International Nuclear Information System (INIS)
Keller, C.
1977-01-01
There are only very few investigations dealing with the chemical and physical properties of actinium, the lanthanum homologue in the actinide series, 227 Ac, the only long-lived isotope can be produced in gram amounts only by neutron irradiation of 226 Ra, the amounts occurring in nature are too low for isolation (about 1 μg 227 Ac/1 uranium ore). Experimental work with 227 Ac gives rise to a lot of problems due to the radiation characteristics of the 227 Ac daughter nuclides. Therefore, the metal and the only ten solid compounds, prepared up to now, have been isolated in the microgram scale. Due to the high specific activity of 227 Ac, the preparation of a lot of compounds, e.g. metal-organic compounds seems to be very difficult, if not impossible. The properties of actinium in aqueous solutions have been deduced from experiments in the tracer scale only. The present investigations on actinium show that only the oxidation state + 3 exists - only radiopolarographic studies indicate the possibility of a lower valancy state (Ac 2+ ). - This review will give a critical and comprehensive description on the present knowledge about this element. The presently decreasing interest in the development of thermionic batteries using 227 Ac 2 O 3 radionuclide also implies that there will be only small progress in the chemistry of this radio-element in the near future. (orig.) [de
Application of partition chromatography method for separation and analysis of actinium radionuclides
International Nuclear Information System (INIS)
Sinitsina, G.S.; Shestakova, I.A.; Shestakov, B.I.; Plyushcheva, N.A.; Malyshev, N.A.; Belyatskij, A.F.; Tsirlin, V.A.
1979-01-01
The method of partition chromatography is considered with the use of different extractants for the extraction of actinium-227, actinium-225 and actinium-228. It is advisable to extract actinium-227 from the irradiated radium with the help of D2FGFK. The use of 2DEGFK allows us to separate actinium-227 from alkaline and alkaline-earth elements. Amines have a higher radiative stability. An express-method has been developed for the identification of actinium-227 with TOA by its intrinsic α-emission in nonequilibrium preparations of irradiated radium-226 of small activity. Actinium-225 is extracted from uranium-233 with due regard for the fact that U, Th, and Ac are extracted differently by TBP from HNO 3 solutions. With the help of the given procedure one can reach the purifying coefficient of 10 4 . Actinium-228 is extracted from the radiummesothorium preparations by a deposition of decay products, including polonium-210 on the iron hydroxyde. Actinium-228 extraction from the mixture of radium radionuclides is performed by the partition chromatography method on D2EGFK. All the procedures for separation of actinium isotopes by the above methods are described
Separation of protactinum, actinium, and other radionuclides from proton irradiated thorium target
Fassbender, Michael E.; Radchenko, Valery
2018-04-24
Protactinium, actinium, radium, radiolanthanides and other radionuclide fission products were separated and recovered from a proton-irradiated thorium target. The target was dissolved in concentrated HCl, which formed anionic complexes of protactinium but not with thorium, actinium, radium, or radiolanthanides. Protactinium was separated from soluble thorium by loading a concentrated HCl solution of the target onto a column of strongly basic anion exchanger resin and eluting with concentrated HCl. Actinium, radium and radiolanthanides elute with thorium. The protactinium that is retained on the column, along with other radionuclides, is eluted may subsequently treated to remove radionuclide impurities to afford a fraction of substantially pure protactinium. The eluate with the soluble thorium, actinium, radium and radiolanthanides may be subjected to treatment with citric acid to form anionic thorium, loaded onto a cationic exchanger resin, and eluted. Actinium, radium and radiolanthanides that are retained can be subjected to extraction chromatography to separate the actinium from the radium and from the radio lanthanides.
Separation of actinium-227 from its daughter products by cationic resins technique
International Nuclear Information System (INIS)
Nastasi, M.J.C.
1976-01-01
A method for separating actinium-227 from its daughter products based on ion exchange principle is shown. Radionuclides mixture in perchloric acid 8,5 N and chloridric acid 0,5 N medium pass by a cationic resin column. Thorium-227 and actinium-227, which are retained by the resin, are eluted with nitric acid 6 N which releases actinium-227 while oxalic acid 7% is used for thorium-227 elution [pt
Separation of Actinium 227 from the uranium minerals
International Nuclear Information System (INIS)
Martinez-Tarango, S.
1991-01-01
The purpose of this work was to separate Actinium 227, whose content is 18%, from the mineral carnotite found in Gomez Chihuahua mountain range in Mexico. The mineral before processing is is pre-concentrated and passed, first through anionic exchange resins, later the eluate obtained is passed through cationic resins. The resins were 20-50 MESH QOWEX and 100-200 MESH 50 X 8-20 in some cased 200-400 MESH AG 50W-X8, 1X8 in other cases. The eluates from the ionic exchange were electrodeposited on stainless steel polished disc cathode and platinum electrode as anode; under a current ODF 10mA for 2.5 to 5 hours and of 100mA for .5 of an hour. it was possible to identify the Actinium 227 by means of its descendents, TH-227 and RA-223, through alpha spectroscopy. Due to the radiochemical purity which the electro deposits were obtained the Actinium 227 was low and was not quantitatively determined. A large majority of the members of the natural radioactive series 3 were identified and even alpha energies reported in the literature with very low percentages of non-identified emissions were observed. We conclude that a more precise study is needed concerning ionic exchange and electrodeposit to obtain an Actinium 227 of radiochemical purity. (Author)
Short history of radioactivity. No. XIII. The actinium and thorium series
Energy Technology Data Exchange (ETDEWEB)
Chalmers, T W
1950-06-16
Discussions of the actinium disintegration series (about 1905), the /sup 235/U or actinium series (as it is accepted today), the disintegration of thorium (about 1905), the thorium series in the modern form, and the 4n, 4n + 1, 4n + 2, and 4n + 3 series are presented.
Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232
Energy Technology Data Exchange (ETDEWEB)
Harvey, James T.; Nolen, Jerry; Vandergrift, George; Gomes, Itacil; Kroc, Tom; Horwitz, Phil; McAlister, Dan; Bowers, Del; Sullivan, Vivian; Greene, John
2011-12-30
The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces {approx}100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 Ge
The sorption of polonium, actinium and protactinium onto geological materials
International Nuclear Information System (INIS)
Baston, G.M.N.; Berry, J.A.; Brownsword, M.; Heath, T.G.; Ilett, D.J.; McCrohon, R.; Tweed, C.J.; Yui, M.
1999-01-01
This paper describes a combined experimental and modeling program of generic sorption studies to increase confidence in the performance assessment for a potential high-level radioactive waste repository in Japan. The sorption of polonium, actinium and protactinium onto geological materials has been investigated. Sorption of these radioelements onto bentonite, tuff and granodiorite from equilibrated de-ionized water was studied under reducing conditions at room temperature. In addition, the sorption of actinium and protactinium was investigated at 60 C. Thermodynamic chemical modeling was carried out to aid interpretation of the results
The sorption of polonium, actinium and protactinium onto geological materials
Energy Technology Data Exchange (ETDEWEB)
Baston, G.M.N.; Berry, J.A.; Brownsword, M.; Heath, T.G.; Ilett, D.J.; McCrohon, R.; Tweed, C.J.; Yui, M.
1999-07-01
This paper describes a combined experimental and modeling program of generic sorption studies to increase confidence in the performance assessment for a potential high-level radioactive waste repository in Japan. The sorption of polonium, actinium and protactinium onto geological materials has been investigated. Sorption of these radioelements onto bentonite, tuff and granodiorite from equilibrated de-ionized water was studied under reducing conditions at room temperature. In addition, the sorption of actinium and protactinium was investigated at 60 C. Thermodynamic chemical modeling was carried out to aid interpretation of the results.
Radchenko, V; Engle, J W; Wilson, J J; Maassen, J R; Nortier, F M; Taylor, W A; Birnbaum, E R; Hudston, L A; John, K D; Fassbender, M E
2015-02-06
Actinium-225 (t1/2=9.92d) is an α-emitting radionuclide with nuclear properties well-suited for use in targeted alpha therapy (TAT), a powerful treatment method for malignant tumors. Actinium-225 can also be utilized as a generator for (213)Bi (t1/2 45.6 min), which is another valuable candidate for TAT. Actinium-225 can be produced via proton irradiation of thorium metal; however, long-lived (227)Ac (t1/2=21.8a, 99% β(-), 1% α) is co-produced during this process and will impact the quality of the final product. Thus, accurate assays are needed to determine the (225)Ac/(227)Ac ratio, which is dependent on beam energy, irradiation time and target design. Accurate actinium assays, in turn, require efficient separation of actinium isotopes from both the Th matrix and highly radioactive activation by-products, especially radiolanthanides formed from proton-induced fission. In this study, we introduce a novel, selective chromatographic technique for the recovery and purification of actinium isotopes from irradiated Th matrices. A two-step sequence of cation exchange and extraction chromatography was implemented. Radiolanthanides were quantitatively removed from Ac, and no non-Ac radionuclidic impurities were detected in the final Ac fraction. An (225)Ac spike added prior to separation was recovered at ≥ 98%, and Ac decontamination from Th was found to be ≥ 10(6). The purified actinium fraction allowed for highly accurate (227)Ac determination at analytical scales, i.e., at (227)Ac activities of 1-100 kBq (27 nCi to 2.7 μCi). Copyright © 2014 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Cuillerdier, C.; Musikas, C.
1993-01-01
Present invention is concerned with new amides with nitrogenous heterocyclic substituent utilizable to separate trivalent actinium series from trivalent lanthanides. In these molecules, it is possible to obtain particularly covalent liaison which has more affinity with 5f series, that is to say actinium series; included a manufacturing process for these amides with nitrogenous heterocyclic substituent
Analysis of the gamma spectra of the uranium, actinium, and thorium decay series
International Nuclear Information System (INIS)
Momeni, M.H.
1981-09-01
This report describes the identification of radionuclides in the uranium, actinium, and thorium series by analysis of gamma spectra in the energy range of 40 to 1400 keV. Energies and absolute efficiencies for each gamma line were measured by means of a high-resolution germanium detector and compared with those in the literature. A gamma spectroscopy method, which utilizes an on-line computer for deconvolution of spectra, search and identification of each line, and estimation of activity for each radionuclide, was used to analyze soil and uranium tailings, and ore
Actinium-225 and Bismuth-213 Alpha Particle Immunotherapy of Cancer
International Nuclear Information System (INIS)
Scheinberg, D.
2013-01-01
Nuclides with appropriate half-lives and emission characteristics that would be potent enough to kill neoplastic cells in the small quantities that reach targets in vivo, include the high linear energy transfer (LET) alpha emitters such as Actinium-225 and Bi-213. We developed methods for the attachment of radiometals via bifunctional chelates to monoclonal antibodies (mAb) without loss of immunoreactivity. We developed alphaemitting Bi-213 lintuzumab constructs, characterized and qualified them in preclinical models, and took them into human clinical trials in patients with AML. Safety, anti-leukemic activity, and complete responses (CR’s) have been demonstrated through phase 2 trilas. Bi-213 is produced in a portable small generator device based on Ac- 225 in the hospital nuclear medicine lab. The isotope is then purified, attached to the antibody, and the product is qualified and processed. Despite this success, the major obstacle to the widespread use of these drugs remains the short 213 Bi half-life (46 minutes), which poses a large logistical hurdle before injection and limits its delivery to only the most accessible cancer cells after injection
Spectroscopy of 214Bi and systematics of 210,212,214Pb(0+) long->β-210,212,214Bi(0-)
International Nuclear Information System (INIS)
Berant, Z.; Schuhmann, R.B.; Alburger, D.E.; Chou, W.T.; Gill, R.L.; Warburton, E.K.; Wesselborg, C.
1991-01-01
Experiments designed to provide more information on the spectroscopy of 214 Bi, and on 214 Pb(β - ) 214 Bi in particular, were undertaken because of interest in first-forbidden β decay in the lead region. The experiments consisted of γ-γ coincidences and angular correlations, conversion electron measurements, level lifetime determinations, and precision γ-ray energy measurements. The 352-keV level of 214 Bi was found to be a strong candidate (and the only candidate) for the 0 1 - state. Recent additions to the 214 Pb decay scheme are confirmed by γ-γ coincidence measurements. A careful evaluation of the 214 Bi level scheme is made with emphasis on separating experimentally based conclusions from speculations based on systematics and other ''weak'' arguments. Shell-model calculations of the spectroscopy of 210,212 Bi and 210,212 Pb(β - ) 210,212 Bi were performed using a modification of the Kuo-Herling realistic interaction. These calculations and a generalized seniority model provide a basis for an examination of the systematics of the A=210, 212, 214 spectroscopy and β decay. The generalized seniority model is found to be a quite good approximation which provides a quantitative understanding of the 214 Pb decay rates
2010-04-01
... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Marketing. 884.214 Section 884.214... HOUSING PROJECTS Project Development and Operation § 884.214 Marketing. (a) Compliance with equal opportunity requirements. Marketing of units and selection of Families by the Owner shall be in accordance...
2010-07-01
... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Costs. 214.11 Section 214.11... SUPPLIES OF DRINKING WATER § 214.11 Costs. Costs incurred by the Corps of Engineers in furnishing emergency... by the community generally will not be required. Costs of necessary measures for the decontamination...
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Audit. 214.500 Section 214.500... PROGRAM Other Federal Requirements § 214.500 Audit. Housing counseling grant recipients and subrecipients shall be subject to the audit requirements contained in 24 CFR parts 84 and 85. HUD must be provided a...
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Definition. 214.1 Section 214.1 Indians BUREAU OF INDIAN... MINING, EXCEPT OIL AND GAS § 214.1 Definition. The term “officer in charge” shall refer to the... time, be in charge of the Osage Agency and school, or any person who may be detailed by the Secretary...
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLH214 (Link to dictyBase) - - - Contig-U16455-1 SLH214E (Link... to Original site) - - - - - - SLH214E 308 Show SLH214 Library SL (Link to library) Clone ID SLH214 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-A/SLH214Q.Seq.d/ Representative seq. ID SLH21...4E (Link to Original site) Representative DNA sequence >SLH214 (SLH214Q) /CSM/SL/SLH2-A/SLH214Q.Seq.d/ GTTGA...a: 0.00 m3b: 0.00 m_ : 1.00 48.0 %: nuclear 28.0 %: mitochondrial 20.0 %: cytoplasmic 4.0 %: peroxisomal >> prediction for SLH2
49 CFR 214.4 - Preemptive effect.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Preemptive effect. 214.4 Section 214.4 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD WORKPLACE SAFETY General § 214.4 Preemptive effect. Under 49 U.S.C...
46 CFR 10.214 - Security Check.
2010-10-01
... 46 Shipping 1 2010-10-01 2010-10-01 false Security Check. 10.214 Section 10.214 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY MERCHANT MARINE OFFICERS AND SEAMEN MERCHANT MARINER CREDENTIAL General Requirements for All Merchant Mariner Credentials § 10.214 Security Check. Until April 15, 2009...
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Foul time. 214.323 Section 214.323 Transportation... TRANSPORTATION RAILROAD WORKPLACE SAFETY Roadway Worker Protection § 214.323 Foul time. Working limits established on controlled track through the use of foul time procedures shall comply with the following...
49 CFR 214.325 - Train coordination.
2010-10-01
..., DEPARTMENT OF TRANSPORTATION RAILROAD WORKPLACE SAFETY Roadway Worker Protection § 214.325 Train coordination. Working limits established by a roadway worker through the use of train coordination shall comply with the... 49 Transportation 4 2010-10-01 2010-10-01 false Train coordination. 214.325 Section 214.325...
49 CFR 195.214 - Welding procedures.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Welding procedures. 195.214 Section 195.214... PIPELINE Construction § 195.214 Welding procedures. (a) Welding must be performed by a qualified welder in accordance with welding procedures qualified under Section 5 of API 1104 or Section IX of the ASME Boiler and...
Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL
International Nuclear Information System (INIS)
Raeder, S.; Bastin, B.; Block, M.; Creemers, P.; Delahaye, P.; Ferrer, R.; Fléchard, X.; Franchoo, S.; Ghys, L.; Gaffney, L.P.; Granados, C.; Heinke, R.; Hijazi, L.
2016-01-01
To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.
Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL
Energy Technology Data Exchange (ETDEWEB)
Raeder, S., E-mail: s.raeder@gsi.de [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Bastin, B. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Block, M. [Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Institut für Kernchemie, Johannes Gutenberg Universität, 55128 Mainz (Germany); Creemers, P. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Delahaye, P. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Ferrer, R. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Fléchard, X. [LPC Caen, ENSICAEN, Université de Caen, CNRS/IN2P3, Caen (France); Franchoo, S. [Institute de Physique Nucléaire (IPN) d’Orsay, 91406 Orsay, Cedex (France); Ghys, L. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); SCK-CEN, Belgian Nuclear Research Center, Boeretang 200, 2400 Mol (Belgium); Gaffney, L.P.; Granados, C. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Heinke, R. [Institut für Physik, Johannes Gutenberg Universität, 55128 Mainz (Germany); Hijazi, L. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); and others
2016-06-01
To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.
48 CFR 12.214 - Cost Accounting Standards.
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Cost Accounting Standards. 12.214 Section 12.214 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION... Items 12.214 Cost Accounting Standards. Cost Accounting Standards (CAS) do not apply to contracts and...
48 CFR 214.202-5 - Descriptive literature.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Descriptive literature. 214.202-5 Section 214.202-5 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS... 214.202-5 Descriptive literature. (c) Requirements of invitation for bids. When brand name or equal...
2010-10-01
... 49 Transportation 5 2010-10-01 2010-10-01 false Reciprocity. 384.214 Section 384.214 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL MOTOR CARRIER SAFETY... Reciprocity. The State shall allow any person to operate a CMV in the State who is not disqualified from...
2010-04-01
... Internet or other electronic media. (b) Local funding sources. HUD recommends that approved agencies seek and secure funding from funding sources that may include local and state governments, private... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Funding. 214.311 Section 214.311...
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Trainees. 553.214 Section 553.214 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR REGULATIONS APPLICATION OF THE FAIR LABOR STANDARDS ACT TO EMPLOYEES OF STATE AND LOCAL GOVERNMENTS Fire Protection and Law...
36 CFR 2.14 - Sanitation and refuse.
2010-07-01
... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Sanitation and refuse. 2.14 Section 2.14 Parks, Forests, and Public Property NATIONAL PARK SERVICE, DEPARTMENT OF THE INTERIOR RESOURCE PROTECTION, PUBLIC USE AND RECREATION § 2.14 Sanitation and refuse. (a) The following are...
49 CFR 214.523 - Hi-rail vehicles.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Hi-rail vehicles. 214.523 Section 214.523..., DEPARTMENT OF TRANSPORTATION RAILROAD WORKPLACE SAFETY On-Track Roadway Maintenance Machines and Hi-Rail Vehicles § 214.523 Hi-rail vehicles. (a) The hi-rail gear of all hi-rail vehicles shall be inspected for...
30 CFR 77.214 - Refuse piles; general.
2010-07-01
... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Refuse piles; general. 77.214 Section 77.214... Installations § 77.214 Refuse piles; general. (a) Refuse piles constructed on or after July 1, 1971, shall be..., tipples, or other surface installations and such piles shall not be located over abandoned openings or...
22 CFR 214.42 - Uniform pay guidelines.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Uniform pay guidelines. 214.42 Section 214.42... Advisory Committees § 214.42 Uniform pay guidelines. (a) A.I.D. follows OMB/CSC guidelines in section 11 of... experts, their compensation shall be fixed in accordance with CSC guidelines and regulations, and the...
2010-10-01
... 47 Telecommunication 5 2010-10-01 2010-10-01 false Purpose. 214.1 Section 214.1 Telecommunication OFFICE OF SCIENCE AND TECHNOLOGY POLICY AND NATIONAL SECURITY COUNCIL PROCEDURES FOR THE USE AND... provide guidance for the use of the radio spectrum in a period of war, or a threat of war, or a state of...
2010-01-01
... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Report. 21.4 Section 21.4 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY MINIMUM SECURITY DEVICES AND PROCEDURES, REPORTS OF... Report. The security officer for a national bank shall report at least annually to the bank's board of...
49 CFR 214.113 - Head protection.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Head protection. 214.113 Section 214.113 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... conform to the national consensus standards for industrial head protection (American National Standards...
48 CFR 5433.214. - Alternative Dispute Resolution (ADR).
2010-10-01
... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Alternative Dispute Resolution (ADR). 5433.214. Section 5433.214. Federal Acquisition Regulations System DEFENSE LOGISTICS AGENCY, DEPARTMENT OF DEFENSE PROTESTS, DISPUTES AND APPEALS 5433.214. Alternative Dispute Resolution (ADR). The...
49 CFR 214.115 - Foot protection.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Foot protection. 214.115 Section 214.115... protection. (a) The railroad or railroad contractor shall require railroad bridge workers to wear foot protection equipment when potential foot injury may result from impact, falling or flying objects, electrical...
49 CFR 214.117 - Eye and face protection.
2010-10-01
... corrective lenses, when required by this section to wear eye protection, shall be protected by goggles or... 49 Transportation 4 2010-10-01 2010-10-01 false Eye and face protection. 214.117 Section 214.117..., DEPARTMENT OF TRANSPORTATION RAILROAD WORKPLACE SAFETY Bridge Worker Safety Standards § 214.117 Eye and face...
International Nuclear Information System (INIS)
Quintero P, E.; Rojas M, V.P.; Cervantes N, M.L.; Gaso P, M.I.
2002-01-01
In this work a comparison between the 226 Ra concentration and its decay products ( 214 Pb and 214 Bi) in soil samples is presented before and after that the decay mentioned products reach the equilibria with the radium. Moreover, the obtained daughter/father ratio is presented; and the correction factor for the calculus of the 214 Pb and 214 Bi quantification without being necessary to wait until that the secular equilibria has been established. For the quantification of the concentration of the three radionuclides the gamma spectrometry technique was used. (Author)
22 CFR 214.37 - Public access to committee records.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Public access to committee records. 214.37 Section 214.37 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT ADVISORY COMMITTEE MANAGEMENT Operation of Advisory Committees § 214.37 Public access to committee records. Records maintained in...
MicroRNA-214 Suppresses Gluconeogenesis by Targeting Activating Transcriptional Factor 4*
Li, Kai; Zhang, Jin; Yu, Junjie; Liu, Bin; Guo, Yajie; Deng, Jiali; Chen, Shanghai; Wang, Chunxia; Guo, Feifan
2015-01-01
Although the gluconeogenesis pathway is already a target for the treatment of type 2 diabetes, the potential role of microRNAs (miRNAs) in gluconeogenesis remains unclear. Here, we investigated the physiological functions of miR-214 in gluconeogenesis. The expression of miR-214 was suppressed by glucagon via protein kinase A signaling in primary hepatocytes, and miR-214 was down-regulated in the livers of fasted, high fat diet-induced diabetic and leptin receptor-mutated (db/db) mice. The overexpression of miR-214 in primary hepatocytes suppressed glucose production, and silencing miR-214 reversed this effect. Gluconeogenesis was suppressed in the livers of mice injected with an adenovirus expressing miR-214 (Ad-miR-214). Additionally, Ad-miR-214 alleviated high fat diet-induced elevation of gluconeogenesis and hyperglycemia. Furthermore, we found that activating transcription factor 4 (ATF4), a reported target of miR-214, can reverse the suppressive effect of miR-214 on gluconeogenesis in primary hepatocytes, and this suppressive effect was blocked in liver-specific ATF4 knock-out mice. ATF4 regulated gluconeogenesis via affecting forkhead box protein O1 (FOXO1) transcriptional activity. Finally, liver-specific miR-214 transgenic mice exhibited suppressed gluconeogenesis and reduced expression of ATF4, phosphoenolpyruvate carboxykinase, and glucose-6-phosphatase in liver. Taken together, our results suggest that the miR-214-ATF4 axis is a novel pathway for the regulation of hepatic gluconeogenesis. PMID:25657009
24 CFR 214.313 - Housing counseling fees.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Housing counseling fees. 214.313... HOUSING COUNSELING PROGRAM Program Administration § 214.313 Housing counseling fees. (a) Participating agencies may charge reasonable and customary fees for housing education and counseling services, as long as...
