25 CFR 217.5 - Management decisions.

    2010-04-01

    ... Management decisions. In arriving at management decisions concerning the assets, the business committee shall... 25 Indians 1 2010-04-01 2010-04-01 false Management decisions. 217.5 Section 217.5 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND MINERALS MANAGEMENT OF TRIBAL ASSETS OF...

  8. 40 CFR 86.217-94 - [Reserved

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false 86.217-94 Section 86.217-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) CONTROL OF... Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium-Duty...

  9. 33 CFR 117.217 - Norwalk River.

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Norwalk River. 117.217 Section... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Connecticut § 117.217 Norwalk River. (a) The draw of.... to 12 p.m., on the first Saturday in December, to facilitate the running of the annual Norwalk...

  10. 48 CFR 217.7601 - Provisioning.

    2010-10-01

    ... Provisioning Requirements 217.7601 Provisioning. (a) Follow the procedures at PGI 217.7601 for contracts with provisioning requirements. (b) For technical requirements of provisioning, see DoD 4140.1-R, DoD Supply Chain... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Provisioning....

  11. In-source laser spectroscopy developments at TRILIS—towards spectroscopy on actinium and scandium

    Resonance Ionization Laser Ion Sources (RILIS) have become a versatile tool for production and study of exotic nuclides at Isotope Separator On-Line (ISOL) facilities such as ISAC at TRIUMF. The recent development and addition of a grating tuned spectroscopy laser to the TRIUMF RILIS solid state laser system allows for wide range spectral scans to investigate atomic structures on short lived isotopes, e.g., those from the element actinium, produced in uranium targets at ISAC. In addition, development of new and improved laser ionization schemes for rare isotope production at ISAC is ongoing. Here spectroscopic studies on bound states, Rydberg states and autoionizing (AI) resonances on scandium using the existing off-line capabilities are reported. These results allowed to identify a suitable ionization scheme for scandium via excitation into an autoionizing state at 58,104 cm − 1 which has subsequently been used for ionization of on-line produced exotic scandium isotopes.

  12. 48 CFR 217.504 - Ordering procedures.

    2010-10-01

    ... Acquisitions Under the Economy Act 217.504 Ordering procedures. (a) When the requesting agency is within DoD, a... obtained from the requesting agency and placed in the contract file for the Economy Act order....

  13. 49 CFR 571.217 - Standard No. 217; Bus emergency exits and window retention and release.

    2010-10-01

    ... conditions specified in S6.1 of Standard No. 131 (49 CFR 571.131), meets the criteria specified in Table 1 of... Editorial Note: For Federal Register citations affecting § 571.217 see the List of CFR Sections Affected... 49 Transportation 6 2010-10-01 2010-10-01 false Standard No. 217; Bus emergency exits and...

  14. Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL

    Raeder, S.; Bastin, B.; Block, M.; Creemers, P.; Delahaye, P.; Ferrer, R.; Fléchard, X.; Franchoo, S.; Ghys, L.; Gaffney, L. P.; Granados, C.; Heinke, R.; Hijazi, L.; Huyse, M.; Kron, T.; Kudryavtsev, Yu.; Laatiaoui, M.; Lecesne, N.; Luton, F.; Moore, I. D.; Martinez, Y.; Mogilevskiy, E.; Naubereit, P.; Piot, J.; Rothe, S.; Savajols, H.; Sels, S.; Sonnenschein, V.; Traykov, E.; Van Beveren, C.; Van den Bergh, P.; Van Duppen, P.; Wendt, K.; Zadvornaya, A.

    2016-06-01

    To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.

  15. 14 CFR 217.10 - Instructions.

    2010-01-01

    ... Section 217.10 of 14 CFR Part 217—Instructions to Foreign Air Carriers for Reporting Traffic Data on Form... records: 1 2 3 4 5 6 7 8 9 10 11 Sample No. 1 “CCC” 8701 “JFK” “LHR” “F” 8161 29 59 69 79 89 Sample No. 2 “CCC” 8701 “JFK” “LHR” “F” 6901 299 599 0 0 0 Sample No. 3 “CCC” 8701 “JFK” “LHR” “G” 7102 299 0 599...

  16. 48 CFR 1252.217-72 - Performance.

    2010-10-01

    ... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 1252.217-72 Performance. As prescribed at (TAR) 48 CFR 1217.7001(b) and (c), insert the following clause: Performance (OCT 1994) (a) Upon... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Performance....

  17. 30 CFR 217.200 - Audits.

    2010-07-01

    ... copies of audit reports that express opinions on such compliance to the Associate Director for Minerals... INSPECTIONS Coal § 217.200 Audits. An audit of the accounts and books of operators/lessees for the purpose of determining compliance with Federal lease terms relating to Federal royalties may be required annually or...

  18. 7 CFR 1.217 - Witness fees and travel expenses.

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Witness fees and travel expenses. 1.217 Section 1.217... Witnesses in Judicial or Administrative Proceedings § 1.217 Witness fees and travel expenses. (a) Any... produce official documents on behalf of the United States is entitled to travel expenses in...

  19. 49 CFR 199.217 - On-duty use.

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false On-duty use. 199.217 Section 199.217 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY... Prevention Program § 199.217 On-duty use. Each operator shall prohibit a covered employee from using...

  20. 48 CFR 252.217-7015 - Safety and health.

    2010-10-01

    ... U.S.C. 651, et seq.); (b) The Safety and Health Regulations for Ship Repairing (29 CFR part 1915... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Safety and health. 252.217... Clauses 252.217-7015 Safety and health. As prescribed in 217.7104(a), use the following clause: Safety...

  1. 20 CFR 217.15 - Where to file.

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Where to file. 217.15 Section 217.15... ANNUITY OR LUMP SUM Filing An Application § 217.15 Where to file. (a) Applicant in U.S. or Canada. An applicant who lives in the United States or Canada may file an application at any Board office in person...

  2. 42 CFR 2.17 - Undercover agents and informants.

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false Undercover agents and informants. 2.17 Section 2.17 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL PROVISIONS... agent or informant. (b) Restriction on use of information. No information obtained by an...

  3. 48 CFR 217.7103-4 - Emergency work.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Emergency work. 217.7103-4... Repair and Alteration of Vessels 217.7103-4 Emergency work. (a) The contracting officer, without... agreement when— (i) Delay in the performance of necessary repair work would endanger a vessel, its cargo...

  4. 5 CFR 532.217 - Appropriated fund survey jobs.

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Appropriated fund survey jobs. 532.217... PREVAILING RATE SYSTEMS Prevailing Rate Determinations § 532.217 Appropriated fund survey jobs. (a) A lead agency shall survey the following required jobs: Job title Job grade Janitor (Light) 1 Janitor (Heavy)...

  5. 20 CFR 217.10 - Application filed after death.

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Application filed after death. 217.10 Section... APPLICATION FOR ANNUITY OR LUMP SUM Applications § 217.10 Application filed after death. (a) A survivor... expenses dies before applying for the lump-sum death payment under part 234 of this chapter....

  6. 7 CFR 800.217 - Equipment that shall be tested.

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Equipment that shall be tested. 800.217 Section 800... Supervision, Monitoring, and Equipment Testing § 800.217 Equipment that shall be tested. (a) General. Testing... for which official performance requirements have been established shall be tested for accuracy....

  7. 22 CFR 217.42 - Admissions and recruitment.

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Admissions and recruitment. 217.42 Section 217... Admissions and recruitment. (a) General. Qualified handicapped persons may not, on the basis of handicap, be denied admission or be subjected to discrimination in admission or recruitment by a recipient to...

  8. 30 CFR 217.301 - Lease account reconciliations.

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Lease account reconciliations. 217.301 Section... MANAGEMENT AUDITS AND INSPECTIONS Geothermal Resources § 217.301 Lease account reconciliations. Specific lease account reconciliations will be performed with priority being given to reconciling those...

  9. 30 CFR 217.51 - Lease account reconciliation.

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Lease account reconciliation. 217.51 Section... MANAGEMENT AUDITS AND INSPECTIONS Oil and Gas, General § 217.51 Lease account reconciliation. Specific lease account reconciliations shall be performed with priority being given to reconciling those lease...

  10. 34 CFR 668.217 - Default prevention plans.

    2010-07-01

    ... 34 Education 3 2010-07-01 2010-07-01 false Default prevention plans. 668.217 Section 668.217... Default prevention plans. (a) First year. (1) If your cohort default rate is equal to or greater than 30 percent you must establish a default prevention task force that prepares a plan to— (i) Identify...

  11. 46 CFR 199.217 - Muster list and emergency instructions.

    2010-10-01

    ... § 199.217 Muster list and emergency instructions. (a) The format of each passenger vessel muster list required under § 199.80 must be approved by the OCMI. (b) The passenger vessel muster list or emergency... 46 Shipping 7 2010-10-01 2010-10-01 false Muster list and emergency instructions. 199.217...

  12. Dicty_cDB: SSG217 [Dicty_cDB

    Full Text Available SS (Link to library) SSG217 (Link to dictyBase) - G20962 DDB0191432 Contig-U10318-1 SSG217Z (Lin ... 0.20 BC105663_1( BC105663 |pid:none) Mus musculus dopamine ... receptor 2, ... 37 0.26 X53278_1( X53278 |pid:none ... ) R.norvegicus mRNA for D2 dopamine ... rece... 37 0.26 ( P61168 ) RecName: Full=D(2) dopa ...

  13. Dicty_cDB: VFM217 [Dicty_cDB

    Full Text Available qpqedivnrehsvpdnersktsvvas iiaagysvgqdaaikarqvdeehmislklkvgaeavkakaneidnnlhisesaaaikgav veranalderfqisgffksasdmisqqasnlmka...rkry*lfk*y*itttttttttttrttrtilkyrffkrtisl Homology vs CSM-cDNA Score E Sequences producing significant alignment...2.19 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N ( BJ434793 ) Dictyos...core E Sequences producing significant alignments: (bits) Value AC150647_11( AC150647 |pid:none) Medicago tr...VF (Link to library) VFM217 (Link to dictyBase) - - - Contig-U13881-1 VFM217P (Link

  14. Groundwater seepage from the Ranger uranium mine tailings dam: radioisotopes of radium, thorium and actinium. Supervising Scientist report 106

    Monitoring of bores near the Ranger uranium mine tailings dam has revealed deterioration in water quality in several bores since 1983. In a group of bores to the north of the dam, increases have been observed of up to 500 times for sulphate concentrations and of up to 5 times for 226Ra concentrations. Results are presented here of measurements of members of the uranium, thorium and actinium decay series in borewater samples collected between 1985 and 1993. In particular, measurements of all four naturally-occurring radium isotopes have been used in an investigation of the mechanism of radium concentration changes. For the most seepage-affected bores the major findings of the study include: 228Ra/226Ra 223Ra /226Ra and 224Ra/228Ra ratios all increased over the course of the study; barium concentrations show high seasonal variability, being lower in November than May, but strontium concentrations show a steady increase with time. Calculations show that the groundwater is probably saturated with respect to barite but not with respect to celestite or anglesite; sulphide concentrations are low in comparison with sulphate, and are higher in November than in May; and 227Ac concentrations have increased with time, but do not account for the high 223Ra/226Ra ratios. It is concluded on the basis of these observations that increases in Ra isotope concentrations observed in a number of seepage-affected bores arise from increases in salinity leading to desorption of radium from adsorption sites in the vicinity of the bore rather by direct transport of radium from the tailings. Increased salinity is also causing the observed increases in 227Ac and strontium concentrations, while formation of a barite solid phase in the groundwater is causing the removal of some radium from solution. This is the cause of the increasing radium isotope ratios noted above

  15. 48 CFR 3052.217-95 - Liability and insurance (USCG).

    2010-10-01

    ... CONTRACT CLAUSES Text of Provisions and Clauses 3052.217-95 Liability and insurance (USCG). As prescribed in USCG guidance at (HSAR) 48 CFR 3017.9000(a) and (b), insert the following clause: Liability and... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Liability and...

  16. 8 CFR 217.7 - Electronic data transmission requirement.

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Electronic data transmission requirement... VISA WAIVER PROGRAM § 217.7 Electronic data transmission requirement. (a) An alien who applies for... manifest data relative to that alien passenger in accordance with 19 CFR 4.7b or 19 CFR 122.49a....

  17. 78 FR 8684 - Fifteenth Meeting: RTCA Special Committee 217-Aeronautical Databases Joint with EUROCAE WG-44...

    2013-02-06

    ... Federal Aviation Administration Fifteenth Meeting: RTCA Special Committee 217--Aeronautical Databases Joint with EUROCAE WG-44--Aeronautical Databases AGENCY: Federal Aviation Administration (FAA), U.S. Department of Transportation (DOT). ACTION: Notice of RTCA Special Committee 217--Aeronautical...

  18. 78 FR 66418 - Eighteenth Meeting: RTCA Special Committee 217-Aeronautical Databases Joint With EUROCAE WG-44...

    2013-11-05

    ... Federal Aviation Administration Eighteenth Meeting: RTCA Special Committee 217--Aeronautical Databases Joint With EUROCAE WG-44--Aeronautical Databases AGENCY: Federal Aviation Administration (FAA), U.S. Department of Transportation (DOT). ACTION: Notice of RTCA Special Committee 217--Aeronautical...

  19. 78 FR 51809 - Seventeenth Meeting: RTCA Special Committee 217-Aeronautical Databases Joint With EUROCAE WG-44...

    2013-08-21

    ... Federal Aviation Administration Seventeenth Meeting: RTCA Special Committee 217--Aeronautical Databases Joint With EUROCAE WG-44--Aeronautical Databases AGENCY: Federal Aviation Administration (FAA), U.S. Department of Transportation (DOT). ACTION: Notice of RTCA Special Committee 217--Aeronautical...

  20. 78 FR 25134 - Sixteenth Meeting: RTCA Special Committee 217-Aeronautical Databases Joint With EUROCAE WG-44...

    2013-04-29

    ... Federal Aviation Administration Sixteenth Meeting: RTCA Special Committee 217--Aeronautical Databases Joint With EUROCAE WG-44--Aeronautical Databases AGENCY: Federal Aviation Administration (FAA), U.S. Department of Transportation (DOT). ACTION: Notice of RTCA Special Committee 217--Aeronautical...

  1. 5 CFR 179.217 - Non-waiver of rights by payments.

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Non-waiver of rights by payments. 179.217 Section 179.217 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS CLAIMS COLLECTION STANDARDS Salary Offset § 179.217 Non-waiver of rights by payments. An employee's...

  2. 40 CFR 80.217 - How does a refiner or importer apply for the GPA standards?

    2010-07-01

    ... for the GPA standards? 80.217 Section 80.217 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY...-in Program § 80.217 How does a refiner or importer apply for the GPA standards? (a) To apply for the GPA standards under § 80.216, a refiner or importer must submit an application in accordance with...

  3. 14 CFR 21.7 - Continued airworthiness and safety improvements for transport category airplanes.

    2010-01-01

    ... improvements for transport category airplanes. 21.7 Section 21.7 Aeronautics and Space FEDERAL AVIATION... § 21.7 Continued airworthiness and safety improvements for transport category airplanes. (a) On or... subchapter. (b) For new transport category airplanes manufactured under the authority of the FAA, the...

  4. 美国军用手册217F以外的可靠性预计方法%Reliability Prediction Methods Except Mil-HDBK 217F

    周雷; 许新芳; 程俊

    2008-01-01

    介绍美国军用手册217F之外的可靠性预计方法-EPILD-97和NPRD-95数据库,PRISM方法以及FIDES方法等,分别讨论其适用条件和失效率模型,全面比较了包括217F在内的各种可靠性预计方法的优劣.

  5. Proton polarimeter calibration between 82 and 217 MeV

    The proton analyzing power in carbon has been measured for energies of 82-217 MeV and proton scattering angles of 5-410. The measurements were carried out using polarized protons from the elastic scattering 1H(e→,p→) reaction and the Focal Plane Polarimeter (FPP) in Hall A of Jefferson Lab. A new parameterization of the FPP p-C analyzing power was fit to the data, which is in good agreement with previous parameterizations and provides an extension to lower energies and larger angles. The main conclusions are that all polarimeters to date give consistent measurements of the carbon analyzing power, independently of the details of their construction and that measuring on a larger angular range significantly improves the polarimeter figure of merit at low energies.

  6. Proton Polarimeter Calibration between 82 and 217 MeV

    Glister, J; Lee, B; Beck, A; Brash, E; Camsonne, A; Choi, S; Dumas, J; Feuerbach, R; Gilman, R; Higinbotham, D W; Jiang, X; Jones, M K; May-Tal Beck, S; McCullough, E; Paolone, M; Piasetzky, E; Roche, J; Rousseau, Y; Sarty, A J; Sawatzky, B

    2009-07-01

    The proton analyzing power in carbon has been measured for energies of 82 to 217 MeV and proton scattering angles of 5 to 41 degrees. The measurements were carried out using polarized protons from the elastic scattering H(pol. e, pol. p) reaction and the Focal Plane Polarimeter (FPP) in Hall A of Jefferson Lab. A new parameterization of the FPP p-C analyzing power was fit to the data, which is in good agreement with previous parameterizations and provides an extension to lower energies and larger angles. The main conclusions are that all polarimeters to date give consistent measurements of the carbon analyzing power, independently of the details of their construction and that measuring on a larger angular range significantly improves the polarimeter figure of merit at low energies.

  7. Proton polarimeter calibration between 82 and 217 MeV

    Glister, J. [Department of Astronomy and Physics, Saint Mary' s University, Halifax, Nova Scotia, B3H 3C3 (Canada); Dalhousie University, Halifax, Nova Scotia, B3H 3J5 (Canada)], E-mail: jglister@jlab.org; Ron, G. [Tel Aviv University, Tel Aviv 69978 (Israel); Lee, B. [Seoul National University, Seoul 151-747 (Korea, Republic of); Beck, A. [NRCN, P.O. Box 9001, Beer-Sheva 84190 (Israel); Brash, E. [Christopher Newport University, Newport News, VA 23606 (United States); Camsonne, A. [Thomas Jefferson National Accelerator Facility, Newport News, VA 23606 (United States); Choi, S. [Seoul National University, Seoul 151-747 (Korea, Republic of); Dumas, J. [Rutgers, State University of New Jersey, Piscataway, NJ 08855 (United States); Feuerbach, R. [Thomas Jefferson National Accelerator Facility, Newport News, VA 23606 (United States); Gilman, R. [Thomas Jefferson National Accelerator Facility, Newport News, VA 23606 (United States); Rutgers, State University of New Jersey, Piscataway, NJ 08855 (United States); Higinbotham, D.W. [Thomas Jefferson National Accelerator Facility, Newport News, VA 23606 (United States); Jiang, X. [Rutgers, State University of New Jersey, Piscataway, NJ 08855 (United States); Jones, M.K. [Thomas Jefferson National Accelerator Facility, Newport News, VA 23606 (United States); May-Tal Beck, S. [NRCN, P.O. Box 9001, Beer-Sheva 84190 (Israel); McCullough, E. [Department of Astronomy and Physics, Saint Mary' s University, Halifax, Nova Scotia, B3H 3C3 (Canada); Paolone, M. [University of South Carolina, Columbia, SC 29208 (United States); Piasetzky, E. [Tel Aviv University, Tel Aviv 69978 (Israel); Roche, J. [Ohio University, Athens, OH 45701 (United States); Rousseau, Y. [Rutgers, The State University of New Jersey, Piscataway, NJ 08855 (United States); Sarty, A.J. [Department of Astronomy and Physics, Saint Mary' s University, Halifax, Nova Scotia, B3H 3C3 (Canada)] (and others)

    2009-07-21

    The proton analyzing power in carbon has been measured for energies of 82-217 MeV and proton scattering angles of 5-41{sup 0}. The measurements were carried out using polarized protons from the elastic scattering {sup 1}H(e{sup {yields}},p{sup {yields}}) reaction and the Focal Plane Polarimeter (FPP) in Hall A of Jefferson Lab. A new parameterization of the FPP p-C analyzing power was fit to the data, which is in good agreement with previous parameterizations and provides an extension to lower energies and larger angles. The main conclusions are that all polarimeters to date give consistent measurements of the carbon analyzing power, independently of the details of their construction and that measuring on a larger angular range significantly improves the polarimeter figure of merit at low energies.

  8. 19 CFR 10.217 - Verification and justification of claim for preferential treatment.

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Verification and justification of claim for preferential treatment. 10.217 Section 10.217 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF... justification of claim for preferential treatment. (a) Verification by Customs. A claim for...

  9. 48 CFR 217.175 - Multiyear contracts for electricity from renewable energy sources.

    2010-10-01

    ... electricity from renewable energy sources. 217.175 Section 217.175 Federal Acquisition Regulations System... renewable energy sources. (a) The head of the contracting activity may enter into a contract for a period not to exceed 10 years for the purchase of electricity from sources of renewable energy, as that...

  10. 48 CFR 217.7504 - Acquisition of parts when data is not available.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Acquisition of parts when data is not available. 217.7504 Section 217.7504 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES...

  11. 46 CFR 10.217 - Merchant mariner credential application and examination locations.

    2010-10-01

    ... 46 Shipping 1 2010-10-01 2010-10-01 false Merchant mariner credential application and examination locations. 10.217 Section 10.217 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY MERCHANT MARINE OFFICERS AND SEAMEN MERCHANT MARINER CREDENTIAL General Requirements for All Merchant Mariner...

  12. 49 CFR 40.217 - Where is other information on the role of STTs and BATs found in this regulation?

    2010-10-01

    ... BATs found in this regulation? 40.217 Section 40.217 Transportation Office of the Secretary of... Personnel § 40.217 Where is other information on the role of STTs and BATs found in this regulation? You can find other information on the role and functions of STTs and BATs in the following sections of...

  13. 25 CFR 217.4 - Referral of questions by the joint managers.

    2010-04-01

    ... party's proposal, if any, for solution. Such referrals shall be in writing, addressed to the other joint... DISTRIBUTION CORP. § 217.4 Referral of questions by the joint managers. The business committee and the board...

  14. 42 CFR 436.217 - Individuals receiving home and community-based services.

    2010-10-01

    ... Children and Aged, Blind, and Disabled Individuals, Including Pregnant Women § 436.217 Individuals... furnished in a hospital, NF, or an ICF/MR; or (2) Subpart H of this subchapter, the group would...

  15. ZNF217 expression correlates with the biological behavior of human ovarian cancer cells

    Lilin Hang; Min Zhang; Fanliang Meng; Mei Zhong; Jing Li 

    2014-01-01

    Objective:The aim of the study was to investigate the correlation of zinc-finger protein 217 (ZNF217) gene ex-pression with the biological behavior of human ovarian cancer HO-8910 cel s. Methods:The expression of ZNF217 in ovarian carcinoma cel lines was detected by RT-PCR and Western blot, respectively. The biological behaviors of the transfectants were investigated by MTT, in vitro Boyden chamber and in vivo invasion assay, respectively. Results:RT-PCR and Western blotting revealed that transfection of ZNF217 into the HO-8910 cel s significantly increased their proliferation along with mark-edly enhanced in vitro and in vivo invasion and metastatic abilities. MTT assay showed that the proliferation ability of pEGFP-N1-ZNF217/HO-8910 cel s was significantly higher than that of pEGFP-N1/HO-8910 cel s and HO-8910 cel s (P<0.001). The Boyden chamber assay showed that the numbers of migrating pEGFP-N1-ZNF217/HO-8910, pEGFP-N1/HO-8910 and HO-8910 cel s were (141.25 ± 13.91) cel s/200 × field, (82.50 ± 11.73) cel s/200 × field and (81.75 ± 12.12) cel s/200 × field, respectively, with a significant dif erence between them (F=29.274, P<0.001). The nude mouse experiment showed that the in vivo tumor formation ability of pEGFP-N1-ZNF217/HO-8910 cel s was significantly higher than that of pEGFP-N1/HO-8910 cel s (P<0.001). Conclusion:Based on these clinical and laboratory observations, we conclude that ZNF217 may contribute to ovarian cancer invasion and metastasis, and associated with worse clinical outcomes. We evaluated ZNF217’s role as a biomarker of ovarian carcinogenesis and tumor progression in patient samples and explored possible molecular mechanisms in promoting tumor growth and invasion.