49 CFR 214.311 - Responsibility of employers.
2010-10-01
... Responsibility of employers. (a) Each employer is responsible for the understanding and compliance by its employees with its rules and the requirements of this part. (b) Each employer shall guarantee each employee... 49 Transportation 4 2010-10-01 2010-10-01 false Responsibility of employers. 214.311 Section 214...
49 CFR 214.341 - Roadway maintenance machines.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Roadway maintenance machines. 214.341 Section 214... Roadway maintenance machines. (a) Each employer shall include in its on-track safety program specific provisions for the safety of roadway workers who operate or work near roadway maintenance machines. Those...
40 CFR 86.214-94 - Analytical gases.
2010-07-01
... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Analytical gases. 86.214-94 Section 86.214-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED... Later Model Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium-Duty...
MicroRNA-214 suppresses gluconeogenesis by targeting activating transcriptional factor 4.
Li, Kai; Zhang, Jin; Yu, Junjie; Liu, Bin; Guo, Yajie; Deng, Jiali; Chen, Shanghai; Wang, Chunxia; Guo, Feifan
2015-03-27
Although the gluconeogenesis pathway is already a target for the treatment of type 2 diabetes, the potential role of microRNAs (miRNAs) in gluconeogenesis remains unclear. Here, we investigated the physiological functions of miR-214 in gluconeogenesis. The expression of miR-214 was suppressed by glucagon via protein kinase A signaling in primary hepatocytes, and miR-214 was down-regulated in the livers of fasted, high fat diet-induced diabetic and leptin receptor-mutated (db/db) mice. The overexpression of miR-214 in primary hepatocytes suppressed glucose production, and silencing miR-214 reversed this effect. Gluconeogenesis was suppressed in the livers of mice injected with an adenovirus expressing miR-214 (Ad-miR-214). Additionally, Ad-miR-214 alleviated high fat diet-induced elevation of gluconeogenesis and hyperglycemia. Furthermore, we found that activating transcription factor 4 (ATF4), a reported target of miR-214, can reverse the suppressive effect of miR-214 on gluconeogenesis in primary hepatocytes, and this suppressive effect was blocked in liver-specific ATF4 knock-out mice. ATF4 regulated gluconeogenesis via affecting forkhead box protein O1 (FOXO1) transcriptional activity. Finally, liver-specific miR-214 transgenic mice exhibited suppressed gluconeogenesis and reduced expression of ATF4, phosphoenolpyruvate carboxykinase, and glucose-6-phosphatase in liver. Taken together, our results suggest that the miR-214-ATF4 axis is a novel pathway for the regulation of hepatic gluconeogenesis. © 2015 by The American Society for Biochemistry and Molecular Biology, Inc.
Energy Technology Data Exchange (ETDEWEB)
Quintero P, E.; Rojas M, V.P.; Cervantes N, M.L.; Gaso P, M.I. [Gerencia de Seguridad Radiologica, ININ, A.P. 18-1027, 11801 Mexico D.F. (Mexico)
2002-07-01
In this work a comparison between the {sup 226} Ra concentration and its decay products ({sup 214} Pb and {sup 214} Bi) in soil samples is presented before and after that the decay mentioned products reach the equilibria with the radium. Moreover, the obtained daughter/father ratio is presented; and the correction factor for the calculus of the {sup 214} Pb and {sup 214} Bi quantification without being necessary to wait until that the secular equilibria has been established. For the quantification of the concentration of the three radionuclides the gamma spectrometry technique was used. (Author)
49 CFR 214.331 - Definite train location.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Definite train location. 214.331 Section 214.331... location. A roadway worker may establish on-track safety by using definite train location only where... may only use definite train location to establish on-track safety at points where such procedures were...
40 CFR 211.214 - Removal of label.
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Removal of label. 211.214 Section 211... PRODUCT NOISE LABELING Hearing Protective Devices § 211.214 Removal of label. Section 10(a)(4) of the Act prohibits any person from removing, prior to sale, any label required by this subpart, by either physical...
47 CFR 90.214 - Transient frequency behavior.
2010-10-01
... 47 Telecommunication 5 2010-10-01 2010-10-01 false Transient frequency behavior. 90.214 Section 90... PRIVATE LAND MOBILE RADIO SERVICES General Technical Standards § 90.214 Transient frequency behavior... Behavior for Equipment Designed to Operate on 25 kHz Channels t1 4 ±25.0 kHz 5.0 ms 10.0 ms t2 ±12.5 kHz 20...
49 CFR 214.343 - Training and qualification, general.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Training and qualification, general. 214.343... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD WORKPLACE SAFETY Roadway Worker Protection § 214.343 Training and qualification, general. (a) No employer shall assign an employee to perform the duties of a...
31 CFR 800.214 - Foreign government-controlled transaction.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Foreign government-controlled transaction. 800.214 Section 800.214 Money and Finance: Treasury Regulations Relating to Money and Finance... control of a U.S. business by a foreign government or a person controlled by or acting on behalf of a...
48 CFR 1852.214-70 - Caution to offerors furnishing descriptive literature.
2010-10-01
... furnishing descriptive literature. 1852.214-70 Section 1852.214-70 Federal Acquisition Regulations System... CLAUSES Texts of Provisions and Clauses 1852.214-70 Caution to offerors furnishing descriptive literature... Descriptive Literature (DEC 1988) Bidders are cautioned against furnishing as a part of their bids descriptive...
5 CFR 531.214 - Setting pay upon promotion.
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Setting pay upon promotion. 531.214... Changes § 531.214 Setting pay upon promotion. (a) General. An agency must set an employee's payable rate of basic pay upon promotion following the rules in this section, consistent with 5 U.S.C. 5334(b...
8 CFR 214.14 - Alien victims of certain qualifying criminal activity.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Alien victims of certain qualifying criminal activity. 214.14 Section 214.14 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS NONIMMIGRANT CLASSES § 214.14 Alien victims of certain qualifying criminal activity. (a...
Development of an atmospheric 214Bi measuring instrument
International Nuclear Information System (INIS)
1975-01-01
Part of the radiation environment encountered during airborne gamma ray surveys is produced by 214 Bi existing in the atmosphere. The 214 Bi atmospheric concentration changes with time and location, and should be measured to process the acquired data correctly. Three methods of atmospheric 214 Bi measurement are evaluated in this work. These are: (1) an 11 1 / 2 '' dia. x 4'' thick NaI(Tl) crystal shielded from ground radiation, (2) a negatively charged wire to collect radioactive ions, and (3) a high volume air sampler collecting particulate matter on filter paper. The shielded detector and filter paper methods yield good results with the shielded detector producing a factor of about 10 times higher counting rate. The charged wire method gave very low counting rates where the shielded detector counting rates were about a factor of 100 times higher, and the results did not correlate with the 214 Bi atmospheric concentration as determined by the other two methods. The theory necessary to understand the collection and decay of the airborne radioactivity using the charged wire and filter paper methods is developed
13 CFR 120.214 - What conditions apply for variable interest rates?
2010-01-01
... interest rates? 120.214 Section 120.214 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Policies Specific to 7(a) Loans Maturities; Interest Rates; Loan and Guarantee Amounts § 120.214 What conditions apply for variable interest rates? A Lender may use a variable rate of interest...
34 CFR 668.214 - Participation rate index appeals.
2010-07-01
... 34 Education 3 2010-07-01 2010-07-01 false Participation rate index appeals. 668.214 Section 668... § 668.214 Participation rate index appeals. (a) Eligibility. (1) You may appeal a notice of a loss of... rate index for that cohort's fiscal year is equal to or less than 0.06015. (2) You may appeal a notice...
48 CFR 1552.214-71 - Contract award-other factors-formal advertising.
2010-10-01
... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Contract award-other factors-formal advertising. 1552.214-71 Section 1552.214-71 Federal Acquisition Regulations System ENVIRONMENTAL PROTECTION AGENCY CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and Clauses 1552.214-71 Contract...
32 CFR Appendix A to Part 45 - DD Form 214
2010-07-01
... 32 National Defense 1 2010-07-01 2010-07-01 false DD Form 214 A Appendix A to Part 45 National... CERTIFICATE OF RELEASE OR DISCHARGE FROM ACTIVE DUTY (DD FORM 214/5 SERIES) Pt. 45, App. A Appendix A to Part 45—DD Form 214 EC23OC91.003 EC23OC91.004 EC23OC91.005 EC23OC91.006 [54 FR 9985, Mar. 9, 1989] ...
32 CFR Appendix B to Part 45 - DD Form 214ws
2010-07-01
... 32 National Defense 1 2010-07-01 2010-07-01 false DD Form 214ws B Appendix B to Part 45 National... CERTIFICATE OF RELEASE OR DISCHARGE FROM ACTIVE DUTY (DD FORM 214/5 SERIES) Pt. 45, App. B Appendix B to Part 45—DD Form 214ws EC23OC91.007 ...
40 CFR 98.214 - Monitoring and QA/QC requirements.
2010-07-01
... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Monitoring and QA/QC requirements. 98.214 Section 98.214 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS... standard method or other enhanced industry consensus standard method published by an industry consensus...
5 CFR 591.214 - How does OPM collect prices?
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false How does OPM collect prices? 591.214 Section 591.214 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS ALLOWANCES AND DIFFERENTIALS Cost-of-Living Allowance and Post Differential-Nonforeign Areas Cost-Of-Living...
49 CFR 214.351 - Training and qualification of flagmen.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Training and qualification of flagmen. 214.351... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD WORKPLACE SAFETY Roadway Worker Protection § 214.351 Training and qualification of flagmen. (a) The training and qualification for roadway workers assigned the...
2010-07-01
... included in the evaluation. (a) Whether the criteria required by the law and outlined in § 214.6 have been... other than negligence attributable to the United States or its contractor. (3) To maintain and operate...
25 CFR 214.13 - Diligence; annual expenditures; mining records.
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Diligence; annual expenditures; mining records. 214.13... OSAGE RESERVATION LANDS, OKLAHOMA, FOR MINING, EXCEPT OIL AND GAS § 214.13 Diligence; annual expenditures; mining records. (a) Lessees shall exercise diligence in the conduct of prospecting and mining...
7 CFR 58.214 - General construction, repair and installation.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false General construction, repair and installation. 58.214... Service 1 Equipment and Utensils § 58.214 General construction, repair and installation. All equipment and utensils necessary to the manufacture of dry milk products, including pasteurizer, timing-pump or device...
49 CFR 214.345 - Training for all roadway workers.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Training for all roadway workers. 214.345 Section... ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD WORKPLACE SAFETY Roadway Worker Protection § 214.345 Training for all roadway workers. The training of all roadway workers shall include, as a minimum, the...
Port, Sarah A.; Mendes, Adélia; Valkova, Christina; Spillner, Christiane; Fahrenkrog, Birthe; Kaether, Christoph; Kehlenbach, Ralph H.
2016-01-01
Genetic rearrangements are a hallmark of several forms of leukemia and can lead to oncogenic fusion proteins. One example of an affected chromosomal region is the gene coding for Nup214, a nucleoporin that localizes to the cytoplasmic side of the nuclear pore complex (NPC). We investigated two such fusion proteins, SET-Nup214 and SQSTM1 (sequestosome)-Nup214, both containing C-terminal portions of Nup214. SET-Nup214 nuclear bodies containing the nuclear export receptor CRM1 were observed in the leukemia cell lines LOUCY and MEGAL. Overexpression of SET-Nup214 in HeLa cells leads to the formation of similar nuclear bodies that recruit CRM1, export cargo proteins, and certain nucleoporins and concomitantly affect nuclear protein and poly(A)+ RNA export. SQSTM1-Nup214, although mostly cytoplasmic, also forms nuclear bodies and inhibits nuclear protein but not poly(A)+ RNA export. The interaction of the fusion proteins with CRM1 is RanGTP-dependent, as shown in co-immunoprecipitation experiments and binding assays. Further analysis revealed that the Nup214 parts mediate the inhibition of nuclear export, whereas the SET or SQSTM1 part determines the localization of the fusion protein and therefore the extent of the effect. SET-Nup214 nuclear bodies are highly mobile structures, which are in equilibrium with the nucleoplasm in interphase and disassemble during mitosis or upon treatment of cells with the CRM1-inhibitor leptomycin B. Strikingly, we found that nucleoporins can be released from nuclear bodies and reintegrated into existing NPC. Our results point to nuclear bodies as a means of preventing the formation of potentially insoluble and harmful protein aggregates that also may serve as storage compartments for nuclear transport factors. PMID:27613868
Port, Sarah A; Mendes, Adélia; Valkova, Christina; Spillner, Christiane; Fahrenkrog, Birthe; Kaether, Christoph; Kehlenbach, Ralph H
2016-10-28
Genetic rearrangements are a hallmark of several forms of leukemia and can lead to oncogenic fusion proteins. One example of an affected chromosomal region is the gene coding for Nup214, a nucleoporin that localizes to the cytoplasmic side of the nuclear pore complex (NPC). We investigated two such fusion proteins, SET-Nup214 and SQSTM1 (sequestosome)-Nup214, both containing C-terminal portions of Nup214. SET-Nup214 nuclear bodies containing the nuclear export receptor CRM1 were observed in the leukemia cell lines LOUCY and MEGAL. Overexpression of SET-Nup214 in HeLa cells leads to the formation of similar nuclear bodies that recruit CRM1, export cargo proteins, and certain nucleoporins and concomitantly affect nuclear protein and poly(A) + RNA export. SQSTM1-Nup214, although mostly cytoplasmic, also forms nuclear bodies and inhibits nuclear protein but not poly(A) + RNA export. The interaction of the fusion proteins with CRM1 is RanGTP-dependent, as shown in co-immunoprecipitation experiments and binding assays. Further analysis revealed that the Nup214 parts mediate the inhibition of nuclear export, whereas the SET or SQSTM1 part determines the localization of the fusion protein and therefore the extent of the effect. SET-Nup214 nuclear bodies are highly mobile structures, which are in equilibrium with the nucleoplasm in interphase and disassemble during mitosis or upon treatment of cells with the CRM1-inhibitor leptomycin B. Strikingly, we found that nucleoporins can be released from nuclear bodies and reintegrated into existing NPC. Our results point to nuclear bodies as a means of preventing the formation of potentially insoluble and harmful protein aggregates that also may serve as storage compartments for nuclear transport factors. © 2016 by The American Society for Biochemistry and Molecular Biology, Inc.
22 CFR 214.38 - Submission of reports to the Library of Congress.
2010-04-01
... Congress. 214.38 Section 214.38 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT ADVISORY COMMITTEE MANAGEMENT Operation of Advisory Committees § 214.38 Submission of reports to the Library of Congress. (a) Each advisory committee is to file with the Library of Congress eight copies of each of its reports...
48 CFR 52.214-34 - Submission of Offers in the English Language.
2010-10-01
... the English Language. 52.214-34 Section 52.214-34 Federal Acquisition Regulations System FEDERAL... Provisions and Clauses 52.214-34 Submission of Offers in the English Language. As prescribed in 14.201-6(w), insert the following provision: Submission of Offers in the English Language (APR 1991) Offers submitted...
24 CFR 214.315 - Recordkeeping.
2010-04-01
... of clients with the same housing need. (f) Group education file. The housing counseling agency must... COUNSELING PROGRAM Program Administration § 214.315 Recordkeeping. (a) Recordkeeping system. Each participating housing counseling agency must maintain a recordkeeping system. The system must permit HUD to...
9 CFR 93.214 - Import permit and declaration for poultry.
2010-01-01
... poultry. 93.214 Section 93.214 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE EXPORTATION AND IMPORTATION OF ANIMALS (INCLUDING POULTRY) AND ANIMAL PRODUCTS IMPORTATION OF CERTAIN ANIMALS, BIRDS, FISH, AND POULTRY, AND CERTAIN ANIMAL, BIRD, AND POULTRY PRODUCTS...
50 CFR 216.214 - Prohibitions.
2010-10-01
..., DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking of Marine Mammals Incidental to Explosive Severance Activities Conducted During Offshore Structure Removal Operations on the Outer Continental Shelf in the U.S. Gulf of Mexico § 216.214 Prohibitions. No...
Valence configurations in 214Rn
International Nuclear Information System (INIS)
Dracoulis, G.D.; Byrne, A.P.; Stuchbery, A.E.; Bark, R.A.; Poletti, A.R.
1987-01-01
Excited states of 214 Rn, up to spins of ≅ 24 ℎ have been studied using γ-ray and electron spectroscopy following the 208 Pb( 9 Be,3n) 214 Rn reaction. The level scheme (which differs substantially from earlier work) is compared with the results of a semi-empirical shell model calculation. The availability of high-spin orbitals for the four valence protons and two valence neutrons, and the effect of the attractive proton-neutron interaction, leads to the prediction of high-spin states at an unusually low excitation energy. Experimentally, the high level density leads to difficulties in the level scheme assignments at high spin. Nevertheless, configuration assignments, supported by transition strengths deduced from the measured lifetimes (in the nanosecond region) are suggested for the main yrast states. The decay properties also suggest that configuration mixing is important. The possibility of a gradual transition to octupole deformation, implied by the decay properties of the 11 - and 10 + yrast states is also discussed. (orig.)
49 CFR 214.513 - Retrofitting of existing on-track roadway maintenance machines; general.
2010-10-01
... maintenance machines; general. 214.513 Section 214.513 Transportation Other Regulations Relating to... SAFETY On-Track Roadway Maintenance Machines and Hi-Rail Vehicles § 214.513 Retrofitting of existing on-track roadway maintenance machines; general. (a) Each existing on-track roadway maintenance machine...
49 CFR 214.515 - Overhead covers for existing on-track roadway maintenance machines.
2010-10-01
... maintenance machines. 214.515 Section 214.515 Transportation Other Regulations Relating to Transportation... Roadway Maintenance Machines and Hi-Rail Vehicles § 214.515 Overhead covers for existing on-track roadway maintenance machines. (a) For those existing on-track roadway maintenance machines either currently or...
2010-07-01
... providing emergency supplies of clean drinking water. Sewage treatment and disposal, and other sanitary... with contamination of water used in its process is not eligible. The drinking water used by the people... SUPPLIES OF DRINKING WATER § 214.6 Discussion. (a) The amendment provides for furnishing emergency supplies...
23 CFR 973.214 - Indian lands congestion management system (CMS).
2010-04-01
... 23 Highways 1 2010-04-01 2010-04-01 false Indian lands congestion management system (CMS). 973.214... HIGHWAYS MANAGEMENT SYSTEMS PERTAINING TO THE BUREAU OF INDIAN AFFAIRS AND THE INDIAN RESERVATION ROADS PROGRAM Bureau of Indian Affairs Management Systems § 973.214 Indian lands congestion management system...
46 CFR 199.214 - Immersion suits and thermal protective aids.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Immersion suits and thermal protective aids. 199.214... Passenger Vessels § 199.214 Immersion suits and thermal protective aids. (a) Each passenger vessel must... an immersion suit. (c) The immersion suits and thermal protective aids required under paragraphs (a...
22 CFR 214.51 - Administrative review of denial for public access to records.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Administrative review of denial for public access to records. 214.51 Section 214.51 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT ADVISORY COMMITTEE MANAGEMENT Administrative Remedies § 214.51 Administrative review of denial for public access to...
25 CFR 214.21 - Inspection of lessees' books and records.
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Inspection of lessees' books and records. 214.21 Section... OSAGE RESERVATION LANDS, OKLAHOMA, FOR MINING, EXCEPT OIL AND GAS § 214.21 Inspection of lessees' books... premises for the purpose of inspection, and their books and records showing manner of operations and...
27 CFR 555.214 - Storage within types 1, 2, 3, and 4 magazines.
2010-04-01
..., 3, and 4 magazines. 555.214 Section 555.214 Alcohol, Tobacco Products, and Firearms BUREAU OF... Storage § 555.214 Storage within types 1, 2, 3, and 4 magazines. (a) Explosive materials within a magazine... materials are not to be unpacked or repacked inside a magazine or within 50 feet of a magazine, and must not...
International Nuclear Information System (INIS)
Koumarianou, E.; Loktionova, N.S.; Fellner, M.; Roesch, F.; Thews, O.; Pawlak, D.; Archimandritis, S.C.; Mikolajczak, R.
2012-01-01
Aim: In the present study we demonstrate the in vitro and in vivo comparison of the 44 Sc and 68 Ga labeled DOTA-BN[2-14]NH 2 . 44 Sc is a positron emitter with a half life of 3.92 h. Hence it could be used for PET imaging with ligands requiring longer observation time than in the case of 68 Ga. Methods: The binding affinity of nat Sc-DOTA-BN[2-14]NH 2 and nat Ga-DOTA-BN[2-14]NH 2 to GRP receptors was studied in competition to [ 125 I-Tyr 4 ]-Bombesin in the human prostate cancer cell line PC-3. A preliminary biodistribution in normal rats was performed, while first microPET images were assessed in male Copenhagen rats bearing the androgen-independent Dunning R-3327-AT-1 prostate cancer tumor. Results: The affinity to GRP receptors in the PC-3 cell line was higher for nat Ga-DOTA-BN[2-14]NH 2 (IC 50 (nM)=0.85±0.06) than that of nat Sc-DOTA-BN[2-14]NH 2 (IC 50 (nM)=6.49±0.13). The internalization rate of 68 Ga labeled DOTA-BN[2-14]NH 2 was slower than that of 44 Sc, but their final internalization percents were comparable. 68 Ga-DOTA-BN[2-14]NH 2 was externalized faster than 44 Sc-DOTA-BN[2-14]NH 2 . The biodistribution of 44 Sc-DOTA-BN[2-14]NH 2 and 68 Ga-DOTA-BN[2-14]NH 2 in normal rats revealed a higher uptake in target organs and tissues of the first one while both excreted mainly through urinary tract. In microPET images both tracers were accumulated in the tumor with similar uptake patterns. Conclusions: Despite the differences in the receptor affinity both the 68 Ga- and the 44 Sc-labeled DOTA-BN[2-14]NH 2 tracers showed comparable distribution and similar time constants of uptake and elimination. Moreover no differences in tumor accumulation (neither in the overall uptake nor in the dynamics) were observed from the microPet imaging. From that perspective the use of either 44 Sc or 68 Ga for detecting tumors with GRP receptors is equivalent. - Highlights: ► In vitro and in vivo evaluation of 44 Sc- and 68 Ga-DOTA-BN[2-14]NH 2 in reference to published
49 CFR 214.5 - Responsibility for compliance.
2010-10-01
..., DEPARTMENT OF TRANSPORTATION RAILROAD WORKPLACE SAFETY General § 214.5 Responsibility for compliance. Any... railroad; a manager, supervisor, official, or other employee or agent of a railroad; any owner...
Koumarianou, E; Loktionova, N S; Fellner, M; Roesch, F; Thews, O; Pawlak, D; Archimandritis, S C; Mikolajczak, R
2012-12-01
In the present study we demonstrate the in vitro and in vivo comparison of the (44)Sc and (68)Ga labeled DOTA-BN[2-14]NH(2). (44)Sc is a positron emitter with a half life of 3.92 h. Hence it could be used for PET imaging with ligands requiring longer observation time than in the case of (68)Ga. The binding affinity of (nat)Sc-DOTA-BN[2-14]NH(2) and (nat)Ga-DOTA-BN[2-14]NH(2) to GRP receptors was studied in competition to [(125)I-Tyr(4)]-Bombesin in the human prostate cancer cell line PC-3. A preliminary biodistribution in normal rats was performed, while first microPET images were assessed in male Copenhagen rats bearing the androgen-independent Dunning R-3327-AT-1 prostate cancer tumor. The affinity to GRP receptors in the PC-3 cell line was higher for (nat)Ga-DOTA-BN[2-14]NH(2) (IC(50)(nM)=0.85 ± 0.06) than that of (nat)Sc-DOTA-BN[2-14]NH(2) (IC(50) (nM)=6.49 ± 0.13). The internalization rate of (68)Ga labeled DOTA-BN[2-14]NH(2) was slower than that of (44)Sc, but their final internalization percents were comparable. (68)Ga-DOTA-BN[2-14]NH(2) was externalized faster than (44)Sc-DOTA-BN[2-14]NH(2). The biodistribution of (44)Sc-DOTA-BN[2-14]NH(2) and (68)Ga-DOTA-BN[2-14]NH(2) in normal rats revealed a higher uptake in target organs and tissues of the first one while both excreted mainly through urinary tract. In microPET images both tracers were accumulated in the tumor with similar uptake patterns. Despite the differences in the receptor affinity both the (68)Ga- and the (44)Sc-labeled DOTA-BN[2-14]NH(2) tracers showed comparable distribution and similar time constants of uptake and elimination. Moreover no differences in tumor accumulation (neither in the overall uptake nor in the dynamics) were observed from the microPet imaging. From that perspective the use of either (44)Sc or (68)Ga for detecting tumors with GRP receptors is equivalent. Copyright © 2012 Elsevier Ltd. All rights reserved.
49 CFR 214.507 - Required safety equipment for new on-track roadway maintenance machines.
2010-10-01
... maintenance machines. 214.507 Section 214.507 Transportation Other Regulations Relating to Transportation... Roadway Maintenance Machines and Hi-Rail Vehicles § 214.507 Required safety equipment for new on-track roadway maintenance machines. (a) Each new on-track roadway maintenance machine shall be equipped with: (1...
Measurements of Bismuth (214Bi) in Indoor Air and Evaluation of Deposition Fraction
International Nuclear Information System (INIS)
Mohamed, A.; Ahmed, A.A.; Yuness, M.
2010-01-01
The activity size distribution of unattached as well as attached 214 Bi to aerosol particles was measured in indoor air of physics department at Minia University, Minia City, Egypt. The samples were collected using a wire screen diffusion battery technique and a low pressure Berner cascade impactor. The mean Activity Median Thermodynamic Diameter (AMTD) of unattached 214 Bi was determined to be 1.25 nm with a relative mean Geometric Standard Deviation (GSD) of 1.29. A mean unattached fraction (fun) of 0.08±0.05 was obtained. The average activity concentration of 214 Bi was found to be 4.9±0.42 Bq m -3 . Most of the attached activities of progeny were associated with aerosol particles of the accumulation mode. The GSD of the accumulation mode of 214 Bi was determined to be 3 with an Active Median Aerodynamic Diameter (AMAD) of 350 nm. Based on the obtained measured data values, deposition fraction of 214 Bi has been evaluated by using a stochastic deposition model. The bronchial deposition efficiencies of particles in the size range of attached 214 Bi were found to be lower than those of unattached progeny
12 CFR 347.214 - Branch established under section 5 of the International Banking Act.
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Branch established under section 5 of the International Banking Act. 347.214 Section 347.214 Banks and Banking FEDERAL DEPOSIT INSURANCE CORPORATION REGULATIONS AND STATEMENTS OF GENERAL POLICY INTERNATIONAL BANKING Foreign Banks § 347.214 Branch established...
24 CFR 214.300 - Counseling services.
2010-04-01
... to provide specified types of counseling nationally. (6) All participating agencies that offer group educational sessions must also offer individual counseling on the same topics covered in the group educational... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Counseling services. 214.300...
49 CFR 214.529 - In-service failure of primary braking system.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false In-service failure of primary braking system. 214... Maintenance Machines and Hi-Rail Vehicles § 214.529 In-service failure of primary braking system. (a) In the event of a total in-service failure of its primary braking system, an on-track roadway maintenance...
49 CFR 214.511 - Required audible warning devices for new on-track roadway maintenance machines.
2010-10-01
... roadway maintenance machines. 214.511 Section 214.511 Transportation Other Regulations Relating to... SAFETY On-Track Roadway Maintenance Machines and Hi-Rail Vehicles § 214.511 Required audible warning devices for new on-track roadway maintenance machines. Each new on-track roadway maintenance machine shall...
miR-214 down-regulates ARL2 and suppresses growth and invasion of cervical cancer cells
International Nuclear Information System (INIS)
Peng, Ruiqing; Men, Jianlong; Ma, Rui; Wang, Qian; Wang, Yang; Sun, Ying; Ren, Jing
2017-01-01
Increasing evidence has shown that miRNAs are implicated in carcinogenesis and can function as oncogenes or tumor suppressor genes in human cancers. In this study, we confirmed that miR-214 is frequently down-regulated in cervical cancer compared with normal cervical tissues. Ectopic expression of miR-214 suppressed proliferation, migration and invasion of HeLa and C33A cervical cancer cells. Bioinformatics analysis revealed that ADP ribosylation factor like 2 (ARL2) was a potential target of miR-214 and was remarkably up-regulated in cervical cancer. Knockdown of ARL2 markedly inhibited cervical cancer cell proliferation, migration and invasion, similarly to over-expression of miR-214, indicating that ARL2 may function as an oncogene in cervical cancer. In conclusion, our study revealed that miR-214 acts as a tumor suppressor via inhibiting proliferation, migration and invasion of cervical cancer cells through targeting ARL2, and that both miR-214 and ARL2 may serve as prognostic or therapeutic targets for cervical cancer. - Highlights: • miR-214 targets ARL2. • ARL2 maybe an oncogene in cervical cancer. • ARL2 rescues miR-214.
49 CFR 214.519 - Floors, decks, stairs, and ladders of on-track roadway maintenance machines.
2010-10-01
... roadway maintenance machines. 214.519 Section 214.519 Transportation Other Regulations Relating to... SAFETY On-Track Roadway Maintenance Machines and Hi-Rail Vehicles § 214.519 Floors, decks, stairs, and ladders of on-track roadway maintenance machines. Floors, decks, stairs, and ladders of on-track roadway...
48 CFR 36.214 - Special procedures for price negotiation in construction contracting.
2010-10-01
... price negotiation in construction contracting. 36.214 Section 36.214 Federal Acquisition Regulations... negotiation in construction contracting. (a) Agencies shall follow the policies and procedures in part 15 when... scope of the work. If negotiations reveal errors in the Government estimate, the estimate shall be...
An aerial radiological survey of the Sandia National Laboratories and surrounding area
International Nuclear Information System (INIS)
Riedhauser, S.R.
1994-06-01
A team from the Remote Sensing Laboratory conducted an aerial radiological survey of the area surrounding the Sandia National Laboratories and Kirtland Air Force Base in Albuquerque, New Mexico, during March and April 1993. The survey team measured the terrestrial gamma radiation at the site to determine the levels of natural and man-made radiation. This survey includes the areas covered by a previous survey in 1981. The results of the aerial survey show a background exposure rate which varies between 5 and 18 μR/h plus an approximate 6 μR/h contribution from cosmic rays. The major radioactive isotopes found in this survey were: potassium-40, thallium-208, bismuth-214, and actinium-228, which are all naturally-occurring isotopes, and cobalt-60, cesium-137, and excess amounts of thallium-208 and actinium-228, which are due to human actions in the survey area. In regions away from man-made activity, the exposure rates inferred from this survey's gamma ray measurements agree almost exactly with the exposure rates inferred from the 1981 survey. In addition to the aerial measurements, another survey team conducted in situ and soil sample radiation measurements at three sites within the survey perimeter. These ground-based measurements agree with the aerial measurements within ± 5%
49 CFR 214.525 - Towing with on-track roadway maintenance machines or hi-rail vehicles.
2010-10-01
... or hi-rail vehicles. 214.525 Section 214.525 Transportation Other Regulations Relating to... SAFETY On-Track Roadway Maintenance Machines and Hi-Rail Vehicles § 214.525 Towing with on-track roadway maintenance machines or hi-rail vehicles. (a) When used to tow pushcars or other maintenance-of-way equipment...
24 CFR 214.305 - Agency profile changes.
2010-04-01
...) of its branches and affiliates; (2) Staff personnel responsible for the Housing Counseling program... URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES HOUSING COUNSELING PROGRAM Program Administration § 214.305 Agency profile changes. Participating agencies...
49 CFR 214.521 - Flagging equipment for on-track roadway maintenance machines and hi-rail vehicles.
2010-10-01
... maintenance machines and hi-rail vehicles. 214.521 Section 214.521 Transportation Other Regulations Relating... WORKPLACE SAFETY On-Track Roadway Maintenance Machines and Hi-Rail Vehicles § 214.521 Flagging equipment for on-track roadway maintenance machines and hi-rail vehicles. Each on-track roadway maintenance machine...
5 CFR 214.402 - Career reserved positions.
2010-01-01
... collection of taxes and the preparation or review of interpretative opinions. (2) Career reserved positions... review agency designations of general and career reserved positions. If the Office finds that an agency... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Career reserved positions. 214.402...
24 CFR 214.105 - Preliminary application process.
2010-04-01
... program, SHFAs must either submit a request and provide HUD with a list of affiliates, if applicable, and... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES HOUSING COUNSELING PROGRAM Approval and Disapproval of Housing Counseling Agencies § 214.105...
48 CFR 52.214-21 - Descriptive Literature.
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Descriptive Literature. 52....214-21 Descriptive Literature. As prescribed in 14.201-6(p)(1), insert the following provision: Descriptive Literature (APR 2002) (a) Descriptive literature, as used in this provision, means information...
Directory of Open Access Journals (Sweden)
Siqi Yao
2017-01-01
Full Text Available Periodontitis is the main cause of adult tooth loss. Stem cell-based tissue engineering has become a promising therapy for periodontitis treatment. To date, human periodontal ligament stem cells (hPDLSCs have been shown to be a favorable source for tissue engineering, but modulatory mechanisms of hPDLSCs remain unclear. Approximately 60% of mammalian genes are the targets of over 2000 miRNAs in multiple human cell types, and miRNAs are able to influence various biological processes in the human body, including bone formation. In this study, we found that after osteogenic induction, miR-214 was significantly decreased in hPDLSCs; therefore, we examined the effects of miR-214 on osteogenic differentiation. Computational miRNA target prediction analyses and luciferase reporter assays revealed that activating transcription factor 4 (ATF4 is a direct target of miR-214. We prepared cells overexpressing miR-214 and found that miR-214 negatively regulates osteogenic differentiation of hPDLSCs. For the target of miR-214, ATF4 protein expression level was decreased after induction. In conclusion, we found that miR-214-ATF4 axis is a novel pathway for regulating hPDLSC osteogenic differentiation.
Radon and progeny (214Pb and 214Bi) in urban water-supply systems of Sao Paulo State, Brazil
International Nuclear Information System (INIS)
Bonotto, Daniel Marcos; Padron-Armada, Priscilla Cardoso
2008-01-01
Many water-supply systems in South America utilize the waters of the Guarani aquifer at least as part of their networks. However, there is little present knowledge in Brazil of the factors affecting Rn presence in the water supplied for end-users, despite the economic importance of Guarani aquifer. 222 Rn analyzes of 162 water samples were performed at 8 municipalities in Sao Paulo State, Brazil, with the aim of investigating the major factors affecting its presence in solution. The 222 Rn activity concentration ranged from 0.04 up to 204.9 Bq/L, with three samples exceeding the World Health Organization maximum limit of 100 Bq/L. Aeration was confirmed as the most important factor for Rn release, as expected due to its gaseous nature. Accumulation in pipes and stratification in the water column were other significant factors explaining the data obtained in some circumstances. The Rn daughters 214 Pb and 214 Bi were also determined in a set of selected samples and their presence was directly related to the occurrence of Rn dissolved in water
29 CFR 779.214 - “Business” purpose.
2010-07-01
... RETAILERS OF GOODS OR SERVICES Employment to Which the Act May Apply; Enterprise Coverage Common Business Purpose § 779.214 “Business” purpose. The activities described in section 3(r) are included in an enterprise only when they are performed for a “business” purpose. Activities of eleemosynary, religious, or...
Directory of Open Access Journals (Sweden)
Zaborski Margarete
2009-01-01
Full Text Available Abstract Background SET-NUP214 fusion resulting from a recurrent cryptic deletion, del(9(q34.11q34.13 has recently been described in T-cell acute lymphoblastic leukemia (T-ALL and in one case of acute myeloid leukemia (AML. The fusion protein appears to promote elevated expression of HOXA cluster genes in T-ALL and may contribute to the pathogenesis of the disease. We screened a panel of ALL and AML cell lines for SET-NUP214 expression to find model systems that might help to elucidate the cellular function of this fusion gene. Results Of 141 human leukemia/lymphoma cell lines tested, only the T-ALL cell line LOUCY and the AML cell line MEGAL expressed the SET(TAF-Iβ-NUP214 fusion gene transcript. RT-PCR analysis specifically recognizing the alternative first exons of the two TAF-I isoforms revealed that the cell lines also expressed TAF-Iα-NUP214 mRNA. Results of fluorescence in situ hybridization (FISH and array-based copy number analysis were both consistent with del(9(q34.11q34.13 as described. Quantitative genomic PCR also confirmed loss of genomic material between SET and NUP214 in both cell lines. Genomic sequencing localized the breakpoints of the SET gene to regions downstream of the stop codon and to NUP214 intron 17/18 in both LOUCY and MEGAL cells. Both cell lines expressed the 140 kDa SET-NUP214 fusion protein. Conclusion Cell lines LOUCY and MEGAL express the recently described SET-NUP214 fusion gene. Of special note is that the formation of the SET exon 7/NUP214 exon 18 gene transcript requires alternative splicing as the SET breakpoint is located downstream of the stop codon in exon 8. The cell lines are promising model systems for SET-NUP214 studies and should facilitate investigating cellular functions of the the SET-NUP214 protein.
2010-10-01
... devices for new on-track roadway maintenance machines. 214.509 Section 214.509 Transportation Other... TRANSPORTATION RAILROAD WORKPLACE SAFETY On-Track Roadway Maintenance Machines and Hi-Rail Vehicles § 214.509 Required visual illumination and reflective devices for new on-track roadway maintenance machines. Each new...
75 FR 55272 - Safety Zone; Mississippi River, Mile 212.0 to 214.5
2010-09-10
...-AA00 Safety Zone; Mississippi River, Mile 212.0 to 214.5 AGENCY: Coast Guard, DHS. ACTION: Temporary final rule. SUMMARY: The Coast Guard is establishing a temporary safety zone for waters of the Upper Mississippi River, Mile 212.0 to 214.5, extending West of Portage Island to the right descending bank of the...
48 CFR 33.214 - Alternative dispute resolution (ADR).
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Alternative dispute... GENERAL CONTRACTING REQUIREMENTS PROTESTS, DISPUTES, AND APPEALS Disputes and Appeals 33.214 Alternative dispute resolution (ADR). (a) The objective of using ADR procedures is to increase the opportunity for...
14 CFR 1274.214 - Inquiries and release of information.
2010-01-01
... AGREEMENTS WITH COMMERCIAL FIRMS Pre-Award Requirements § 1274.214 Inquiries and release of information. NASA personnel shall follow the procedures established in NFS 1805.402 prior to releasing information to the news...
International Nuclear Information System (INIS)
Schumann, W.C.; Magnusson, I.; Chandramouli, V.; Kumaran, K.; Wahren, J.; Landau, B.R.
1991-01-01
To examine the fate of the carbons of acetate and to evaluate the usefulness of labeled acetate in assessing intrahepatic metabolic processes during gluconeogenesis, [2-14C]acetate, [2-14C]ethanol, and [1-14C]ethanol were infused into normal subjects fasted 60 h and given phenyl acetate. Distributions of 14C in the carbons of blood glucose and glutamate from urinary phenylacetylglutamine were determined. With [2-14C]acetate and [2-14C]ethanol, carbon 1 of glucose had about twice as much 14C as carbon 3. Carbon 2 of glutamate had about twice as much 14C as carbon 1 and one-half to one-third as much as carbon 4. There was only a small amount in carbon 5. These distributions are incompatible with the metabolism of [2-14C]acetate being primarily in liver. Therefore, [2-14C]acetate cannot be used to study Krebs cycle metabolism in liver and in relationship to gluconeogenesis, as has been done. The distributions can be explained by: (a) fixation of 14CO2 from [2-14C]acetate in the formation of the 14C-labeled glucose and glutamate in liver and (b) the formation of 14C-labeled glutamate in a second site, proposed to be muscle. [1,3-14C]Acetone formation from the [2-14C]acetate does not contribute to the distributions, as evidenced by the absence of 14C in carbons 2-4 of glutamate after [1-14C]ethanol administration
48 CFR 852.214-72 - Alternate item(s).
2010-10-01
... AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and Clauses 852.214-72... 2008) Bids on []* will be given equal consideration along with bids on []** and any such bids received... [].** * Contracting officer will insert an alternate item that is considered acceptable. ** Contracting officer will...
Lukas 2:14 vanuit 'n Joods-Christelike perspektief
African Journals Online (AJOL)
A concordance to the Septuagint, Vol L Graz: Akademische Druck- u Verlagsanstalt. Jeremias, J 1980. Die sprache des Lukasevangeliums. Gottingen; Vandenhoeck &. Ruprecht. Kilpatrick, R S 1988. The Greek syntax of Luke 2:14. NTS 34,472-475. Maier, G 1991. Lukas-Evangelium, 1 Teil. Neuhausen-Stuttgart: Hanssler.
48 CFR 1433.214 - Alternative dispute resolution (ADR).
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Alternative dispute... GENERAL CONTRACTING REQUIREMENTS PROTESTS, DISPUTES, AND APPEALS Disputes and Appeals 1433.214 Alternative dispute resolution (ADR). DOI strongly encourages the use of ADR in the resolution of disputes in lieu of...
48 CFR 3033.214 - Alternative dispute resolution (ADR).
2010-10-01
..., DISPUTES, AND APPEALS Disputes and Appeals 3033.214 Alternative dispute resolution (ADR). (c) The Administrative Dispute Resolution Act (ADRA) of 1996, as amended, 5 U.S.C. 571, et seq., authorizes and... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Alternative dispute...
Li, Hongdan; Wang, Haoqi; Ren, Zhen
2018-01-01
This study aims to explore the effects of microRNA-214-5p (miR-214-5p) on the invasion and migration of Hepatocellular Carcinoma cells (HCC). Hepatocellular Carcinoma tissues and adjacent normal tissues from 44 hepatocellular carcinoma patients were prepared for this study. The HepG2 and BEL-7402 cells were transfected with miR-214-5p mimic and inhibitor. qRT-PCR was performed to detect the expressions of miR-214-5p. Transwell assays were used to detect the invasion and migration assays in HepG2 and BEL-7402 cells. A dual-luciferase reporter assay was conducted to examine the effect of miR-214-5p on Wiskott-Aldrich Syndrome Like (WASL/ N-WASP). Western blot and qRT-PCR were used to measure the expressions of the E-cadherin, N-cadherin and Vimentin proteins. Transwell chamber assays were performed to detect cell invasion and migration. Compared with normal tissues, HCC tissues demonstrated significantly lower expression of miR-214-5p. Overexpression of miR-214-5p significantly inhibited the migration and invasion of HCC cells and inhibition of miR-214-5p promoted the migration and invasion. Additionally, miR-214-5p suppressed the epithelial-mesenchymal transition (EMT). Further study showed WASL was a putative target gene of miR-214-5p. Up-regulating the expression of WASL could reverse the inhibition effect of miR-214-5p on invasion and migration. Our data suggested that miR-214-5p inhibited the invasion and migration of HepG2 and BEL-7402 by targeting WASL in Hepatocellular carcinoma. © 2018 The Author(s). Published by S. Karger AG, Basel.
41 CFR 101-29.214 - Commercial-type product.
2010-07-01
... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Commercial-type product... Regulations System FEDERAL PROPERTY MANAGEMENT REGULATIONS SUPPLY AND PROCUREMENT 29-FEDERAL PRODUCT DESCRIPTIONS 29.2-Definitions § 101-29.214 Commercial-type product. A commercial-type product is defined as: (a...
27 CFR 24.214 - Spanish type blending sherry.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Spanish type blending... BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Production of Other Than Standard Wine § 24.214 Spanish..., produced under this section, is designated “Spanish Type Blending Sherry.” Upon removal, the shipping...
Yin, Yuan; Cai, Xing; Chen, Xi; Liang, Hongwei; Zhang, Yujing; Li, Jing; Wang, Zuoyun; Chen, Xiulan; Zhang, Wen; Yokoyama, Seiji; Wang, Cheng; Li, Liang; Li, Limin; Hou, Dongxia; Dong, Lei; Xu, Tao; Hiroi, Takachika; Yang, Fuquan; Ji, Hongbin; Zhang, Junfeng; Zen, Ke; Zhang, Chen-Yu
2014-01-01
An increased population of CD4+CD25highFoxp3+ regulatory T cells (Tregs) in the tumor-associated microenvironment plays an important role in cancer immune evasion. However, the underlying mechanism remains unclear. Here we observed an increased secretion of miR-214 in various types of human cancers and mouse tumor models. Tumor-secreted miR-214 was sufficiently delivered into recipient T cells by microvesicles (MVs). In targeted mouse peripheral CD4+ T cells, tumor-derived miR-214 efficiently downregulated phosphatase and tensin homolog (PTEN) and promoted Treg expansion. The miR-214-induced Tregs secreted higher levels of IL-10 and promoted tumor growth in nude mice. Furthermore, in vivo studies indicated that Treg expansion mediated by cancer cell-secreted miR-214 resulted in enhanced immune suppression and tumor implantation/growth in mice. The MV delivery of anti-miR-214 antisense oligonucleotides (ASOs) into mice implanted with tumors blocked Treg expansion and tumor growth. Our study reveals a novel mechanism through which cancer cell actively manipulates immune response via promoting Treg expansion. PMID:25223704
9 CFR 113.214 - Parvovirus Vaccine, Killed Virus (Canine).
2010-01-01
... REQUIREMENTS Killed Virus Vaccines § 113.214 Parvovirus Vaccine, Killed Virus (Canine). Parvovirus Vaccine... antibody against canine parvovirus to determine susceptibility. A constant virus-varying serum... vaccinates and the controls shall be challenged with virulent canine parvovirus furnished or approved by...
Saito, Shoko; Cigdem, Sadik; Okuwaki, Mitsuru; Nagata, Kyosuke
2016-07-01
Nuclear-cytoplasmic transport through nuclear pore complexes is mediated by nuclear transport receptors. Previous reports have suggested that aberrant nuclear-cytoplasmic transport due to mutations or overexpression of nuclear pore complexes and nuclear transport receptors is closely linked to diseases. Nup214, a component of nuclear pore complexes, has been found as chimeric fusion proteins in leukemia. Among various Nup214 fusion proteins, SET-Nup214 and DEK-Nup214 have been shown to be engaged in tumorigenesis, but their oncogenic mechanisms remain unclear. In this study, we examined the functions of the Nup214 fusion proteins by focusing on their effects on nuclear-cytoplasmic transport. We found that SET-Nup214 and DEK-Nup214 interact with exportin-1 (XPO1)/CRM1 and nuclear RNA export factor 1 (NXF1)/TAP, which mediate leucine-rich nuclear export signal (NES)-dependent protein export and mRNA export, respectively. SET-Nup214 and DEK-Nup214 decreased the XPO1-mediated nuclear export of NES proteins such as cyclin B and proteins involved in the NF-κB signaling pathway by tethering XPO1 onto nuclear dots where Nup214 fusion proteins are localized. We also demonstrated that SET-Nup214 and DEK-Nup214 expression inhibited NF-κB-mediated transcription by abnormal tethering of the complex containing p65 and its inhibitor, IκB, in the nucleus. These results suggest that SET-Nup214 and DEK-Nup214 perturb the regulation of gene expression through alteration of the nuclear-cytoplasmic transport system. Copyright © 2016, American Society for Microbiology. All Rights Reserved.