  16. Level structure of 217Rn and 221Ra investigated in the alpha-decay 225Th → 221Ra → 217Rn

    The nuclei 221Ra and 217Rn have been investigated in the α-decay chain 225Th → 221Ra → 217Rn through γ-ray and conversion-electron studies. The short-lived 225Th nuclei (T1/2=8 min) were produced in the 226Ra(α, 5n) reaction, and γ-rays and conversion electrons were measured - between the irradiation periods - in coincidence with α-particles. In 221Ra the five lowest levels are interpreted as members of a K=5/2 parity-doublet with ΔEπ=104 keV. These levels, as well as a higher-lying Kπ=3/2+ band, are consistent with an octupole deformation of 221Ra, as expected from theoretical considerations. In 217Rn only three excited levels are observed, with a favoured α-decay to a 5/2+ excited level thus establishing positive parity for the ground state of 221Ra. (orig.)

  17. 22 CFR 217.10 - Effect of state or local law or other requirements and effect of employment opportunities.

    2010-04-01

    ... requirements and effect of employment opportunities. 217.10 Section 217.10 Foreign Relations AGENCY FOR... effect of employment opportunities. (a) The obligation to comply with this part is not obviated or... obviated or alleviated because employment opportunities in any occupation or profession are or may be...

  18. 76 FR 70531 - Tenth Meeting: RTCA Special Committee 217/EUROCAE WG-44: Terrain and Airport Mapping Databases

    2011-11-14

    ... Airport Mapping Databases AGENCY: Federal Aviation Administration (FAA), U.S. Department of Transportation... RTCA Special Committee 217/EUROCAE WG-44: Terrain and Airport Mapping Databases: For the tenth meeting... meeting of RTCA Special Committee 217/EUROCAE WG-44: Terrain and Airport Mapping Databases. The...

  19. CULTIVAR RELEASE-BRS 217 Flora: Early-maturing soybean cultivar

    Plínio Itamar de Mello de Souza

    2008-01-01

    Full Text Available The soybean (Glycine max L. Merr. cultivar BRS 217 Flora was developed by Embrapa and released forproduction in the states of Goiás, Minas Gerais, Bahia, Mato Grosso and the Distrito Federal, Brazil. It is resistant to stemcanker, frog-eye leaf spot, bacterial pustule, and partially resistant to powdery mildew.

  20. 20 CFR 217.7 - Claim filed with the Social Security Administration.

    2010-04-01

    ... RETIREMENT ACT APPLICATION FOR ANNUITY OR LUMP SUM Applications § 217.7 Claim filed with the Social Security... Security Act is an application for an annuity if the conditions either in paragraphs (a)(1), (2), and (3... social security application was filed. (3) The applicant asks the Board in a written statement...

  1. 48 CFR 1252.217-73 - Inspection and manner of doing work.

    2010-10-01

    ....217-73 Inspection and manner of doing work. As prescribed at (TAR) 48 CFR 1217.7001(b) and (c), insert..., American Bureau of Shipping, or Department of the Navy for the type of welding being performed... proper closing of all openings to the vessel's underwater structure upon which work has been...

  2. 20 CFR 10.217 - Is COP charged if the employee continues to work, but in a different job that pays less?

    2010-04-01

    ... job with different duties with no loss in pay, then COP is not chargeable. COP must be paid and the... work, but in a different job that pays less? 10.217 Section 10.217 Employees' Benefits OFFICE OF... § 10.217 Is COP charged if the employee continues to work, but in a different job that pays less?...

  3. GATA3-driven expression of miR-503 inhibits prostate cancer progression by repressing ZNF217 expression.

    Jiang, Xingkang; Chen, Yue; Du, E; Yang, Kuo; Zhang, Zhihong; Qi, Shiyong; Xu, Yong

    2016-09-01

    Although increasing evidence demonstrated that deregulation of mircoRNA-503 (miRNA-503) contributes to tumorigenesis, little is known about the biological role and intrinsic regulatory mechanisms of miR-503 in prostate cancer (PCa). In present study, we found that miR-503 was significantly downregulated in advanced PCa tissues and cell lines. Downregulation of miR-503 was strongly associated with aggressive clinical-pathological features and poor prognosis in PCa patients. Ectopic expression of miR-503 significantly inhibited tumor cells growth, cell migration and invasion in vitro and in vivo. Mechanistic studies revealed that ZNF217 was a direct target downstream target of miR-503. Knockdown of ZNF217 mimicked the tumor-suppressive effects of miR-503 overexpression on PCa invasion, whereas ZNF217 overexpression attenuated the tumor-suppressive function of miR-503. Subsequently, miR-503 further modulated the activation of ZNF217-downstream epithelial-mesenchymal transition (EMT) genes. Besides, we also found that GATA3 directly increased miR-503 expression and thus decreased ZNF217 expression, indicating the involvement of GATA3/miR-503/ZNF217 signaling in EMT process. Collectively, our results demonstrated that GATA3-driven expression of miR-503 inhibits PCa progression by repressing ZNF217 expression, and also implicated the potential application of miR-503 in PCa therapy. PMID:27267060

  4. Study on manufacture of 2:17 Sm-Co magnets by powder injection molding

    Manufacture of 2:17 Sm-Co magnets by powder injection molding was investigated. The binder of thermoplastic polymer was selected as the wax-based system including paraffin wax, stearic acid and high density polyethylene. Before mixing with paraffin wax and high density polyethylene, the powder of 5-8 μm was coated by stearic acid. The molding compacts were obtained under 200 without deficits. Solvent debinding and thermal debinding were combined to remove the binder. The basic magnetic characteristics of the specimen were of the same level as those by powder metallurgy technique, which indicated that to fabricate 2:17 Sm-Co magnets by powder injection molding was feasible. (orig.)

  5. 28-W, 217 fs solid-state Yb:CAlGdO4 regenerative amplifiers.

    Caracciolo, E; Kemnitzer, M; Guandalini, A; Pirzio, F; Aus der Au, J; Agnesi, A

    2013-10-15

    A new high-performance Yb:CaAlGdO(4) (Yb:CALGO) regenerative amplifier is demonstrated. Pumped by 116 W at ≈980 nm and seeded by means of a 92 fs oscillator, it generates as much as 36 W of average output power with chirped pulses, and 28 W with 217 fs compressed pulses at 500 kHz repetition rate. This corresponds to 56 μJ of pulse energy and 258 MW peak power. The compressed pulses have a time-bandwidth product of 0.69 and could be shortened further with an improved compressor setup. PMID:24321941

  6. Production of photons associated with the psi by 217-GeV/cπ- mesons

    Dimuon production is studied in 217-GeV/cπ--hydrogen and π--beryllium collisions with a lead-glass array to detect photons associated with the psi. The psi-γ mass spectrum shows a 2.6-standard-deviation excess of events above background at approx. 3.5 GeV. This excess, if attributed to the decay chi ( approx. 3.5) → psiγ, implies that 0.70 +- 0.28 of the psi's are produced via radiative decay of one of the chi states

  7. HL-217, a new topical anti-angiogenic agent, inhibits retinal vascular leakage and pathogenic subretinal neovascularization in Vldlr−/− mice

    Highlights: • HL-217 is a new synthetic topical anti-angiogenic agent. • HL-217 attenuated subretinal neovascularization in Vldlr−/− mice. • HL-217 blocked the binding of PDGF-BB to PDGFRβ. - Abstract: HL-217 is a new synthetic angiogenesis inhibitor. Platelet derived growth factor (PDGF) is a vasoactive factor and has been implicated in proliferative retinopathies. In this study, we examined the mechanism of action and efficacy of topical application of HL-217 on subretinal neovascularization in very low-density lipoprotein receptor knockout (Vldlr−/−) mice. In three-week-old male Vldlr−/− mice, HL-217 (1.5 or 3 mg/ml) was administered twice per day for 4 weeks by topical eye drop instillation. Neovascular areas were then measured. We used a protein array to evaluate the expression levels of angiogenic factors. The inhibitory effect of HL-217 on the PDGF-BB/PDGFRβ interaction was evaluated in vitro. The neovascular area in the Vldlr−/− mice was significantly reduced by HL-217. Additionally, HL-217 decreased the expression levels of PDGF-BB protein and VEGF mRNA. Moreover, HL-217 dose-dependently inhibited the PDGF-BB/PDGFRβ interaction (IC50 = 38.9 ± 0.7 μM). These results suggest that HL-217 is a potent inhibitor of PDGF-BB. HL-217, when applied topically, is an effective inhibitor of subretinal neovascularization due to its ability to inhibit the pro-angiogenic effects of PDGF-BB

  8. HL-217, a new topical anti-angiogenic agent, inhibits retinal vascular leakage and pathogenic subretinal neovascularization in Vldlr{sup −/−} mice

    Kim, Junghyun; Kim, Chan-Sik; Jo, Kyuhyung [Korean Medicine Based Herbal Drug Development Group, Herbal Medicine Research Division, Korea Institute of Oriental Medicine, Daejeon (Korea, Republic of); Cho, Yun-Seok; Kim, Hyun-Gyu; Lee, Geun-Hyeog [Research and Development Center, Hanlim Pharm. Co. Ltd., 1656-10, Seocho-dong, Seocho-gu, Seoul (Korea, Republic of); Lee, Yun Mi; Sohn, Eunjin [Korean Medicine Based Herbal Drug Development Group, Herbal Medicine Research Division, Korea Institute of Oriental Medicine, Daejeon (Korea, Republic of); Kim, Jin Sook, E-mail: jskim@kiom.re.kr [Korean Medicine Based Herbal Drug Development Group, Herbal Medicine Research Division, Korea Institute of Oriental Medicine, Daejeon (Korea, Republic of)

    2015-01-02

    Highlights: • HL-217 is a new synthetic topical anti-angiogenic agent. • HL-217 attenuated subretinal neovascularization in Vldlr{sup −/−} mice. • HL-217 blocked the binding of PDGF-BB to PDGFRβ. - Abstract: HL-217 is a new synthetic angiogenesis inhibitor. Platelet derived growth factor (PDGF) is a vasoactive factor and has been implicated in proliferative retinopathies. In this study, we examined the mechanism of action and efficacy of topical application of HL-217 on subretinal neovascularization in very low-density lipoprotein receptor knockout (Vldlr{sup −/−}) mice. In three-week-old male Vldlr{sup −/−} mice, HL-217 (1.5 or 3 mg/ml) was administered twice per day for 4 weeks by topical eye drop instillation. Neovascular areas were then measured. We used a protein array to evaluate the expression levels of angiogenic factors. The inhibitory effect of HL-217 on the PDGF-BB/PDGFRβ interaction was evaluated in vitro. The neovascular area in the Vldlr{sup −/−} mice was significantly reduced by HL-217. Additionally, HL-217 decreased the expression levels of PDGF-BB protein and VEGF mRNA. Moreover, HL-217 dose-dependently inhibited the PDGF-BB/PDGFRβ interaction (IC{sub 50} = 38.9 ± 0.7 μM). These results suggest that HL-217 is a potent inhibitor of PDGF-BB. HL-217, when applied topically, is an effective inhibitor of subretinal neovascularization due to its ability to inhibit the pro-angiogenic effects of PDGF-BB.

  9. Accretion-ejection connection in the young brown dwarf candidate ISO-Cha1 217

    Whelan, E T; Bacciotti, F; Nisini, B; Bonito, R; Antoniucci, S; Stelzer, B; Biazzo, K; D'Elia, V; Ray, T P

    2014-01-01

    As the number of observed brown dwarf outflows is growing it is important to investigate how these outflows compare to the well studied jets from young stellar objects. A key point of comparison is the relationship between outflow and accretion activity and in particular the ratio between the mass outflow and accretion rates ($\\dot{M}_{out}$/$\\dot{M}_{acc}$). The brown dwarf candidate ISO-ChaI 217 was discovered by our group, as part of a spectro-astrometric study of brown dwarfs, to be driving an asymmetric outflow with the blue-shifted lobe having a position angle of $\\sim$ 20$^{\\circ}$. The aim here is to further investigate the properties of ISO-ChaI 217, the morphology and kinematics of its outflow, and to better constrain ($\\dot{M}_{out}$/$\\dot{M}_{acc}$). The outflow is spatially resolved in the $[SII]\\lambda \\lambda 6716,6731$ lines and is detected out to $\\sim$ 1\\farcs6 in the blue-shifted lobe and ~ 1" in the red-shifted lobe. The asymmetry between the two lobes is confirmed although the velocity as...

  10. A computer program to generate equations of motion matrices, L217 (EOM). Volume 2: Supplemental system design and maintenance document

    Clemmons, R. E.; Kroll, R. I.

    1979-01-01

    The equations of motion program L217 (EOM) is described. The program formulates the matrix coefficients for a second order linear differential equation which describes the motion of an airplane relative to its level equilibrium flight condition. Aerodynamic data from FLEXSTAB or Doublet Lattice (L216) programs are used to derive the equations for quasi-steady or complete unsteady aerodynamics.

  11. 77 FR 14584 - Eleventh Meeting: RTCA Special Committee 217, Joint With EUROCAE Working Group-44, Terrain and...

    2012-03-12

    ... are to report on activities that have occurred since the September meeting. For Working Groups and... Working Group--44, Terrain and Airport Mapping Databases. SUMMARY: The FAA is issuing this notice to advise the public of the Eleventh meeting of RTCA Special Committee 217, Joint with EUROCAE Working...

  12. Clinical feature analysis on 217 patients with subjective tinnitus%217例主观性耳鸣的临床特征分析

    陈玲; 杨海弟; 区永康

    2011-01-01

    目的 研究分析耳鸣患者的临床特征及听力学特点,比较不同类型耳鸣的掩蔽试验效果,探索耳鸣的个性化治疗.方法 对我科门诊及住院的主观性耳鸣患者217例,常规病史调查,同时行纯音测听、耳声发射、耳鸣检测及掩蔽,分析耳鸣患者的临床特征,评估各类耳鸣掩蔽试验的情况.结果 耳鸣在人群高发年龄段为36~ 55岁,占24%.男女比例分别为48%及52%,耳鸣发生侧别以左侧最常见(42%),双侧耳鸣次之(30%),右侧耳鸣最少(28%).城市人口及脑力劳动者居多,分别占77%和68%.病程中以慢性耳鸣患者(病程>1年)最多(占46%).耳鸣高频及低频耳鸣患者掩蔽最为有效,有效率分别为71.6%及73.6%,而中频耳鸣掩蔽有效率仅有52.2%,夫特曼曲线类型与掩蔽试验阳性率明显相关,由Ⅰ型掩蔽阳性率为89%降至Ⅴ型掩蔽阳性率为11.7%.结论 耳鸣患者各项特征与掩蔽试验、耳鸣频率等有较大相关性,可作为耳鸣治疗效果的预测指标.Feldman曲线类型在耳鸣诊断和治疗方面有很大应用价值及指导意义,是预测耳鸣掩蔽是否有效的一个重要指标,也是选择耳鸣个体化治疗的一个重要参考依据.%Objective To analysis the clinical feature and audiology feature of patients with subjective tinnitus,compare masking,screening effectiveness of various kinds tinnitus,and search for the individual treatment ways for subjective tinnitus.Methods 217 patients in our hospistor were performed pure tone test,DPOAE,tinnitus determination,and tinnitus masking including pitch matching,intensity matching,Feldmann masking curve,and residual inhibition test with TinniTestTM.Results The prevalence rate is higher in female (52%).Tinnitts occur to the left side more common (42%),followed by bilateral ears (30%) and the right side (28%).The urban population ( 77% ) and mental worker ( 68% ) were primary in patients.The patients

  13. Factors Associated with Coronary Artery Disease in Young Population (Age≤40):Analysis with 217 Cases

    Wei-xian Yang; Zheng Yang; Yong-jian Wu; Shu-bin Qiao; Yue-jin Yang; Ji-lin Chen

    2014-01-01

    Objective To investigate the relevant factors of coronary artery disease (CAD) in young people under 40 years of age. Methods The study population was 292 young patients accepting coronary angiography in Fuwai Hospital from July to December 2006, including 272 men and 20 women, with the mean age being 36.7±3.7 years. The diagnosis of CAD was made in the cases presenting ≥50%stenosis in coronary lumen in coronary angiography. Based on the diagnosis, 217 patients (204 men, 13 women) were assigned to CAD group, and 75 (68 men, 7 women) to non-CAD group. Clinical data and metabolic characteristics of the patients were collected and analyzed using t-test,χ2 test, and multinomial logistic regression with SPSS 8.0 software. Results Most study subjects were current smokers (209/292, 71.6%), and more than half had body mass index (BMI)>24 kg/m2 (230/292, 78.8%) and usually took high-fat diet (162/292, 55.5%). The proportion of heavy smokers (smoking history ≥10 years and ≥20 cigarettes per day) were significantly higher in the CAD group than in the non-CAD group [20.7%(45/217) vs. 9.3%(7/75), P=0.015)]. Heavy smoking [odds ratio (OR), 1.89;95%confidence interval (CI), 1.74-2.05], hypertension (OR, 1.56;95%CI, 1.48-1.65), alcohol (OR, 1.37;95%CI, 1.30-1.46), type 2 diabetes mellitus (OR, 1.37;95%CI, 1.25-1.50), high-fat diet (OR, 1.35;95% CI, 1.28-1.43), and BMI>24 kg/m2 (OR, 1.09;95% CI, 1.03-1.17) were factors related to CAD in the young patients (all P Conclusions Heavy smoking, hypertension, alcohol consumption, type 2 diabetes mellitus, high-fat diet and BMI>24 kg/m2 were significantly related to CAD in patients aged ≤ 40, with heavy smoking presenting the highest OR. Metabolic syndrome and inflammation were also more common in young CAD patients than in non-CAD patients.

  14. Echomorphology of cardiomyopathy: review of 217 cases from 1999 to 2010

    Objective: To study echocardiogram features of different types of cardiomyopathy presenting over a 12 year period at a single centre in Peshawar. Methods: The series comprised a retrospective review of 13,788 consecutive echocardiograms carried out at the Muhammadi Hospital International Medical Research Centre, Hayatabad, Peshawar, from January 1999 to December 2010. Patients were split into two: Group I with paediatric and adolescent cases (0-18 years) and Group II with adults (>18 years). In the adult group, women with peripartum cardiomyopathy were subdivided into two groups of 18-30 years and 30 to 44 years. Standard Echo B and M modes and Doppler parameters were recorded to ascertain the diagnoses of common primary and secondary cardiomyopathies. Patients with myocarditis with chambers dilatation and global dysfunction, and cardiopathy associated with major cardiovascular diseases were excluded. SPSS 14 was used for statistical analysis. Results: Cardiomyopathy was diagnosed in 217 (1.57%) cases. There were 144 (66%) cases of dilated cardiomyopathy with a mean age of 13+-14.8 years; 17 (8%) cases of hypertrophic cardiomyopathy with a mean age of 12+-11.5 years; and 7 (3%) cases of restrictive cardiomyopathy with a mean age of 31+-7.8 years. Primary cardiac amyloidosis was confirmed in 9 (4%) cases, and peripartum cardiomyopathy in 25 (11%) females. Rare subtypes were found in 15 (7%) cases. Conclusion: DCM was the most frequently diagnosed subtype of cardiomyopathy followed by HCM in both the adult and paediatric age groups. (author)

  15. BXERL photo-injector based on a 217 MHz normal conducting RF gun

    LIU Sheng-Guang; HUANG Tong-Ming; XU Jin-Qiang

    2011-01-01

    The Beijing X-ray Energy Recovery Linac(BXERL)test facility is proposed in Institute of High Physics(IHEP).In this proposal,the main linac requires the injector to provide an electron beam with 5 MeV energy and 10 mA average current.An injector based on DC gun technology is the first candidate electron source for BXERL.However,the field emission in the DC gun cavity makes it much more difficult to increase the high voltage to more than 500 kV.Another technology based on a 217 MHz normal conducting RF gun is proposed as the backup injector for this test facility.We have designed this RF gun with 2D SUPERFISH code and 3D MICROWAVE STUDIO code.In this paper,we present the optimized design of the gun cavity,the gun RF parameters and the set-up of the whole injector system.The detailed beam dynamics have been done and the simulation results show that the injector can generate electron bunches with RMS normalizedemittance 1.0 πmm.mrad,bunch length 0.77 mm,beam energy 5.0 MeV and energy spread 0.60%.

  16. BXERL photo-injector based on a 217 MHz normal conducting RF gun

    Liu, Sheng-Guang; Huang, Tong-Ming; Xu, Jin-Qiang

    2011-09-01

    The Beijing X-ray Energy Recovery Linac (BXERL) test facility is proposed in Institute of High Physics (IHEP). In this proposal, the main linac requires the injector to provide an electron beam with 5 MeV energy and 10 mA average current. An injector based on DC gun technology is the first candidate electron source for BXERL. However, the field emission in the DC gun cavity makes it much more difficult to increase the high voltage to more than 500 kV. Another technology based on a 217 MHz normal conducting RF gun is proposed as the backup injector for this test facility. We have designed this RF gun with 2D SUPERFISH code and 3D MICROWAVE STUDIO code. In this paper, we present the optimized design of the gun cavity, the gun RF parameters and the set-up of the whole injector system. The detailed beam dynamics have been done and the simulation results show that the injector can generate electron bunches with RMS normalized emittance 1.0 πmm·mrad, bunch length 0.77 mm, beam energy 5.0 MeV and energy spread 0.60%.

  17. A computer program to generate equations of motion matrices, L217 (EOM). Volume 1: Engineering and usage

    Kroll, R. I.; Clemmons, R. E.

    1979-01-01

    The equations of motion program L217 formulates the matrix coefficients for a set of second order linear differential equations that describe the motion of an airplane relative to its level equilibrium flight condition. Aerodynamic data from FLEXSTAB or Doublet Lattice (L216) programs can be used to derive the equations for quasi-steady or full unsteady aerodynamics. The data manipulation and the matrix coefficient formulation are described.

  18. Line lists for H218O and H217O based on empirical line positions and ab initio intensities

    New line lists for isotopically substituted water are presented. Most line positions were calculated from experimentally determined energy levels, while all line intensities were computed using an ab initio dipole moment surface. Transitions for which experimental energy levels are unavailable use calculated line positions. These line lists cover the range 0.05-20 000 cm-1 and are significantly more complete and potentially more accurate than the line lists available via standard databases. All lines with intensities (scaled by isotopologue abundance) greater than 10-29 cm/molecule at 296 K are included, augmented by weaker lines originating from pure rotational transitions. The final line lists contain 39 918 lines for H218O and 27 546 for H217O and are presented in standard HITRAN format. The number of experimentally determined H218O and H217O line positions is, respectively, 32 970 (83% of the total) and 17 073 (62%) and in both cases the average estimated uncertainty is 2×10-4 cm-1. The number of ab initio line intensities with an estimated uncertainty of 1% is 16 621 (42%) for H218O and 13 159 (48%) for H217O.