Half-life of 214Po and 212Po measured with CTF at LNGS
International Nuclear Information System (INIS)
Bellini, G.; Benziger, J.; Bick, D.
2013-01-01
Polonium isotopes 214 Po and 212 Po are part of the 238 U and 232 Th decay chains, respectively. There exist only a few measurements of these two mean lifetimes with precision better than one or two percent. Since we have been studying decay spectra of 214 Bi and 212 Bi with the purpose of experimentally constraining anti-neutrino spectral shape important for geoneutrino studies, we have a large statistics of decays of 214 Po and 212 Po collected with the Counting Test Facility (CTF), which was operational in the underground I.N.F.N. Gran Sasso National Laboratory. The apparatus consisted of an external cylindrical water tank (diameter ∼ 11 m, high ∼ 10 m; ∼ 1000 tons of water) serving as passive shielding for 4.8 m 3 of liquid organic scintillator contained in an inner spherical vessel with a diameter of ∼ 2 m. The inner vessel was realized with a nylon membrane (∼ 500 ?m thick), with excellent optical clarity, which allowed the effective transmission of the scintillation light to the 100 phototubes (PMTs) forming the optical read-out, anchored on a 7 m diameter support structure inside the water tank. The high purity and low background in CTF allows a favourable signal to background ratio for these measurements. More specifically the ratio of signal to background of the present measurements is more than three orders of magnitude larger than the best existing measurements. We have studied the decays of 214 Po into 210 Pb and of 212 Po into 208 Pb tagged by the coincidence with the previously decays from 214 Bi and 212 Bi by using 222 Rn, 232 Th and 220 Rn sources sealed inside quartz vials and inserted in the CTF
50 CFR 226.214 - Critical habitat for Gulf sturgeon.
2010-10-01
... ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS DESIGNATED CRITICAL HABITAT § 226.214... Sound or the Gulf of Mexico. The Withlacoochee River main stem from Florida State Road 6, Madison and...) Unit 11: Florida Nearshore Gulf of Mexico Unit in Escambia, Santa Rosa, Okaloosa, Walton, Bay, and Gulf...
22 CFR 1203.735-214 - Transmitting communications and gifts.
2010-04-01
... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Transmitting communications and gifts. 1203.735....735-214 Transmitting communications and gifts. (a) Correspondence. In corresponding with anyone other... it to be clearly in the public interest to do so. (c) Gifts. An employee shall not act as an agent...
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Technical requirements for space stations in the satellite digital audio radio service and associated terrestrial repeaters. 25.214 Section 25.214 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS...
Flux density measurements of radio sources at 2.14 millimeter wavelength
International Nuclear Information System (INIS)
Cogdell, J.R.; Davis, J.H.; Ulrich, B.T.; Wills, B.J.
1975-01-01
Flux densities of galactic and extragalactic sources, and planetary temperatures, have been measured at 2.14 mm wavelength (140 GHz). Results are presented for OJ 287; the galactic sources DR 21, W3, and Orion A; the extragalactic sources PKS 0106plus-or-minus01, 3C 84, 3C 120, BL Lac, 3C 216, 3C 273, 3C 279, and NGC 4151; and the Sun, Venus, Mars, and Jupiter. Also presented is the first measurement of the 2.14-mm temperature of Uranus. The spectra of some of these sources are discussed. The flux density scale was calibrated absolutely. The measurements were made with a new continuum receiver on the 4.88-m radio telescope of The University of Texas
49 CFR 214.349 - Training and qualification of watchmen/lookouts.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Training and qualification of watchmen/lookouts...) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION RAILROAD WORKPLACE SAFETY Roadway Worker Protection § 214.349 Training and qualification of watchmen/lookouts. (a) The training and qualification for...
2010-10-01
... operators of roadway maintenance machines. 214.355 Section 214.355 Transportation Other Regulations Relating... operators of roadway maintenance machines. (a) The training and qualification of roadway workers who operate roadway maintenance machines shall include, as a minimum: (1) Procedures to prevent a person from being...
International Nuclear Information System (INIS)
Nakamura, Mariko; Esaka, Takao; Kamata, Masahiro
2005-01-01
Although several works have been published to date regarding radiochemistry, most of them have been designed for those who major in subjects related to chemistry or physics and use rather sophisticated methods and apparatus. Education about radiation and radioactivity is also very important for other students because a basic knowledge of radiation and radioactivity is indispensable for understanding environmental problems or energy problems in the future. However, it is not easy to conduct practical work using radioactivity in students' experiments at school or at university because the use of radioactivity is strictly regulated by the law, and equipment such as radiation counters is too expensive for school budgets. From such a viewpoint, we developed several kinds of safe and inexpensive experiments for education using natural radioactivity so that university (or senior high school) students can learn through their practical work without being regulated by the law. For this purpose, radioactive species belonging to the uranium decay series are suitable because these species can be easily obtained from mineral spring water or soil samples. In addition, some of the species such as 214 Pb and 214 Bi emit beta rays, which are easy to detect, and the half-lives of these which are easy to detect, and the half-lives of these elements can be measured in one or two-hour school activities. This kind of experiment was employed as an ''Educational experiment for radiochemistry'' at Tottori University for nearly fifty students every year. Although the experiment itself was essentially complete, the students did not have the chance to observe how radioactive equilibrium was established. Therefore, we have developed an additional work plan to enable students to observe how 214 Pb and 214 Bi are produced from 222 Rn, and have made this experiment more complete. The educational usefulness of this additional experiment was evaluated and will be presented in section 5. (author)
International Nuclear Information System (INIS)
Wang, Bei; Zhang, XiaoYu; Zhao, Zhendong
2013-01-01
Highlights: •We introduced a new mutagenesis strategy named VBIM to the viral research. •This method can identify either host factors or host restriction factors. •Using VBIM system, we identified Nup214 as a host factor for EV71 replication in RD cells. -- Abstract: Lentiviral validation-based insertional mutagenesis (VBIM) is a sophisticated, forward genetic approach that is used for the investigation of signal transduction in mammalian cells. Using VBIM, we conducted function-based genetic screening for host genes that affect enterovirus 71 (EV71) viral replication. This included host factors that are required for the life cycle of EV71 and host restriction factors that inhibit EV71 replication. Several cell clones, resistant to EV71, were produced using EV71 infection as a selection pressure and the nuclear pore protein 214 (Nup214) was identified as a host factor required for EV71 replication. In SD2-2, the corresponding VBIM lentivirus transformed clone, the expression of endogenous Nup214 was significantly down-regulated by the reverse inserted VBIM promoter. After Cre recombinase-mediated excision of the VBIM promoter, the expression of Nup214 recovered and the clone regained sensitivity to the EV71 infection. Furthermore, over-expression of Nup214 in the cells suggested that Nup214 was promoting EV71 replication. Results of this study indicate that a successful mutagenesis strategy has been established for screening host genes related to viral replication
Energy Technology Data Exchange (ETDEWEB)
Wang, Bei; Zhang, XiaoYu; Zhao, Zhendong, E-mail: timjszzd@163.com
2013-08-02
Highlights: •We introduced a new mutagenesis strategy named VBIM to the viral research. •This method can identify either host factors or host restriction factors. •Using VBIM system, we identified Nup214 as a host factor for EV71 replication in RD cells. -- Abstract: Lentiviral validation-based insertional mutagenesis (VBIM) is a sophisticated, forward genetic approach that is used for the investigation of signal transduction in mammalian cells. Using VBIM, we conducted function-based genetic screening for host genes that affect enterovirus 71 (EV71) viral replication. This included host factors that are required for the life cycle of EV71 and host restriction factors that inhibit EV71 replication. Several cell clones, resistant to EV71, were produced using EV71 infection as a selection pressure and the nuclear pore protein 214 (Nup214) was identified as a host factor required for EV71 replication. In SD2-2, the corresponding VBIM lentivirus transformed clone, the expression of endogenous Nup214 was significantly down-regulated by the reverse inserted VBIM promoter. After Cre recombinase-mediated excision of the VBIM promoter, the expression of Nup214 recovered and the clone regained sensitivity to the EV71 infection. Furthermore, over-expression of Nup214 in the cells suggested that Nup214 was promoting EV71 replication. Results of this study indicate that a successful mutagenesis strategy has been established for screening host genes related to viral replication.
23 CFR 970.214 - Federal lands congestion management system (CMS).
2010-04-01
... 23 Highways 1 2010-04-01 2010-04-01 false Federal lands congestion management system (CMS). 970....214 Federal lands congestion management system (CMS). (a) For purposes of this section, congestion...) Develop criteria to determine when a CMS is to be implemented for a specific transportation system; and (2...
23 CFR 972.214 - Federal lands congestion management system (CMS).
2010-04-01
... 23 Highways 1 2010-04-01 2010-04-01 false Federal lands congestion management system (CMS). 972... § 972.214 Federal lands congestion management system (CMS). (a) For purposes of this section, congestion... interference. For those FWS transportation systems that require a CMS, in both metropolitan and non...
An analysis of 214 cases of rib fractures
Karadayi, Sule; Nadir, Aydin; Sahin, Ekber; Celik, Burcin; Arslan, Sulhattin; Kaptanoglu, Melih
2011-01-01
INTRODUCTION: Rib fractures are the most common type of injury associated with trauma to the thorax. In this study, we investigated whether morbidity and mortality rates increased in correlation with the number of fractured ribs. MATERIALS AND METHODS: Data from 214 patients with rib fractures who applied or were referred to our clinic between January 2007 and December 2008 were retrospectively evaluated. The patients were allocated into three groups according to the number of fractures: 1) p...
CT-guided percutaneous spine biopsy in suspected infection or malignancy. A study of 214 patients
Energy Technology Data Exchange (ETDEWEB)
Rehm, J.; Veith, S.; Kauczor, H.U.; Weber, M.A. [Heidelberg Univ. (Germany). Inst. of Diagnostic and Interventional Radiology; Akbar, M. [Heidelberg Univ. (Germany). Dept. of Orthopaedic Surgery and Rehabilitation Medicine
2016-12-15
To retrospectively determine the effectiveness and accuracy of CT-guided percutaneous biopsy of malignant and inflammatory bone lesions of the spine and to assess the reliability of pre-biopsy CT and MRI. 214 patients with lesions of the spine, which were suspicious either for being malignant or inflammatory, underwent CT-guided biopsy for pathological and/or microbiological detection. Biopsy samples were sent for histological examination in 128/214 patients, for microbiological analysis in 17/214 patients and for both analyses in 69/214 patients. Retrospectively, the diagnostic accuracy and sensitivity/specificity of the pre-interventional imaging (CT and MRI) were determined. In addition, the influence of the biopsy on subsequent patient management was assessed. The accuracy was 94.4% for histopathological analysis and 97.7% for microbiological analysis. In 25% of cases the microbiological analysis revealed an underlying pathogen that was not significantly affected by pre-biopsy antibiotic therapy. The sensitivity/specificity of the pre-biopsy cross-sectional imaging concerning suspected malignancy was 69%/78%. For suspected infection, the sensitivity/specificity of pre-biopsy imaging was 81%/44%. In 52% of all cases, the biopsy result changed subsequent patient management. Percutaneous CT-guided spine biopsy is a useful and reliable diagnostic procedure to establish a definitive diagnosis but with a relatively low yield of microorganisms in the case of infection.
CT-guided percutaneous spine biopsy in suspected infection or malignancy. A study of 214 patients
International Nuclear Information System (INIS)
Rehm, J.; Veith, S.; Kauczor, H.U.; Weber, M.A.; Akbar, M.
2016-01-01
To retrospectively determine the effectiveness and accuracy of CT-guided percutaneous biopsy of malignant and inflammatory bone lesions of the spine and to assess the reliability of pre-biopsy CT and MRI. 214 patients with lesions of the spine, which were suspicious either for being malignant or inflammatory, underwent CT-guided biopsy for pathological and/or microbiological detection. Biopsy samples were sent for histological examination in 128/214 patients, for microbiological analysis in 17/214 patients and for both analyses in 69/214 patients. Retrospectively, the diagnostic accuracy and sensitivity/specificity of the pre-interventional imaging (CT and MRI) were determined. In addition, the influence of the biopsy on subsequent patient management was assessed. The accuracy was 94.4% for histopathological analysis and 97.7% for microbiological analysis. In 25% of cases the microbiological analysis revealed an underlying pathogen that was not significantly affected by pre-biopsy antibiotic therapy. The sensitivity/specificity of the pre-biopsy cross-sectional imaging concerning suspected malignancy was 69%/78%. For suspected infection, the sensitivity/specificity of pre-biopsy imaging was 81%/44%. In 52% of all cases, the biopsy result changed subsequent patient management. Percutaneous CT-guided spine biopsy is a useful and reliable diagnostic procedure to establish a definitive diagnosis but with a relatively low yield of microorganisms in the case of infection.
Saer, Rafael G; Hardjasa, Amelia; Rosell, Federico I; Mauk, A Grant; Murphy, Michael E P; Beatty, J Thomas
2013-04-02
In the native reaction center (RC) of Rhodobacter sphaeroides, the side chain of (M)L214 projects orthogonally toward the plane and into the center of the A branch bacteriopheophytin (BPhe) macrocycle. The possibility that this side chain is responsible for the dechelation of the central Mg(2+) of bacteriochlorophyll (BChl) was investigated by replacement of (M)214 with residues possessing small, nonpolar side chains that can neither coordinate nor block access to the central metal ion. The (M)L214 side chain was also replaced with Cys, Gln, and Asn to evaluate further the requirements for assembly of the RC with BChl in the HA pocket. Photoheterotrophic growth studies showed no difference in growth rates of the (M)214 nonpolar mutants at a low light intensity, but the growth of the amide-containing mutants was impaired. The absorbance spectra of purified RCs indicated that although absorbance changes are associated with the nonpolar mutations, the nonpolar mutant RC pigment compositions are the same as in the wild-type protein. Crystal structures of the (M)L214G, (M)L214A, and (M)L214N mutants were determined (determined to 2.2-2.85 Å resolution), confirming the presence of BPhe in the HA pocket and revealing alternative conformations of the phytyl tail of the accessory BChl in the BA site of these nonpolar mutants. Our results demonstrate that (i) BChl is converted to BPhe in a manner independent of the aliphatic side chain length of nonpolar residues replacing (M)214, (ii) BChl replaces BPhe if residue (M)214 has an amide-bearing side chain, (iii) (M)214 side chains containing sulfur are not sufficient to bind BChl in the HA pocket, and (iv) the (M)214 side chain influences the conformation of the phytyl tail of the BA BChl.
2010-10-01
... premises wiring that serves fewer than four subscriber access lines. 68.214 Section 68.214... other than “fully protected” premises wiring that serves fewer than four subscriber access lines. Operations associated with the installation, connection, reconfiguration and removal (other than final...
Chen, Thomas C; Chan, Nymph; Labib, Shirin; Yu, Jiali; Cho, Hee-Yeon; Hofman, Florence M; Schönthal, Axel H
2018-01-17
Despite the introduction of new therapies for multiple myeloma (MM), many patients are still dying from this disease and novel treatments are urgently needed. We have designed a novel hybrid molecule, called NEO214, that was generated by covalent conjugation of the natural monoterpene perillyl alcohol (POH), an inducer of endoplasmic reticulum (ER) stress, to rolipram (Rp), an inhibitor of phosphodiesterase-4 (PDE4). Its potential anticancer effects were investigated in a panel of MM cell lines. We found that NEO214 effectively killed MM cells in vitro with a potency that was over an order of magnitude stronger than that of its individual components, either alone or in combination. The cytotoxic mechanism of NEO214 involved severe ER stress and prolonged induction of CCAAT/enhancer-binding protein homologous protein (CHOP), a key pro-apoptotic component of the ER stress response. These effects were prevented by salubrinal, a pharmacologic inhibitor of ER stress, and by CHOP gene knockout. Conversely, combination of NEO214 with bortezomib, a drug in clinical use for patients with MM, resulted in synergistic enhancement of MM cell death. Combination with the adenylate cyclase stimulant forskolin did not enhance NEO214 impact, indicating that cyclic adenosine 3',5'-monophosphate (AMP) pathways might play a lesser role. Our study introduces the novel agent NEO214 as a potent inducer of ER stress with significant anti-MM activity in vitro. It should be further investigated as a potential MM therapy aimed at exploiting this tumor's distinct sensitivity to ER stress.
Pan, Di; Li, Wei; Miao, Hanchi; Yao, Jing; Li, Zhiyu; Wei, Libin; Zhao, Li; Guo, Qinglong
2014-02-15
In this study, the anticancer effect of LW-214, a newly synthesized flavonoid, against MCF-7 human breast cancer cells and the underlying mechanisms were investigated. LW-214 triggered the mitochondrial apoptotic pathway by increasing Bax/Bcl-2 ratio, loss of mitochondrial membrane potential (ΔΨm) and caspase-9 activation, degradation of poly (ADP-ribose) polymerase (PARP), cytochrome c (Cyt c) release and apoptosis-inducing factor (AIF) transposition. Further research revealed that both the reactive oxygen species (ROS) generation and the apoptosis signal regulating kinase 1 (ASK1) activation by LW-214 were induced by down-regulating the thioredoxin-1 (Trx-1) expression. The ROS elevation and ASK1 activation induced a sustained phosphorylation of c-Jun N-terminal kinase (JNK), while SP600125, as known as JNK inhibitor, almost reversed LW-214-induced apoptosis in MCF-7 cells. Overexpression of Trx-1 in MCF-7 cells attenuated LW-214-mediated apoptosis as well as the JNK activation and reversed the expression of mitochondrial apoptosis-related protein. Accordingly, the in vivo study showed that LW-214 exhibited a potential antitumor effect in BALB/c species mice inoculated MCF-7 tumor with low systemic toxicity, and the mechanism was the same as in vitro study. Taken together, these findings indicated that LW-214 may down-regulated Trx-1 function, causing intracellular ROS generation and releasing the ASK1, and lead to JNK activation, which consequently induced the mitochondrial apoptosis in vitro and in vivo. Copyright © 2013 Elsevier Inc. All rights reserved.
Lee, Sang-Guk; Park, Tae Sung; Cho, Sun Young; Lim, Gayoung; Park, Gwang Jin; Oh, Seung Hwan; Cho, Eun Hae; Chong, So Young; Huh, Ji Young
2011-01-01
SET-NUP214 rearrangements have been rarely reported in T-cell acute lymphoblastic leukemia (T-ALL), acute undifferentiated leukemia, and acute myeloid leukemia, and most documented cases have been associated with normal karyotypes in conventional cytogenetic analyses. Here, we describe a novel case of T-ALL associated with a mediastinal mass and a SET-NUP214 rearrangement, which was masked by a complex karyotype at the time of initial diagnosis. Using multiplex reverse transcriptase-polymerase chain reaction analysis, we detected a cryptic SET-NUP214 rearrangement in our patient. As only 11 cases (including the present study) of T-ALL with SET-NUP214 rearrangement have been reported, the clinical features and treatment outcomes have not been fully determined. Further studies are necessary to evaluate the incidence of SET-NUP214 rearrangement in T-ALL patients and the treatment responses as well as prognosis of these patients.
2010-07-01
... the Government contractor-issued travel charge card change the employee's obligation to pay his/her travel card bill by the due date? 301-71.214 Section 301-71.214 Public Contracts and Property Management Federal Travel Regulation System TEMPORARY DUTY (TDY) TRAVEL ALLOWANCES AGENCY RESPONSIBILITIES 71-AGENCY...
Directory of Open Access Journals (Sweden)
Deborah Charych
Full Text Available Cytokines are potent immune modulating agents but are not ideal medicines in their natural form due to their short half-life and pleiotropic systemic effects. NKTR-214 is a clinical-stage biologic that comprises interleukin-2 (IL2 protein bound by multiple releasable polyethylene glycol (PEG chains. In this highly PEG-bound form, the IL2 is inactive; therefore, NKTR-214 is a biologic prodrug. When administered in vivo, the PEG chains slowly release, creating a cascade of increasingly active IL2 protein conjugates bound by fewer PEG chains. The 1-PEG-IL2 and 2-PEG-IL2 species derived from NKTR-214 are the most active conjugated-IL2 species. Free-IL2 protein is undetectable in vivo as it is eliminated faster than formed. The PEG chains on NKTR-214 are located at the region of IL2 that contacts the alpha (α subunit of the heterotrimeric IL2 receptor complex, IL2Rαβγ, reducing its ability to bind and activate the heterotrimer. The IL2Rαβγ complex is constitutively expressed on regulatory T cells (Tregs. Therefore, without the use of mutations, PEGylation reduces the affinity for IL2Rαβγ to a greater extent than for IL2Rβγ, the receptor complex predominant on CD8 T cells. NKTR-214 treatment in vivo favors activation of CD8 T cells over Tregs in the tumor microenvironment to provide anti-tumor efficacy in multiple syngeneic models. Mechanistic modeling based on in vitro and in vivo kinetic data provides insight into the mechanism of NKTR-214 pharmacology. The model reveals that conjugated-IL2 protein derived from NKTR-214 occupy IL-2Rβγ to a greater extent compared to free-IL2 protein. The model accurately describes the sustained in vivo signaling observed after a single dose of NKTR-214 and explains how the properties of NKTR-214 impart a unique kinetically-controlled immunological mechanism of action.
Charych, Deborah; Khalili, Samira; Dixit, Vidula; Kirk, Peter; Chang, Thomas; Langowski, John; Rubas, Werner; Doberstein, Stephen K; Eldon, Michael; Hoch, Ute; Zalevsky, Jonathan
2017-01-01
Cytokines are potent immune modulating agents but are not ideal medicines in their natural form due to their short half-life and pleiotropic systemic effects. NKTR-214 is a clinical-stage biologic that comprises interleukin-2 (IL2) protein bound by multiple releasable polyethylene glycol (PEG) chains. In this highly PEG-bound form, the IL2 is inactive; therefore, NKTR-214 is a biologic prodrug. When administered in vivo, the PEG chains slowly release, creating a cascade of increasingly active IL2 protein conjugates bound by fewer PEG chains. The 1-PEG-IL2 and 2-PEG-IL2 species derived from NKTR-214 are the most active conjugated-IL2 species. Free-IL2 protein is undetectable in vivo as it is eliminated faster than formed. The PEG chains on NKTR-214 are located at the region of IL2 that contacts the alpha (α) subunit of the heterotrimeric IL2 receptor complex, IL2Rαβγ, reducing its ability to bind and activate the heterotrimer. The IL2Rαβγ complex is constitutively expressed on regulatory T cells (Tregs). Therefore, without the use of mutations, PEGylation reduces the affinity for IL2Rαβγ to a greater extent than for IL2Rβγ, the receptor complex predominant on CD8 T cells. NKTR-214 treatment in vivo favors activation of CD8 T cells over Tregs in the tumor microenvironment to provide anti-tumor efficacy in multiple syngeneic models. Mechanistic modeling based on in vitro and in vivo kinetic data provides insight into the mechanism of NKTR-214 pharmacology. The model reveals that conjugated-IL2 protein derived from NKTR-214 occupy IL-2Rβγ to a greater extent compared to free-IL2 protein. The model accurately describes the sustained in vivo signaling observed after a single dose of NKTR-214 and explains how the properties of NKTR-214 impart a unique kinetically-controlled immunological mechanism of action.
20 CFR 410.214 - Conditions of entitlement; parent, brother, or sister.
2010-04-01
... entitlement to brother's benefits may be established for any month before January 1973, based on a disability... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Conditions of entitlement; parent, brother...; Duration of Entitlement; Filing of Claims and Evidence § 410.214 Conditions of entitlement; parent, brother...
Optical observations of the millisecond pulsars PSR 1937+214 and PSR 1953+29
International Nuclear Information System (INIS)
Loredo, T.J.; Ricker, G.R.; Rappaport, S.A.; Middleditch, J.
1984-01-01
The results of photometric and time-resolved optical observations of the fields of the recently discovered ultra-fast radio pulsars, PSR 1937+214 and PSR 1953+29 (Backer et al. 1982; Boriakoff et al. 1983) are reported. Deep images of the fields reveal no conspicuous optical counterpart for PSR 1937+214, though a star with m/sub r/ approx. 20.5 is coincident with the position of PSR 1953+29. Time-resolved images of the fields of both objects, obtained with a new stroboscopic technique, have yielded upper limits on the pulsed near-infrared emission from each object. Constraints on the physical models for these systems derived from the optical studies are briefly discussed. 25 references, 9 figures, 4 tables
High-spin states in 214Rn, 216Ra and a study of even-even N=128 systematics
Lönnroth, T.; Horn, D.; Baktash, C.; Lister, C. J.; Young, G. R.
1983-01-01
High-spin states in 214Rn and 216Ra have been studied by means of the reaction 208Pb(13C, α 3n γ)214Rn and 208Pb(13C, 5n γ)216Ra at beam energies in the range 75-95 MeV. In-beam spectroscopy techniques, including γ-decay excitation functions, α-γ coincidences, γ-γ coincidences, γ-ray angular distributions, and pulsed-beam-γ timing, were utilized to establish level energies, γ-ray multipolarities, Jπ assignments, and isomeric lifetimes. Excited states with spins up to 23ℏ in 214Rn and ~30ℏ in 216Ra were observed. Isomers were found in 214Rn at 1625 keV (T12=9 ns, Jπ=8+), 1787 keV (22 ns, 10+), 3485 keV (95 ns, 16), 4509 keV (230 ns, 20), and 4738 keV (8 ns, 22), and in 216Ra at 1708 keV (8 ns, 8+) and 5868 keV (10 ns, ~24). B(EL) values were deduced and compared to previously known lead-region electric transition rates. Shell-model calculations were performed and used to make configurational assignments. The absence of major α-decay branching in the isomers is explained and the systematic behavior of N=128 even-even nuclei is discussed. NUCLEAR STRUCTURE 208Pb(13C, α 3n γ)214Rn, 208Pb(13C, 5n γ) 216Ra, Elab=75-95 MeV. Measured α-γ coin, γ-γ(t) coin, I(θ), pulsed-beam-γ timing. Deduced level schemes, Jπ, T12, B(EL), multipolarities. Shell model calculations, Ge(Li) and Si detectors, enriched target.
International Nuclear Information System (INIS)
Marinho, E.V.A.; Nordemann, D.J.R.
1985-01-01
PO 214 , a short life daughter product of RN 222 , was measured by alpha-ray spectrometry of a atmospheric particles sampled on Millipore filters (0.8 μm pore) at Sao Jose dos Campos (23 0 12'S, 45 0 51'W) and Cachoeira Paulista (22 0 41'S, 45 0 00'W). The infleunce of rainfall on the atmospheric Po 214 was studied at Sao Jose dos Campos. The mean activity was 98 pCi/m 3 for dry days (without rain during the preceding two days). On the contrary a low mean activity of 35 pCi/m 3 was observed for high pluviometry days from 08/30 to 10/26 for which total rainfall was 365.5 mm. At Cachoeria Paulista the Po 214 activity was correlated with the stability of the air (measured by the Richardson number), showing an accumaltion of natural radioactive aerosols during periods of higher stability of the lower atmosphere. (author) [pt
Directory of Open Access Journals (Sweden)
Yayoi Kinoshita
Full Text Available The shape of nuclei in many adherent cultured cells approximates an oblate ellipsoid, with contralateral flattened surfaces facing the culture plate or the medium. Observations of cultured cell nuclei from orthogonal perspectives revealed that nucleoporin p62 (NUP62 and nucleoporin 214 (NUP214 are differentially distributed between nuclear pore complexes on the flattened surfaces and peripheral rim of the nucleus. High resolution stimulated emission depletion (STED immunofluorescence microscopy resolved individual NPCs, and suggested both heterogeneity and microheterogeneity in NUP62 and NUP214 immunolabeling among in NPC populations. Similar to nuclear domains and interphase chromosome territories, architectural diversity and spatial patterning of NPCs may be an intrinsic property of the nucleus that is linked to the functions and organization of underlying chromatin.
49 CFR 214.329 - Train approach warning provided by watchmen/lookouts.
2010-10-01
... Protection § 214.329 Train approach warning provided by watchmen/lookouts. Roadway workers in a roadway work group who foul any track outside of working limits shall be given warning of approaching trains by one... shall clearly signify to all recipients of the warning that a train or other on-track equipment is...
25 CFR 214.28 - Location of sites for mines and buildings.
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Location of sites for mines and buildings. 214.28 Section... and buildings. In event of disagreement between two or more mineral lessees regarding sites for the location of wells, mines, buildings, plants, etc., the same shall be determined by the superintendent after...
40 CFR 421.214 - Standards of performance for new sources.
2010-07-01
...] [Reserved]. Ammonia (as N) 61.720 27.130 Fluoride 16.210 9.214 Total suspended solids 6.945 5.556 pH (1) (1) 1 Within the range of 7.5 to 10.0 at all times. (b) Roaster SO2 scrubber. NSPS for the Primary....218 Nickel 0.924 0.621 Selenium 1.377 0.621 Molybdenum [Reserved] [Reserved]. Ammonia (as N) 223.800...
2010-04-01
... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false You are disabled and drug addiction or alcoholism is a contributing factor material to the determination of disability. 416.214 Section 416.214 Employees' Benefits SOCIAL SECURITY ADMINISTRATION SUPPLEMENTAL SECURITY INCOME FOR THE AGED, BLIND, AND DISABLED Eligibility Reasons Why You May Not...
True coincidence summing correction determination for 214Bi principal gamma lines in NORM samples
International Nuclear Information System (INIS)
Haddad, Kh.
2014-01-01
The gamma lines 609.3 and 1,120.3 keV are two of the most intensive γ emissions of 214 Bi, but they have serious true coincidence summing (TCS) effects due to the complex decay schemes with multi-cascading transitions. TCS effects cause inaccurate count rate and hence erroneous results. A simple and easy experimental method for determination of TCS correction of 214 Bi gamma lines was developed in this work using naturally occurring radioactive material samples. Height efficiency and self attenuation corrections were determined as well. The developed method has been formulated theoretically and validated experimentally. The corrections problems were solved simply with neither additional standard source nor simulation skills. (author)
Polytarchou, Christos; Hommes, Daniel W; Palumbo, Tiziana; Hatziapostolou, Maria; Koutsioumpa, Marina; Koukos, Georgios; van der Meulen-de Jong, Andrea E; Oikonomopoulos, Angelos; van Deen, Welmoed K; Vorvis, Christina; Serebrennikova, Oksana B; Birli, Eleni; Choi, Jennifer; Chang, Lin; Anton, Peter A; Tsichlis, Philip N; Pothoulakis, Charalabos; Verspaget, Hein W; Iliopoulos, Dimitrios
2015-10-01
Persistent activation of the inflammatory response contributes to the development of inflammatory bowel diseases, which increase the risk of colorectal cancer. We aimed to identify microRNAs that regulate inflammation during the development of ulcerative colitis (UC) and progression to colitis-associated colon cancer (CAC). We performed a quantitative polymerase chain reaction analysis to measure microRNAs in 401 colon specimens from patients with UC, Crohn's disease, irritable bowel syndrome, sporadic colorectal cancer, or CAC, as well as subjects without these disorders (controls); levels were correlated with clinical features and disease activity of patients. Colitis was induced in mice by administration of dextran sodium sulfate (DSS), and carcinogenesis was induced by addition of azoxymethane; some mice also were given an inhibitor of microRNA214 (miR214). A high-throughput functional screen of the human microRNAome found that miR214 regulated the activity of nuclear factor-κB. Higher levels of miR214 were detected in colon tissues from patients with active UC or CAC than from patients with other disorders or controls and correlated with disease progression. Bioinformatic and genome-wide profile analyses showed that miR214 activates an inflammatory response and is amplified through a feedback loop circuit mediated by phosphatase and tensin homolog (PTEN) and PDZ and LIM domain 2 (PDLIM2). Interleukin-6 induced signal transducer and activator of transcription 3 (STAT3)-mediated transcription of miR214. A miR214 chemical inhibitor blocked this circuit and reduced the severity of DSS-induced colitis in mice, as well as the number and size of tumors that formed in mice given azoxymethane and DSS. In fresh colonic biopsy specimens from patients with active UC, the miR214 inhibitor reduced inflammation by increasing levels of PDLIM2 and PTEN. Interleukin-6 up-regulates STAT3-mediated transcription of miR214 in colon tissues, which reduces levels of PDLIM2 and PTEN
International Nuclear Information System (INIS)
Salas Mar, Bernardo; Martinez Negrete, Marco Antonio; Ruiz Chavarria, Gerardo; Abarca Munguia, Jose
2008-01-01
Full text: We describe in this paper the results obtained by the project 'Radiological analysis of environmental samples in some points of the coast of the Gulf of Mexico and coast of Quintana Roo, Mexico'. The purpose of the study is to identify and quantify the natural and anthropogenic radionuclides present from sediments, sand and seawater from several sites located along the coast of the Gulf of Mexico and the Caribean Sea. The samples are analysed in a Canberra Multichannel analyzer system for gamma spectrometry, equipped with a detector of hyper pure germanium and a Genie 2000 software, in the 'Laboratory of Radiological Analysis of Environmental Samples', belonging to the Physics Department, Faculty of Sciences, National Autonomous University of Mexico (UNAM). The geographic sites were samples were taken include the states of Tamaulipas, Veracruz, Tabasco, Campeche, Yucatan and Quintana Roo. The results of this studies will be published at the end of the project and we hope they will be useful for the national health and industrial sectors. Until now we have identified and measured the presence of natural radionuclides such as Potassium-40 (K-40), Bismuth 212 (Bi-212), Lead-212 (Pb-212), Bismuth-214 (Bi-214), Lead-214 (Pb-214), Radium-226 (Ra-226), Actinium 228 (Ac-228), Uranium-235 (U-235), as well as some anthropogenic radionuclides found near the Laguna Verde Nuclear Power Plant. The project is scheduled to last for three years, finishing in 2009. At its ending we shall be able to present conclusions and identify some tendencies, in connection with the background and possible radioactive contamination of the studied zones. This project takes place under the auspice of the 'Program of Support to Projects of Research and Technological Innovation' of the National Autonomous University of Mexico. (author)
High-spin states in 214Rn, 216Ra and a study of even-even N = 128 systematics
International Nuclear Information System (INIS)
Loennroth, T.; Horn, D.; Baktash, C.; Lister, C.J.; Young, G.R.
1983-01-01
High-spin states in 214 Rn and 216 Ra have been studied by means of the reaction 208 Pb( 13 C, α 3n #betta#) 214 Rn and 208 Pb( 13 C, 5n #betta#) 216 Ra at beam energies in the range 75--95 MeV. In-beam spectroscopy techniques, including #betta#-decay excitation functions, α-#betta# coincidences, #betta#-#betta# coincidences, #betta#-ray angular distributions, and pulsed-beam-#betta# timing, were utilized to establish level energies, #betta#-ray multipolarities, J/sup π/ assignments, and isomeric lifetimes. Excited states with spins up to 23h in 214 Rn and roughly-equal30h in 216 Ra were observed. Isomers were found in 214 Rn at 1625 keV (T/sub 1/2/ = 9 ns, J/sup π/ = 8 + ), 1787 keV (22 ns, 10 + ), 3485 keV (95 ns, 16), 4509 keV (230 ns, 20), and 4738 keV (8 ns, 22), and in 216 Ra at 1708 keV (8 ns, 8 + ) and 5868 keV (10 ns, approx.24). B(EL) values were deduced and compared to previously known lead-region electric transition rates. Shell-model calculations were performed and used to make configurational assignments. The absence of major α-decay branching in the isomers is explained and the systematic behavior of N = 128 even-even nuclei is discussed
High-spin states in 214Rn, 216Ra and a study of even-even N = 128 systematics
International Nuclear Information System (INIS)
Loennroth, T.; Horn, D.; Baktash, C.; Lister, C.J.; Young, G.R.
1981-09-01
High-spin states in 214 Rn and 216 Ra have been studied by means of the reaction 208 Pb( 13 C,α3nγ) 214 Rn and 208 Pb( 13 C,5nγ) 216 Ra at beam energies in the range 75-95 MeV. In-beam spectroscopy techniques, including γ-decay excitation functions, α-γ coincidences, γ-γ coincidences, γ-ray angular distributions and pulsed-beam-γ timing, were utilized to establish level energies, γ-ray multipolarities, JHπ assignments and isomeric lifetimes. Excited states with spins up to 23 h/2π in 214 Rn and 30 h/2π in 216 Ra were established. Isomers are found in 214 Rn at 1625 keV (9 ns, 8 + ), 1787 keV (22 ns, 10 + ), 3485 keV (95 ns, 16 + ), 4509 keV (230 ns, 20 + ) and 4735 keV (8.0 ns, 22 + ) and in 216 Ra at 1710 keV (8 ns, 8 + ) and 5868 keV (10 ns, 24 - ). B(EL) values are derived and compared to previously known lead-region electric transition rates. Shell-model calculations are performed on the basis of which configuration assignment is made. The absence of α-decay branching in the isomers is explained. The systematical behaviour of N = 128 even-even nuclei is discussed. Effective moments of inertia are derived. (author)
49 CFR 214.503 - Good-faith challenges; procedures for notification and resolution.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Good-faith challenges; procedures for notification... Roadway Maintenance Machines and Hi-Rail Vehicles § 214.503 Good-faith challenges; procedures for... vehicle shall inform the employer whenever the employee makes a good-faith determination that the machine...
Directory of Open Access Journals (Sweden)
Cecilia Nigro
2018-02-01
Full Text Available Evidence has been provided linking microRNAs (miRNAs and diabetic complications, by the regulation of molecular pathways, including insulin-signaling, involved in the pathophysiology of vascular dysfunction. Methylglyoxal (MGO accumulates in diabetes and is associated with cardiovascular complications. This study aims to analyze the contribution of miRNAs in the MGO-induced damaging effect on insulin responsiveness in mouse aortic endothelial cells (MAECs. miRNA modulation was performed by transfection of specific miRNA mimics and inhibitors in MAECs, treated or not with MGO. miRNA-target protein levels were evaluated by Western blot. PH domain leucine-rich repeat protein phosphatase 2 (PHLPP2 regulation by miR-214 was tested by luciferase assays and by the use of a target protector specific for miR-214 on PHLPP2-3′UTR. This study reveals a 4-fold increase of PHLPP2 in MGO-treated MAECs. PHLPP2 levels inversely correlate with miR-214 modulation. Moreover, miR-214 overexpression is able to reduce PHLPP2 levels in MGO-treated MAECs. Interestingly, a direct regulation of PHLPP2 is proved to be dependent by miR-214. Finally, the inhibition of miR-214 impairs the insulin-dependent Akt activation, while its overexpression rescues the insulin effect on Akt activation in MGO-treated MAECs. In conclusion, this study shows that PHLPP2 is a target of miR-214 in MAECs, and identifies miR-214 downregulation as a contributing factor to MGO-induced endothelial insulin-resistance.
International Nuclear Information System (INIS)
2003-01-01
This Corrective Action Investigation Plan contains the U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office's approach to collect the data necessary to evaluate corrective action alternatives appropriate for the closure of Corrective Action Unit (CAU) 214 under the Federal Facility Agreement and Consent Order. Located in Areas 5, 11, and 25 of the Nevada Test Site, CAU 214 consists of nine Corrective Action Sites (CASs): 05-99-01, Fallout Shelters; 11-22-03, Drum; 25-99-12, Fly Ash Storage; 25-23-01, Contaminated Materials; 25-23-19, Radioactive Material Storage; 25-99-18, Storage Area; 25-34-03, Motor Dr/Gr Assembly (Bunker); 25-34-04, Motor Dr/Gr Assembly (Bunker); and 25-34-05, Motor Dr/Gr Assembly (Bunker). These sites are being investigated because existing information on the nature and extent of potential contamination is insufficient to evaluate and recommend corrective action alternatives (CAAs). The suspected contaminants and critical analyte s for CAU 214 include oil (total petroleum hydrocarbons-diesel-range organics [TPH-DRO], polychlorinated biphenyls [PCBs]), pesticides (chlordane, heptachlor, 4,4-DDT), barium, cadmium, chronium, lubricants (TPH-DRO, TPH-gasoline-range organics [GRO]), and fly ash (arsenic). The land-use zones where CAU 214 CASs are located dictate that future land uses will be limited to nonresidential (i.e., industrial) activities. The results of this field investigation will support a defensible evaluation of viable corrective action alternatives that will be presented in the corrective action decision document
Das, Falguni; Dey, Nirmalya; Bera, Amit; Kasinath, Balakuntalam S.; Ghosh-Choudhury, Nandini; Choudhury, Goutam Ghosh
2016-01-01
Elevated IGF-1/insulin-like growth factor-1 receptor (IGF-1R) autocrine/paracrine signaling in patients with renal cell carcinoma is associated with poor prognosis of the disease independent of their von Hippel-Lindau (VHL) status. Increased expression of IGF-1R in renal cancer cells correlates with their potency of tumor development and progression. The mechanism by which expression of IGF-1R is increased in renal carcinoma is not known. We report that VHL-deficient and VHL-positive renal cancer cells possess significantly decreased levels of mature, pre-, and pri-miR-214 than normal proximal tubular epithelial cells. We identified an miR-214 recognition element in the 3′UTR of IGF-1R mRNA and confirmed its responsiveness to miR-214. Overexpression of miR-214 decreased the IGF-1R protein levels, resulting in the inhibition of Akt kinase activity in both types of renal cancer cells. IGF-1 provoked phosphorylation and inactivation of PRAS40 in an Akt-dependent manner, leading to the activation of mTORC1 signal transduction to increase phosphorylation of S6 kinase and 4EBP-1. Phosphorylation-deficient mutants of PRAS40 and 4EBP-1 significantly inhibited IGF-1R-driven proliferation of renal cancer cells. Expression of miR-214 suppressed IGF-1R-induced phosphorylation of PRAS40, S6 kinase, and 4EBP-1, indicating inhibition of mTORC1 activity. Finally, miR-214 significantly blocked IGF-1R-forced renal cancer cell proliferation, which was reversed by expression of 3′UTR-less IGF-1R and constitutively active mTORC1. Together, our results identify a reciprocal regulation of IGF-1R levels and miR-214 expression in renal cancer cells independent of VHL status. Our data provide evidence for a novel mechanism for IGF-1R-driven renal cancer cell proliferation involving miR-214 and mTORC1. PMID:27226530
49 CFR Appendix A to Part 214 - Schedule of Civil Penalties 1
2010-10-01
... individual train detection with interfering noise 2,000 (6) Use of individual train detection while a train...,500 5,000 (4) Failure to inspect and remove 5,000 10,000 (5) Failure to train 5,000 10,000 (6) Failure... 214.323 Foul time: (a) Foul time authority overlapping movement authority of train or equipment 5,000...
27 CFR 28.214 - Notice and claim, Form 1582-A (5120.24).
2010-04-01
... AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS EXPORTATION OF ALCOHOL Exportation of Wine With Benefit of Drawback § 28.214 Notice and claim, Form 1582-A (5120.24). Claim for allowance of drawback of internal revenue taxes on wines removed under the provisions of § 28.211 and § 28.212, shall be prepared by...
International Nuclear Information System (INIS)
Eatough, J.P.; Worley, A.; Moss, G.R.
1999-01-01
Personal dosemeters have been utilized to monitor the deposition of the radon decay products 218 Po and 214 Po onto individuals under normal environmental exposure conditions. Each detector consists of TASTRAK alpha-sensitive plastic incorporated into an ordinary working wristwatch. Subsequent analysis provides energy discrimination of the detected alpha-particle decays, and allows events from the individual radon decay products 218 Po and 214 Po, attached to the detector surface, to be uniquely identified. Assuming similar deposition onto skin and detector surfaces, the activity per unit area of deposited radionuclides can be determined for exposed skin. Forty-one personal dosemeters were issued to volunteers selected through the hospital medical physics departments at Reading, Northampton, Exeter and Plymouth. Each volunteer was also issued with a personal radon dosemeter to determine their individual radon exposure. The volunteers wore the two dosemeters simultaneously and continuously for a period of around one month. Correlations were observed between the radon exposure of the individual and the activity per unit area of 218 Po and 214 Po on the detector surface. From these correlations it can be estimated that at the UK average radon exposure of 20 Bq m -3 , the number of decays/cm 2 /year on continuously exposed skin surface is between 3500 and 28 000 for 218 Po, and between 7000 and 21 000 for 214 Po. These results can be combined with theoretical modelling of the dose distribution in the skin to yield the alpha-particle radiation dose to any identified target cells. (author)
Directory of Open Access Journals (Sweden)
W. P. Lokapirnasari
2015-03-01
Full Text Available Aim: This study aims to produce and assay cellulolytic enzyme activity (endo-(1,4-β-D-glucanase, exo-(1,4-β-Dglucanase, and β-glucosidase, at optimum temperature and optimum pH of Enterobacter cloacae WPL 214 isolated from bovine rumen fluid waste of Surabaya Abbatoir, Indonesia. Materials and Methods: To produce enzyme from a single colony of E. cloacae WPL 214, 98 × 1010 CFU/ml of isolates was put into 20 ml of liquid medium and incubated in a shaker incubator for 16 h at 35°C in accordance with growth time and optimum temperature of E. cloacae WPL 214. Further on, culture was centrifuged at 6000 rpm at 4°C for 15 min. Pellet was discarded while supernatant containing cellulose enzyme activity was withdrawn to assay endo-(1,4-β-D-glucanase, exo-(1,4-β-D-glucanase, and β-glucosidase. Results: Cellulase enzyme of E. cloacae WPL 214 isolates had endoglucanase activity of 0.09 U/ml, exoglucanase of 0.13 U/ml, and cellobiase of 0.10 U/ml at optimum temperature 35°C and optimum pH 5. Conclusion: E. cloacae WPL 214 isolated from bovine rumen fluid waste produced cellulose enzyme with activity as cellulolytic enzyme of endo-(1,4-β-D-glucanase, exo-(1,4-β-D-glucanase and β-glucosidase.