  19. Bloodstream infection following 217 consecutive systemic-enteric drained pancreas transplants

    Mark Walter

    2006-08-01

    Full Text Available Abstract Background Combined kidney pancreas transplantation (PTx evolved as excellent treatment for diabetic nephropathy. Infections remain common and serious complications. Methods 217 consecutive enteric drained PTxs performed from 1997 to 2004 were retrospectively analyzed with regard to bloodstream infection. Immunosuppression consisted of antithymocyteglobuline induction, tacrolimus, mycophenolic acid and steroids for the majority of cases. Standard perioperative antimicrobial prophylaxis consisted of pipercillin/tazobactam in combination with ciprofloxacin and fluconazole. Results One year patient, pancreas and kidney graft survival were 96.4%, 88.5% and 94.8%, surgical complication rate was 35%, rejection rate 30% and rate of infection 59%. In total 46 sepsis episodes were diagnosed in 35 patients (16% with a median onset on day 12 (range 1–45 post transplant. Sepsis source was intraabdominal infection (IAI (n = 21, a contaminated central venous line (n = 10, wound infection (n = 5, urinary tract infection (n = 2 and graft transmitted (n = 2. Nine patients (4% experienced multiple episodes of sepsis. Overall 65 pathogens (IAI sepsis 39, line sepsis 15, others 11 were isolated from blood. Gram positive cocci accounted for 50 isolates (77%: Coagulase negative staphylococci (n = 28, i.e. 43% (nine multi-resistant, Staphylococcus aureus (n = 11, i.e. 17% (four multi-resistant, enterococci (n = 9, i.e. 14% (one E. faecium. Gram negative rods were cultured in twelve cases (18%. Patients with blood borne infection had a two year pancreas graft survival of 76.5% versus 89.4% for those without sepsis (p = 0.036, patient survival was not affected. Conclusion Sepsis remains a serious complication after PTx with significantly reduced pancreas graft, but not patient survival. The most common source is IAI.

  20. The eukaryotic translation elongation factor eEF1A2 induces neoplastic properties and mediates tumorigenic effects of ZNF217 in precursor cells of human ovarian carcinomas

    Sun, Yu; Wong, Nicholas; Guan, Yinghui; Salamanca, Clara M.; Cheng, Jung Chien; Lee, Jonathan M.; Gray, Joe W.; Auersperg, Nelly

    2008-04-25

    Ovarian epithelial carcinomas (OEC) frequently exhibit amplifications at the 20q13 locus which is the site of several oncogenes, including the eukaryotic elongation factor EEF1A2 and the transcription factor ZNF217. We reported previously that overexpressed ZNF217 induces neoplastic characteristics in precursor cells of OEC. Unexpectedly, ZNF217, which is a transcriptional repressor, enhanced expression of eEF1A2. In this study, array comparative genomic hybridization, single nucleotide polymorphism and Affymetrix analysis of ZNF217-overexpressing cell lines confirmed consistently increased expression of eEF1A2 but not of other oncogenes, and revealed early changes in EEF1A2 gene copy numbers and increased expression at crisis during immortalization. We defined the influence of eEF1A2 overexpression on immortalized ovarian surface epithelial cells, and investigated interrelationships between effects of ZNF217 and eEF1A2 on cellular phenotypes. Lentivirally induced eEF1A2 overexpression caused delayed crisis, apoptosis resistance and increases in serum-independence, saturation densities, and anchorage independence. siRNA to eEF1A2 reversed apoptosis resistance and reduced anchorage independence in eEF1A2-overexpressing lines. Remarkably, siRNA to eEF1A2 was equally efficient in inhibiting both anchorage independence and resistance to apoptosis conferred by ZNF217 overexpression. Our data define neoplastic properties that are caused by eEF1A2 in nontumorigenic ovarian cancer precursor cells, and suggest that eEF1A2 plays a role in mediating ZNF217-induced neoplastic progression.

  1. Knockdown of lncRNA-ATB suppresses autocrine secretion of TGF-β2 by targeting ZNF217 via miR-200c in keloid fibroblasts.

    Zhu, Hua-Yu; Bai, Wen-Dong; Li, Chao; Zheng, Zhao; Guan, Hao; Liu, Jia-Qi; Yang, Xue-Kang; Han, Shi-Chao; Gao, Jian-Xin; Wang, Hong-Tao; Hu, Da-Hai

    2016-01-01

    Abnormally high activation of transforming growth factor-β (TGF-β) signaling has been demonstrated to be involved in the initiation and progression of keloids. However, the functional role of long non-coding RNA (lncRNA)-activated by TGF-β (lncRNA-ATB) in keloids has not been documented. Here we investigated the role of lncRNA-ATB in the autocrine secretion of TGF-β in keloid fibroblasts (KFs) and explored the underlying molecular mechanism. Using immunohistochemistry and quantitative RT-PCR analysis, we showed that lncRNA-ATB and ZNF217, a transcriptional activator of TGF-β, were overexpressed and miR-200c, which targets ZNF217, was under-expressed in keloid tissue and keloid fibroblasts. Through gain- and loss-of-function studies, we demonstrated that knockdown of lncRNA-ATB decreased autocrine secretion of TGF-β2 and ZNF217 expression but upregulated expression of miR-200c in KFs. Stable downregulation of ZNF217 expression decreased the autocrine secretion of TGF-β2. miR-200c was endogenously associated with lncRNA-ATB, and inhibition of miR-200c overcame the decrease in ZNF217 expression in KFs. Taken together, these findings indicate that lncRNA-ATB governs the autocrine secretion of TGF-β2 in KFs, at least in part, by downregulating the expression level of ZNF217 via miR-200c, suggesting a signaling axis consisting of lncRNA-ATB/miR-200c/ZNF217/TGF-β2. These findings may provide potential biomarkers and targets for novel diagnostic and therapeutic approaches for keloids. PMID:27090737

  2. Reduction of F1 Neuronal Excitability by Exposure to 217 Hz Magnetic Fields from GSM 900 Mobile Phone

    Mehri Kaviani Moghadam

    2009-01-01

    Full Text Available Objective: The aim of this study was to investigate the effects of a 217 Hz magnetic field ofmobile phone GSM 900 exposure on the bioelectric activity of F1 neuronal cells of the landsnail.Materials and Methods: According to the magnetic field measurement of the mobile phone,a range of flux intensities of magnetic fields (0.46 - 229 μT at a frequency of 217 Hz wasproduced by magnetic field coils. The bioelectrical activity of F1 nerve cells at different timeintervals was recorded, using intracellular recording under current clamp conditions in control,sham and field exposed groups.Results: Magnetic field exposure decreased the amplitude of action potential and the firingfrequency of F1 nerve cells. Furthermore, it resulted in a significant (p<0.05 increase inthe amplitude of after hyperpolarization (AHP and duration of action potential. Change inthe cell’s electrophysiological parameters was associated with a decrease in neuronal excitability.Magnetic field exposure affected also the resting membrane potential of F1 cells in abimodal fashion, including depolarization and hyperpolarization. Considering the exposurecondition, most of the alterations in the electrical activity of F1 nerve cells induced by magneticfields exposure were reversible.Conclusion: These findings suggest that 217 Hz magnetic fields of mobile phones with differentintensities affect the spontaneous bioelectrical activity of F1 nerve cells and exert inhibitoryeffects on neuronal excitability. There is evidence for the existence of an amplitudewindow and these electrophysiological alterations occur within this amplitude window. Thereversibility of the magnetic field- induced most electrophysiological alterations in the neuronalbehavior under our experimental conditions was observed.

  3. Production of D0(1863) mesons in 217 GeV/c pi-minus proton interactions

    This thesis reports on the analysis of data obtained during FNAL experiment E369. The Chicago Cyclotron Magnet Spectrometer Facility was used to perform a search for the hadronic production of charmed D mesons. A 217 Gev π- beam was incident on a liquid hydrogen target. The trigger required a slow recoil proton in coincidence with a muon. A total of 26 +- 8 neutral D mesons were observed through their K0π+π- decay mode. The distributions of Feynman X, missing mass, and momentum transfer to the recoil proton were consistent with diffractive production. Cross sections were calculated based on a diffractive model

  4. Reaction natYb+48Ca->217Th+3n: auto calibration process for DSSSD detector application (particular case)

    Tsyganov, Yu

    2015-01-01

    The Dubna Gas-Filled Recoil Separator (DGFRS) is the mostly effective setup in use for the field of synthesis of superheavy elements. Application of DSSSD detector provides more precise energy and position detection for both implanted recoils and their alpha decays. To minimize contribution of background products the method of fctive correlation is applied at the DGFRS. To apply this method a precise calibration for 48 front strips is strongly required. Method of three peaks auto calibration is proposed with a first approximation step with 9.26 MeV 217Th peaks. Examples of alpha-decay original spectra and spectra after filtration procedures are presented.

  5. Jurisprudential Analysis on the 217th Article of Criminal Law about “Reproducing and Distributing”%对刑法第217条关于“复制发行”规定的法理分析

    王泽众

    2015-01-01

    不论是学术界还是实务界,对刑法第217条关于“复制发行”规定的含义都存在多种理解方式。从法理的应然角度和刑事政策的实然角度分析,“复制发行”应当理解为包括单独的复制行为或既复制又发行行为两种情况,而单独的非法发行行为属于销售侵权复制品罪的范畴,应当适用刑法第218条的规定。%Both in the theory and practice fields,there are many ways of understanding the 217th article of the criminal law about the“reproducing and distributing”.Analyzing from the necessities of jurisprudence and the realities of criminal policies,“reproducing and distributing”behavior ought to be interpreted as two situations:reproducing behavior or both reproducing and distributing behavior. The simple distributing behavior belongs to the category of crime of selling pirated goods that should apply the provisions of the 218th article of the criminal law.

  6. Decay of the ground state and the 29/2+ isomer in 217Ac and G factor measurements by perturbed angular distribution of α-particles

    The nucleus 217Ac was studied using the 205Tl(16O, 4n), 206Pb (15N, 4n) and 209Bi (12C, 4n) reactions. The measurements included α-γ, γ-γ, α-ce and ce-ce coincidence experiments as well as γ-ray and α-particle perturbed angular distribution studies. Results are: g(217Acsup(gs))=+0.85 (1) and Tsub(1/2)(217Acsup(gs))=69(4) ns, the shortest known α-decay of a ground state. 217Agsup(m) decays mainly by a γ cascade, but also by α-emission to the single particles states πhsub(9/2), fsub(7/2), isub(13/2) of 213Fr. Spins and parities of levels to the 29/2+ isomer at 2013 keV with Tsub(1/2)=740(40)ns and g=+0.347(5) are determined. The level scheme of 217Ac and the α decay of N=128 isotones are discussed. (orig.)

  7. High temperature oxidation and its induced coercivity loss of a 2:17 type SmCo-based magnet

    Oxidation has been explained as one possibility for unacceptable and irreversible coercivity loss of 2:17 type SmCo-based magnets at high temperatures over 550 °C, but the question for how oxidation affects coercivity in the magnet has not been fundamentally answered. In this work, oxidation and its induced degradation of the magnetic phases of a Sm(CobalFe0.22Cu0.08Zr0.02)7.5 magnet in air at 600 °C have been investigated by using transmission electron microscopy and correlated with the demagnetization curves measured. It shows that the coercivity loss, which is significantly increased with oxidation time, is small and independent of time in the magnet unaffected by oxidation. The reason lies in that the 2:17 cell and 1:5 cell boundary, although they have been completely disintegrated in the oxidized part by external oxidation of Co, Fe, and Cu and internal oxidation of Sm, remains in the unoxidized part except that 1:5 boundary close to the oxidized part is decreased in thickness and Cu content

  8. 2:17-type SmCo magnets prepared by powder injection molding using a water-based binder

    2:17-type SmCo permanent magnets by powder injection molding using a water-based binder have been studied. The water-based binder is methylcellulose solution, which consists of deionized water and methylcellulose. When the solution concentration is 0.5 wt%, the carbon content of the sintered magnets is below 0.1 wt% and the magnets have better magnetic properties. The magnetic properties and density of the sintered magnets can be increased through pre-sintering in vacuum (10-3 Pa) at 1200 deg. C. However, the Sm content of the magnets loses obviously in pre-sintering for a long period. The appropriate pre-sintering duration is 20-40 min. The magnetic properties of the magnets are: Br=0.97 T, Hcj=871 kA/m, BHmax=157 kJ/m3. The structure of the magnet consists of the matrix phases (2:17 phases) and the precipitate phases (1:5 phases)

  9. Roflumilast: APTA 2217, B9302-107, BY 217, BYK 20869.

    2004-01-01

    Roflumilast [APTA 2217, B9302-107, BY 217, BYK 20869] is a selective phosphodiesterase IV inhibitor. It is being developed by Altana Pharma (formerly Byk Gulden), a subsidiary of Altana Group, as an orally administered therapy for asthma, chronic obstructive pulmonary disease (COPD), allergic rhinitis and psoriasis. The drug is awaiting regulatory approval in Europe for the treatment of asthma and COPD. Byk Gulden has stated that roflumilast relieves asthma symptoms through both an anti-inflammatory effect and a muscle relaxant effect. Roflumilast has potential as first-line long-term therapy in mild-to-moderate COPD and as additive long-term therapy in moderate-to-severe COPD. Altana has stated that roflumilast is to be marketed under the brand name Daxas. Altana Group and Pharmacia Corporation (now Pfizer) signed an agreement on 22 April 2002 to collaborate on the development and commercialisation of roflumilast for the treatment of respiratory disorders, including asthma and COPD. The companies will jointly develop the drug for the US, Europe and other markets. Pharmacia will co-ordinate development in the US and Altana will co-ordinate development in Europe. After approval of the drug, Pharmacia and Altana will jointly launch and promote roflumilast in the US, Europe and elsewhere. Altana will receive an upfront payment and additional milestone payments. Altana additionally has the option to co-promote Pharmacia products in the US and elsewhere. On 16 April 2003, Pharmacia Corporation was acquired by, and merged into, Pfizer. In November 2002, Altana and Tanabe Seiyaku signed an agreement to collaborate on the development and commercialisation of roflumilast for the treatment of respiratory diseases, including asthma and COPD. Tanabe Seiyaku and Altana will develop roflumilast for asthma and COPD in Japan, and will jointly launch and co-promote roflumilast in Japan following regulatory approval. Roflumilast has been in multinational phase III clinical studies

  10. Results of the independent verification of radiological remedial action at 217 South 2nd East Street, Monticello, Utah (MS00097)

    In 1980 the site of a vanadium and uranium mill at Monticello, Utah, was accepted into the US Department of Energy's (DOE's) Surplus Facilities Management Program, with the objectives of restoring the government-owned mill site to safe levels of radioactivity, disposing of or containing the tailings in an environmentally safe manner, and performing remedial actions on off-site (vicinity) properties that had been contaminated by radioactive material resulting from mill operations. During 1985 and 1986, UNC Geotech, the remedial action contractor designated by DOE, performed remedial action on the vicinity property at 217 South 2nd East Street, Monticello, Utah. The Pollutant Assessments Group (PAG) of Oak Ridge National Laboratory was assigned the responsibility of verifying the data supporting the adequacy of remedial action and confirming the site's compliance with DOE guidelines. The PAG found that the site successfully meets the DOE remedial action objectives. Procedures used by PAG are described. 3 refs., 2 tabs

  11. Activity and expression of acetylcholinesterase in PC12 cells exposed to intermittent 1.8 GHz 217-GSM mobile phone signal.

    Valbonesi, Paola; Franzellitti, Silvia; Bersani, Ferdinando; Contin, Andrea; Fabbri, Elena

    2016-01-01

    Purpose Due to its role in learning, memory and in many neurodegenerative diseases, acetylcholinesterase (AChE) represents an interesting endpoint to assess possible targets of exposure to radiofrequency electromagnetic fields (RF-EMF) generated by mobile phones. We investigated possible alterations of enzymatic activity, gene and protein expression of AChE in neuronal-like cells exposed to a 1.8 GHz Global System for Mobile Communication (GSM) modulated signal (217-GSM). Materials and methods Rat PC12 cells were exposed for 24 h to 1.8 GHz 217-GSM signal. Specific adsorption rate (SAR) was 2 W/kg. AChE enzyme activity was assessed spectrophotometrically by Ellman's method, mRNA expression level was evaluated by real time polymerase chain reaction, and protein expression was assessed by Western blotting. Results AChE enzymatic activity increased of 1.4-fold in PC12 cells exposed to 217-GSM signal for 24 h, whilst AChE transcriptional or translational pathways were not affected. Conclusion Our results provide the first evidence of effects on AChE activity after in vitro exposure of mammalian cells to the RF-EMF generated by GSM mobile phones, at the SAR value 2 W/kg. The obtained evidence promotes further investigations on AChE as a possible target of RF-EMF and confirm the ability of 1.8 GHz 217-GSM signal to induce biological effects in different mammalian cells. PMID:26630175

  12. Positional cloning of ZNF217 and NABC1: genes amplified at 20q13.2 and overexpressed in breast carcinoma.

    Collins, C; Rommens, J M; Kowbel, D; Godfrey, T; Tanner, M; Hwang, S I; Polikoff, D; Nonet, G; Cochran, J; Myambo, K; Jay, K E; Froula, J; Cloutier, T; Kuo, W L; Yaswen, P; Dairkee, S; Giovanola, J; Hutchinson, G B; Isola, J; Kallioniemi, O P; Palazzolo, M; Martin, C; Ericsson, C; Pinkel, D; Albertson, D; Li, W B; Gray, J W

    1998-07-21

    We report here the molecular cloning of an approximately 1-Mb region of recurrent amplification at 20q13.2 in breast cancer and other tumors and the delineation of a 260-kb common region of amplification. Analysis of the 1-Mb region produced evidence for five genes, ZNF217, ZNF218, and NABC1, PIC1L (PIC1-like), CYP24, and a pseudogene CRP (Cyclophillin Related Pseudogene). ZNF217 and NABC1 emerged as strong candidate oncogenes and were characterized in detail. NABC1 is predicted to encode a 585-aa protein of unknown function and is overexpressed in most but not all breast cancer cell lines in which it was amplified. ZNF217 is centrally located in the 260-kb common region of amplification, transcribed in multiple normal tissues, and overexpressed in all cell lines and tumors in which it is amplified and in two in which it is not. ZNF217 is predicted to encode alternately spliced, Kruppel-like transcription factors of 1,062 and 1,108 aa, each having a DNA-binding domain (eight C2H2 zinc fingers) and a proline-rich transcription activation domain. PMID:9671742

  13. Draft Genome Sequences of Seven Bacterial Strains Isolated from a Polymicrobial Culture of Coccolith-Bearing (C-Type) Emiliania huxleyi M217

    Rosana, Albert Remus R.; Orata, Fabini D.; Xu, Yue; Simkus, Danielle N.; Bramucci, Anna R.; Boucher, Yan

    2016-01-01

    Strains of Rhodobacteraceae, Sphingomonadales, Alteromonadales, and Bacteroidetes were isolated from a polymicrobial culture of the coccolith-forming (C-type) haptophyte Emiliania huxleyi strain M217. The genomes encode genes for the production of algal growth factors and the consumption of their hosts’ metabolic by-products, suggesting that the polymicrobial culture harbors many symbiotic interactions. PMID:27417845

  14. Herschel/HIFI search for H2-17O and H2-18O in IRC+10216: constraints on models for the origin of water vapor

    Neufeld, David A; Agúndez, Marcelino; González-Alfonso, Eduardo; Decin, Leen; Daniel, Fabien; Cernicharo, José; Melnick, Gary J; Schmidt, Miroslaw; Szczerba, Ryszard

    2013-01-01

    We report the results of a sensitive search for the minor isotopologues of water, H2-17O and H2-18O, toward the carbon-rich AGB star IRC+10216 (a.k.a. CW Leonis) using the HIFI instrument on the Herschel Space Observatory. This search was motivated by the fact that any detection of isotopic enhancement in the H2-17O and H2-18O abundances would have strongly implicated CO photodissociation as the source of the atomic oxygen needed to produce water in a carbon-rich circumstellar envelope. Our observations place an upper limit of 1/470 on the H2-17O/H2-16O abundance ratio. Given the isotopic 17O/16O ratio of 1/840 inferred previously for the photosphere of IRC+10216, this result places an upper limit of a factor 1.8 on the extent of any isotope-selective enhancement of H2-17O in the circumstellar material, and provides an important constraint on any model that invokes CO photodissociation as the source of O for H2O production. In the context of the clumpy photodissociation model proposed previously for the origi...

  15. The anterior flavum ligamentum space in lumbar nerve root compression: a comparison study of MG and CTM of 217 cases

    Purpose: To study the findings of lumbar nerve-roots compression in myelography (MG) and CT-myelography (CTM), proposing a new concept of anterior flavum ligament space (AFLS) and evaluate the AFLS as well as other findings in diagnosis of compressed lumbar radiculopathy, in order to guide lumbar plain CT study. Methods: The images of MG and CTM of 217 cases were reviewed, and the relative sites to the pediculus of L3∼S1 nerve roots getting out of the dural sac at each side, the width of AFLS, the width of superior outlet of lateral recess and the morphology of the disks and the sagittal diameter of the dural sac in L4 to S1 were recorded respectively. The relations of these parameters to the compressed swollen lumbar nerve roots shown in MG were analysed. Results: 254 lumbar nerve roots of 217 cases were swollen as shown in MG. The herniations or bulgings of intervertebral disk were found in 195 level with the diameter of the corresponding dural sac < 10 mm. The sensitivity was 71.4%, specificity was 82.9% and accuracy 80.2% for diagnosis of L-nerve root compression. The width of the superior outlet≤ 3mm was found in 286 lateral recesses, and it's sensitivity, specificity and accuracy were 55.1%, 86.1% and 80.0% respectively in the diagnosis of the lumbar compressed radiculopathy. 229 in 271 (90.2%) lumbar nerve roots were compressed and swollen as demonstrated in MG with the AFLS<5 mm. It's sensitivity was 90.2%, specificity 96.0% and accuracy 94.9% in the diagnosis of the lumbar compressed radiculopathy. The mean width of the AFLS with the corresponding swollen nerve root as shown in MG was 3.6 mm and the mean width of AFLS without the corresponding swollen nerve root shown in MG was 6.9 mm (P<0.001, U test). Conclusion: The AFLS<5 mm can be used as a valuable criterion in diagnosing lumbar nerve root compression in CT study

  16. Apendicectomia em pacientes com idade superior a 40 anos: análise dos resultados de 217 casos

    Antonio Sérgio Brenner

    2006-06-01

    Full Text Available INTRODUÇÃO: A baixa freqüência de apendicite aguda em pacientes acima de 40 anos indica que uma melhor análise desse grupo torna-se necessária. MÉTODO: Realizamos um estudo de Coorte em 1343 pacientes submetidos a apendicectomia entre 2001 a 2005. Duzentos e dezessete pacientes apresentavam idade superior a 40 anos. Os pacientes foram divididos em 2 grupos: pacientes com idade superior (n=217 e inferior (n=1126. O Banco de Dados do Serviço em Cirurgia do Hospital Universitário Evangélico foi utilizado para fornecer os achados operatórios, os exames histopatológicos e o resultado clínico imediato. RESULTADOS: No grupo com idade acima de 40 anos, os achados cirúrgicos demonstraram o apêndice em fase edematosa em 42,85% e em 26,72% foi identificada supuração. A incisão mediana foi realizada em 39,17% e o tempo de internação médio foi de 4,65 dias. No grupo com idade abaixo de 40 anos, os achados cirúrgicos demonstraram o apêndice em fase edematosa em 24,5% e supuração em 32,6%. A incisão mediana foi utilizada em 11,90% dos pacientes e o tempo de internação médio foi de 3,35 dias. CONCLUSÃO: Nos pacientes acima de 40 anos, observamos casos mais complexos, provavelmente pelo baixo índice de suspeição.INTRODUCTION: The low frequency of acute appendicitis in patients over 40 years old suggests that a better analysis is necessary. METHOD: We have made a Cohort in 1343 patients submitted to appendectomy from 2001 to 2005. Patients were divided in two groups: over (n = 217 and under (n = 1126 40 years old. The Evangelico Hospital Colorectal Data Base was accessed to give surgical, histopathologic and clinical outcome. RESULTS: In the over 40 group, surgical findings demonstrated edematous appendicitis in 42.85% and suppuration in 26.72%. Median incision was used in 39.17% and the average hospital stay was 4.65 days. In the under 40 group, surgical findings demonstrated edematous appendicitis in 24.5% and suppuration in 32

  17. VizieR Online Data Catalog: HK photometry in an UCHII region near Sh2-217 (Brand+, 2011)

    Brand, J.; Massi, F.; Zavagno, A.; Deharveng, L.; Lefloch, B.

    2010-11-01

    Coordinates and photometric parameters (magnitudes and colours) are presented of the stars located in a molecular condensation on the SW-border of the Galactic HII region Sh2-217. The data were obtained on January 4, 2004 with the 3.58-m Telescopio Nazionale Galileo (TNG; La Palma, Canary Islands, Spain). Near-infrared observations were carried out through H and K' broad-band filters with the camera NICS. The image scale is 0.25arcsec/pixel, yielding a field of view of about 4.2'x4.2'. Observing strategy and exposure times are described in Deharveng et al. (2006A&A...458..191D), the only difference being that the dithering sequence for the H-band images was the same as adopted for K'. The data reduction steps adopted are outlined in Deharveng et al. (2006A&A...458..191D). Aperture photometry was done using the DAOPHOT package in IRAF. We followed the same procedure described in Deharveng et al. (2006A&A...458..191D) to obtain aperture photometry, after which PSF-fitting photometry was performed. Although the seeing was good (position on the image of a sample of stars and fitting those positions to the equatorial coordinates given by Deharveng et al. (2006A&A...458..191D), using tasks of STSDAS/IRAF. The typical accuracy of this procedure is of the order of 1". (1 data file).

  18. Status of the 7 MeV/u, 217 MHz Injector Linac for the Heidelberg Cancer Therapy Facility

    Schlitt, B; Hutter, G; Klos, F; Lu, Y; Minaev, S A; Mühle, C; Ratzinger, U; Schlitt, B; Tiede, R; Vinzenz, W; Will, C; Zurkan, O

    2004-01-01

    A clinical synchrotron facility for cancer therapy using energetic proton and ion beams (C, He and O) is under construction and will be installed at the Radiologische Universitätsklinik in Heidelberg, Germany, starting in 2005. The status of the ECR ion source systems, the beam line components of the low energy beam transport lines, the 400 keV/u RFQ and the 20 MV IH-cavity as well as the linac rf system will be reported. Two prototype magnets of the linac quadrupole magnets have been built at GSI and have been tested successfully. A test bench for the 1.4 MW, 217 MHz cavity amplifier built by industry has been installed at GSI including a 120 kW driver amplifier which will be used also for high power tests of the RFQ. A test bench for the RFQ using proton beams is presently being set up at the IAP. RF tuning of the 1:2 scaled IH-DTL model as well as Microwave Studio simulations of the model and the power cavity have been also performed at the IAP [1].

  19. Long-term exposure to low frequency electro-magnetic fields of 50- and 217-Hz leads to learning and memory deficits in mice

    Soheila Khodakarim; Mostafa Rezaei-Tavirani; Elaheh Nooshinfar

    2012-01-01

    Electromagnetic field (EMF) radiation affects cellular and brain chemistry and function, resulting in deleterious effects such as free radicals formation, impaired DNA repair, reduced melatonin and blood brain barrier protection, and defects on learning and memory and other higher brain functions. In this paper the effects of low frequency EMF of 50- and 217 Hz, ranges often associated with common electronic devices such as televisions and cell phones were examined on learning and memory in a...

  20. HERSCHEL/HIFI SEARCH FOR H217O AND H218O IN IRC+10216: CONSTRAINTS ON MODELS FOR THE ORIGIN OF WATER VAPOR

    We report the results of a sensitive search for the minor isotopologues of water, H217O and H218O, toward the carbon-rich asymptotic giant branch star IRC+10216 (a.k.a. CW Leonis) using the HIFI instrument on the Herschel Space Observatory. This search was motivated by the fact that any detection of isotopic enhancement in the H217O and H218O abundances would have strongly implicated CO photodissociation as the source of the atomic oxygen needed to produce water in a carbon-rich circumstellar envelope. Our observations place an upper limit of 1/470 on the H217O/H216O abundance ratio. Given the isotopic 17O/16O ratio of 1/840 inferred previously for the photosphere of IRC+10216, this result places an upper limit of a factor 1.8 on the extent of any isotope-selective enhancement of H217O in the circumstellar material, and provides an important constraint on any model that invokes CO photodissociation as the source of O for H2O production. In the context of the clumpy photodissociation model proposed previously for the origin of water in IRC+10216, our limit implies that 12C16O (not 13C16O or SiO) must be the dominant source of 16O for H2O production, and that the effects of self-shielding can only have reduced the 12C16O photodissociation rate by at most a factor ∼2.

  1. Herschel/HIFI Search for H_2^{17}O and H_2^{18}O in IRC+10216: Constraints on Models for the Origin of Water Vapor

    Neufeld, David A.; Tolls, Volker; Agúndez, Marcelino; González-Alfonso, Eduardo; Decin, Leen; Daniel, Fabien; Cernicharo, José; Melnick, Gary J.; Schmidt, Miroslaw; Szczerba, Ryszard

    2013-04-01

    We report the results of a sensitive search for the minor isotopologues of water, H_2^{17}O and H_2^{18}O, toward the carbon-rich asymptotic giant branch star IRC+10216 (a.k.a. CW Leonis) using the HIFI instrument on the Herschel Space Observatory. This search was motivated by the fact that any detection of isotopic enhancement in the H_2^{17}O and H_2^{18}O abundances would have strongly implicated CO photodissociation as the source of the atomic oxygen needed to produce water in a carbon-rich circumstellar envelope. Our observations place an upper limit of 1/470 on the H_2^{17}O/H_2^{16}O abundance ratio. Given the isotopic 17O/16O ratio of 1/840 inferred previously for the photosphere of IRC+10216, this result places an upper limit of a factor 1.8 on the extent of any isotope-selective enhancement of H_2^{17}O in the circumstellar material, and provides an important constraint on any model that invokes CO photodissociation as the source of O for H2O production. In the context of the clumpy photodissociation model proposed previously for the origin of water in IRC+10216, our limit implies that 12C16O (not 13C16O or SiO) must be the dominant source of 16O for H2O production, and that the effects of self-shielding can only have reduced the 12C16O photodissociation rate by at most a factor ~2. Herschel is an ESA space observatory with science instruments provided by European-led Principal Investigator consortia and with important participation from NASA.

  2. IUPAC critical evaluation of the rotational-vibrational spectra of water vapor. Part I-Energy levels and transition wavenumbers for H217O and H218O

    This is the first part of a series of articles reporting critically evaluated rotational-vibrational line positions, transition intensities, pressure dependence and energy levels, with associated critically reviewed assignments and uncertainties, for all the main isotopologues of water. The present article contains energy levels and data for line positions of the singly substituted isotopologues H217O and H218O. The procedure and code MARVEL, standing for measured active rotational-vibrational energy levels, is used extensively in all stages of determining the validated levels and lines and their self-consistent uncertainties. The spectral regions covered for both isotopologues H217O and H218O are 0-17125cm-1. The energy levels are checked against ones determined from accurate variational calculations. The number of critically evaluated and recommended levels and lines are, respectively, 2687 and 8614 for H217O, and 4839 and 29 364 for H218O. The extensive lists of MARVEL lines and levels obtained are deposited in the Supplementary Material, as well as in a distributed information system applied to water, W-DIS, where they can easily be retrieved. A distinguishing feature of the present evaluation of water spectroscopic data is the systematic use of all available experimental data and validation by first-principles theoretical calculations.

  3. Investigating the effects of 217 Hz frequency of cell phone on learning and spatial memory in rats

    Kohzad S

    2013-03-01

    Full Text Available Background: Extremely low frequency (0-300 Hz fields from power lines, electronic equipment and medical devices, have been reported to produce various biological effects. Global system for mobile (GSM is most largely used in everybody's life. This system utilizes a low frequency band as well as a high frequency range of electromagnetic field. This study investigated the effects of 217 Hz electromagnetic field (the modulating signal in GSM on spatial learning and memory in rat.Methods: Twenty four male Wistar rat (200- 250 g were randomly divided in to three groups as: test, sham and control. Using a Helmholtz coil system, the test group was exposed to a uniform pulsed EMF of 200 µT (micro Tesla intensity for 4 h/day for 21 days (2 time in a day. This procedure was repeated for the sham group but with no field. All groups were trained prior to the day 21 on the 15th day for five days four trial per day in Morris Water-Maze system. Then the probe test was carried out for 60 seconds with no platform.Results: The ANOVA test revealed that no significant differences were found between control and exposed rats in all day of learning acquisition. Also, in probe test for investigating the memory, no significant differences observed. (P≤0.05 is accepted for significant level.Conclusion: This finding is in consistent with previous studies and indicates low frequency band of electromagnetic fields (EMF (200 µT intensity in cell phone may not have any effect on the learning acquisition and spatial memory in rat.

  4. The Effect of 217 Hz Magnetic Field of Cell Phone with Different Intensities on Apoptosis of Normal and Cancerous Cells Treated with Chemotherapy Drug

    Mahsa Mansourian

    2012-03-01

    Full Text Available Background: According to the increasing development of home and business electronic equipment in today's world, the biological effects of ELF magnetic fields have been studied at two molecular-cellular and animal- human levels. Considering the therapeutic viewpoint of this study regarding the effects of low-frequency fields of mobile phone, the effect of acute exposure to this field on chemotherapy will be studied.Materials and Methods: In this experimental study, based on measurement of the intensity of the magnetic fields from mobile phones in another research, flux densities of magnetic field of 159.44, 93.25 and 120µ tesla with frequency of 217Hz was generated in magnetic field generator system, and the apoptosis level in K562 cancer cells and healthy cells of lymphocytes was assessed after exposure to field using flow cytometry method. This evaluation method was also performed for the cells treated with bleomycin after exposure to this field.Results: 217 Hz magnetic field exposure significantly increases the rate of apoptosis percentage (p > 0.05 in K562 cancer cells and in two intensities of 120 and 159.44µ tesla compared to the control group, but such effect is not observed in lymphocyte cells. Bleomycin-induced apoptosis percentage following exposure to the mentioned magnetic field shows no significant difference compared to the group of treatment with drug and without field exposure. This lack of significant difference is observed between the groups of drug after field exposure and field alone as well as between groups exposed to field and groups treated with bleomycin.Conclusion: Study results showed that 217 Hz magnetic field of mobile phone can induce apoptosis on cancer cells, but it has no effect on healthy cells. Thus, in order to use mobile phone as an effective factor in their treatment, some studies should be conducted at animal-human level.

  5. Epidemiology of Staphylococcus aureus in Bangalore, India: emergence of the ST217 clone and high rate of resistance to erythromycin and ciprofloxacin in the community

    Bouchiat, C.; El-Zeenni, N.; Chakrakodi, B.; Nagaraj, S.; Arakere, G.; Etienne, J.

    2015-01-01

    This study aimed to determine the antibiotic susceptibility pattern of Staphylococcus aureus (SA) and the circulating clones in Bangalore, India. Susceptibility testing was performed for all cases of SA infections in a tertiary-care hospital. Panton-Valentine leucocidin (PVL) encoding genes were detected, and sequence type and spa type were determined. Out of the 92 collected strains, 52.2% were methicillin-resistant SA (MRSA), isolated from community-acquired (CA) infections in 60.4% and hospital-acquired (HA) infections in 39.6%. S. aureus isolates were also highly resistant to erythromycin (54.3%) and ciprofloxacin (70.6%) in methicillin-susceptible SA (MSSA) and MRSA, as well as in CA and HA infections. MRSA were found to be significantly more resistant to gentamicin (p <0.001), cotrimoxazole (p <0.001) and ciprofloxacin (p 0.001) than MSSA, but no significant difference was observed between CA- and HA-SA. ST217 appeared as a new emerging and prevalent clone, but ST772 remained the predominant clone, all being PVL-positive isolates. Our study points out the high prevalence of MRSA, even in the community, and the worrying increase of resistance to ciprofloxacin and erythromycin among CA-MSSA. Emergence of clone ST217 is reported for the first time in India. PMID:26110062

  6. Role of the non-opioid dynorphin peptide des-Tyr-dynorphin (DYN-A2-17) in food intake and physical activity, and its interaction with orexin-A.

    Gac, L; Butterick, T A; Duffy, C M; Teske, J A; Perez-Leighton, C E

    2016-02-01

    Food intake and physical activity are regulated by multiple neuropeptides, including orexin and dynorphin (DYN). Orexin-A (OXA) is one of two orexin peptides with robust roles in regulation of food intake and spontaneous physical activity (SPA). DYN collectively refers to several peptides, some of which act through opioid receptors (opioid DYN) and some whose biological effects are not mediated by opioid receptors (non-opioid DYN). While opioid DYN is known to increase food intake, the effects of non-opioid DYN peptides on food intake and SPA are unknown. Neurons that co-express and release OXA and DYN are located within the lateral hypothalamus. Limited evidence suggests that OXA and opioid DYN peptides can interact to modulate some aspects of behaviors classically related to orexin peptide function. The paraventricular hypothalamic nucleus (PVN) is a brain area where OXA and DYN peptides might interact to modulate food intake and SPA. We demonstrate that injection of des-Tyr-dynorphin (DYN-A2-17, a non opioid DYN peptide) into the PVN increases food intake and SPA in adult mice. Co-injection of DYN-A2-17 and OXA in the PVN further increases food intake compared to DYN-A2-17 or OXA alone. This is the first report describing the effects of non-opioid DYN-A2-17 on food intake and SPA, and suggests that DYN-A2-17 interacts with OXA in the PVN to modulate food intake. Our data suggest a novel function for non-opioid DYN-A2-17 on food intake, supporting the concept that some behavioral effects of the orexin neurons result from combined actions of the orexin and DYN peptides. PMID:26654796

  7. Hydrogen decrepitation as a method of powder preparation of a 2:17-type, Sm(Co, Cu, Fe, Zr)sub(8.92) magnetic alloy

    The present work has shown that hydrogen decrepitation of a 2:17-type Sm(Cosub(0.673)Cusub(0.080)Fesub(0.222)Zrsub(0.025))sub(8.92) alloy is a very rapid and convenient means of producing powdered material for the production of polymer-bonded permanent magnets. The magnets made from the hydrogen decrepitated powder (average particle size approx. 100 μm) exhibited improved demagnetization loop shapes, higher intrinsic coercivities and improved elevated temperature stability when compared with the magnets produced from the standard milled powder material (average particle size approx. 40 μm). These differences in properties have been related to the differences in the character of the powders produced by the two methods of decrepitation. (author)

  8. All-solid-state continuous-wave frequency doubling Nd:LuVO4/LBO laser with 2.17 W output power at 543 nm

    Li, B.; Zhao, L.; Zhang, Y. B.; Zheng, Q.; Zhao, Y.; Yao, Y.

    2013-03-01

    Efficient and compact green-yellow laser output at 543 nm is generated by intracavity frequency doubling of a CW diode-pumped Nd:LuVO4 laser at 1086 nm under the condition of suppressing the higher gain transition near 1064 nm. With 16 W of diode pump power and the frequency-doubling crystal LBO, as high as 2.17 W of CW output power at 543 nm is achieved, corresponding to an optical-to-optical conversion efficiency of 13.6% and the output power stability over 8 hours is better than 2.86%. To the best of our knowledge, this is the highest watt-level laser at 543 nm generated by intracavity frequency doubling of a diode pumped Nd:LuVO4 laser at 1086 nm.

  9. A representation of the Sm-Co-Zr-Cu-Fe quinary system: a tool for optimisation of 2/17 permanent magnets

    In order to optimise the elaboration process of Sm2Co17 type magnets, the boundary of the single-phase domain at 1150 C and of the two-phase domain involving the 1/5 and the 2/17 at 850 C must be known. The knowledge of solid-liquid equilibria is also needed in order to avoid formation of other phases during sintering. It was then necessary to investigate phase equilibria in the Sm-Co-Zr-Cu-Fe system. However, since the variability of a such system under isobaric and isothermal conditions is four, the classic graphical representation can not be used. The presented part of the work concerns the region of interest near 1150 C. A specific approach of the quinary system is developed. It starts from the Sm-Co binary system, then the Sm-Co-Zr ternary system has been investigated: 1150 C isothermal section has been drawn for high Co contents and special attention has been paid to in the structural modification induced by Zr addition. Based on our knowledge of the ternary system, the Sm-Co-Zr-Cu quaternary one has been studied; an isothermal section has been drawn for a Cu concentration of 4 at.%. Finally a representation of the 1150 C single-phase domain in the quinary system Sm-Co-Zr-Cu-Fe is proposed. For this purpose, a method consisting of a two-dimensional projection of the domain coupled with a three-dimensional one is applied. This representation makes possible to predict if a quinary alloy is single-phased at 1150 C or not. Magnetic behaviour of alloys is shown. This easy to read, easy to use representation appears a good tool to optimise the 2/17-type permanent magnets. (orig.)

  10. Malachi’s concern for social justice: Malachi 2:17 and 3:5 and its ethical imperatives for faith communities

    Blessing O. Bọlọjẹ

    2014-02-01

    Full Text Available Any time humans in any culture consider primary ethical concepts, justice will be to the fore. Much seems to hinge upon it whether human society is to function with any semblance of civil order, security and harmony. When justice is pervasively trampled upon, the very fabric of liveable society crumbles. The apprehension for justice is clearly reflected in almost all of the Old Testament (OT. It is an important theological motif in the OT. This is found in such OT literature as historical, legal, prophetic and wisdom writings. This evidence thus reveals that the apprehension for the issue of justice was one of the many ways by which Israel’s multifaceted social life was knit together throughout its various ancient historical developments. No aspect of the life of Israel was excluded from this kind of apprehension for justice, and Yahweh was understood to be actively involved in its entire phase. This article examines Malachi’s fourth disputation in the light of the lawlessness alluded to in Malachi 2:17 and the corruption of personal and civil morality in Malachi 3:5. In the discussions that follow, this article examines the need for the justice of Yahweh; that is, Yahweh’s righting of past wrongs and the reversal of sinful societal order. The purpose is to enact a communal ethic for those who generously care for the neighbourhood and are firm in their devotion to Him, that is, God.

  11. Regulatory Assistance, Stakeholder Outreach, and Coastal and Marine Spatial Planning Activities In Support Marine and Hydrokinetic Energy Deployment: Task 2.1.7 Permitting and Planning Fiscal Year 2012 Year-End Report

    Geerlofs, Simon H.; Hanna, Luke A.; Judd, Chaeli R.; Blake, Kara M.

    2012-09-01

    This fiscal year 2012 year-end report summarizes activities carried out under DOE Water Power task 2.1.7, Permitting and Planning. Activities under Task 2.1.7 address the concerns of a wide range of stakeholders with an interest in the development of the MHK industry, including regulatory and resource management agencies, tribes, NGOs, and industry. Objectives for 2.1.7 are the following: • To work with stakeholders to streamline the MHK regulatory permitting process. • To work with stakeholders to gather information on needs and priorities for environmental assessment of MHK development. • To communicate research findings and directions to the MHK industry and stakeholders. • To engage in spatial planning processes in order to further the development of the MHK industry. These objectives are met through three subtasks, each of which are described in this report: • 2.1.7.1—Regulatory Assistance • 2.1.7.2—Stakeholder Outreach • 2.1.7.3—Coastal and Marine Spatial Planning As the MHK industry works with the regulatory community and stakeholders to plan, site, permit and license MHK technologies they have an interest in a predictable, efficient, and transparent process. Stakeholders and regulators have an interest in processes that result in sustainable use of ocean space with minimal effects to existing ocean users. Both stakeholders and regulators have an interest in avoiding legal challenges by meeting the intent of federal, state, and local laws that govern siting and operation of MHK technologies. The intention of work under 2.1.7 is to understand these varied interests, explore mechanisms to reduce conflict, identify efficiencies, and ultimately identify pathways to reduce the regulatory costs, time, and potential environmental impacts associated with developing, siting, permitting, and deploying MHK systems.

  12. IUPAC critical evaluation of the rotational–vibrational spectra of water vapor. Part IV. Energy levels and transition wavenumbers for D216O, D217O, and D218O

    This paper is the fourth of a series of papers reporting critically evaluated rotational–vibrational line positions, transition intensities, pressure dependences, and energy levels, with associated critically reviewed assignments and uncertainties, for all the main isotopologues of water. This paper presents energy level and transition data for the following doubly and triply substituted isotopologues of water: D216O, D217O, and D218O. The MARVEL (Measured Active Rotational–Vibrational Energy Levels) procedure is used to determine the levels, the lines, and their self-consistent uncertainties for the spectral regions 0–14 016, 0–7969, and 0–9108 cm−1 for D216O, D217O, and D218O, respectively. For D216O, D217O, and D218O, 53 534, 600, and 12 167 lines are considered, respectively, from spectra recorded in absorption at room temperature and in emission at elevated temperatures. The number of validated energy levels is 12 269, 338, and 3351 for D216O, D217O, and D218O, respectively. The energy levels have been checked against the ones determined, with an average accuracy of about 0.03 cm−1, from variational rovibrational computations employing exact kinetic energy operators and an accurate potential energy surface. Furthermore, the rovibrational labels of the energy levels have been validated by an analysis of the computed wavefunctions using the rigid-rotor decomposition (RRD) scheme. The extensive list of MARVEL lines and levels obtained is deposited in the Supplementary Material of this paper, in a distributed information system applied to water, W@DIS, and on the official MARVEL website, where they can easily be retrieved. - Highlights: • All published transitions are collected and analyzed. • A set of validated rovibrational transitions are presented. • Experimental energy levels for all three D2O isotopologues are determined. • Synthetic spectra are presented using these validated energy levels

  13. Analysis of 217 Strains Bacteria and their Drug Susceptibility from Hospitalized Children with Lower Respiratory Tract Infections%儿童下呼吸道感染217株细菌分析及药物敏感趋势监测

    方敏; 何邱宁

    2012-01-01

    目的:了解儿童下呼吸道感染致病菌的流行趋势和药物敏感性,为临床合理用药提供依据.方法:对2010年3月1日~2011年8月31日在我科住院的下呼吸道感染患儿痰液标本中分离出的病原菌进行药物敏感性监测分析.结果:共分离出217株病原菌.G-杆菌以大肠埃希菌(28.11%)、解鸟氨酸克雷伯菌(7.37%)、洛菲不动杆菌(6.91%)为主;G+菌以腐生葡萄球菌(9.68%)、表皮葡萄球菌(6.45%)、金黄色葡萄球菌(3.69%)为主.G-杆菌对第三代头孢菌素中的头孢他啶、头孢吡肟、氨曲南、亚胺培南、哌拉西林/他唑巴坦、头孢哌酮/舒巴坦、阿米卡星等抗生素敏感性高;G+球菌对青霉素、红霉素、克林霉素及阿奇霉素耐药率高,对其他抗生素敏感.超广谱β-内酰胺酶(ESBLs)的确证试验结果:61株大肠埃希菌产酶率55.74%;21株腐生葡萄球菌、耐甲氧西林凝固酶阴性葡萄球菌(MRSCN)产酶率9.52%,14株表皮葡萄球菌MRSCN的产酶率7.14%;5株屎肠球菌高水平氨基糖苷类耐药株( HLAR)40.00%,4株粪肠球菌HLAR为25.00%.结论:加强细菌培养和耐药性监测对临床合理使用抗生素十分必要.%Objective;To investigate the trend of lower respiratory tract infections in children and drug susceptibility to provide basis for reasonable use of drugs in clinical practice. Methods; A total of 217 strains of bacteria were isolated from sputum specimen of children who were hospitalized with lower respiratory tract infections form March 2010 to August 2011 in our hospital. The bacteria were cultured with blood dish and identified. Drug susceptibility was monitored. Results; 217 strains of bacteria were isolated. The first three places of Cram-negative bacilli were Escherichia coli (28. 11%), Klebsiella omithinolytica (7.37%) and Acinetobacter lwoffi (6.91%). The first three places of Cram-positive cocci were S. saprophyticus (9. 68% ) , S. epidermidis (6

  14. Molecular dynamics simulation and free energy landscape methods in probing L215H, L217R and L225M βI-tubulin mutations causing paclitaxel resistance in cancer cells.