Toyama, Hiroshi; Ichise, Masanori; Liow, Jeih-San; Modell, Kendra J; Vines, Douglass C; Esaki, Takanori; Cook, Michelle; Seidel, Jurgen; Sokoloff, Louis; Green, Michael V; Innis, Robert B
2004-08-01
The purpose of this study was to evaluate the feasibility of absolute quantification of regional cerebral glucose utilization (rCMR(glc)) in mice by use of (18)F-FDG and a small animal PET scanner. rCMR(glc) determined with (18)F-FDG PET was compared with values determined simultaneously by the autoradiographic 2-(14)C-DG method. In addition, we compared the rCMR(glc) values under isoflurane, ketamine and xylazine anesthesia, and awake states. Immediately after injection of (18)F-FDG and 2-(14)C-DG into mice, timed arterial samples were drawn over 45 min to determine the time courses of (18)F-FDG and 2-(14)C-DG. Animals were euthanized at 45 min and their brain was imaged with the PET scanner. The brains were then processed for 2-(14)C-DG autoradiography. Regions of interest were manually placed over cortical regions on corresponding coronal (18)F-FDG PET and 2-(14)C-DG autoradiographic images. rCMR(glc) values were calculated for both tracers by the autoradiographic 2-(14)C-DG method with modifications for the different rate and lumped constants for the 2 tracers. Average rCMR(glc) values in cerebral cortex with (18)F-FDG PET under normoglycemic conditions (isoflurane and awake) were generally lower (by 8.3%) but strongly correlated with those of 2-(14)C-DG (r(2) = 0.95). On the other hand, under hyperglycemic conditions (ketamine/xylazine) average cortical rCMR(glc) values with (18)F-FDG PET were higher (by 17.3%) than those with 2-(14)C-DG. Values for rCMR(glc) and uptake (percentage injected dose per gram [%ID/g]) with (18)F-FDG PET were significantly lower under both isoflurane and ketamine/xylazine anesthesia than in the awake mice. However, the reductions of rCMR(glc) were markedly greater under isoflurane (by 57%) than under ketamine and xylazine (by 19%), whereas more marked reductions of %ID/g were observed with ketamine/xylazine (by 54%) than with isoflurane (by 37%). These reverse differences between isoflurane and ketamine/xylazine may be due to
International Nuclear Information System (INIS)
Jaswin, M. Arockia; Lal, D. Mohan
2011-01-01
Research highlights: → Tensile behaviour of cryo-treated valve steels are investigated at elevated temperature. → En 52 and 21-4N valve steel materials are treated at - 196 o C . → Tensile strength of cryo-treated En 52 and 21-4N valve steel has improved by 8 % and 12 % respectively. → Precipitation of fine carbides through cryogenic treatment is the reason for the improved strength. -- Abstract: This experimental study investigates the effects of cryogenic treatment on the tensile behaviour of En 52 and 21-4N valve steels at room and elevated temperatures. The materials are subjected to shallow cryogenic treatment (SCT) at 193 K and deep cryogenic treatment (DCT) at 85 K and the tensile behaviour is compared with that of the conventional heat treatment (CHT). The high temperature tensile test is conducted at 673 K (400 o C) and 923 K (650 o C) for the En 52 and 21-4N valve steels respectively. The ultimate tensile strength of the En 52 and 21-4N DCT samples show an enhancement of 7.87% and 6.76% respectively, over the CHT samples tested at the elevated temperature. The average yield strength of the En 52 DCT samples has an improvement 11% than that of the CHT samples when tested at room and elevated temperatures. The deep cryogenic treatment conducted at the optimized condition shows 7.84% improvement in the tensile strength for the En 52 valve steel and 11.87% improvement for the 21-4N valve steel when compared to the strength of the samples without the cryogenic treatment. A scanning electron microscopic analysis of the fracture surface indicates the presence of dimples and microvoid coalescence on the grain facets and interfaces of the cryo-treated specimens. The fracture surface of the deep cryo-treated 21-4N valve steel specimen shows a complete intergranular fracture with deep secondary cracks between the grains. On comparing the results of the percentage elongation, the cryo-treated samples show a smaller reduction in the elongation than that of the
DEFF Research Database (Denmark)
Silberstein, F; Cozzi-Lepri, A; Ruiz, L
2007-01-01
BACKGROUND: A negative association between the polymorphism F214L and type 1 thymidine analogue (TA) mutations (TAMs) has been observed. However, the virological response to TAs according to the detection of F214L has not been evaluated. METHODS: We studied 590 patients from EuroSIDA who started ...... were observed in patients with M41L/T215Y and mixed TAM profiles detected before the initiation of cART. CONCLUSIONS: This study provides evidence that the detection of polymorphism F214L is associated with a favorable virological response to TA-based cART.......BACKGROUND: A negative association between the polymorphism F214L and type 1 thymidine analogue (TA) mutations (TAMs) has been observed. However, the virological response to TAs according to the detection of F214L has not been evaluated. METHODS: We studied 590 patients from EuroSIDA who started TA...... therapy for the first time as part of potent combination antiretroviral therapy (cART) and who were tested for genotypic resistance within the past 6 months. End points were median reduction in the week 24 viral load and time to virological failure (2 consecutive VL measurements >400 copies/mL after...
Kristensen, Jens; Jonassen, Thomas E N; Rehling, Michael; Tønnesen, Else; Sloth, Erik; Nielsen, Søren; Frøkiaer, Jørgen
2011-01-01
The effect of an α-melanocyte stimulating hormone (α-MSH) analogue (AP214) on experimentally endotoxin-induced systemic inflammatory response syndrome (SIRS) was studied, because α-MSH in rodent models has shown promise in attenuating inflammatory response markers and associated organ damage in SIRS. SIRS is associated with considerable morbidity and mortality. Consequently, new treatment modalities are still warranted to address the different aspects of the pathophysiological process. SIRS was induced by lipopolysaccharide (LPS) (Escherichia coli endotoxin) infusion in anaesthetized Danish Landrace pigs (20-25 kg). The pigs received an α-MSH analogue (AP214) or saline as a bolus at the initiation of the LPS infusion. The hemodynamic response was registered as well as echocardiographic indices of left ventricular function. The cardiovascular response was recorded together with echocardiographic indices of left ventricular function in control and in intervention animals. AP214 reduced the early peak in pulmonary pressure and pulmonary vascular resistance by approximately 33%. Furthermore, AP214 prevented the decline in left ventricular fractional shortening as observed in the control group. Mean change and standard deviation in fractional shortening (ΔFS) in control group: - 7·3 (4·7), AP214 (low dose): 0·9 (8·2) and AP214 (high dose) 4·1 (6·0), P < 0·05 for both intervention groups versus control. In the porcine model, the peak increase in pulmonary pressure was attenuated, and the LPS-induced decline in left ventricular function was prevented. © 2010 The Authors. Clinical Physiology and Functional Imaging © 2010 Scandinavian Society of Clinical Physiology and Nuclear Medicine.
2013-12-19
...The FAA is issuing this notice to advise the public of nineteenth meeting of RTCA Special Committee 214 to be held jointly with EUROCAE WG-78: Standards for Air Traffic Data Communication Services.
2013-08-05
...The FAA is issuing this notice to advise the public of nineteenth meeting of RTCA Special Committee 214 to be held jointly with EUROCAE WG-78: Standards for Air Traffic Data Communication Services.
30 CFR 250.214 - What geological and geophysical (G&G) information must accompany the EP?
2010-07-01
... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What geological and geophysical (G&G... and Information Contents of Exploration Plans (ep) § 250.214 What geological and geophysical (G&G) information must accompany the EP? The following G&G information must accompany your EP: (a) Geological...
DEFF Research Database (Denmark)
Ceccherini-Silberstein, Francesca; Cozzi-Lepri, Alessandro; Ruiz, Lidia
2007-01-01
A negative association between the polymorphism F214L and type 1 thymidine analogue (TA) mutations (TAMs) has been observed. However, the virological response to TAs according to the detection of F214L has not been evaluated....
Work in the area of buildings 513 - 289 - 214 - Disruption to traffic
Optical Fibre Section, TS/EL
2005-01-01
The TS/EL group wishes to inform you that, in order to create an optical fibre access for the GEANT2 project, Route Rutherford will be closed to the public between Buildings 289 and 214 on 13 July 2005. Part of the Sophora car park will also be closed while the work is in progress (week 28: 11 - 15 July). You are requested to comply with the road signs in place. For more information, please call 160484. Optical Fibre Section, TS/EL
International Nuclear Information System (INIS)
Licina, G.J.; Busboom, H.J.; Ring, P.J.; Roy, P.; Schmidt, C.G.; Spalaris, C.N.
1982-02-01
The suitability and incentives were examined for using 2-1/4Cr-1Mo steel as a structural material for the entire primary and secondary sodium systems in a 1000 MWe pool-type Liquid Metal Fast Breeder Reactor. The critical properties, advantages and disadvantages of 2-1/4Cr-1Mo, and data needed for design were described for each major component in the reactor. The relative importance of alloy properties to the successful use of ferritics in LMFBR was identified. Licensing issues, likely to surface if ferritic alloys were to be used for critical reactor components, were discussed
Giovannelli, Alessio; Deslauriers, Annie; Fragnelli, Giuseppe; Scaletti, Luciano; Castro, Gaetano; Rossi, Sergio; Crivellaro, Alan
2007-01-01
Different irrigation effects on stem radius variation (DeltaR) and maximum daily shrinkage (MDS) in Populus deltoides 'Dvina' and Populusxcanadensis 'I-214' were studied to assess differences in drought tolerance between clones. One-year-old trees growing in concrete tanks were submitted to two irrigation regimes (natural rainfall and irrigation) from 24 June to 10 August, and DeltaR was monitored by automatic point dendrometers. Independently of the irrigation regime, 'Dvina' showed a higher stem radial increment than 'I-214'. In both clones, the first response to changed soil water content was a significant increase in MDS, whilst DeltaR decreased about 20 d later when pre-dawn leaf water potential (Psipd) dropped below -0.4 MPa. However, they displayed different strategies to overcome drought. 'Dvina' maintained a positive DeltaR for longer than 'I-214', which had lower leaf Psipd and greater leaf abscission at the end of the drought period. After irrigation resumed, 'Dvina' showed a higher capacity to restore stem growth. 'I-214' was probably unable to recover secondary growth because of higher leaf abscission during drought stress and the production of newly expanded leaves during recovery. It is concluded that the larger radial growth of 'Dvina' derived from a better water use (carbon uptake versus water loss) than 'I-214' under limited water availability.
2010-04-19
... so far SPR & INT documents version H SC-214/WG-78 TORs and Work Plan Review of Position Papers.... Francisco Estrada C., RTCA Advisory Committee. [FR Doc. 2010-8849 Filed 4-16-10; 8:45 am] BILLING CODE 4910...
2010-01-01
... school will be notified of the reasons and appeal rights if a petition for certification is denied, in accordance with the provisions of 8 CFR 103.3(a)(1)(iii). No fee is required with appeals related to SEVP... qualified professional personnel. (xiv) Failure to limit advertising in the manner prescribed in 8 CFR 214.3...
Li, Q S; Meng, F Y; Zhao, Y H; Jin, C L; Tian, J; Yi, X J
2017-08-01
This study aimed to investigate the functional effects of microRNA (miR)-214-5p on osteoblastic cells, which might provide a potential role of miR-214-5p in bone fracture healing. Blood samples were obtained from patients with hand fracture or intra-articular calcaneal fracture and from healthy controls (HCs). Expression of miR-214-5p was monitored by qRT-PCR at day 7, 14 and 21 post-surgery. Mouse osteoblastic MC3T3-E1 cells were transfected with antisense oligonucleotides (ASO)-miR-214-5p, collagen type IV alpha 1 (COL4A1) vector or their controls; thereafter, cell viability, apoptotic rate, and the expression of collagen type I alpha 1 (COL1A1), type II collagen (COL-II), and type X collagen (COL-X) were determined. Luciferase reporter assay, qRT-PCR, and Western blot were performed to ascertain whether COL4A1 was a target of miR-214-5p. Plasma miR-214-5p was highly expressed in patients with bone fracture compared with HCs after fracture (p extracellular matrix (ECM) formation of osteoblastic MC3T3-E1 cells by targeting COL4A1. Cite this article: Q. S. Li, F. Y. Meng, Y. H. Zhao, C. L. Jin, J. Tian, X. J. Yi. Inhibition of microRNA-214-5p promotes cell survival and extracellular matrix formation by targeting collagen type IV alpha 1 in osteoblastic MC3T3-E1 cells. Bone Joint Res 2017;6:464-471. DOI: 10.1302/2046-3758.68.BJR-2016-0208.R2. © 2017 Yi et al.
2010-10-01
..., modifications, revisions, and withdrawals of technical proposals under two-step sealed bidding. 52.214-23... Late submissions, modifications, revisions, and withdrawals of technical proposals under two-step..., Modifications, Revisions, and Withdrawals of Technical Proposals Under Two-Step Sealed Bidding (NOV 1999) (a...
International Nuclear Information System (INIS)
2009-02-01
The presence of actinium-227 has been noticed in the Mont d'Arree region (Finistere district) and such a presence in the environment had never been reported before. Thus, a study has been performed to investigate the origin of this element: about 300 samples have been analysed. After an indication of the investigation chronology, the report outlines that there is no relationship between the excess of actinium-227 and land amendment or embankments, that there is no obvious relationship between this presence and radioactive liquid effluents or atmospheric effluents from the Brennilis nuclear site. It shows that there is an obvious relationship with the radiological quality. It states that this excess of actinium 227 is related to the management of rain waters about the Brennilis site. An appendix specifies the location, nature and agenda of samplings (bio-indicators, samplings in sludge, soils, food and tap water, aquatic foams and sediments, ponds, wet lands, and at the vicinity of the power plant channel), presents detailed results obtained by gamma spectrometry, and measurement equipment and methods
Gamma-gamma directional correlations for levels excited up to 2.5 MeV of 214Po
International Nuclear Information System (INIS)
Morales, A.; Nunez-Lagos, R.; Morales, J.; Plo, M.
1984-01-01
The spin of twenty two excited states (up to an energy of 2.5 MeV) of 214 Po have been measured by using gamma-gamma directional correlation techniques, twelve of them for the first time. The multipole mixing ratios of the corresponding electromagnetic transition from these levels to the first excited level have also been determined. (author)
2010-10-01
... IMPROVEMENTS, SCHOLARSHIPS AND STUDENT LOANS Health Professions Student Loans § 57.214 Repayment of loans made... complete these studies, taking into account such factors as academic, medical, or financial difficulties...
2010-10-01
... reduction. This right to a price reduction is limited to that resulting from defects in data relating to... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Price Reduction for... PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 52.214-27 Price Reduction for Defective...
International Nuclear Information System (INIS)
Wilson, W.L.
1983-05-01
A series of prototypic steam generator 2-1/4 Cr-1 Mo tube/alloy 718 tube support plate wear tests were conducted in direct support of the Westinghouse Nuclear Components Division -- Breeder Reactor Components Project Large Scale steam Generator design. The initial objective was to verify the acceptable wear behavior of softer, ''over-aged'' alloy 718 support plate material. For all interfaces under all test conditions, resultant wear damage was adhesive in nature with varying amounts of 2-1/4 Cr-1 Mo tube material being adhesively transferred to the alloy 718 tube supports. Maximum tube wear depths exceeded the initially established design allowable limit of 127 μm (.005 in.) at 17 of the 18 interfaces tested. A decrease in contact stresses produced acceptable tube wear depths below a readjusted maximum design allowable value of 381 μm (.015 in.). Additional conservatisms associated with the simulation of a 40-year lifetime of rubbing in a one-week laboratory test provided further confidence that the 381 μm maximum tube wear allowance would not be exceeded in service. Softer, ''over-aged'' alloy 718 material was found to produce slightly less wear damage on 2-1/4 Cr-1 Mo tubing than fully age hardened material. Also, air formed oxide films on the alloy 718 reduced initial tube wear and delayed the onset of adhesive surface damage. However, at high surface stress levels, these films were not sufficiently stable to provide adequate long term protection from adhesive wear. The results of the present work and those of previous test programs suggest that the successful in-sodium tribological performance of 2-1/4 Cr-1 Mo/alloy 718 rubbing couples is dependent upon the presence of lubricative surface films, such as oxides and/or surface reaction or deposition products. 11 refs., 13 figs., 4 tabs
International Nuclear Information System (INIS)
Mohamed, A.; Ahmed, A.A.; Ali, A.E.; Yuness, M.
2009-01-01
Inhalation of 2 '2 2 Rn progeny in the domestic environment contributes the greatest fraction of the natural radiation exposure to the public. Dosimetric models are most often used in the assessment of human lung doses due to inhaled radioactivity because of the difficulty in making direct measurements. These models require information about the parameters of activity size distributions of radon progeny. The current study presents measured data on the attached and unattached activity size distributions of radon progeny in indoor air in El-Minia, Egypt. The attached fraction was collected using a low pressure Berner cascade impactor technique. A screen diffusion battery was used for collecting the unattached fraction. Most of the attached activities for 222 Rn progeny were associated with aerosol particles of the accumulation mode. The mean activity median aerodynamic diameter (AMAD) of this mode for 21 4 P b was determined to be 401 nm with relative mean geometric standard deviation of 2.96. The mean value of specific air activity concentration of 214 Pb associated with that mode was determined to be 4.74 %0.44 Bq m -3 . The relative mean geometric standard deviations of unattached 214 Pb was determined to be 1.21 with the mean activity thermodynamic diameter (AMTD) of 1.2 nm. The mean unattached activity concentration of 214 Pb was found to be 0.44%0.14 Bq m-3. Based on the obtained results of radon progeny size distributions (unattached and attached), the deposition fractions in each airway generation of the human lung were evaluated by using a lung deposition model
"Neurologic complications in Hemophilia: A study in 214 cases "
Directory of Open Access Journals (Sweden)
Ghaffarpoor M
2001-08-01
Full Text Available Intracranial hemorrhage and entrapment neuropathy are the most serious and disabling complications in hemophilia.The occurance of these neurological complications was studied in 214 hemophiliac patients during a 3 month period. Nine patients (4.2% suffered intracranial hemorrhage (One epidural and others intracerebral. All of intracranial hemorrhage patients had the sevee form of disease (<1% factor VIII or IX. 6 out of 9 intracranial hemorrhage cases mentioned a history of head trauma. Entrapment neuropathy was presen in 10 patients (femoral neuropathy 5, ulnar n. 3, radial n. 1 median n. 1 all of entropament neuropathy patients described a history of trauma to the extremities. Eight patients in the latter group had severe disease and two patients had moderate disease (1-5%. The proportion of intracranial hemorrhage following head trauma (20% in this series was greater than other studies. In conclusion, early diagnostic evaluation and replacement therapy may be beneficial in hemophilic patients with trauma.
Synthesis and antibacterial activity of 1-N-(1,3-dihydroxy-2-propyl)kanamycin B (UK-31,214).
Richardson, K; Brammer, K W; Jevons, S; Plews, R M; Wright, J R
1979-10-01
1-N-(1,3-Dihydroxy-2-propyl)kanamycin B was prepared and its in vitro activity against aminoglycoside-sensitive and aminoglycoside-resistant organisms was compared with that of kanamycin B and gentamicin. This kanamycin B derivative (code No. UK-31,214) demonstrated potent activity in all of these tests and gave good protection in experimental infections in mice.
International Nuclear Information System (INIS)
Kuesters, H.; Lalovic, M.
1976-04-01
In this report a review is given on the actinium isotope build-up and decay in LWRs, LMFBRs and HTRs. The dependence of the corresponding physical aspects on reactor type, fuel cycle strategy, calculational methods and cross section uncertainties is discussed. Results from postirradiation analyses and from integral experiments in fast zero power assemblies are compared with theoretical predictions. Some sensitivity studies about the influence of actinium nuclear data uncertainties on the isotopic concentration, decay heat, and the radiation out-put in fuel and waste are presented. In a second part, the main results of the IAEA-Advisory Group Meeting on Transactinium Nuclear Data are summarized and discussed. (orig.) [de
International Nuclear Information System (INIS)
Bezuidenhout, J.
2013-01-01
This article investigates the prospect of utilising the 351.9 keV gamma-ray of 214 Pb when determining the concentration of uranium. Soil samples were collected from various locations around South Africa and laboratory gamma ray spectra for each were obtained by means of a NaI(Tl)-detector (7.62×7.62 cm 2 ). The potassium, uranium and thorium concentrations where extracted by analysing gamma ray peaks that are associated with these radionuclides. Two separate uranium concentrations were extracted; one by means of the 214 Pb decay and the other one by means of the 214 Bi decay. These uranium concentrations were compared in terms of accuracies and detection limits. - Highlights: • Investigated a method to improve uranium concentrations measurements. • Expansion on an existing method that analyses naturally occurring radionuclides. • Utilise pill containers opposed to Marrinelli beakers. • Possible application to in situ measurements. • The method utilise NaI(Tl)-detectors with relative high efficiency
Interpersonal relationships and child-rearing practices in 214 parents of battered children.
Smith, S M; Hanson, R
1975-12-01
The self-reported child-rearing practices of 214 parents of battered babies were characterized in a few but not all respects by demanding behaviour which exceeded that to be expected in relation to their social class and age. Inconsistency in child management was noted in the comparison between lack of demonstrativeness and emotional over-involvement, and between physical punishment and a tendency to be lax in the supervision of the child, and was reminiscent of parents of delinquents. Unhappiness and hostility in relationships with members of their families of origin, with unsupporting partners and with people in general were other important features. Generally, identified perpetrators were characterized by features significant for the sample as a whole.
2010-10-01
... RAILROAD WORKPLACE SAFETY Roadway Worker Protection § 214.353 Training and qualification of roadway workers who provide on-track safety for roadway work groups. (a) The training and qualification of roadway... 49 Transportation 4 2010-10-01 2010-10-01 false Training and qualification of roadway workers who...
Papi, Ahmad; Khalaji, Davoud; Rizi, Hasan Ashrafi; Shabani, Ahmad; Hassanzadeh, Akbar
2014-01-01
Commitment to abstracting standards has a very significant role in information retrieval. The present research aimed to evaluate the rate of Commitment to ISO 214 Standard among the Persian abstracts of approved research projects at School of Health Management and Medical Informatics, Isfahan University of Medical Sciences, Isfahan, Iran. This descriptive study used a researcher-made checklist to collect data, which was then analyzed through content analysis. The studied population consisted of 227 approved research projects in the School of Health Management and Medical Informatics, Isfahan University of Medical Sciences during 2001-2010. The validity of the checklist was measured by face and content validity. Data was collected through direct observations. Statistical analyzes including descriptive (frequency distribution and percent) and inferential statistics (Chi-square test) were performed in SPSS-16. The highest and lowest commitment rates to ISO 214 standard were in using third person pronouns (100%) and using active verbs (34/4%), respectively. In addition, the highest commitment rates to ISO 214 standard (100%) related to mentioning third person pronouns, starting the abstract with a sentence to explain the subject of the research, abstract placement, and including keyword in 2009. On the other hand, during 2001-2003, the lowest commitment rate was observed in reporting research findings (16/7%). Moreover, various educational groups differed significantly only in commitment to study goals, providing research findings, and abstaining from using abbreviations, signs, and acronyms. Furthermore, educational level of the corresponding author was significantly related with extracting the keywords from the text. Other factors of ISO 214 standard did not have significant relations with the educational level of the corresponding author. In general, a desirable rate of commitment to ISO 214 standard was observed among the Persian abstracts of approved research
del Rio, Beatriz; Linares, Daniel M.; Fernandez, Maria; Mayo, Baltasar; Martin, M. Cruz; Alvarez, Miguel A.
2014-01-01
We here report a 2,801,031-bp annotated draft assembly for the Lactococcus lactis subsp. cremoris GE2-14 genome. This dairy strain produces the biogenic amine putrescine. This sequence may help identify the mechanisms regulating putrescine biosynthesis and throw light on ways to reduce its presence in fermented foods. PMID:25342694
Furfaro, Lucy L; Spiller, O Brad; Keelan, Jeffrey A; Payne, Matthew S
2015-09-01
There is a strong association between vaginal and/or amniotic fluid Ureaplasma spp. colonisation and risk of preterm birth. The novel fluoroketolide antibiotic solithromycin (CEM-101) is active against Ureaplasma spp. in vitro. Evidence from ex vivo and in vivo models suggests that, unlike most macrolide antibiotics, solithromycin readily crosses the placenta. Solithromycin metabolism varies according to species; in pregnant sheep, the bioactive metabolites CEM-214 and N-acetyl-CEM-101 (NAc-CEM-101) have been shown to accumulate in the amniotic cavity following maternal solithromycin administration, potentially contributing to its antimicrobial effects. To determine the antimicrobial activity of these metabolites against Ureaplasma spp., the effects of solithromycin, CEM-214, NAc-CEM-101 and the comparator azithromycin were tested on a collection of 100 clinical Ureaplasma spp. isolates from the UK and Australia using a modified 96-well broth microdilution method. MIC90 values observed for the combined cohort were: solithromycin, 0.125 mg/L; CEM-214, 0.5mg/L; NAc-CEM-101, 0.5mg/L; and azithromycin, 2mg/L. Solithromycin showed 34-fold greater activity against Ureaplasma spp. isolates than azithromycin, whilst CEM-214 and NAc-CEM-101 possessed ca. 22% and 17% of the activity of solithromycin, respectively, significantly greater than that of azithromycin. One bacterial isolate showed resistance to azithromycin (MIC=16 mg/L) but had a much lower MIC for solithromycin (MIC=0.25mg/L). In conclusion, the metabolites of solithromycin had reduced, but still potent, activity against 100 clinical Ureaplasma spp. isolates in vitro. This may be important in some instances such as pregnancy, however studies to determine levels of the metabolites in these settings are required. Copyright © 2015 Elsevier B.V. and the International Society of Chemotherapy. All rights reserved.
Degradation of Triazine-2-(14C Metsulfuron-Methyl in Soil from an Oil Palm Plantation.
Directory of Open Access Journals (Sweden)
B S Ismail
Full Text Available Triazine-2-(14C metsulfuron-methyl is a selective, systemic sulfonylurea herbicide. Degradation studies in soils are essential for the evaluation of the persistence of pesticides and their breakdown products. The purpose of the present study was to investigate the degradation of triazine-2-(14C metsulfuron-methyl in soil under laboratory conditions. A High Performance Liquid Chromatograph (HPLC equipped with an UV detector and an on-line radio-chemical detector, plus a Supelco Discovery column (250 x 4.6 mm, 5 μm, and PRP-1 column (305 x 7.0 mm, 10 μm was used for the HPLC analysis. The radioactivity was determined by a Liquid Scintillation Counter (LSC in scintillation fluid. The soil used was both sterilized and non-sterilized in order to observe the involvement of soil microbes. The estimated DT50 and DT90 values of metsulfuron-methyl in a non-sterile system were observed to be 13 and 44 days, whereas in sterilized soil, the DT50 and DT90 were 31 and 70 days, respectively. The principal degradation product after 60 days was CO2. The higher cumulative amount of (14CO2 in (14C-triazine in the non-sterilized soil compared to that in the sterile system suggests that biological degradation by soil micro-organisms significantly contributes to the dissipation of the compound. The major routes of degradation were O-demethylation, sulfonylurea bridge cleavage and the triazine "ring-opened."
Shnayder, E. P.; Moshkin, M. P.; Petrovskii, D. V.; Shevela, A. I.; Babko, A. N.; Kulikov, V. G.
2009-05-01
Our aim was to examine the possibility of use e-nose Bloodhound-214ST to determine presence or absence of H. pylori infection using exhalation samples of patients. Breath samples were collected twice: at baseline and after oral administration of 500 mg of urea. H. pylori status of patients was confirmed by antral biopsy. Using two approaches for the data analysis we showed the possibility to distinguish H. pylori free and infected patients.
Energy Technology Data Exchange (ETDEWEB)
U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office
2003-05-16
This Corrective Action Investigation Plan contains the U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office's approach to collect the data necessary to evaluate corrective action alternatives appropriate for the closure of Corrective Action Unit (CAU) 214 under the Federal Facility Agreement and Consent Order. Located in Areas 5, 11, and 25 of the Nevada Test Site, CAU 214 consists of nine Corrective Action Sites (CASs): 05-99-01, Fallout Shelters; 11-22-03, Drum; 25-99-12, Fly Ash Storage; 25-23-01, Contaminated Materials; 25-23-19, Radioactive Material Storage; 25-99-18, Storage Area; 25-34-03, Motor Dr/Gr Assembly (Bunker); 25-34-04, Motor Dr/Gr Assembly (Bunker); and 25-34-05, Motor Dr/Gr Assembly (Bunker). These sites are being investigated because existing information on the nature and extent of potential contamination is insufficient to evaluate and recommend corrective action alternatives (CAAs). The suspected contaminants and critical analyte s for CAU 214 include oil (total petroleum hydrocarbons-diesel-range organics [TPH-DRO], polychlorinated biphenyls [PCBs]), pesticides (chlordane, heptachlor, 4,4-DDT), barium, cadmium, chronium, lubricants (TPH-DRO, TPH-gasoline-range organics [GRO]), and fly ash (arsenic). The land-use zones where CAU 214 CASs are located dictate that future land uses will be limited to nonresidential (i.e., industrial) activities. The results of this field investigation will support a defensible evaluation of viable corrective action alternatives that will be presented in the corrective action decision document.
Planck Collaboration, [Unknown; Ade, P. A. R.; Aghanim, N.; Arnaud, M.; Ashdown, M.; Atrio-Barandela, F.; Aumont, J.; Baccigalupi, C.; Balbi, A.; Banday, A. J.; Barreiro, R. B.; Bartlett, J. G.; Battaner, E.; Benabed, K.; Benoît, A.; Bernard, J.-P.; Bersanelli, M.; Bhatia, R.; Bikmaev, I.; Böhringer, H.; Bonaldi, A.; Bond, J. R.; Borrill, J.; Bouchet, F. R.; Bourdin, H.; Burenin, R.; Burigana, C.; Cabella, P.; Cardoso, J.-F.; Castex, G.; Catalano, A.; Cayón, L.; Chamballu, A.; Chiang, L.-Y.; Chon, G.; Christensen, P. R.; Clements, D. L.; Colafrancesco, S.; Colombi, S.; Colombo, L. P. L.; Comis, B.; Coulais, A.; Crill, B. P.; Cuttaia, F.; Da Silva, A.; Dahle, H.; Danese, L.; Davis, R. J.; de Bernardis, P.; de Gasperis, G.; de Zotti, G.; Delabrouille, J.; Démoclès, J.; Diego, J. M.; Dolag, K.; Dole, H.; Donzelli, S.; Doré, O.; Dörl, U.; Douspis, M.; Dupac, X.; Efstathiou, G.; Enßlin, T. A.; Eriksen, H. K.; Finelli, F.; Flores-Cacho, I.; Forni, O.; Frailis, M.; Franceschi, E.; Frommert, M.; Galeotta, S.; Ganga, K.; Génova-Santos, R. T.; Giard, M.; Gilfanov, M.; Giraud-Héraud, Y.; González-Nuevo, J.; Górski, K. M.; Gregorio, A.; Gruppuso, A.; Hansen, F. K.; Harrison, D.; Heinämäki, P.; Hempel, A.; Henrot-Versillé, S.; Hernández-Monteagudo, C.; Herranz, D.; Hildebrandt, S. R.; Hivon, E.; Hobson, M.; Holmes, W. A.; Hurier, G.; Jaffe, T. R.; Jaffe, A. H.; Jagemann, T.; Jones, W. C.; Juvela, M.; Keihänen, E.; Khamitov, I.; Kisner, T. S.; Kneissl, R.; Knoche, J.; Knox, L.; Kunz, M.; Kurki-Suonio, H.; Lagache, G.; Lähteenmäki, A.; Lamarre, J.-M.; Lasenby, A.; Lawrence, C. R.; Le Jeune, M.; Leonardi, R.; Lilje, P. B.; López-Caniego, M.; Luzzi, G.; Macías-Pérez, J. F.; Maino, D.; Mandolesi, N.; Maris, M.; Marleau, F.; Marshall, D. J.; Martínez-González, E.; Masi, S.; Massardi, M.; Matarrese, S.; Mazzotta, P.; Mei, S.; Melchiorri, A.; Melin, J.-B.; Mendes, L.; Mennella, A.; Mitra, S.; Miville-Deschênes, M.-A.; Moneti, A.; Montier, L.; Morgante, G.; Mortlock, D.; Munshi, D.; Murphy, J. A.; Naselsky, P.; Nati, F.; Natoli, P.; Nørgaard-Nielsen, H. U.; Noviello, F.; Novikov, D.; Novikov, I.; Osborne, S.; Pajot, F.; Paoletti, D.; Pasian, F.; Patanchon, G.; Perdereau, O.; Perotto, L.; Perrotta, F.; Piacentini, F.; Piat, M.; Pierpaoli, E.; Piffaretti, R.; Plaszczynski, S.; Pointecouteau, E.; Polenta, G.; Ponthieu, N.; Popa, L.; Poutanen, T.; Pratt, G. W.; Prunet, S.; Puget, J.-L.; Rachen, J. P.; Rebolo, R.; Reinecke, M.; Remazeilles, M.; Renault, C.; Ricciardi, S.; Riller, T.; Ristorcelli, I.; Rocha, G.; Roman, M.; Rosset, C.; Rossetti, M.; Rubiño-Martín, J. A.; Rusholme, B.; Sandri, M.; Savini, G.; Scott, D.; Smoot, G. F.; Starck, J.-L.; Sudiwala, R.; Sunyaev, R.; Sutton, D.; Suur-Uski, A.-S.; Sygnet, J.-F.; Tauber, J. A.; Terenzi, L.; Toffolatti, L.; Tomasi, M.; Tristram, M.; Tuovinen, J.; Valenziano, L.; Van Tent, B.; Vielva, P.; Villa, F.; Vittorio, N.; Wade, L. A.; Wandelt, B. D.; Welikala, N.; Yvon, D.; Zacchei, A.; Zaroubi, S.; Zonca, A.
The survey of galaxy clusters performed by Planck through the Sunyaev-Zeldovich effect has already discovered many interesting objects, thanks to its full sky coverage. One of the SZ candidates detected inthe early months of the mission near to the signal-to-noise threshold, PLCKG214.6+37.0, was
Nadizadeh, Zahra; Naimi-Jamal, M. Reza; Panahi, Leila
2018-03-01
In the present study, ibuprofen-loaded nano metal-organic frameworks (NMOFs) {Cu2(1,4-bdc)2(dabco)}n and {Cu2(1,4-bdc-NH2)2(dabco)}n (bdc=benzenedicarboxylic acid, and dabco=diazabicyclooctane) were synthesized by ball-milling at room temperature in 2 h. The produced drug-loaded Cu-NMOFs were studied as ibuprofen drug delivery system and exhibited well-defined drug release behavior, exceptionally high drug loading capacities and the ability to entrap the model drug. The loading efficiency for ibuprofen was determined about 50.54% and 50.27%, respectively. The drug release of NMOFs was also monitored, and all of the loaded drug was released in 1 day. The NMOFs were characterized by FT-IR spectroscopy, X-ray powder diffraction (XRPD), thermogravimetric analysis (TGA), SEM (scanning electron microscopy), transmission electron microscopy (TEM), energy-dispersive X-ray spectroscopy (EDS), inductively coupled plasma (ICP), UV-vis spectroscopy and N2 adsorption porosimetry (BET&BJH).
International Nuclear Information System (INIS)
Moulin, J.
2008-06-01
Understanding natural radionuclides behaviour in surface water is a required step to achieve uranium mine rehabilitation and preserve water quality. The first objective of this thesis is to determine which are the radionuclides sources in a drinking water reservoir. The second objective is to improve the knowledge about the behaviour of uranium series radionuclides, especially actinium. The investigated site is a brook (Sagnes, Limousin, France) which floods a peat bog contaminated by a former uranium mine and which empties into the Crouzille lake. It allows studying radionuclides transport in surface water and radionuclides retention through organic substance or water reservoir. Radionuclides distribution in particulate, colloidal and dissolved phases is determined thanks to ultra-filtrations. Gamma spectrometry allows measuring almost all natural radionuclides with only two counting stages. However, low activities of 235 U series radionuclides impose the use of very low background well-type Ge detectors, such as those of the Underground Laboratory of Modane (France). Firstly, this study shows that no or few radionuclides are released by the Sagnes peat bog, although its radioactivity is important. Secondly, it provides details on the behaviour of uranium series radionuclides in surface water. More specifically, it provides the first indications of actinium solubility in surface water. Actinium's behaviour is very close to uranium's even if it is a little less soluble. (author)
Energy Technology Data Exchange (ETDEWEB)
Mauger, F.
1995-02-01
The NEMO experiment is designed to understand the nature of the neutrino by studying the double beta decay of Mo-100 which is related to the Majorana neutrino effective mass. In this kind of experiment a good understanding of the different sources of background is crucial as only few events are expected per year at the required level of sensitivity. In this thesis we present the main theoretical and experimental aspects of the measurement of the neutrinoless double beta decay of Mo-100 with the prototype detector NEMO2. The goal of this study is to obtain a realistic interpretation of the few events detected at high energy in the two-electron channel as a background to neutrinoless double beta decay. In particular, the contribution arising from Bi-214 has been investigated. These events have been selected and analysed by means of the beta-alpha decays of Bi-214 into Pb-210. The events are characterized by a delayed track in the wire chamber and the corresponding signal is rather clean. The study has demonstrated the diffusion of Rn-222 into the detector and its contribution to Bi-214 pollution has been estimated. A measurement of the Bi-214 internal contamination of the source has been made as well as an estimation of the Bi-214 deposit due to Rn-222. As a result of this study it appears that, under the conditions of the NEMO2 experiment, the Bi and Rn contributions are of the same order of magnitude as the background induced at high energy by two-neutrino double beta decay. In conclusion, the backgrounds of the neutrinoless double beta decay of Mo-100 are well understood in the NEMO2 experiment leading to an extrapolation for the NEMO3 experiment. (authors).
Directory of Open Access Journals (Sweden)
Yumei Luo
2016-01-01
Full Text Available The human induced pluripotent stem cell (hiPSC provides a breakthrough approach that helps overcoming ethical and allergenic challenges posed in application of neural stem cells (NSCs in targeted cancer gene therapy. However, the tumor-tropic capacity of hiPSC-derived NSCs (hiPS-NSCs still has much room to improve. Here we attempted to promote the tumor tropism of hiPS-NSCs by manipulating the activity of endogenous miR-199a/214 cluster that is involved in regulation of hypoxia-stimulated cell migration. We first developed a baculovirus-delivered CRISPR interference (CRISPRi system that sterically blocked the E-box element in the promoter of the miR-199a/214 cluster with an RNA-guided catalytically dead Cas9 (dCas9. We then applied this CRISPRi system to hiPS-NSCs and successfully suppressed the expression of miR-199a-5p, miR-199a-3p, and miR-214 in the microRNA gene cluster. Meanwhile, the expression levels of their targets related to regulation of hypoxia-stimulated cell migration, such as HIF1A, MET, and MAPK1, were upregulated. Further migration assays demonstrated that the targeted inhibition of the miR-199a/214 cluster significantly enhanced the tumor tropism of hiPS-NSCs both in vitro and in vivo. These findings suggest a novel application of CRISPRi in NSC-based tumor-targeted gene therapy.
International Nuclear Information System (INIS)
2007-01-01
This study resumes the discovery of an excess of actinium 227 found around by EL4 nuclear reactor actually in dismantling. The search for the origin of this excess revealed a real inquiry of investigation during three years. Because a nuclear reactor existed in this area a particular attention will have concerned this region. The doubt became the line of conduct to find the answer to the human or natural origin of this excess. Finally and against any evidence, it appears that the origin of this phenomenon was natural, consequence of the particular local geology. The detail of the different investigations is given: search of a possible correlation with the composition of elevations constituent of lanes, search (and underlining) of new sites in the surroundings of the Rusquec pond and the Plouenez station, study of the atmospheric deposits under winds of the nuclear power plant and in the east direction, search of a possible relationship with the gaseous effluents of the nuclear power plant in the past, historical study of radioactive effluents releases in the fifty last years by the analysis of the sedimentary deposits in the Saint-Herbiot reservoir, search of a possible correlation between the excess of actinium 227 and the nuclear power plant activity; search of a possible correlation with a human activity without any relationship with the nuclear activities, search of a correlation with the underground waters, search of a correlation with the geological context, collect of information on the possible transfers in direction of the food chain, determination of the radiological composition of the underground waters ( not perturbed by human activity), search of the cause of an excess of actinium 227 in the old channel of liquid effluents release of the nuclear power plant. The results are given and discussed. And contrary to all expectations the origin of the excess of actinium 227 is completely natural. (N.C.)
Energy Technology Data Exchange (ETDEWEB)
NONE
2007-07-01
This study resumes the discovery of an excess of actinium 227 found around by EL4 nuclear reactor actually in dismantling. The search for the origin of this excess revealed a real inquiry of investigation during three years. Because a nuclear reactor existed in this area a particular attention will have concerned this region. The doubt became the line of conduct to find the answer to the human or natural origin of this excess. Finally and against any evidence, it appears that the origin of this phenomenon was natural, consequence of the particular local geology. The detail of the different investigations is given: search of a possible correlation with the composition of elevations constituent of lanes, search (and underlining) of new sites in the surroundings of the Rusquec pond and the Plouenez station, study of the atmospheric deposits under winds of the nuclear power plant and in the east direction, search of a possible relationship with the gaseous effluents of the nuclear power plant in the past, historical study of radioactive effluents releases in the fifty last years by the analysis of the sedimentary deposits in the Saint-Herbiot reservoir, search of a possible correlation between the excess of actinium 227 and the nuclear power plant activity; search of a possible correlation with a human activity without any relationship with the nuclear activities, search of a correlation with the underground waters, search of a correlation with the geological context, collect of information on the possible transfers in direction of the food chain, determination of the radiological composition of the underground waters ( not perturbed by human activity), search of the cause of an excess of actinium 227 in the old channel of liquid effluents release of the nuclear power plant. The results are given and discussed. And contrary to all expectations the origin of the excess of actinium 227 is completely natural. (N.C.)
Sorption studies of radioelements on geological materials
International Nuclear Information System (INIS)
Berry, John A.; Yui, Mikazu; Kitamura, Akira
2007-11-01
Batch sorption experiments have been carried out to study the sorption of uranium, technetium, curium, neptunium, actinium, protactinium, polonium, americium and plutonium onto bentonite, granodiorite and tuff. Mathematical modelling using the HARPHRQ program and the HATCHES database was carried out to predict the speciation of uranium and technetium in the equilibrated seawater, and neptunium, americium and plutonium in the rock equilibrated water. Review of the literature for thermodynamic data for curium, actinium, protactinium and polonium was carried out. Where sufficient data were available, predictions of the speciation and solubility were made. This report is a summary report of the experimental work conducted by AEA Technology during April 1991-March 1998, and the main results have been presented at Material Research Society Symposium Proceedings and published as proceedings of them. (author)
2010-01-01
... in Judicial or Administrative Proceedings § 1.214 Appearance as a witness on behalf of a party other... valid summons, subpoena, or other compulsory process demanding his or her appearance, or otherwise requested to appear on behalf of a party other than the United States in a judicial or administrative...
International Nuclear Information System (INIS)
Yung Moo Huh
2001-01-01
Thermodynamics has been studied systematically for the high temperature cuprate superconductor La 2-x Sr x CuO 4-δ , La-214, in the entire superconductive region from strongly underdoped to strongly overdoped regimes. Magnetization studies with H(parallel)c have been made in order to investigate the changes in free energy of the system as the number of carriers is reduced. Above the superconducting transition temperature, the normal-state magnetization exhibits a two-dimensional Heisenberg antiferromagnetic behavior. Below T c , magnetization data are thermodynamically reversible over large portions of the H-T plane, so the free energy is well defined in these regions. As the Sr concentration is varied over the wide range from 0.060 (strongly underdoped) to 0.234 (strongly overdoped), the free energy change goes through a maximum at the optimum doped in a manner similar to the T c0 vs. x curve. The density of states, N(0), remains nearly constant in the overdoped and optimum doped regimes, taking a broad maximum around x = 0.188, and then drops abruptly towards zero in the underdoped regime. The La 2-x Sr x CuO 4 (La-214) system displays the fluctuating vortex behavior with the characteristic of either 2D or 3D fluctuations as indicated by clearly identifiable crossing points T* close to T c . The dimensional character of the fluctuations depends on both applied magnetic fields and the density of charge carriers. The dimensional crossover from 2D to 3D occurs in the strongly underdoped regime when the c-axis coherence distance ζ c becomes comparable to the spacing between adjacent CuO 2 layers s at sufficiently high magnetic fields near H c2
International Nuclear Information System (INIS)
Finnemore, Douglas K.
2001-01-01
Thermodynamics has been studied systematically for the high temperature cuprate superconductor La 2-x Sr x CuO 4-δ , La-214, in the entire superconductive region from strongly underdoped to strongly overdoped regimes. Magnetization studies with H (parallel) c have been made in order to investigate the changes in free energy of the system as the number of carriers is reduced. Above the superconducting transition temperature, the normal-state magnetization exhibits a two-dimensional Heisenberg antiferromagnetic behavior. Below T c , magnetization data are thermodynamically reversible over large portions of the H-T plane, so the free energy is well defined in these regions. As the Sr concentration is varied over the wide range from 0.060 (strongly underdoped) to 0.234 (strongly overdoped), the free energy change goes through a maximum at the optimum doped in a manner similar to the T c0 vs. x curve. The density of states, N(0), remains nearly constant in the overdoped and optimum doped regimes, taking a broad maximum around x = 0.188, and then drops abruptly towards zero in the underdoped regime. The La 2-x Sr x CuO 4 (La-214) system displays the fluctuating vortex behavior with the characteristic of either 2D or 3D fluctuations as indicated by clearly identifiable crossing points T* close to T c . The dimensional character of the fluctuations depends on both applied magnetic fields and the density of charge carriers. The dimensional crossover from 2D to 3D occurs in the strongly underdoped regime when the c-axis coherence distance ξ c becomes comparable to the spacing between adjacent CuO 2 layers s at sufficiently high magnetic field near H c2
Directory of Open Access Journals (Sweden)
Synne Torkildsen
Full Text Available RNA-sequencing of a case of acute myeloid leukemia with the bone marrow karyotype 46,XY,t(2;14(q22;q32[5]/47,XY,idem,+?4,del(6(q13q21[cp6]/46,XY[4] showed that the t(2;14 generated a ZEB2-BCL11B chimera in which exon 2 of ZEB2 (nucleotide 595 in the sequence with accession number NM_014795.3 was fused to exon 2 of BCL11B (nucleotide 554 in the sequence with accession number NM_022898.2. RT-PCR together with Sanger sequencing verified the presence of the above-mentioned fusion transcript. All functional domains of BCL11B are retained in the chimeric protein. Abnormal expression of BCL11B coding regions subjected to control by the ZEB2 promoter seems to be the leukemogenic mechanism behind the translocation.