    Tripathi, Shubhandra; Srivastava, Gaurava; Sharma, Ashok

    2016-08-01

    Drug resistance poses a threatening challenge for mankind, as the development of resistance to already well-established drugs causes serious therapeutic problems. Resistance to paclitaxel (Ptxl), a complex diterpenoid working as microtubule stabilizer, is one such issue in cancer treatment. Microtubule stabilizer drugs, stabilises microtubules upon binding to β-tubulin subunit of tubulin heterodimer thus causing mitotic arrest leading to death of cancer cell. Leucine point mutations viz. L215H, L217R, and L225M were reported for Ptxl resistance in various cancers. In the current study, molecular mechanism of these resistance causing mutations was explored using molecular docking, molecular dynamics (MD) simulation, binding energy estimation (MMPBSA), free energy decomposition, principle component analysis (PCA) and free energy landscape (FEL) methods. A total of five systems including unbound βI-tubulin (Apo), docked wild+Ptxl, L215H+Ptxl, L217R+Ptxl and L225M+Ptxl were prepared, and 50 ns MD simulation was performed for each system. Binding energy estimation indicated that leucine mutation reduces the binding affinity of Ptxl in mutant types (MTs) as compared to wild type (WT). Further, in contrast to WT Ptxl interactions with the M-loop (PHE270-VAL286), S6-S7 loop and H9-H10 were significantly altered in MTs. Results showed that in MTs, Ptxl had weak interaction with M-loop residues, while having strong affinity with S6-S7 loop and H6-H7 loop. Moreover, PCA and FEL analysis revealed that M-loop flexible region (THR274-LEU284) was strongly bound with Ptxl in WT preventing its flexible movement and the causing factor for microtubule stabilization. In MTs due to poor interaction with Ptxl, M-loop flexible region retains its flexibility, therefore unable to stabilize microtubule. This study will give an insight into the importance of M-loop flexible region interaction with Ptxl for microtubule stabilization. In addition, it clearly provides the molecular basis of

  15. 76 FR 16526 - Airworthiness Directives; Pratt & Whitney JT8D-209, -217, -217A, -217C, and -219 Series Turbofan...

    2011-03-24

    .../stage 4 LPT turbine blades shroud wear and subsequent high-cycle fatigue. They suggested that the... stage and 4th stage low- pressure turbine (LPT) blades for shroud notch wear and replacement of the... prevent turbine blade failures that could result in uncontained engine debris and damage to the...

  16. Radium-228 analysis of natural waters by Cherenkov counting of Actinium-228

    The activities of 228Ra in natural waters were determined by the Cherenkov counting of the daughter nuclide 228Ac. The radium was pre-concentrated on MnO2 and the radium purified via ion exchange and, after a 2-day period of incubation to allow for secular equilibrium between the parent-daughter 228Ra(228Ac), the daughter nuclide 228Ac was isolated by ion exchange according to the method of Nour et al. [2004. Radium-228 determination of natural waters via concentration on manganese dioxide and separation using Diphonix ion exchange resin. Appl. Radiat. Isot. 61, 1173-1178]. The Cherenkov photons produced by 228Ac were counted directly without the addition of any scintillation reagents. The optimum Cherenkov counting window, sample volume, and vial type were determined experimentally to achieve optimum Cherenkov photon detection efficiency and lowest background count rates. An optimum detection efficiency of 10.9±0.1% was measured for 228Ac by Cherenkov counting with a very low Cherenkov photon background of 0.317±0.013 cpm. The addition of sodium salicylate into the sample counting vial at a concentration of 0.1 g/mL yielded a more than 3-fold increase in the Cherenkov detection efficiency of 228Ac to 38%. Tests of the Cherenkov counting technique were conducted with several water standards of known activity and the results obtained compared closely with a conventional liquid scintillation counting technique. The advantages and disadvantages of Cherenkov counting compared to liquid scintillation counting methods are discussed. Advantages include much lower Cherenkov background count rates and consequently lower minimal detectable activities for 228Ra and no need for expensive environmentally unfriendly liquid scintillation cocktails. The disadvantages of the Cherenkov counting method include the need to measure 228Ac Cherenkov photon detection efficiency and optimum Cherenkov counting volume, which are not at all required when liquid scintillation analysis is used

  17. Linear free energy relationship applied to trivalent cations with lanthanum and actinium oxide and hydroxide structure

    Linear free energy relationships for trivalent cations with crystalline M2O3 and, M(OH)3 phases of lanthanides and actinides were developed from known thermodynamic properties of the aqueous trivalent cations, modifying the Sverjensky and Molling equation. The linear free energy relationship for trivalent cations is as ΔGf,MvX0=aMvXΔGn,M3+0+bMvX+βMvXrM3+, where the coefficients aMvX, bMvX, and βMvX characterize a particular structural family of MvX, rM3+ is the ionic radius of M3+ cation, ΔGf,MvX0 is the standard Gibbs free energy of formation of MvX and ΔGn,M3+0 is the standard non-solvation free energy of the cation. The coefficients for the oxide family are: aMvX=0.2705, bMvX=-1984.75 (kJ/mol), and βMvX=197.24 (kJ/molnm). The coefficients for the hydroxide family are: aMvX=0.1587, bMvX=-1474.09 (kJ/mol), and βMvX=791.70 (kJ/molnm).

  18. Actinium: A RESTful Runtime Container for Scriptable Internet of Things Applications

    Kovatsch, Matthias; Lanter, Martin; Duquennoy, Simon

    2012-01-01

    Programming Internet of Things (IoT) applications is challenging because developers have to be knowledgeable in various technical domains, from low-power networking, over embedded operating systems, to distributed algorithms. Hence, it will be challenging to find enough experts to provide software for the vast number of expected devices, which must also be scalable and particularly safe due to the connection to the physical world. To remedy this situation, we propose an architecture that pr...

  19. Reflection asymmetry in odd-A and odd-odd actinium nuclei

    Theoretical calculations and measurements indicate that octupole correlations are at a maximum in the ground states of the odd-proton nuclei Ac and Pa. It has been expected that odd-odd nuclei should have even larger amount of octupole-octupole correlations. We have recently made measurements on the structure of 224Ac. Although spin and parity assignments could not be made, two bands starting at 354.1 and 360.0 keV have properties characteristic of reflection asymmetric shape. These two bands have very similar rotational constants and also similar alpha decay rates, which suggest similarity between the wavefunctions of these bands. These signatures provide evidence for octupole correlations in these nuclides

  20. Bestimmung der Ionisationsenergie von Actinium und Ultraspurenanalyse von Plutonium mit resonanter Ionisationsmassenspektrometrie (RIMS)

    Waldek, Achim Marcus

    2001-01-01

    ZusammenfassungDie Resonanzionisationsmassenspektrometrie (RIMS) verbindet hohe Elementselektivität mit guter Nachweiseffizienz. Aufgrund dieser Eigenschaften ist die Methode für Ultraspurenanalyse und Untersuchungen an seltenen oder schwer handhabbaren Elementen gut geeignet. Für RIMS werden neutrale Atome mit monochromatischem Laserlicht ein- oder mehrfach resonant auf energetisch hoch liegende Niveaus angeregt und anschließend durch einen weiteren Laserstrahl oder durch ein elektrisches Fe...

  1. Synthesis of chelating agents for actinium 225 complexation and its application in radioimmunotherapy

    Immunotherapy with radiolabeled antibodies should allow fairly specific targeting of certain cancers. However, iodine 131 may not be the best isotope for tumor therapy because of its limited specific activity, low beta-energy, relatively long half life and strong gamma emission. Another approach to improve therapeutic efficacy is the use of replacement isotopes with better physical properties. Chelator that can hold radio-metals with high stability under physiological conditions are essential to avoid excessive damage to non-target cells; Moreover, the development of new bifunctional chelating agents is essential for this purpose. Accordingly, our efforts have been directed, for several years, to the synthesis of original chelating agents likely to form stable complexes in vivo with the numerous potential candidates for such applications. Therefore, we have developed a new simple and efficient synthesis pathway of 2-(4-iso-thio-cyanate-benzyl)-1,4,7,10,13,16- hexa-aza-cyclo-hexadecane- 1,4,7,10,13,16-hexa-acetic acid, though functionalized on the cycle by a termination allowed coupling to an antibody or any other biological substance such as a hapten. (author)

  2. Purification of selenium from thorium, uranium, radium, actinium and potassium impurities for low background measurements

    A technique of selenium purification from 232Th, 238U, 226,228Ra, 227Ac and 40K was developed. This technique is simple to perform and employs a minimum number of highly pure reagents (bidistilled water, nitric acid). Operations carried out during purification (elution, evaporation) practically exclude losses of the target product (chemical yields of Se > 99%). A test purification of 100 g of selenium was carried out using this technique. The efficiency of this technique was confirmed by low background gamma spectrometry of the purified selenium sample. Distribution coefficients of Th, U, Ra and Ac on DOWEX 50W- x 8 cation-exchange resin at different concentrations of selenium and nitric acid were experimentally determinated. Instrumental neutron activation analysis of bidistilled water, deionized water and nitric acid was performed. (orig.)

  3. Purification of selenium from thorium, uranium, radium, actinium and potassium impurities for low background measurements

    Rakhimov, A.V. [Joint Institute for Nuclear Research (JINR), Dubna (Russian Federation); Uzbek Academy of Sciences, Tashkent (Uzbekistan). Inst. of Nuclear Physics (INP AS RUz); Warot, G. [CEA-CNRS, Modane (France). Laboratoire Souterrain de Modane (LSM); Karaivanov, D.V. [Joint Institute for Nuclear Research (JINR), Dubna (Russian Federation); Institute for Nuclear Research and Nuclear Energy (INRNE), Sofia (Bulgaria); Kochetov, O.I.; Lebedev, N.A.; Filosofov, D.V. [Joint Institute for Nuclear Research (JINR), Dubna (Russian Federation); Mukhamedshina, N.M.; Sadikov, I.I. [Uzbek Academy of Sciences, Tashkent (Uzbekistan). Inst. of Nuclear Physics (INP AS RUz)

    2013-07-01

    A technique of selenium purification from {sup 232}Th, {sup 238}U, {sup 226,228}Ra, {sup 227}Ac and {sup 40}K was developed. This technique is simple to perform and employs a minimum number of highly pure reagents (bidistilled water, nitric acid). Operations carried out during purification (elution, evaporation) practically exclude losses of the target product (chemical yields of Se > 99%). A test purification of 100 g of selenium was carried out using this technique. The efficiency of this technique was confirmed by low background gamma spectrometry of the purified selenium sample. Distribution coefficients of Th, U, Ra and Ac on DOWEX 50W- x 8 cation-exchange resin at different concentrations of selenium and nitric acid were experimentally determinated. Instrumental neutron activation analysis of bidistilled water, deionized water and nitric acid was performed. (orig.)

  4. New method for large scale production of medically applicable Actinium-225 and Radium-223

    Alpha-emitters (211At, 212Bi, 213Bi, 223Ra, 225Ac) are promising for targeted radiotherapy of cancer. Only two alpha decays near a cell membrane result in 50% death of cancer cell and only a single decay inside the cell is required for this. 225Ac may be used either directly or as a mother radionuclide in 213Bi isotope generator. Production of 225Ac is provided by three main suppliers - Institute for Transuranium Elements in Germany, Oak Ridge National Laboratory in USA and Institute of Physics and Power Engineering in Obninsk, Russia. The current worldwide production of 225Ac is approximately 1.7 Ci per year that corresponds to only 100-200 patients that could be treated annually. The common approach for 225Ac production is separation from mother 229Th or irradiation of 226Ra with protons in a cyclotron. Both the methods have some practical limitations to be applied routinely. 225Ac can be also produced by irradiation of natural thorium with medium energy protons . Cumulative cross sections of 225Ac, 227Ac, 227Th, 228Th formations have been obtained recently. Thorium targets (1-9 g) were irradiated by 114-91 MeV proton beam (1-50 μA) at INR linear accelerator. After dissolution in 8 M HNO3 + 0.004 M HF thorium was removed by double LLX by HDEHP in toluene (1:1). Ac and REE were pre-concentrated and separated from Ra and most fission products by DGA-Resin (Triskem). After washing out by 0.01 M HNO3 Ac was separated from REE by TRU Resin (Triskem) in 3 M HNO3 media. About 6 mCi 225Ac were separated in hot cell with chemical yield 85%. The method may be upscaled for production of Ci amounts of the radionuclide. The main impurity is 227Ac (0.1% at the EOB) but it does not hinder 225Ac from being used for medical 225Ac/213Bi generators. (author)

  5. 22 CFR 217.47 - Nonacademic services.

    2010-04-01

    ... services. (a) Physical education and athletics. (1) In providing physical education courses and athletics... or that operates or sponsors intercollegiate, club, or intramural athletics shall provide...

  6. 22 CFR 217.13 - Employment criteria.

    2010-04-01

    ..., the test results accurately reflect the applicant's or employee's job skills, aptitude, or whatever... criteria. (a) A recipient may not make use of any employment test or other selection criterion that screens... test score or other selection criterion, as used by the recipient, is shown to be job-related for...

  7. 49 CFR 212.217 - Car inspector.

    2010-10-01

    ... (ii) The Freight Car Safety Standards (49 CFR part 215), Safety Glazing Standards (49 CFR part 223), Safety Appliance Standards (49 CFR part 231) and Power Brake Standards (49 CFR part 232); (3) The... Safety Standards (49 CFR part 215), Safety Glazing Standards (49 CFR part 223), Safety...

  8. 14 CFR 16.217 - Witnesses.

    2010-01-01

    ... may designate as a witness any person who is able and willing to give testimony that is relevant and... witness has no right to examine the witness or otherwise participate in the development of testimony. ... section. (b) The hearing officer may exclude testimony of witnesses that would be irrelevant,...

  9. 50 CFR 217.204 - Mitigation.

    2010-10-01

    ... SPECIFIED ACTIVITIES Taking Of Marine Mammals Incidental To The Port of Anchorage Marine Terminal... cease and vessels will reduce to the slowest speed practicable while still maintaining control of...

  10. 48 CFR 217.7302 - Procedures.

    2010-10-01

    ... paragraph (a) of this section does not apply to contracts that are— (1) For commercial items; or (2) Valued... OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Identification...

  11. 36 CFR 21.7 - Health examinations.

    2010-07-01

    ... required by the Superintendent, and being found free from any infectious or communicable disease. Cross Reference: For a list of communicable diseases included in the regulations of the United States Public Health Service, see 21 CFR 1240.54....

  12. 22 CFR 217.3 - Definitions.

    2010-04-01

    ..., muscular dystrophy, multiple sclerosis, cancer, heart disease, diabetes, mental retardation, emotional... mental impairment which substantially limits one or more major life activities, (ii) has a record of such... this section the phrase: (i) Physical or mental impairment includes but is not limited to such...

  13. Purification of radium-226 for the manufacturing of actinium-225 in a cyclotron for alpha-immunotherapy; Radium-Aufreinigung zur Herstellung von Actinium-225 am Zyklotron fuer die Alpha-Immuntherapie

    Marx, Sebastian Markus

    2014-09-23

    The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.

  14. Distribution of trace elements in land plants and botanical taxonomy with special reference to rare earth elements and actinium

    Distribution profiles of trace elements in land plants were studied by neutron activation analysis and radioactivity measurements without activation. Number of botanical samples analyzed were more than three thousand in which more than three hundred botanical species were included. New accumulator plants of Co, Cr, Zn, Cd, rare earth elements, Ac, U, etc., were found. Capabilities of accumulating trace elements can be related to the botanical taxonomy. Discussions are given from view points of inorganic chemistry as well as from botanical physiology

  15. Purification of radium-226 for the manufacturing of actinium-225 in a cyclotron for alpha-immunotherapy

    The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.

  16. Renal uptake of bismuth-213 and its contribution to kidney radiation dose following administration of actinium-225-labeled antibody

    Schwartz, J; O' Donoghue, J A; Humm, J L [Department of Medical Physics, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); Jaggi, J S [Bristol-Myers Squibb, Plainsboro, NJ (United States); Ruan, S; Larson, S M [Nuclear Medicine Service Department of Radiology, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); McDevitt, M; Scheinberg, D A, E-mail: schwarj1@mskcc.org [Molecular Pharmacology and Chemistry, Sloan-Kettering Institute, 1275 York Avenue, New York, NY 10065 (United States)

    2011-02-07

    Clinical therapeutic studies using {sup 225}Ac-labeled antibodies have begun. Of major concern is renal toxicity that may result from the three alpha-emitting progeny generated following the decay of {sup 225}Ac. The purpose of this study was to determine the amount of {sup 225}Ac and non-equilibrium progeny in the mouse kidney after the injection of {sup 225}Ac-huM195 antibody and examine the dosimetric consequences. Groups of mice were sacrificed at 24, 96 and 144 h after injection with {sup 225}Ac-huM195 antibody and kidneys excised. One kidney was used for gamma ray spectroscopic measurements by a high-purity germanium (HPGe) detector. The second kidney was used to generate frozen tissue sections which were examined by digital autoradiography (DAR). Two measurements were performed on each kidney specimen: (1) immediately post-resection and (2) after sufficient time for any non-equilibrium excess {sup 213}Bi to decay completely. Comparison of these measurements enabled estimation of the amount of excess {sup 213}Bi reaching the kidney ({gamma}-ray spectroscopy) and its sub-regional distribution (DAR). The average absorbed dose to whole kidney, determined by spectroscopy, was 0.77 (SD 0.21) Gy kBq{sup -1}, of which 0.46 (SD 0.16) Gy kBq{sup -1} (i.e. 60%) was due to non-equilibrium excess {sup 213}Bi. The relative contributions to renal cortex and medulla were determined by DAR. The estimated dose to the cortex from non-equilibrium excess {sup 213}Bi (0.31 (SD 0.11) Gy kBq{sup -1}) represented {approx}46% of the total. For the medulla the dose contribution from excess {sup 213}Bi (0.81 (SD 0.28) Gy kBq{sup -1}) was {approx}80% of the total. Based on these estimates, for human patients we project a kidney-absorbed dose of 0.28 Gy MBq{sup -1} following administration of {sup 225}Ac-huM195 with non-equilibrium excess {sup 213}Bi responsible for approximately 60% of the total. Methods to reduce renal accumulation of radioactive progeny appear to be necessary for the success of {sup 225}Ac radioimmunotherapy.

  17. Big Desire Equal to No Desire:Chuang-tzu's Thoughts in Passage 217 of Tsurezuregus%《徒然草》第二百十七段中的《庄子》思想——以“大欲与无欲相似”为视点

    陈秉珊

    2012-01-01

    The process of a rich man's acquisition of wealth is narrated in Passage 217 of Tsurezuregus. According to the millionaire, accumulation of wealth is the most important thing in one's life, and one should practice spiritual asceticism for the good of one's wealth. Anyhow, this point of view is opposed by Kenk6, who insists that a big amount of wealth accumulated by suppressing one's desire is nothing better than no wealth at all ;therefore, wealth is nothing better than poverty in the rich man's case. The author of this article believes that Kenk's comment on wealth and desire has relevance to the thoughts in Chuang-tzu.%《徒然草》第二百十七段中某大富翁认为,人生最重要的就是不断积累财富,为积蓄财富,就要禁锢一切欲望,进行精神上的修行。对此,兼好提出异议,认为通过禁止任何欲望积累钱财,还不如一开始就没有钱财的好。按大富翁的逻辑,贫富将无区别,大欲与无欲相似。该段与《庄子》思想有较强的关联性。

  18. Alkaline earth-gold-aluminides. Synthesis and structure of SrAu{sub 3}Al{sub 2}, SrAu{sub 2.83}Al{sub 2.17}, BaAu{sub 2.89}Al{sub 2.11} and BaAu{sub 7.09}Al{sub 5.91}

    Gerke, Birgit; Poettgen, Rainer [Muenster Univ. (Germany). Inst. fuer Anorganische und Analytische Chemie

    2015-07-01

    New alkaline earth-gold-aluminides were synthesized from the elements in sealed tantalum or quartz ampoules in muffle furnaces at maximum annealing temperatures of 1325 K. The structures were refined from single crystal X-ray diffractometer data. SrAu{sub 3}Al{sub 2} crystallizes in an ordered version of the LT-SrZn{sub 5} structure: Pnma, a = 1315.9(3), b = 549.0(1), c = 684.5(3) pm, wR2 = 0.0232, 930 F{sup 2} values, 35 variables. SrAu{sub 2.83}Al{sub 2.17} (a = 1065.0(2), b = 845.0(2), c = 548.1(1) pm, wR2 = 0.0416, 452 F{sup 2} values, 22 variables) and BaAu{sub 2.89}Al{sub 2.11} (a = 1096.1(3), b = 835.7(3), c = 554.0(1) pm, wR2 = 0.0280, 501 F{sup 2} values, 22 variables) both adopt the BaZn{sub 5} type, space group Cmcm with Au/Al mixing on the 4c site. The gold and aluminum atoms in both types form three-dimensional networks of condensed tetrahedra with the strontium and barium atoms in large cavities. BaAu{sub 7.09}Al{sub 5.91} is a new member of the NaZn{sub 13} type: Fm anti 3c, a = 1257.6(2) pm, wR2 = 0.0267, 168 F{sup 2} values, 12 variables. Both the 96i and 8b sites show Au/Al mixing. The crystal chemical details are discussed.

  19. 29 CFR 778.217 - Reimbursement for expenses.

    2010-07-01

    .... (2) The actual or reasonably approximate amount expended by an employee in purchasing, laundering or... expenses, such as taxicab fares, incurred while traveling on the employer's business. (4) “Supper money”,...

  20. 48 CFR 217.171 - Multiyear contracts for services.

    2010-10-01

    ... services that include— (i) An unfunded contingent liability in excess of $20 million (Section 8008(a) of... contingent liabilities for the assembly, training, or transportation of a specialized work force; and...

  1. 22 CFR 217.43 - Treatment of students; general.

    2010-04-01

    ... aid, physical education, athletics, recreation, transportation, other extracurricular, or other postsecondary education aid, benefits, or services to which this subpart applies. (b) A recipient to which this... HANDICAP IN PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Postsecondary Education §...

  2. 49 CFR 234.217 - Flashing light units.

    2010-10-01

    ..., DEPARTMENT OF TRANSPORTATION GRADE CROSSING SIGNAL SYSTEM SAFETY AND STATE ACTION PLANS Maintenance... interior of the unit. Roundels and reflectors shall be clean and in good condition. (c) All light...

  3. Dicty_cDB: VSF217 [Dicty_cDB

    Full Text Available GWEMPVQYPAGVMKEHLHV RKESGLFDVSHMGQLRIHGKDRVKFFESIVVADLQALPTGHSKLSVFTNEKGGIIDDTMI TNAGDSLYVVVNAGCADKDISHINE...HLHV RKESGLFDVSHMGQLRIHGKDRVKFFESIVVADLQALPTGHSKLSVFTNEKGGIIDDTMI TNAGDSLYVVVNAGCADKDISHINEKIKEFKSVNPTHDVSMQ

  4. 7 CFR 2.17 - Under Secretary for Rural Development.

    2010-01-01

    ..., and Deposit Insurance Protection Act of 1996, Subtitle E of Public Law No. 104-208. (24)-(25) (26... joint regulations issued pursuant thereto by the Attorney General and the Comptroller General (4 CFR..., exercise the functions delegated to the Secretary by Executive Order 12580, 3 CFR, 1987 Comp., p....

  5. Dicty_cDB: CHQ217 [Dicty_cDB

    Full Text Available yvsrw*lyhg*wyww*inlr*qic**klqiktfr srytlngqrwcqhqwftilylccsn*lvrr*trcirfch*rygcr*kdgscwftir*nyq tsrhcqlwstlnyqhiafl**liri...fl**lirikrxiqfff Translated Amino Acid sequence (All Frames) Frame A: t*nn*k*qllnqppqkthvssli...n mRNA, ... 253 1e-65 EU126917_1( EU126917 |pid:none) Gerbera hybrid cultivar cyclophili...-65 AF020434_1( AF020434 |pid:none) Arabidopsis thaliana cyclophilin (... 250 5e-65 AF126551_1( AF126551 |pi...*wyww*inlr*qic**klqiktfr srytlngqrwcqhqwftilylccsn*lvrr*trcirfch*rygcr*kdgscwftir*nyq tsrhcqlwstlnyqhia

  6. 29 CFR 1910.217 - Mechanical power presses.

    2010-07-01

    ... cylinders shall incorporate means to retain the piston and rod in case of breakage or loosening. (iv) Air... dependent upon spring action, the spring(s) shall be of the compression type, operating on a rod or guided..., operating on a rod or guided within a hole or tube, or designed to prevent interleaving of spring coils...

  7. Dicty_cDB: SHH217 [Dicty_cDB

    Full Text Available 16 3 BM056853 |BM056853.1 2154-85 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides feli...9 hindgut and Malpighian tubule subtracted cDNA library Ctenocephalides felis cDN...2018A03 5', mRNA sequence. 88 6e-14 2 BM058578 |BM058578.1 2193-94 hindgut and Malpighian tubule subtracted cDNA library Ctenocephali...des felis cDNA clone 2193-94, mRNA sequence. 90 1e-13 1 BM058379 |BM058379.1 2191-2

  8. Dicty_cDB: VFB217 [Dicty_cDB

    Full Text Available ', mRNA sequence. 68 3e-07 1 BE459798 |BE459798.1 EST415090 tomato developing/immature green fruit Lycopersico...c, DNA sequence. 66 1e-12 2 BI921109 |BI921109.1 EST541012 tomato callus Lycopersicon esculentum... 1 AI771812 |AI771812.1 EST252912 tomato ovary, TAMU Lycopersicon esculentum cDNA clone cLED38E1, mRNA seque...nce. 68 3e-07 1 AW932476 |AW932476.1 EST358319 tomato fruit mature green, TAMU Lycopersicon esculentum cDNA ...clone cLEF48O8 5', mRNA sequence. 68 3e-07 1 AW033447 |AW033447.1 EST277018 tomato callus, TAMU Lyco

  9. 50 CFR 217.202 - Permissible methods of taking.

    2010-10-01

    ... leucas), harbor seals (Phoca vitulina), harbor porpoises (Phocoena phocoena), and killer whales (Orcinus orca). (c) The taking by injury or death of the species listed in paragraph (b) of this section or...

  10. 31 CFR 31.217 - Confidentiality of information.

    2010-07-01

    ... business days of detecting a violation of the prohibitions in paragraph (b), above. The security measures... insider trading, when the arrangement relates to the acquisition, valuation, management, or disposition...

  11. 78 FR 217 - Shared Responsibility for Employers Regarding Health Coverage

    2013-01-02

    ...)(2) as an employer that employed an average of at least 50 full-time employees on business days... FR 70644). Those HHS proposed regulations provide that the percentage of the total allowed cost of... taxpayer's social security benefits (as defined in section 86(d)) which is not included in gross...

  12. 50 CFR 216.217 - Requirements for monitoring and reporting.

    2010-10-01

    ..., and any other Federal, state or local agency with regulatory authority over the offshore oil-and-gas...) Acoustic surveys will be run concurrent with requisite pre-detonation surveys, beginning with the surface observations and concluding at the finish of the aerial surveys when the detonation(s) is allowed to...

  13. Dicty_cDB: CFD217 [Dicty_cDB

    Full Text Available kp*lvklspwkskvltt lkmlkpksqdkegippdqqrlifagkqledgrtlsdyniqkestlhlvlrlrggmqifvk tltgktitleg*r**YIEMSKPNXRQXRX...IKRVVCN XLLXLSLVKPSP*kskvvitlkmskpksktkkvfhqdqqrxifagkqledgrtlsdyniq kestlhlvlrlrggmqifvktltgktitlevegsdnien...vkakiqdkegippdqqrlifa gkqledgrtlsdyniqkestlhlvlrlrggmqifvktltgktitlevegsdnienvkaki qdkegippdqqrlifagkqledgrt...xxdyniqkestlpfsxqxkxvvtkfga Translated Amino Acid sequence (All Frames) Frame A: fty*limqifvktltgktitlevegsd...nienvkakiqdkegippdqqrlifagkqledgr tlsdyniqkestlhlvlrlrggmqifvktltgktitlevegsdnien

  14. 48 CFR 217.172 - Multiyear contracts for supplies.

    2010-10-01

    ... the agency shall submit to USD(C)(P/B) information supporting the agency's determination that this... supporting this certification to USD(C)(P/B) for transmission to Congress through the Secretary of...

  15. 50 CFR 217.205 - Requirements for monitoring and reporting.

    2010-10-01

    ... during all in-water pile driving operations but will continue monitoring one-year post in-water... of a Letter of Authorization shall submit a monthly report to NMFS' Headquarters Permits, Education... must notify the Director, Office of Protected Resources, NMFS, or designee, by e-mail or telephone...

  16. Dicty_cDB: VHO217 [Dicty_cDB

    Full Text Available ld acclimated flavedo & albedo cDNA library Citrus sinensis cDNA clone UCRCS01_05ca09, mRNA sequence. 56 8e-...one CR_CEa01K07, mRNA sequence. 56 8e-04 1 CB293061 |CB293061.1 UCRCS01_05ca09_g1 Washington Navel orange co

  17. Dicty_cDB: AFL217 [Dicty_cDB

    Full Text Available ranslated Amino Acid sequence llyky*ihilffyil*HFIKKKKKKKXKKXPFLKKK--- ---NVKPXFQDKGGFPPXQXRFISXVXN*xmxxlslipiskknxls...- ---NVKPXFQDKGGFPPXQXRFISXVXN*xmxxlslipiskknxlshlvxrlrggmqifv ktltgktitlevegsdnienvktkiqdkegippdqqrlifagkql

  18. 47 CFR 25.217 - Default service rules.

    2010-10-01

    ... with terrestrial wireless services shall comply with the requirements in § 25.203(c). (c)(1) For all... paragraph (c)(1) of this paragraph in frequency bands shared with terrestrial wireless services shall comply... licenses to operate a satellite system in a frequency band granted after a domestic frequency...

  19. 42 CFR 435.217 - Individuals receiving home and community-based services.

    2010-10-01

    ... 42 Public Health 4 2010-10-01 2010-10-01 false Individuals receiving home and community-based... receiving home and community-based services. The agency may provide Medicaid to any group or groups of individuals in the community who meet the following requirements: (a) The group would be eligible for...

  20. 37 CFR 1.217 - Publication of a redacted copy of an application.

    2010-07-01

    ... translation is accurate; (3) A marked-up copy of the application showing the redactions in brackets; and (4) A... brackets; and (ii) A copy of each submission previously filed by the applicant including any desired... material in brackets. (2) In addition to providing the submission required by paragraphs (c) and (d)(1)...

  1. Yeast Interacting Proteins Database: YHR114W, YDL217C [Yeast Interacting Proteins Database

    Full Text Available YHR114W BZZ1 SH3 domain protein implicated in the regulation of actin polymerization , able to re ... cruit actin polymerization ... machinery through its SH3 domains, colocalizes wit ... main protein implicated in the regulation of actin polymerization , able to recruit actin polymerization ... machinery th ...

  2. SU-E-T-217: Intrinsic Respiratory Gating in Small Animal CT

    Purpose: Preclinical animal models of lung cancer can provide a controlled test-bed for testing dose escalation or function-based-treatment-planning studies. However, to extract lung function, i.e. ventilation, one needs to be able to image the lung at different phases of ventilation (in-hale / ex-hale). Most respiratory-gated imaging using micro-CT involves using an external ventilator and surgical intervention limiting the utility in longitudinal studies. A new intrinsic respiratory retrospective gating method was developed and tested in mice. Methods: A fixed region of interest (ROI) that covers the diaphragm was selected on all projection images to estimate the mean intensity (M). The mean intensity depends on the projection angle and diaphragm position. A 3-point moving average (A) of consecutive M values: Mpre, Mcurrent and Mpost, was calculated to be subtracted from Mcurrent. A fixed threshold was used to enable amplitude based sorting into 4 different phases of respiration. Images at full-inhale and end-exhale phases of respiration were reconstructed using the open source OSCaR. Lung volumes estimated at the 2 phases of respiration were validated against literature values. Results: Intrinsic retrospective gating was accomplished without the use of any external breathing waveform. While projection images were acquired at 360 different angles. Only 138 and 104 projections were used to reconstruct images at full-inhale and end-exhale. This often results in non-uniform under-sampled angular projections leading to some minor streaking artifacts. The calculated expiratory, inspiratory and tidal lung volumes correlated well with the values known from the literature. Conclusion: Our initial result demonstrates an intrinsic gating method that is suitable for flat panel cone beam small animal CT systems. Reduction in streaking artifacts can be accomplished by oversampling the data or using iterative reconstruction methods. This initial experience will enable freebreathing small animal micro-CT imaging to fuel longitudinal studies of lung function

  3. 48 CFR 3052.217-92 - Inspection and manner of doing work (USCG).

    2010-10-01

    ... work (USCG). As prescribed in USCG guidance at (HSAR) 48 CFR 3017.9000(a) and (b), insert the following..., American Bureau of Shipping, or Department of the Navy for the type of welding being performed... proper closing of all openings to the vessel's underwater structure upon which work has been...

  4. Progress of Recycling in the Built Environment Final report of the RILEM Technical Committee 217-PRE

    2013-01-01

    This report is a useful tool for countries starting to recycle aggregates or construction and demolition waste. It contains the latest developments in this field, introduces a completely new approach to the procedure of proportioning concrete mixtures with recycled aggregate, references recent publications, opinions and discrepancies in relation to the durability of recycled concrete, such as freeze-thaw standards, studies of chloride penetration and diffusion, and sulfate attacks, the use of the fine fraction <4mm, quality assurance of concrete recycled aggregate, sustainability and recycling construction waste and global impact assessment of urban renewal based on sustainable recycling strategies for construction and demolition waste. This volume will be of interest to recyclers, researchers and consumers.

  5. People and things. CERN Courier, September 1981, v. 21(7)

    The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events: The King of Belgium recently paid a state visit to the People's Republic of China and invited four Belgian scientists to accompany him — M. Engelborghs-Bertelsr P. Melchior (Royal Observatory of Brussels and Louvain), J. van der Veken (Louvain) and Y. Go/dschmidt-Clermont (Brussels and CERN). Yves Goldschmidt- Clermont provided us with the following report. Italian physicists are presently developing a large modular track detector to be installed in the future Gran Sasso underground laboratory. Such a 'Giant Underground track- Detector' (GUD), up to 10 Kt in mass, should be capable of investigating nucleon decay and the interactions of high energy cosmic neutrinos. An International Conference on Nucleus-Nucleus Collisions will be held at Michigan State University from 26 September to 1 October, 1982

  6. SU-E-T-217: Intrinsic Respiratory Gating in Small Animal CT

    Liu, Y; Smith, M; Mistry, N [University of Maryland School of Medicine, Baltimore, MD (United States)

    2014-06-01

    Purpose: Preclinical animal models of lung cancer can provide a controlled test-bed for testing dose escalation or function-based-treatment-planning studies. However, to extract lung function, i.e. ventilation, one needs to be able to image the lung at different phases of ventilation (in-hale / ex-hale). Most respiratory-gated imaging using micro-CT involves using an external ventilator and surgical intervention limiting the utility in longitudinal studies. A new intrinsic respiratory retrospective gating method was developed and tested in mice. Methods: A fixed region of interest (ROI) that covers the diaphragm was selected on all projection images to estimate the mean intensity (M). The mean intensity depends on the projection angle and diaphragm position. A 3-point moving average (A) of consecutive M values: Mpre, Mcurrent and Mpost, was calculated to be subtracted from Mcurrent. A fixed threshold was used to enable amplitude based sorting into 4 different phases of respiration. Images at full-inhale and end-exhale phases of respiration were reconstructed using the open source OSCaR. Lung volumes estimated at the 2 phases of respiration were validated against literature values. Results: Intrinsic retrospective gating was accomplished without the use of any external breathing waveform. While projection images were acquired at 360 different angles. Only 138 and 104 projections were used to reconstruct images at full-inhale and end-exhale. This often results in non-uniform under-sampled angular projections leading to some minor streaking artifacts. The calculated expiratory, inspiratory and tidal lung volumes correlated well with the values known from the literature. Conclusion: Our initial result demonstrates an intrinsic gating method that is suitable for flat panel cone beam small animal CT systems. Reduction in streaking artifacts can be accomplished by oversampling the data or using iterative reconstruction methods. This initial experience will enable freebreathing small animal micro-CT imaging to fuel longitudinal studies of lung function.

  7. Q/SdR.04.896-2008 SQR7130A217/Model A Car

    2012-01-01

    1.Background As the development of global economy demands an increasingly large quantity of energy,the energy crisis is getting more severe.Auto manufacturers in Japan,America,and Europe have all began to develop hybrid power vehicles or its technology platform since 1990s,so as to save energy.Relied on its THS system which consists of the planet wheel and e-CVT,TOYOTA developed a series of strong hybrid power vehicles,such as Prius,Lexus,Highlander,Camry,etc.Based on its IMA system,HONDA developed a series of mild hybrid power vehicles,such as Insight,Civic,Accord,etc.On the basis of its Belt-driven Starter Generator (BSG) system,French SPA Group developed a series of weak hybrid power vehicles,such as Citroen C3,Citroen C2,Citroen 1007,Citroen 207,etc.In America the research of hybrid power vehicle is being done actively by a group of relevant parties consisting of Department of Transport,Department of Defense,major auto companies and relevant organizations under the leadership of Department of Energy and with the large quantity ofinvestment from GE Motors Co.and CHRYSLER.

  8. Abandon Hope All Ye Who Enter Here? (N217-11)

    Pecchenino, Rowena

    2011-01-01

    Hope plays an important role in all individuals’ lives both today and in the future. While hope and hopelessness are important concepts and the subjects of much theorizing in psychology, theology, philosophy, political science, nursing, as well as in literature and the arts, it is absent from economics. This silence on hope is notable since hope is fundamentally at the centre of choice, especially intertemporal choice, which is at the centre of economic analysis. To place hope ...

  9. Laboratory manual for salt-mixing test in 37- and 217-pin bundles

    This laboratory manual deals with the procedure employed during salt tracer experiments used in evaluating the hydraulic characteristics of a rod bundle. A description of the standard equipment used is given together with the details of manufacture of probes used for detecting the salt concentration. Details of the bundle construction have been excluded as they are availble in the reference cited. An attempt has been made to point out potential trouble areas and procedures

  10. Subtask 2.17 - CO{sub 2} Storage Efficiency in Deep Saline Formations

    Gorecki, Charles; Liu, Guoxiang; Braunberger, Jason; Klenner, Robert; Ayash, Scott; Dotzenrod, Neil; Steadman, Edward; Harju, John

    2014-02-01

    As the field of carbon capture and storage (CCS) continues to advance, and large-scale implementation of geologic carbon dioxide (CO{sub 2}) storage progresses, it will be important to understand the potential of geologic formations to store meaningful amounts of CO{sub 2}. Geologic CO{sub 2} storage in deep saline formations (DSFs) has been suggested as one of the best potential methods for reducing anthropogenic CO{sub 2} emission to the atmosphere, and as such, updated storage resource estimation methods will continue to be an important component for the widespread deployment of CCS around the world. While there have been several methodologies suggested in the literature, most of these methods are based on a volumetric calculation of the pore volume of the DSF multiplied by a storage efficiency term and do not consider the effect of site-specific dynamic factors such as injection rate, injection pattern, timing of injection, pressure interference between injection locations, and overall formation pressure buildup. These volumetric methods may be excellent for comparing the potential between particular formations or basins, but they have not been validated through real-world experience or full-formation injection simulations. Several studies have also suggested that the dynamic components of geologic storage may play the most important role in storing CO{sub 2} in DSFs but until now have not directly compared CO{sub 2} storage resource estimates made with volumetric methodologies to estimates made using dynamic CO{sub 2} storage methodologies. In this study, two DSFs, in geographically separate areas with geologically diverse properties, were evaluated with both volumetric and dynamic CO{sub 2} storage resource estimation methodologies to compare the results and determine the applicability of both approaches. In the end, it was determined that the dynamic CO{sub 2} storage resource potential is timedependent and it asymptotically approaches the volumetric CO{sub 2} storage resource potential over very long periods of time in the two systems that were evaluated. These results indicate that the volumetric assessments can be used as long as the appropriate storage efficiency terms are used and it is understood that it will take many wells over very long periods of time to fully realize the storage potential of a target formation. This subtask was funded through the Energy & Environmental Research Center (EERC)– U.S. Department of Energy (DOE) Joint Program on Research and Development for Fossil Energy-Related Resources Cooperative Agreement No. DE-FC26-08NT43291. Nonfederal funding was provided by the IEA Greenhouse Gas R&D Programme.

  11. Basic webliography on health promotion and disease prevention - doi:10.5020/18061230.2009.p217

    Ana Claudia Camargo Gonçalves da Silva

    2012-01-01

    Full Text Available Objectives: To introduce a basic webliography to access highly qualified evidence-based material on health promotion and disease prevention, aiming at the continuing education of health professionals. Methods: By means of Google® browser, applying the descriptors in sequence to progressively refine the search on Internet and key concepts to be learned, all previously defined by the authors themselves, we proceeded a qualitative analyses of the 20 first listed links for each searched issue and the final selection of the most scientifically relevant ones. Results: The 34 selected links are presented in 4 groups: 23 portals, 5 guides and recommendations, 4 scientific journals and 3 blogs that allow free access to health promotion and disease prevention related subjects, such as: concepts; national and international public policies; epidemiology, statistics and health indicators; diseases screening and prophylaxis; counseling for behavior change of health related habits; and interdisciplinary work. Among the selected links 10 (29% are written in English while the others are in Portuguese. Conclusions: The identification of reading materials on health promotion and disease prevention available on Internet, many in Portuguese, allowed us to select relevant scientifically qualified literature and turn it accessible to health professionals, enabling the acquisition of new knowledge or quick update.

  12. 18 CFR 2.17 - Price discrimination and anticompetitive effect (price squeeze issue).

    2010-04-01

    ... proceeding, the intervening customer or other interested person must support its allegation by a prima facie case. The elements of the prima facie case shall include at a minimum: (1) Specification of the filing... present their case, including prima facie showing, on price squeeze issues. (c) Within 30 days from...

  13. 77 FR 47492 - Thirteenth Meeting: RTCA Special Committee 217, Terrain and Airport Mapping Databases, Joint With...

    2012-08-08

    ....gouv.fr , telephone, 33-5 57 92 57 81, mobile telephone, 33-6 10 74 56 00. Honeywell's Prague facility... Mapping Databases, Joint With EUROCAE WG-44 AGENCY: Federal Aviation Administration (FAA), U.S. Department... Mapping Databases, Joint with EUROCAE WG-44. SUMMARY: The FAA is issuing this notice to advise the...

  14. Children of Working Mothers, March 1977. Special Labor Force Report 217.

    Grossman, Allyson Sherman

    1979-01-01

    This special labor force report, focusing on children of working mothers, summarizes findings from the 1977 annual survey of marital and family characteristics of workers in the population who are 16 years old and over. Data are given on: the numbers of children of various ages with working mothers, the percentages of black and white children…

  15. Study on laser atomic spectroscopy

    Laser atomic spectroscopic study on actinium element has been performed in many areas of spectroscopy. The study on characteristic of atomic vapor has been proceeded for copper atom and the spatial density distribution of copper vapor is measured. This experimental data has been compared with the theoretically calculated data. In spectroscopic experiment, the first and second excited states for actinium element are identified and the most efficient ionization scheme for actinium element is identified. In addition, the corrosion problem for filament material due to the heating of the actinium element has been studied. (Author)

  16. Removal of actinium from europium for the determination of specific radioactivity of ultra low-level Eu-152 in a sample exposed to atomic-bomb neutrons in Nagasaki

    Measurements of specific radioactivities of residual neutron-induced radionuclides such as 152Eu and 60Co have been carried out to check the validity of a series of computer calculations employed for the atomic-bomb neutron dosimetry in Hiroshima (exposed to uranium bomb) and Nagasaki (exposed to plutonium bomb). The use of these nuclides for atomic-bomb neutron dosimetry, however, has been limited by the following difficulties: (1) today, these radionuclides are found only at extremely low concentrations in materials exposed to the atomic-bomb and (2) the neutrons that induced these radionuclides were thermal and epithermal, while the neutron dose received in Hiroshima and Nagasaki is attributable to fast neutrons. In order to overcome the first difficulty, we established a chemical procedure to extract Eu and Co from materials exposed to the atomic-bomb, and the chemical procedure has been successful for the materials exposed to atomic-bomb within 1400 m in slant distance from the explosion point. As for Nagasaki, materials exposed in the distances farther than 1200 m have never been subjected to the measurement of residual neutron-induced radionuclides. In this work, determination of specific radioactivity of 152Eu (half-life: 13.542 y) in a sample exposed to Nagasaki atomic-bomb at a distant place from the explosion point was undertaken. But, because of radioactive decay during this ∝60 years since 1945 and long distance from the explosion point, the present specific radioactivity of 152Eu in the sample is extremely low (estimated to be ∝3 x 10-4 Bq-152Eu/mg-Eu), and a serious problem is interferences from daughters of 227Ac (half-life: 21.8 y) in the measurement of ultra low-level radioactivity of 152Eu. Hence, our chemical procedure to obtain Eu-enriched counting source should be improved, and much attention is being denoted to removal of Ac from Eu. (orig.)

  17. Tritiated water detection in the 2.17 µM spectral region by cavity ring down spectroscopy

    Nuclear waste containers are intended to be stored in dedicated disposal sites. For the inside and environmental safety of the disposal sites, the tiny outgassing rates leaking out the containers are measured. Presently, the radioactive HT gas is measured by liquid scintillation. However an alternative method—cavity ring down spectroscopy, an isotopically selective laser technique based on molecular spectroscopy—is currently developed and evaluated for tritium measurement in its oxidized form, HTO. Applying this method, the number density of the gaseous HTO sample hold in the optical cavity cell, is derived from the laser beam absorption by vibrational symmetric stretching 2ν1 (R) HTO lines in the 4590 and 4600 cm−1 spectral range. To ensure a future accurate HTO measurement, the theoretical line intensities are confronted to the experiment: two tritiated water standards are measured with a dedicated CRDS set-up. Compared to the theoretical database, the line positions are correct (−0.067 to −0.128 cm−1), their relative intensities are in agreement with the database, but their absolute intensities are 20% weaker. Among the seven intense lines, the 4596.485 cm−1 line (intensity 8.22 10−22 cm/molecule) and the 4592.407 cm−1 line (intensity 9.83 10−22 cm/molecule) are isolated and intense for a sensitive detection. The HTO detection limit with the present set-up is 3 kBq (10 min), equivalent to 1.8 1012 molecules in the 111 cm3 CRDS cell. This detection limit could be improved by a factor 3 by reducing the detection noise

  18. 50 CFR 226.217 - Critical habitat for the Gulf of Maine Distinct Population Segment of Atlantic Salmon (Salmo salar).

    2010-10-01

    ... reference was approved by the Director of the Federal Register in accordance with 5 U.S.C. 552(a) and 1 CFR... as defined by the ordinary high-water line (33 CFR 329.11). In areas where the ordinary high-water.... Kennebec Augusta, Benton, Chelsea, China, Clinton, Farmingdale, Fayette, Gardiner, Hallowell,...

  19. In vivo emergence of Aspergillus terreus with reduced azole susceptibility and a Cyp51a M217I alteration

    Arendrup, Maiken C; Jensen, Rasmus; Grif, Katharina;

    2012-01-01

    Azole resistance in Aspergillus terreus isolates was explored. Twenty related (MB) and 6 unrelated A. terreus isolates were included. CYP51A sequencing and RAPD genotyping was performed. Five MB isolates were itraconazole susceptible, whereas the minimum inhibitory concentrations (MICs) for 15 MB...

  20. Optimisation of 2/17 permanent magnets using the quinary Sm-Co-Cu-Fe-Zr phase diagram

    The combination of high magnetisation and high Curie temperature of the Sm2Co17 type magnets makes them attractive for a number of applications requiring high-energy products and long term stability for continuous operating up to 300 C. In order to optimise the elaboration process, it was necessary to investigate phase equilibria in the Sm-Co-Zr-Cu-Fe system. The presented part of the work concerns two regions of interest near 1150 C and 850 C. A specific method is proposed to represent the diagram where a two dimension projection of the different domains is coupled with a three dimensional one. This representation appears as a tool to understand the metallurgical process and to obtain better reproducibility of the alloys magnetic properties. Then an optimisation could be made. Magnetic behaviour of alloys is discussed. (orig.)

  1. Ser217Cys mutation in the Ig Ⅱ domain of FGFR3 in a Chinese family with autosomal dominant achondroplasia

    ZHANG Shi-rong; ZHOU Xiao-qing; REN Xiang; WANG Tian-tian; YUAN Ming-xiong; WANG Qing; LIU Jing-yu; LIU Mu-gen

    2007-01-01

    @@ Achondroplasia (ACH) is the most common form of skeletal dysplasia characterized by disproportionately short stature, lumbar lordosis, relative macrocephaly and other skeletal anomalies resulting from a defect in the maturation of the chondrocytes in the growth plate of the cartilage. The combined frequency of the disease has been estimated to be 1 in 15 000 live births.1 ACH is inherited in autosomal dominant fashion with a complete penetrance, more than 80% of affected individuals have de novo mutations associated with increased paternal age.

  2. Kryptonita: un Superman argentino entre Patoruzú y Afanancio : Oyola, Leandro (2011): Kryptonita. Buenos Aires, Mondadori, pp. 217

    Yema, Sihuén

    2012-01-01

    Luego de leer Kryptonita de Leandro Oyola volví a sentir esa sensación de que los superhéroes pueden estar allí afuera. Pero no con trajes especiales ni poderes demenciales. Ni siquiera precisan ser superhéroes a la manera que los define el comic, pero una pizca de realidad puede haber en las historias de Batman o Superman

  3. A response matrix method for improved modeling of neutron streaming in large control rod holes of prismatic VHTR cores - 217

    This paper presents a response matrix method developed for accurate modeling of neutron streaming through empty, large control rod holes in VHTRs. In this approach, a response matrix based on transport solution is derived for each control rod channel region and embedded in the whole-core transport solution scheme. Depending on the region geometry only, each element of the response matrix represents the outgoing partial current at a surface due to a unit incoming partial current at another surface. In order to improve the axial solution accuracy, this response matrix approach was incorporated into the DeCART code that solves whole-core transport problems by coupling two-dimensional MOC and one-dimensional nodal solutions. Verification test results showed very good agreements in control rod worth and axial power distributions with MCNP5 solutions. (authors)

  4. 41 CFR 101-6.217 - Laws authorizing Federal financial assistance for programs to which this subpart applies.

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Laws authorizing Federal... Contracts and Property Management Federal Property Management Regulations System FEDERAL PROPERTY MANAGEMENT..., preserving and compiling, and publishing of documentary sources significant to the history of the...

  5. What Is Physical Oceanography? A Learning Experience for Coastal and Oceanic Awareness Studies, No. 217. [Project COAST].

    Delaware Univ., Newark. Coll. of Education.

    This unit is concerned with an overview of physical oceanography - the study of currents, tides, waves, and particle movements. The activities are designed for use by junior high school age students. Included in the unit are activities related to properties of sea water, physical phenomena of the ocean, and physical features of the ocean.…

  6. Generator method of 225Ac production without a carrier for nuclear medicine

    The two-steps isotope generator scheme of 225Ac production from 229Th has been developed. The first step is used for separation of thorium, actinium, radium and daughter decay products (DDP), and removals of parent radionuclide. The second step provides additional separation of actinium from traces of radium and DDP, and conversion of actinium in the nitrate form. The chosen solutions provide optimal conditions for carry out of process. The yield of the 225Ac was 99.9% at minimal losses of parent 229Th (less than 0.1%)

  7. SU-E-J-217: Multiparametric MR Imaging of Cranial Tumors On a Dedicated 1.0T MR Simulator Prior to Stereotactic Radiosurgery

    Purpose: Quantitative magnetic resonance imaging (MRI) of cranial lesions prior to stereotactic radiosurgery (SRS) may improve treatment planning and provide potential prognostic value. The practicality and logistics of acquiring advanced multiparametric MRI sequences to measure vascular and cellular properties of cerebral tumors are explored on a 1.0 Tesla MR Simulator. Methods: MR simulation was performed immediately following routine CT simulation on a 1T MR Simulator. MR sequences used were in the order they were performed: T2-Weighted Turbo Spin Echo (T2W-TSE), T2 FLAIR, Diffusion-weighted (DWI, b = 0, 800 to generate an apparent diffusion coefficient (ADC) map), 3D T1-Weighted Fast Field Echo (T1W-FFE), Dynamic Contrast Enhanced (DCE) and Post Gadolinium Contrast Enhanced 3D T1W-FFE images. T1 pre-contrast values was generated by acquiring six different flip angles. The arterial input function was derived from arterial pixels in the perfusion images selected manually. The extended Tofts model was used to generate the permeability maps. Routine MRI scans took about 30 minutes to complete; the additional scans added 12 minutes. Results: To date, seven patients with cerebral tumors have been imaged and tumor physiology characterized. For example, on a glioblastoma patient, the volume contoured on T1 Gd images, ADC map and the pharmacokinetic map (Ktrans) were 1.9, 1.4, and 1.5 cc respectively with strong spatial correlation. The mean ADC value of the entire volume was 1141 μm2/s while the value in the white matter was 811 μm2/s. The mean value of Ktrans was 0.02 min-1 in the tumor volume and 0.00 in the normal white matter. Conclusion: Our initial results suggest that multiparametric MRI sequences may provide a more quantitative evaluation of vascular and tumor properties. Implementing functional imaging during MR-SIM may be particularly beneficial in assessing tumor extent, differentiating radiation necrosis from tumor recurrence, and establishing reliable bio-markers for treatment response evaluation. The Department of Radiation Oncology at Henry Ford Health System has research agreement with Varian Medical System and Philips Health Care

  8. The VIMOS VLT Deep Survey: Star Formation Rate Density of Lya emitters from a sample of 217 galaxies with spectroscopic redshifts 2

    Cassata, P; Garilli, B; Maccagni, D; Le Brun, V; Scodeggio, M; Tresse, L; Ilbert, O; Zamorani, G; Cucciati, O; Contini, T; Bielby, R; Mellier, Y; McCracken, H J; Pollo, A; Zanichelli, A; Bardelli, S; Cappi, A; Pozzetti, L; Vergani, D; Zucca, E

    2010-01-01

    Aims. The aim of this work is to study the contribution of the Ly-alpha emitters to the Star Formation Rate Density (SFRD) of the Universe in the interval 2 1.5x10^18 erg/s/cm^2 are 33 galaxies/arcmin2 and ~ 4x10^-2 Mpc^-3, respectively. We find that the the observed luminosity function of LAE does not evolve from z=2 to z=6. This implies that, after correction f or the redshift dependant IGM absorption and dust, the intrinsic LF must have evolved significantly over 3 Gyr. The star formation rate density from LAE is found to be contributing about 20% of the SFRD at z = 2 -- 3 while the LAE appear to be the dominant source of star formation producing ionizing photons in the early universe z > 5 -- 6, becoming equivalent to that of Lyman Break Galaxies.

  9. SU-E-J-217: Multiparametric MR Imaging of Cranial Tumors On a Dedicated 1.0T MR Simulator Prior to Stereotactic Radiosurgery

    Wen, N; Glide-Hurst, C; Liu, M; Hearshen, D; Brown, S; Siddiqui, S; Chetty, I [Henry Ford Health System, Detroit, MI (United States)

    2015-06-15

    Purpose: Quantitative magnetic resonance imaging (MRI) of cranial lesions prior to stereotactic radiosurgery (SRS) may improve treatment planning and provide potential prognostic value. The practicality and logistics of acquiring advanced multiparametric MRI sequences to measure vascular and cellular properties of cerebral tumors are explored on a 1.0 Tesla MR Simulator. Methods: MR simulation was performed immediately following routine CT simulation on a 1T MR Simulator. MR sequences used were in the order they were performed: T2-Weighted Turbo Spin Echo (T2W-TSE), T2 FLAIR, Diffusion-weighted (DWI, b = 0, 800 to generate an apparent diffusion coefficient (ADC) map), 3D T1-Weighted Fast Field Echo (T1W-FFE), Dynamic Contrast Enhanced (DCE) and Post Gadolinium Contrast Enhanced 3D T1W-FFE images. T1 pre-contrast values was generated by acquiring six different flip angles. The arterial input function was derived from arterial pixels in the perfusion images selected manually. The extended Tofts model was used to generate the permeability maps. Routine MRI scans took about 30 minutes to complete; the additional scans added 12 minutes. Results: To date, seven patients with cerebral tumors have been imaged and tumor physiology characterized. For example, on a glioblastoma patient, the volume contoured on T1 Gd images, ADC map and the pharmacokinetic map (Ktrans) were 1.9, 1.4, and 1.5 cc respectively with strong spatial correlation. The mean ADC value of the entire volume was 1141 μm2/s while the value in the white matter was 811 μm2/s. The mean value of Ktrans was 0.02 min-1 in the tumor volume and 0.00 in the normal white matter. Conclusion: Our initial results suggest that multiparametric MRI sequences may provide a more quantitative evaluation of vascular and tumor properties. Implementing functional imaging during MR-SIM may be particularly beneficial in assessing tumor extent, differentiating radiation necrosis from tumor recurrence, and establishing reliable bio-markers for treatment response evaluation. The Department of Radiation Oncology at Henry Ford Health System has research agreement with Varian Medical System and Philips Health Care.

  10. Post irradiation fatigue tests of type 316 LN stainless steel. Final report for the ITER Task T511, Subtask 1. European Technology Programme Task GB5-T217

    The main objective of this Subtask was to estimate the corrosion fatigue behaviour of 316L Stainless Steel (SS) and SS/SS joints, and to check among others the influence of irradiation. Joints were produced by solid Hot Isostatic Pressure (HIP) and powder HIP. Conventional material was used for comparison. The specimens were supplied by EFDA and were irradiated to 4 dpa in Dimitrovgrad (Russia). All specimens were tested at 150 deg C in hydrogenated high purity water. Testing was performed with a stepwise decrease in ΔK keeping Kmax constant. The crack growth rates of irradiated as well as unirradiated specimens tested earlier are of the same magnitude, around 2x10-5 mm/cycle at ΔK= 18 MPa√m. Thus, irradiation does not seem to enhance the fatigue crack growth rate, at least not up to irradiation levels of 4 dpa. But it is worth noting that the exponents in the da/dN versus ΔK equation, also known as Paris' law, seems to fall within two areas, either around 3.5 or just below 2. Both Powder HIPed and Solid HIPed specimens are found in both groups. The reason for this is not evident. The fracture surfaces of the specimens show typical fatigue appearance

  11. SU-E-J-217: Accuracy Comparison Between Surface and Volumetric Registrations for Patient Setup of Head and Neck Radiation Therapy

    Purpose: Optical surface imaging has been applied to radiation therapy patient setup. This study aims to investigate the accuracy of the surface registration of the optical surface imaging compared with that of the conventional method of volumetric registration for patient setup in head and neck radiation therapy. Methods: Clinical datasets of planning CT and treatment Cone Beam CT (CBCT) were used to compare the surface and volumetric registrations in radiation therapy patient setup. The Iterative Closest Points based on point-plane closest method was implemented for surface registration. We employed 3D Slicer for rigid volumetric registration of planning CT and treatment CBCT. 6 parameters of registration results (3 rotations and 3 translations) were obtained by the two registration methods, and the results were compared. Digital simulation tests in ideal cases were also performed to validate each registration method. Results: Digital simulation tests showed that both of the registration methods were accurate and robust enough to compare the registration results. In experiments with the actual clinical data, the results showed considerable deviation between the surface and volumetric registrations. The average root mean squared translational error was 2.7 mm and the maximum translational error was 5.2 mm. Conclusion: The deviation between the surface and volumetric registrations was considerable. Special caution should be taken in using an optical surface imaging. To ensure the accuracy of optical surface imaging in radiation therapy patient setup, additional measures are required. This research was supported in part by the KIST institutional program (2E24551), the Industrial Strategic technology development program (10035495) funded by the Ministry of Trade, Industry and Energy (MOTIE, KOREA), and the Radiation Safety Research Programs (1305033) through the Nuclear Safety and Security Commission, and the NIH (R01EB016777)

  12. 26 CFR 1.217-1 - Deduction for moving expenses paid or incurred in taxable years beginning before January 1, 1970.

    2010-04-01

    ...-month period and who teaches on a full-time basis for more than 6 months in fulfillment of such contract.... After working full-time for 30 weeks his job is terminated, and he subsequently moves to and secures... reimbursed $600 by M. After working for M for a period of 3 months, A becomes dissatisfied with the job...

  13. 26 CFR 1.217-2 - Deduction for moving expenses paid or incurred in taxable years beginning after December 31, 1969.

    2010-04-01

    ... REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Additional... chapter (Employment Tax Regulations). The term self-employed individual as used in this section is defined..., expenses of occupying temporary quarters do not include, for example, the cost of entertainment,...

  14. Melhaoui Mohammed, Peste, contagion et martyre. Histoire du fléau en Occident médiéval, Paris, Publisud, 2005, 217 p.

    Stéphane Barry

    2007-07-01

    Full Text Available En France, à l’exception des études du médecin, historien et démographe Jean-Noël Biraben (1975-1976, peu de travaux existent sur la Peste noire et ses conséquences dans l’Occident musulman médiéval. On comprendra alors tout l’intérêt de l’ouvrage de Mohammed Melhaoui sur ce thème qu’il connaît bien puisqu’il lui a consacré non seulement une thèse de doctorat d’histoire, mais aussi quelques études portant notamment sur la « perception de la peste en pays chrétiens byzantins et musulman » (Co...

  15. Coeliac disease: characterisation of monoclonal antibodies raised against a synthetic peptide corresponding to amino acid residues 206-217 of A-gliadin.

    Ellis, H. J.; Doyle, A. P.; Sturgess, R P; Ciclitira, P J

    1992-01-01

    A dodecapeptide of A-gliadin, which shares amino acid homologies with the E1b protein of adenovirus 12, was used to produce murine monoclonal antibodies. Five monoclonal antibodies were produced and were screened by enzyme linked immunosorbant assay, immunodot assay, and immunoblotting. The antibodies were tested against whole wheat gliadin and its alpha, beta, gamma, and omega subfractions, and the prolamins of rye, barley, oats, maize, millet, rice, and sorghum. Four of the five antibodies ...

  16. The Impact of Education On Fertility and Child Mortality: Do Fathers Really Matter Less than Mothers? OECD Development Centre Working Paper, No. 217 (Formerly Webdoc No. 5)

    Breierova, Lucia; Duflo, Esther

    2003-01-01

    This paper takes advantage of a massive school construction program that took place in Indonesia between 1973 and 1978 to estimate the effect of education on fertility and child mortality. Time and region varying exposure to the school construction program generates instrumental variables for the average education in the household, and the…

  17. The crystal structure of franckeite, Pb21.7Sn9.3Fe4.0Sb8.1S56.9

    Makovicky, Emil; Petricek, Vaclav; Dusek, Michal; Topa, Dan

    layer (M = Sn4+, Fe2+) with a = 3.665(8), b = 6.2575(16), c = 17.419(5) Å, a = 95.25(2)°, ß = 95.45(2)°, ¿ = 89.97(2)°; the modulation vector is q = –0.00087(8) a* + 0.13725(16) b* – 0.0314(4) c*. The a and b vectors of both subsystems are parallel; the c vectors diverge. (3+2)D superspace refinement...... forms a homologous pair with cylindrite, which has thinner Q slabs. The Q slabs in franckeite are four atomic layers thick. The two components have their own lattices and a common modulation. The Q slab of the refined franckeite structure, Pb21.74Sn9.34Fe3.95Sb8.08S56.87, is an MS layer (M = Pb2+, Sn2......+, Sb3+) four atomic planes thick, with a = 5.805(8), b = 5.856(16) Å, and the layer-stacking vector c = 17.338(5) Å. The lattice angles are a = 94.97(2)°, ß = 88.45(2)°, ¿ = 89.94(2)°; the modulation vector q = –0.00129(8) a* + 0.128436(10) b* – 0.0299(3) c*. The H layer is a single-octahedron MS2...

  18. PS2-17: Diabetes Social Support Feasibility Pilot Study: Utilizing Mobile Technology and Self-Identified Supporters to Enhance Self-Monitoring of Blood Glucose

    Robinson, Brandi; Roblin, Douglas; Hipkens, James; Vupputuri, Suma; McMahon, Kevin

    2010-01-01

    Background and Aims: Self-monitoring of blood glucose (SMBG) is associated with improved glycemic control among patients with type 2 diabetes, however, the practice of daily self-monitoring is not optimal. Telecommunications technology may improve adherence to recommended self-management practices by remotely transmitting automated reminders to motivate patients, and utilizing social networking for peer support. The purpose of this pilot study is to demonstrate the feasibility and usability o...

  19. Diagnostic value of a new myocardial perfusion agent, teboroxime (SO 30,217), utilizing a rapid planar imaging protocol: Preliminary results

    Technetium-99m-labeled agents have advantages over thallium-201 in terms of photon statistics, cost and clinical availability. They have been suggested as an alternative to thallium for myocardial perfusion imaging. Teboroxime is a new boronic acid adduct of technetium dioxime (BATO) compound that demonstrates favorable characteristics in preliminary studies. With use of a novel (seated) patient positioning technique and a rapid dynamic acquisition protocol, 30 patients underwent planar imaging with teboroxoime while at rest and after maximal treadmill exercise. Postexercise scans were completed in an average time (mean +/- SD) of 4.4 +/- 1.6 min, with 4.8 +/- 1.5 min for the views at rest. These results were compared with coronary arteriography or thallium scintigraphy after treadmill exercise, or both. Diagnostic agreement (abnormal versus normal) was present in 28 of the 30 patients (p less than 0.001). Regarding physiologic assessment as compared with thallium scintigraphy, the finding of infarction and ischemia was concordant in 89% and 86% of patients, respectively. This report describes the initial use of teboroxime with a rapid dynamic planar imaging technique, resulting in a high correlation with exercise thallium scintigraphy. Delayed postexercise images obtained 5 to 10 min after exercise demonstrated rapid disappearance of exercise-induced defects noted on the initial (0 to 5 min) postexercise views. The rapid differential washout with teboroxime has not been previously described and the possible clinical significance is discussed

  20. Diagnostic value of a new myocardial perfusion agent, teboroxime (SQ 30,217), utilizing a rapid planar imaging protocol: Preliminary results

    Hendel, R.C.; McSherry, B.; Karimeddini, M.; Leppo, J.A. (Univ. of Massachusetts Medical Center, Worcester (USA))

    1990-10-01

    Technetium-99m-labeled agents have advantages over thallium-201 in terms of photon statistics, cost and clinical availability. They have been suggested as an alternative to thallium for myocardial perfusion imaging. Teboroxime is a new boronic acid adduct of technetium dioxime (BATO) compound that demonstrates favorable characteristics in preliminary studies. With use of a novel (seated) patient positioning technique and a rapid dynamic acquisition protocol, 30 patients underwent planar imaging with teboroxime while at rest and after maximal treadmill exercise. Postexercise scans were completed in an average time (mean +/- SD) of 4.4 +/- 1.6 min, with 4.8 +/- 1.5 min for the views at rest. These results were compared with coronary arteriography or thallium scintigraphy after treadmill exercise, or both. Diagnostic agreement (abnormal versus normal) was present in 28 of the 30 patients (p less than 0.001). Regarding physiologic assessment as compared with thallium scintigraphy, the finding of infarction and ischemia was concordant in 89% and 86% of patients, respectively. This report describes the initial use of teboroxime with a rapid dynamic planar imaging technique, resulting in a high correlation with exercise thallium scintigraphy. Delayed postexercise images obtained 5 to 10 min after exercise demonstrated rapid disappearance of exercise-induced defects noted on the initial (0 to 5 min) postexercise views. The rapid differential washout with teboroxime has not been previously described and the possible clinical significance is discussed.

  1. Diagnostic value of a new myocardial perfusion agent, teboroxime (SO 30,217), utilizing a rapid planar imaging protocol: Preliminary results

    Hendel, R.C.; McSherry, B.; Karimeddini, M.; Leppo, J.A. (Univ. of Massachusettes Medical Center, Worcester (USA))

    1990-11-01

    Technetium-99m-labeled agents have advantages over thallium-201 in terms of photon statistics, cost and clinical availability. They have been suggested as an alternative to thallium for myocardial perfusion imaging. Teboroxime is a new boronic acid adduct of technetium dioxime (BATO) compound that demonstrates favorable characteristics in preliminary studies. With use of a novel (seated) patient positioning technique and a rapid dynamic acquisition protocol, 30 patients underwent planar imaging with teboroxoime while at rest and after maximal treadmill exercise. Postexercise scans were completed in an average time (mean +/- SD) of 4.4 +/- 1.6 min, with 4.8 +/- 1.5 min for the views at rest. These results were compared with coronary arteriography or thallium scintigraphy after treadmill exercise, or both. Diagnostic agreement (abnormal versus normal) was present in 28 of the 30 patients (p less than 0.001). Regarding physiologic assessment as compared with thallium scintigraphy, the finding of infarction and ischemia was concordant in 89% and 86% of patients, respectively. This report describes the initial use of teboroxime with a rapid dynamic planar imaging technique, resulting in a high correlation with exercise thallium scintigraphy. Delayed postexercise images obtained 5 to 10 min after exercise demonstrated rapid disappearance of exercise-induced defects noted on the initial (0 to 5 min) postexercise views. The rapid differential washout with teboroxime has not been previously described and the possible clinical significance is discussed.

  2. Effects of diabetes definition on global surveillance of diabetes prevalence and diagnosis: pooled analysis of 82 population-based studies with 217,000 participants

    Danaei, Goodarz; Fahimi, Saman; Lu, Yuan; Zhou, Bin; Hajifathalian, Kaveh; Di Cesare, Mariachiara; Ezzati, Majid; NCD-RisC, Group

    2015-01-01

    Background: Diabetes has been defi ned on the basis of different biomarkers, including fasting plasma glucose (FPG), 2-h plasma glucose in an oral glucose tolerance test (2hOGTT), and HbA1c. We assessed the effect of different diagnostic definitions on both the population prevalence of diabetes and the classifi cation of previously undiagnosed individuals as having diabetes versus not having diabetes in a pooled analysis of data from population-based health examination surveys in ...

  3. I. The metabolic properties of plutonium and allied materials

    Hamilton, J.G.

    1948-05-24

    This report on the metabolic properties of plutonium and related radioactive materials presents experimental information in the following areas: radioautographic studies; tracer studies (with tables of accumulation in tissues) of actinium, radio-zirconium, technetium, radio-rubidium, radio-germanium, beryllium, and cadmium; decontamination and bone metabolism studies; and radio-chemical isolation.

  4. CTD data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 miles north of Oahu, Hawaii for cruises HOT208-217 during 2009 (NODC Accession 0068957)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  5. Thermosalinograph data of the Hawaii Ocean Time-series (HOT) program in the North Pacific, 100 Miles North of Oahu, Hawaii for cruises HOT208-217 during 2009 (NODC Accession 0069501)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  6. Niskin bottle data of the Hawaii Ocean Time-series (HOT) program in the North Pacific 100 miles north of Oahu, Hawaii for cruises HOT208-217 during 2009 (NODC Accession 0069177)

    National Oceanic and Atmospheric Administration, Department of Commerce — The HOT program makes repeated observations of the physics, biology and chemistry at a site approximately 100 km north of Oahu, Hawaii. Two stations are visited...

  7. Nanostructured crystals of fluorite phases Sr1-xRxF2+x (R are rare-earth elements) and their ordering: IV. Study of the optical transmission spectra in the 2-17-μm wavelength range

    Transmission spectra of two-component crystals of Sr1-xRxF2+x (R = Y, La-Lu; 0 ≤ x ≤ 0.5) in the 1-17-μm wavelength range were studied. The spectral characteristics of these crystals and of single-component crystals of MF2 (M = Ca, Sr, or Ba) and RF3 (R = La-Nd) were compared. The transmission cutoff of Sr1-xRxF2+x crystals is shifted to shorter wavelengths with increasing x. The same tendency is observed with the increasing atomic number R of rare-earth elements for two isoconcentration series of Sr1-xRxF2+x (x ∼ 0.10 and 0.28). This tendency is pronounced at large x. The transmission cutoff of Sr1-xRxF2+x crystals can be varied in the range of from 10.7 to 12.2 μm by changing their qualitative (R) and quantitative (x) composition. Hence, these crystals can be assigned to multicomponent fluoride optical materials with controlled optical characteristics. The Sr1-xRxF2+x crystals, where R = Ce-Sm, were shown to be promising materials for the design of selective optical filters in the 2-10-μm spectral range.

  8. Ulnar ray defect in an infant with a 6q21;7q31.2 translocation: Further evidence of the existence of a limb defect gene in 6q21

    Gurrieri, F.; Genuardi, M.; Pomponi, M.G. [Universita di Palermo (Italy)] [and others

    1995-01-30

    Ectrodactyly is a developmental defect of the distal limbs characterized by marked clinical variability and genetic heterogeneity, also reflected in the observation of different chromosome abnormalities nonrandomly associated with longitudinal postaxial limb deficiencies. The one most frequently found in patients with split hand-split foot (SHSF) involves chromosome band 7q22. Recently, structural anomalies of chromosome 6q21 have been reported in 2 unrelated patients with SHSF, suggesting that this region may also contain genes responsible for limb development. We report on a third patient who had a de novo, apparently balanced t(6;7)(q21;q31.2) translocation and bilateral ulnar aplasia with postaxial oligodactyly. In spite of the different phenotypic effects observed in these 3 patients, we consider our case as further evidence that genes in 6q21 may play a role in distal limb development. 8 refs., 3 figs.

  9. The crystal structure of franckeite, Pb.sub.21.7./sub.Sn.sub.9.3./sub.Fe.sub.4.0./sub.Sb.sub.8.1./sub.S.sub.56.9./sub..

    Makovicky, E.; Petříček, Václav; Dušek, Michal; Topa, D.

    2011-01-01

    Roč. 96, 11-12 (2011), s. 1686-1702. ISSN 0003-004X Grant ostatní: AVČR(CZ) Praemium Academiae Institutional research plan: CEZ:AV0Z10100521 Keywords : franckeite * Pb-Sn-Sb-Fe sulfide * modulated layer-misfit crystal structure * 2D–non-commensurate layer structure Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.169, year: 2011

  10. Investigation for determining the retention properties of rock over the ASSE II mine for dissolved radionuclides

    For a model consideration of groundwater movement and the associated transport of dissolved substance in deep groundwater, the retention properties of the ASSE II mine for radionuclides dissolved in water were determined. A series of properties of rocks were examined and described for this purpose. Apart from the chemical, mineralogical and petrophysical characteristics of the rocks, the retention was determined by 3 different methods and stated in the form of distribution coefficients for specific elements. A comparison of the results of vibration and diffusion experiments gave good agreement, while the results in through column experiments only reached the same order of magnitude after an expensive determination with the aid of a place concentration distribution. The distribution coefficients for the elements carbon, selenium, strontium, technetium, iodine, caesium, lead, radium, actinium, proto-actinium, uranium, neptunium, plutonium, americium and curium are listed and collected for model rock packages. (orig./HP)

  11. Sorption studies of radioelements on geological materials

    Batch sorption experiments have been carried out to study the sorption of uranium, technetium, curium, neptunium, actinium, protactinium, polonium, americium and plutonium onto bentonite, granodiorite and tuff. Mathematical modelling using the HARPHRQ program and the HATCHES database was carried out to predict the speciation of uranium and technetium in the equilibrated seawater, and neptunium, americium and plutonium in the rock equilibrated water. Review of the literature for thermodynamic data for curium, actinium, protactinium and polonium was carried out. Where sufficient data were available, predictions of the speciation and solubility were made. This report is a summary report of the experimental work conducted by AEA Technology during April 1991-March 1998, and the main results have been presented at Material Research Society Symposium Proceedings and published as proceedings of them. (author)

  12. Sorption studies of radioelements on geological materials

    Berry, J. A; 油井 三和; 北村 暁

    2007-01-01

    Batch sorption experiments have been carried out to study the sorption of uranium, technetium, curium, neptunium, actinium, protactinium, polonium, americium and plutonium onto bentonite, granodiorite and tuff. Mathematical modelling using the HARPHRQ program and the HATCHES database was carried out to predict the speciation of uranium and technetium in the equilibrated seawater, and neptunium, americium and plutonium in the rock equilibrated water. Review of the literature for thermodynamic ...

  13. Purification of cerium, neodymium and gadolinium for low background experiments

    Boiko R.S.; Barabash A.S.; Belli P.; Bernabei R.; Cappella F.; Cerulli R.; Danevich F.A.; Incicchitti A.; Laubenstein M.; Mokina V.M.; Nisi S.; Poda D.V.; Polischuk O.G.; Tretyak V.I.

    2014-01-01

    Cerium, neodymium and gadolinium contain double beta active isotopes. The most interesting are 150Nd and 160Gd (promising for 0ν2β search), 136Ce (2β+ candidate with one of the highest Q2β). The main problem of compounds containing lanthanide elements is their high radioactive contamination by uranium, radium, actinium and thorium. The new generation 2β experiments require development of methods for a deep purification of lanthanides from the radioactive elements. A combination of physical an...

  14. LASL experience in decontamination of the environment

    This discussion represents one part of a major effort in soil decontamination at the Los Alamos site. A contaminated industrial waste line in the Los Alamos townsite was removed, and a plutonium incineration facility, and a filter building contaminated with actinium-227 were dismantled. The former plutonium handling facility has been decontaminated, and canyons and an old firing site contaminated with strontium-90 have been surveyed

  15. Study of the origin of elements of the uranium-235 family observed in excess in the vicinity of the experimental nuclear EL4 reactor under dismantling. Lessons got at this day and conclusions; Etude de l'origine des elements de la famille de l'uranium-235 observes en exces dans les environs du reacteur nucleaire experimental EL4 en cours de demantelement. Enseignements retires a ce jour et conclusion

    NONE

    2007-07-01

    This study resumes the discovery of an excess of actinium 227 found around by EL4 nuclear reactor actually in dismantling. The search for the origin of this excess revealed a real inquiry of investigation during three years. Because a nuclear reactor existed in this area a particular attention will have concerned this region. The doubt became the line of conduct to find the answer to the human or natural origin of this excess. Finally and against any evidence, it appears that the origin of this phenomenon was natural, consequence of the particular local geology. The detail of the different investigations is given: search of a possible correlation with the composition of elevations constituent of lanes, search (and underlining) of new sites in the surroundings of the Rusquec pond and the Plouenez station, study of the atmospheric deposits under winds of the nuclear power plant and in the east direction, search of a possible relationship with the gaseous effluents of the nuclear power plant in the past, historical study of radioactive effluents releases in the fifty last years by the analysis of the sedimentary deposits in the Saint-Herbiot reservoir, search of a possible correlation between the excess of actinium 227 and the nuclear power plant activity; search of a possible correlation with a human activity without any relationship with the nuclear activities, search of a correlation with the underground waters, search of a correlation with the geological context, collect of information on the possible transfers in direction of the food chain, determination of the radiological composition of the underground waters ( not perturbed by human activity), search of the cause of an excess of actinium 227 in the old channel of liquid effluents release of the nuclear power plant. The results are given and discussed. And contrary to all expectations the origin of the excess of actinium 227 is completely natural. (N.C.)

  16. The discoveries of uranium 237 and symmetric fission — From the archival papers of Nishina and Kimura

    IKEDA, Nagao

    2011-01-01

    Shortly before the Second World War time, Nishina reported on a series of prominent nuclear physical and radiochemical studies in collaboration with Kimura. They artificially produced 231Th, a member of the natural actinium series of nuclides, by bombarding thorium with fast neutrons. This resulted in the discovery of 237U, a new isotope of uranium, by bombarding uranium with fast neutrons, and confirmed that 237U disintegrates into element 93 with a mass number of 237. They also identified t...

  17. History of the unraveling of the natural decay series

    Milestones in the subject of radioactivity, which were important to the unraveling of natural decay series, have been identified and described. The interplay between all these issues is very complex, and some aspects of the development of the uranium series is discussed as an example, the thorium and actinium series evolved in a similar way from research by many of the same people. All three series as understood in 1913 are compared with their present-day representation. (orig.)

  18. History of the unraveling of the natural decay series

    Milestones in the subject of radioactivity, which were important to the unraveling of natural decay series, have been identified and described. The interplay between all these issues is very complex, and some aspects of the development of the uranium series is discussed as an example, the thorium and actinium series evolved in a similar way from research by many of the same people. All three series as understood in 1913 are compared with their present-day representation. (author)

  19. System for recovery of daughter isotopes from a source material

    Tranter, Troy J [Idaho Falls, ID; Todd, Terry A [Aberdeen, ID; Lewis, Leroy C [Idaho Falls, ID; Henscheid, Joseph P [Idaho Falls, ID

    2009-08-04

    A method of separating isotopes from a mixture containing at least two isotopes in a solution is disclosed. A first isotope is precipitated and is collected from the solution. A daughter isotope is generated and collected from the first isotope. The invention includes a method of producing an actinium-225/bismuth-213 product from a material containing thorium-229 and thorium-232. A solution is formed containing nitric acid and the material containing thorium-229 and thorium-232, and iodate is added to form a thorium iodate precipitate. A supernatant is separated from the thorium iodate precipitate and a second volume of nitric acid is added to the thorium iodate precipitate. The thorium iodate precipitate is stored and a decay product comprising actinium-225 and bismuth-213 is generated in the second volume of nitric acid, which is then separated from the thorium iodate precipitate, filtered, and treated using at least one chromatographic procedure. A system for producing an actinium-225/bismuth-213 product is also disclosed.

  20. Behaviour of uranium series radionuclides in surface water (Crouzille, Limousin). Geochemical implications

    Understanding natural radionuclides behaviour in surface water is a required step to achieve uranium mine rehabilitation and preserve water quality. The first objective of this thesis is to determine which are the radionuclides sources in a drinking water reservoir. The second objective is to improve the knowledge about the behaviour of uranium series radionuclides, especially actinium. The investigated site is a brook (Sagnes, Limousin, France) which floods a peat bog contaminated by a former uranium mine and which empties into the Crouzille lake. It allows studying radionuclides transport in surface water and radionuclides retention through organic substance or water reservoir. Radionuclides distribution in particulate, colloidal and dissolved phases is determined thanks to ultra-filtrations. Gamma spectrometry allows measuring almost all natural radionuclides with only two counting stages. However, low activities of 235U series radionuclides impose the use of very low background well-type Ge detectors, such as those of the Underground Laboratory of Modane (France). Firstly, this study shows that no or few radionuclides are released by the Sagnes peat bog, although its radioactivity is important. Secondly, it provides details on the behaviour of uranium series radionuclides in surface water. More specifically, it provides the first indications of actinium solubility in surface water. Actinium's behaviour is very close to uranium's even if it is a little less soluble. (author)

  1. Synthesis and characterization of NiFe2O4 electrocatalyst for the hydrogen evolution reaction in alkaline water electrolysis using different polymer binders

    Chanda, D.; Hnát, J.; Paidar, M.; Schauer, Jan; Bouzek, K.

    2015-01-01

    Roč. 285, 1 July (2015), s. 217-226. ISSN 0378-7753 Institutional support: RVO:61389013 Keywords : alkaline water electrolysis * spinel oxides * polymer binder Subject RIV: CG - Electrochemistry Impact factor: 6.217, year: 2014

  2. Grupo de Estudios en Historia de las Ciencias, GEHC (Editores). Control Social y Objetivación : escrituras y tránsitos de las Ciencias en Chile, Universidad de Chile, Santiago de Chile, 2012. 217 p.

    Pincheira Torres, Ivan

    2012-01-01

    Las articulaciones existentes entre discurso científico y prácticas de gobierno no han quedado fuera del campo de problematización de los estudios sociales latinoamericanos. De este modo, y aunque se ubiquen en distintas matrices de análisis, nos encontramos con distintos trabajos que van a reconocer la relevante labor desempeñada por las epistemologías europeas en la conformación de prácticas de gobierno que, actuando sobre estructuras tanto subjetivas como sociales, perpetuarán relaciones d...

  3. DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS

    P. Bernot

    2005-07-13

    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this activity is to predict dissolved concentrations or solubility limits for elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) relevant to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are provided in the form of tabulated functions with pH and log fCO{sub 2} as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. Even though selection of an appropriate set of radionuclides documented in Radionuclide Screening (BSC 2002 [DIRS 160059]) includes actinium, transport of Ac is not modeled in the total system performance assessment for the license application (TSPA-LA) model because of its extremely short half-life. Actinium dose is calculated in the TSPA-LA by assuming secular equilibrium with {sup 231}Pa (Section 6.10); therefore, Ac is not analyzed in this report. The output data from this report are fundamental inputs for TSPA-LA used to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for the actinides discussed in this report. These models cover broad ranges of environmental conditions so they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or

  4. DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS

    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this activity is to predict dissolved concentrations or solubility limits for elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) relevant to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are provided in the form of tabulated functions with pH and log fCO2 as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. Even though selection of an appropriate set of radionuclides documented in Radionuclide Screening (BSC 2002 [DIRS 160059]) includes actinium, transport of Ac is not modeled in the total system performance assessment for the license application (TSPA-LA) model because of its extremely short half-life. Actinium dose is calculated in the TSPA-LA by assuming secular equilibrium with 231Pa (Section 6.10); therefore, Ac is not analyzed in this report. The output data from this report are fundamental inputs for TSPA-LA used to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for the actinides discussed in this report. These models cover broad ranges of environmental conditions so they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or otherwise

  5. Detection of rare earth elements in Powder River Basin sub-bituminous coal ash using laser-induced breakdown spectroscopy (LIBS)

    Tran, Phuoc [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State; Mcintyre, Dustin [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State

    2015-10-01

    We reported our preliminary results on the use of laser-induced breakdown spectroscopy to analyze the rare earth elements contained in ash samples from Powder River Basin sub-bituminous coal (PRB-coal). We have identified many elements in the lanthanide series (cerium, europium, holmium, lanthanum, lutetium, praseodymium, promethium, samarium, terbium, ytterbium) and some elements in the actinide series (actinium, thorium, uranium, plutonium, berkelium, californium) in the ash samples. In addition, various metals were also seen to present in the ash samples

  6. The identification of soil radionuclides in the area of Puspiptek and surrounding

    The area of PUSPIPTEK and the surrounding are potentially exposed by radionuclides, because the operation of the nuclear research plant. The PPTN Serpong was operated long than 10 years, therefore soil radioactivity need to evaluate. The determination of radioactivity in the soil samples which be taken from research location using gamma spectrometry on June-August. The result of the research identified natural radionuclides K-40; Thorium decay series Ac-228, Bi-212, Pb-212, Tl-208, Ra-224 and Rn-220; Uranium decay series Bi-214, Pa-234, Pb-214 and Actinium decay series Bi-211, Po-211. There are no identification radionuclides produce from the activation of PPTN Serpong

  7. Dicty_cDB: Contig-U14370-1 [Dicty_cDB

    Full Text Available n 73 Query: 74 ggtattgntgaaactgaattactatcncataatnaatccnatgaaaaagttttnnacnca 133 ||||||||||||||||||||||||||||...|||||||||||||||||||||||||||||||| Sbjct: 74 ggtattgntgaaactgaattactatcncataatnaatccnatgaaaaagttttnnacnca 133 ...||||| Sbjct: 217 tcaaatacaattaaaaaanaagntgntcnaaaaaatgtnagagtaatgatnatttccccn 158 Query: 74 ggtattgntgaaactgaattactatcncataatnaatccna...|||||||||||||||||||||||||||| Sbjct: 157 ggtattgntgaaactgaattactatcncataatnaatccnatgaaaaagttttnnacnca 98 Quer

  8. The Technological Enhancement of Normally Occurring Radioactive Materials in Red Mud due to the Production of Alumina

    Maurice O. Miller

    2016-01-01

    Full Text Available This study investigates the level of technological enhancement of normally occurring radioactive materials (TENORM in the red mud waste due to the production of alumina in Jamaica. Technological enhancements factors (TEF were determined for the uranium, thorium, actinium series, their progenies, and the nonseries potassium-40 using gamma spectrometry. The study concluded that bauxite production technologically enhances the uranium progenies Th-234, Pb-214, Bi-214, and Pa-234 and the thorium-232 progenies Ac-228, Pb-212, and Bi-212 in red mud. The actinium series was technologically enhanced, but K-40 and the thorium daughter, Tl-208, were reduced. The spectrometric comparison of Tl-208 (at 510 keV was unexpected since its other photopeaks at 583 keV, 934 keV, and 968 keV were markedly different. An explanation for this anomaly is discussed. An explanation regarding the process of accumulation and fractionation of organically derived phosphate deposits and potassium-feldspar is offered to explain the spectrometric differences between the alumina product and its waste material, red mud.

  9. An aerial radiological survey of the Sandia National Laboratories and surrounding area

    A team from the Remote Sensing Laboratory conducted an aerial radiological survey of the area surrounding the Sandia National Laboratories and Kirtland Air Force Base in Albuquerque, New Mexico, during March and April 1993. The survey team measured the terrestrial gamma radiation at the site to determine the levels of natural and man-made radiation. This survey includes the areas covered by a previous survey in 1981. The results of the aerial survey show a background exposure rate which varies between 5 and 18 μR/h plus an approximate 6 μR/h contribution from cosmic rays. The major radioactive isotopes found in this survey were: potassium-40, thallium-208, bismuth-214, and actinium-228, which are all naturally-occurring isotopes, and cobalt-60, cesium-137, and excess amounts of thallium-208 and actinium-228, which are due to human actions in the survey area. In regions away from man-made activity, the exposure rates inferred from this survey's gamma ray measurements agree almost exactly with the exposure rates inferred from the 1981 survey. In addition to the aerial measurements, another survey team conducted in situ and soil sample radiation measurements at three sites within the survey perimeter. These ground-based measurements agree with the aerial measurements within ± 5%

  10. Mixed valency of the RE and Ac ions in solid states

    Full text: This review is devoted to consideration of the methods and results of the theoretical and experimental investigations of the electronic state of the rare earths and actinium ions in the separate compound. The methods of the high resolution X ray spectroscopy were used for our consideration. Energy of the X ray lines of the rare earths and actinium ions in free state and solid states was study carefully. Valency shifts of X Ray lines under change of electronic state of nf - ions in different oxide, fluoride and chloride compounds were determined for K -, L- and M - lines for these ions with accuracy near 10 -100 MeV. We studied the electronic state of nf- ions which is changed from '+2' to '+4' and determined the concentration of ions in different electronic state. Relative error for theoretical energy of the most lines for HFP - approach in comparison with experiment is less than 0.5%, and deviation for concentration is less than 5%