Directory of Open Access Journals (Sweden)
Muhammad Ishtiaq Jan
2018-02-01
Full Text Available Data is about the mitochondrial apoptosis regulatory framework genes PUMA, DRP1 (apoptotic, and ARC (anti-apoptotic analysis after the employment of their controlling miRNAs inhibitors. The data represents putative conserved targeting of seed regions of miR-15a, miR-29a, and miR-214 with respective target genes PUMA, DRP1, and ARC. Data is of cross interference in expression levels of one miRNA family, miR-29a and its putative target DRP1 upon the inhibitory treatment of other miRNAs 15a and 214. Keywords: DRP1, miR-15a, Apoptosis, miRNAs inhibition
System for Automated Geoscientific Analyses (SAGA) v. 2.1.4
Conrad, O.; Bechtel, B.; Bock, M.; Dietrich, H.; Fischer, E.; Gerlitz, L.; Wehberg, J.; Wichmann, V.; Böhner, J.
2015-07-01
The System for Automated Geoscientific Analyses (SAGA) is an open source geographic information system (GIS), mainly licensed under the GNU General Public License. Since its first release in 2004, SAGA has rapidly developed from a specialized tool for digital terrain analysis to a comprehensive and globally established GIS platform for scientific analysis and modeling. SAGA is coded in C++ in an object oriented design and runs under several operating systems including Windows and Linux. Key functional features of the modular software architecture comprise an application programming interface for the development and implementation of new geoscientific methods, a user friendly graphical user interface with many visualization options, a command line interpreter, and interfaces to interpreted languages like R and Python. The current version 2.1.4 offers more than 600 tools, which are implemented in dynamically loadable libraries or shared objects and represent the broad scopes of SAGA in numerous fields of geoscientific endeavor and beyond. In this paper, we inform about the system's architecture, functionality, and its current state of development and implementation. Furthermore, we highlight the wide spectrum of scientific applications of SAGA in a review of published studies, with special emphasis on the core application areas digital terrain analysis, geomorphology, soil science, climatology and meteorology, as well as remote sensing.
An analysis of 214 cases of rib fractures
Directory of Open Access Journals (Sweden)
Sule Karadayi
2011-01-01
Full Text Available INTRODUCTION: Rib fractures are the most common type of injury associated with trauma to the thorax. In this study, we investigated whether morbidity and mortality rates increased in correlation with the number of fractured ribs. MATERIALS AND METHODS: Data from 214 patients with rib fractures who applied or were referred to our clinic between January 2007 and December 2008 were retrospectively evaluated. The patients were allocated into three groups according to the number of fractures: 1 patients with an isolated rib fracture (RF1 (n = 50, 23.4%, 2 patients with two rib fractures (RF2 (n = 53, 24.8%, and 3 patients with more than two rib fractures (RF3 (n = 111, 51.9%. The patients were evaluated and compared according to the number of rib fractures, mean age, associated chest injuries (hemothorax, pneumothorax, and/or pulmonary contusion, and co-existing injuries to other systems. FINDINGS: The mean age of the patients was 51.5 years. The distribution of associated chest injuries was 30% in group RF1, 24.6% in group RF2, and 75.6% in group RF3 (p<0.05. Co-existing injuries to other systems were 24% in group RF1, 23.2% in group RF2, and 52.6% in group RF3 (p<0.05. Two patients (4% in group RF1, 2 patients (3.8% in group RF2, and 5 patients (4.5% in group RF3 (total n = 9; 4.2% died. CONCLUSION: Patients with any number of rib fractures should be carefully screened for co-existing injuries in other body systems and hospitalized to receive proper treatment.
International Nuclear Information System (INIS)
Oku, Tatsuo; Kikuyama, Toshihiko; Fukaya, Kiyoshi; Kodaira, Tsuneo
1978-11-01
This is a collection of mechanical properties data of 2-1/4Cr-1Mo steel necessary for structural design and safety analysis of the pressure vessel of the Experimental Very High Temperature Gas-Cooled Reactor (VHTR). These include physical properties, mechanical properties, temper embrittlement, creep with fatigue, fracture toughness and irradiation effects. A review of the data shows the research areas to be carried out particularly in the future for more data. (author)
Directory of Open Access Journals (Sweden)
Qiaoyun Chen
2015-05-01
Full Text Available Background and Aims: Single nucleotide polymorphisms in miRNA binding sites, which are located in mRNA 3' untranslated regions (3'-UTRs, were recently found to influence microRNA-target interactions. Specifically, such polymorphisms can modulatebinding affinity or create or destroy miRNA-binding sites; such variants have also been found to be associated with cancer risk. In this study, we explored the effect of a functional variant at the miR-214 binding site in the methylenetetrahydrofolate reductase gene (rs114673809 on gastric cancer (GC risk in a hospital-based case-control study in a Chinese Han population. Methods and Results: We genotyped the rs114673809 polymorphism in 345 gastric cancer patients and 376 cancer-free controls using the polymerase chain reaction restriction fragment length polymorphism (PCR-RFLP technique. The functions of rs114673809 were investigated using a luciferase activity assay and validated by immunoblotting. We found that participants carrying the rs114673809 AA genotype or A allele had a significantly increased risk of gastric cancer (OR = 1.667, 95% CI = 1.044-2.660, P = 0.034; OR = 1.261, 95% CI = 1.017-1.563, P = 0.037, respectively compared to those carrying the GG genotype and G allele. In addition, rs114673809 modified the binding of hsa-miR-214 to MTHFR as well as MTHFR protein levels in gastric cancer patients. Conclusion: Our data suggested that rs114673809, which is located at the miR-214 binding site in the 3'-UTR of MTHFR, may play an important role in the development of gastric cancer in a Chinese Han population.
Correlation between inflammatory infiltrate and epithelial lining in 214 cases of periapical cysts.
Alcantara, Bárbara Albertini Roquim; Carli, Marina Lara de; Beijo, Luiz Alberto; Pereira, Alessandro Antônio Costa; Hanemann, João Adolfo Costa
2013-01-01
The aim of this study was to evaluate the prevalence of periapical cysts, identify their clinical and microscopic features and correlate their microscopic features with the inflammatory infiltrate present in the lesion site. A total of 214 cases were collected over a 10-year period. Clinical data, including gender, age, race, symptoms and location of the lesion, were recorded. Two independent examiners with no prior knowledge of the patients' clinical data conducted the microscopic evaluations. Statistical analyses were performed using Fisher's or chi-square tests at a 5% level of significance. The results showed that periapical cysts were more prevalent in white women, with a mean age of 35 years, and in the anterosuperior region. The majority of the lesions were lined by atrophic cystic epithelium, which was associated with moderate inflammatory infiltrate in the cystic capsule (p periapical cysts lined by atrophic epithelium are related to the presence of moderate mononuclear inflammatory infiltrate.
Mishra, Ritu; Benlhabib, Houda; Guo, Wei; Lerma Cervantes, Connie B; Mendelson, Carole R
2018-06-01
The major surfactant protein, SP-A (a product of the SFTPA gene), serves as a marker of type II pneumocyte differentiation and surfactant synthesis. SFTPA expression in cultured human fetal lung (HFL) epithelial cells is upregulated by hormones that increase cyclic AMP (cAMP) and activate TTF-1/NKX2.1 and NF-κB. To further define mechanisms for type II cell differentiation and induction of SP-A, we investigated roles of microRNAs (miRNAs). Using microarray to identify differentially expressed miRNAs in HFL epithelial cells during type II cell differentiation in culture, we observed that members of the miRNA 199a (miR-199a)/miR-214 cluster were significantly downregulated during differentiation. Validated and predicted targets of miR-199a-3p/miR-199a-5p and miR-214, which serve roles in type II cell differentiation (COX-2, NF-κB p50/p65, and CREB1), and the CREB1 target, C/EBPβ, were coordinately upregulated. Accordingly, overexpression of miR-199a-5p, miR-199a-3p, or miR-214 mimics in cultured HFL epithelial cells decreased COX-2, NF-κB p50/p65, CREB1, and C/EBPβ proteins, with an associated inhibition of SP-A expression. Interestingly, overexpression of the EMT factor, ZEB1, which declines during cAMP-induced type II cell differentiation, increased pri-miR-199a and reduced the expression of the targets NF-κB/p50 and COX-2. Collectively, these findings suggest that the developmental decline in miR-199a/miR-214 in HFL causes increased expression of critical targets that enhance type II cell differentiation and SP-A expression. Copyright © 2018 American Society for Microbiology.
Structure, magnetic and thermo-mechanic properties of Ni2.14Mn0.81Fe0.05Ga Heusler alloy
International Nuclear Information System (INIS)
Borisenko, I.D.; Koledov, V.V.; Khovajlo, V.V.; Khudaverdyan, T.O.; Shavrov, V.G.; Grechishkin, R.M.; Krasnoperov, E.P.; Li, Ya.; Tszyan, Ch.
2005-01-01
The influence of a strong magnetic field, single-axis pressure and intensive ultrasound on the process of structural (martensitic) transition on polycrystals of ferromagnetic alloy Ni 2.14 Mn 0.81 Fe 0.05 Ga with shape memory was studied experimentally. It is shown that magnetic field up to 8 T shifts without essential distortions the temperature hysteresis loop of martensitic transition to the range of higher temperatures, single-axis pressure blurs the martensitic transition, expanding the temperature hysteresis loop, while ultrasonic vibration may result in contraction of the hysteresis loop [ru
Correlation between inflammatory infiltrate and epithelial lining in 214 cases of periapical cysts
Directory of Open Access Journals (Sweden)
Barbara Albertini Roquim Alcantara
2013-12-01
Full Text Available The aim of this study was to evaluate the prevalence of periapical cysts, identify their clinical and microscopic features and correlate their microscopic features with the inflammatory infiltrate present in the lesion site. A total of 214 cases were collected over a 10-year period. Clinical data, including gender, age, race, symptoms and location of the lesion, were recorded. Two independent examiners with no prior knowledge of the patients' clinical data conducted the microscopic evaluations. Statistical analyses were performed using Fisher's or chi-square tests at a 5% level of significance. The results showed that periapical cysts were more prevalent in white women, with a mean age of 35 years, and in the anterosuperior region. The majority of the lesions were lined by atrophic cystic epithelium, which was associated with moderate inflammatory infiltrate in the cystic capsule (p < 0.01, with a diffuse localization pattern (p = 0.03 and absence of neutrophils (p = 0.01. Our findings suggest that periapical cysts lined by atrophic epithelium are related to the presence of moderate mononuclear inflammatory infiltrate.
Formation and evolution of ultrafine particles produced by radiolysis and photolysis
International Nuclear Information System (INIS)
Madelaine, G.J.; Perrin, M.L.; Renoux, A.
1980-01-01
Results are presented, concerning the formation, the size distribution, and the behavior of ultrafine particles produced by alpha disintegration of actinium and uv irradiation in filtered and natural atmospheric air. The characterization of these particles is obtained by electrical aerosol analyzer and diffusion battery method. Measurements are made in the range between 0.003 and 0.5 micrometer. Some qualitative indications are obtained on the different mechanisms which govern the evolution of ultrafine particles in the atmosphere (nucleation, coagulation, and condensation). It is now well established that the photo-oxydation of SO 2 in the atmosphere leads to the production of sulphuric acid and of sulphate, which are usually found in the form of submicronic particles. This paper concerns the evolution of ultrafine particles generated in the presence of a preexisting aerosol. They are either instantaneously produced by the alpha disintegrations of actinium 219 or continuously produced by the transformation of SO 2 under uv irradiation
Energy Technology Data Exchange (ETDEWEB)
Brown, Paul L. [Geochem Australia, Kiama, NSW (Australia); Ekberg, Christian [Chalmers Univ. of Technology, Goeteborg (Sweden). Nuclear Chemistry/Industrial Materials Recycling
2016-07-01
All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO{sub 2}OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH{sup 2+} for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.
Status of liquid metal reactor development in the United States of America
International Nuclear Information System (INIS)
Griffith, J.D.; Horton, K.E.
1991-01-01
An existing network of government and industry research facilities and engineering test centers in the United States is currently providing test capabilities and the technical expertise required to conduct an aggressive advanced reactor development program. Subsequent to the directive to shut down the Fast Flux Test Facility in early 1990, a variety of activities were undertaken to provide support for continued operation. The United States has made substantial progress in achieving ALMR program objectives. The metal fuel cycle is designed to recycle and burn its own actiniums, and has the potential to be a very effective burner of actiniums generated in the LWRs. The current emphasis in the IFR Program is on the comprehensive development of the IFR (Integral Fast Reactor) technology, to be followed by a period of technology demonstration which would verify the economic feasibility of the concept. The United States has been active in international cooperative activities in the fast reactor sector since 1969. (author). 11 figs, 1 tab
International Nuclear Information System (INIS)
Brown, Paul L.; Ekberg, Christian
2016-01-01
All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO 2 OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH 2+ for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.
International Nuclear Information System (INIS)
Fazal-ur-Rehman; Jamil, K.; Ali, S.; Khan, H.A.
1996-01-01
Passive radon /sup 222/Rn dosimeters employing particle detectors are widely used in concentration (p Ci/l) measurement in houses, mines and other areas of activity. These dosimeters yield track density which is needed to be converted into physically meaningful parameter of radon concentration in either p Ci/l or Bq m/sup -3/. Therefore, it is required to know the separate contributions of /sup 222/Rn and its progeny. In the present study we have measured the concentration of /sup 222/Rn and its daughters (/sup 218/Po and /sup 214/Po) separately in the Karlsruhe diffusion chamber radon dosimeter, with and without a filter, as a function of time by an active method using a surface barrier detector. The build up behavior of radon and its two daughters (/sup 218/Po and /sup 214/Po) as a function of time was studied by plotting the area under each peak versus collection time. The differential curves and the relative concentration of radon daughters as a function of time were also studied. The concentration of radon and its daughters shows a somewhat linear build up as a function of time for the presently studied time periods. The results of this experiment are expected to be useful in converting the integrated alpha track density as measured by a particle track detector, (used in passive radon dosimetry) to radon concentration levels and for determination of equilibrium factor. (author)
Fatigue-creep life prediction for a notched specimen of 2[1]/[4]Cr-1Mo steel at 600 C
International Nuclear Information System (INIS)
Inoue, Tatsuo; Sakane, Masao; Fukuda, Yoshio; Igari, Toshihide; Miyahara, Mitsuo; Okazaki, Masakazu
1994-01-01
This paper presents the life prediction of 2[1]/[4]Cr-1Mo notched specimens subjected to fast-fast, slow-slow and hold-time loadings at 600 C. The crack initiation lives of notched specimens were estimated based on the local stress-strain calculated by inelastic finite element analyses. For the life prediction, combinations of seven different constitutive models and five fatigue-creep damage laws were used. The applicability of the constitutive model and damage law is discussed. The constitutive models predict similar stress-strain relations at the notch root, leading to similar predicted lives. The damage model, however, has a much larger influence on the life prediction. ((orig.))
International Nuclear Information System (INIS)
Segre, Nadia; Fagundes, Rosane Correa
2013-01-01
In order to evaluate possible effects to the environment resulting from the implementation of the Centro Tecnologico da Marinha - Centro Experimental Aramar (CTMSP-CEA) at Ipero in Sao Paulo state, Brazil, which came into operation in 1989, an Environmental Monitoring Program (PMA) was established in October, 1987. One of the aims of this program is to monitor the soil and river sediments radionuclides levels at CEA and beyond its boundary. The utilization of statistical tools to evaluate the results of radiometric environmental monitoring is a procedure required by National Nuclear Energy Commission (CNEN). The box plot is a simple statistical tool for displaying data. The central tendency and dispersion of the results as well as the observation of unusual results (outliers) in the dataset are easily visualized. Control chart is a graph that maps data and provides a picture of how a process is performing over time. A control chart always has a central line for the mean, an upper line for the upper control limit and a lower line for the lower control limit. Box plots and control charts were used to visualize the annual amount of natural uranium, lead-214, actinium-228 and lead-212 in soil and river sediment detected between 1987 and 2011, considering the measurements of all monitored places each year. This historical observation shows that, in average, the results obtained are below than the 1987-1988 levels (CEA's pre-operational) or below than the backgrounds radionuclides values. (author)
Energy Technology Data Exchange (ETDEWEB)
Segre, Nadia; Fagundes, Rosane Correa, E-mail: nadia.segre@ctmsp.mar.mil.br [Centro Tecnologico da Marinha (CTM-SP/CEA/LARE), Ipero, SP (Brazil). Centro Experimental Aramar. Lab. Radioecologico; Moraes, Marco Antonio P.V. [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)
2013-07-01
In order to evaluate possible effects to the environment resulting from the implementation of the Centro Tecnologico da Marinha - Centro Experimental Aramar (CTMSP-CEA) at Ipero in Sao Paulo state, Brazil, which came into operation in 1989, an Environmental Monitoring Program (PMA) was established in October, 1987. One of the aims of this program is to monitor the soil and river sediments radionuclides levels at CEA and beyond its boundary. The utilization of statistical tools to evaluate the results of radiometric environmental monitoring is a procedure required by National Nuclear Energy Commission (CNEN). The box plot is a simple statistical tool for displaying data. The central tendency and dispersion of the results as well as the observation of unusual results (outliers) in the dataset are easily visualized. Control chart is a graph that maps data and provides a picture of how a process is performing over time. A control chart always has a central line for the mean, an upper line for the upper control limit and a lower line for the lower control limit. Box plots and control charts were used to visualize the annual amount of natural uranium, lead-214, actinium-228 and lead-212 in soil and river sediment detected between 1987 and 2011, considering the measurements of all monitored places each year. This historical observation shows that, in average, the results obtained are below than the 1987-1988 levels (CEA's pre-operational) or below than the backgrounds radionuclides values. (author)
DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS
Energy Technology Data Exchange (ETDEWEB)
P. Bernot
2005-07-13
The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this activity is to predict dissolved concentrations or solubility limits for elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) relevant to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are provided in the form of tabulated functions with pH and log fCO{sub 2} as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. Even though selection of an appropriate set of radionuclides documented in Radionuclide Screening (BSC 2002 [DIRS 160059]) includes actinium, transport of Ac is not modeled in the total system performance assessment for the license application (TSPA-LA) model because of its extremely short half-life. Actinium dose is calculated in the TSPA-LA by assuming secular equilibrium with {sup 231}Pa (Section 6.10); therefore, Ac is not analyzed in this report. The output data from this report are fundamental inputs for TSPA-LA used to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for the actinides discussed in this report. These models cover broad ranges of environmental conditions so they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or
DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS
International Nuclear Information System (INIS)
P. Bernot
2005-01-01
The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this activity is to predict dissolved concentrations or solubility limits for elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) relevant to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are provided in the form of tabulated functions with pH and log fCO 2 as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. Even though selection of an appropriate set of radionuclides documented in Radionuclide Screening (BSC 2002 [DIRS 160059]) includes actinium, transport of Ac is not modeled in the total system performance assessment for the license application (TSPA-LA) model because of its extremely short half-life. Actinium dose is calculated in the TSPA-LA by assuming secular equilibrium with 231 Pa (Section 6.10); therefore, Ac is not analyzed in this report. The output data from this report are fundamental inputs for TSPA-LA used to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for the actinides discussed in this report. These models cover broad ranges of environmental conditions so they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or otherwise
Kinetics of radioisotope exchange between brine and rock in a geothermal system
International Nuclear Information System (INIS)
Hammond, D.E.; Zukin, J.G.; Teh-Lung Ku
1988-01-01
A wide range of isotopes in the /sup 238/U, /sup 235/U, and /sup 232/Th decay chains was measured in geothermal brines collected from two production zones at 1898 and 3220 m in the Salton Sea Scientific Drilling Project well. High concentrations of radium, radon, and lead isotopes are generated and maintained by the input of these isotopes from solid phases into brine by both recoil and leaching processes, by the high chloride content of the brine which complexes radium and lead, and by the apparent absence of suitable unoccupied adsorption sites. In contrast, uranium, thorium, actinium, bismuth, and polonium isotopes all have low concentrations due to their efficient sorption from brine to rock. Measurements of short-lived isotopes in these decay series yield insights regarding the mechanisms controlling radioisotope exchange, and they permit estimation of rates of brine-rock interaction. For example, the /sup 228/Ac//sup 228/Ra activity ratio of 0.2 in brines indicates that the mean residence time of actinium in solution before sorption onto solid surfaces is less than 2.5 hours
Fatigue crack growth behaviour of 21/4Cr1Mo steel tube at elevated temperature
International Nuclear Information System (INIS)
Bulloch, J.H.; Buchanan, L.W.
1987-01-01
The fatigue crack growth characteristics of 21/4Cr1Mo steel tube have been examined at 588 0 C over the frequency range 0.02-20 Hz and dwell time range 10-960 min. All tests were conducted under load control in laboratory air at an R-ratio of 0.5. The elevated temperature fatigue crack growth characteristics were adequately described in terms of the stress intensity range ΔKAPPA. The continuous cyclic test data exhibited a significant effect of frequency that agreed well with predicted effects using a simple mathematical model of the high temperature fatigue process. With the dwell time range of 10-100 min there was a significant dwell time effect on the critical ΔKAPPA level for creep-fatigue interactive growth. At dwell times > 100 min the dwell time effect saturates. When creep-fatigue interactive growth occurs, growth rates reside above the maximum for continuum-controlled fatigue crack growth, and exhibit a da/dN varies as ΔKAPPA 10 dependence; failure is then intergranular in nature. (author)
Kuipers, B.J.H.; Gruppen, H.
2007-01-01
The molar extinction coefficients of 20 amino acids and the peptide bond were measured at 214 nm in the presence of acetonitrile and formic acid to enable quantitative comparison of peptides eluting from reversed-phase high-performance liquid chromatography, once identified with mass spectrometry
Evaluation of ferritic alloy Fe-2-1/4Cr-1Mo after neutron irradiation - microstructure development
International Nuclear Information System (INIS)
Gelles, D.S.
1984-05-01
Microstructural examinations are reported for nine specimen conditions of 2-1/4Cr-1Mo steel which had been irradiated by fast neutrons over the temperature range 390 to 510 0 C. Two heats of material were involved, each with a different preirradiation heat treatment, one irradiated to a peak fluence of 5.1 x 10 22 n/cm 2 (E > 0.1 MeV) or 24 dpa and the other to 2.4 x 10 23 n/cm 2 (E > 0.1 MeV) or 116 dpa. Void swelling is found following irradiation at 400 0 C in both conditions and to 480 0 C in the higher fluence conditions. Concurrently dislocation structure and precipitation formed. Peak void swelling, void density, dislocation density and precipitate number density developed at the lowest temperature, approx. 400 0 C, whereas mean void size, and mean precipitate size increased with increasing irradiation temperature. The examination results are used to provide interpretation of in-reactor creep, density change and post irradiation tensile behavior
LASL experience in decontamination of the environment
International Nuclear Information System (INIS)
Ahlquist, A.J.
1981-01-01
This discussion represents one part of a major effort in soil decontamination at the Los Alamos site. A contaminated industrial waste line in the Los Alamos townsite was removed, and a plutonium incineration facility, and a filter building contaminated with actinium-227 were dismantled. The former plutonium handling facility has been decontaminated, and canyons and an old firing site contaminated with strontium-90 have been surveyed
Determination of radionuclides in discharged water from gold ...
African Journals Online (AJOL)
Long-lived radionuclides from the Uranium-, Thorium- and Actinium-decay chains in the discharged water into the environment were radiochemically separated and the activity concentrations determined for 238U-series ranged from 3.8 ± 1.5 to 178 ± 19 mBqL-1, 232Th-series ranged from < 2.0 to 47.8 ± 7.3 mBqL-1 and ...
Multiaxial fatigue criterion for 2-1/4 Cr-1 Mo steel for use in high-temperature structural design
International Nuclear Information System (INIS)
Blass, J.J.
1990-01-01
An improved multiaxial fatigue failure criterion is described that is based on a definition of equivalent inelastic strain range incorporating the shear and normal components of inelastic strain range on the planes of maximum inelastic shear strain range. Optimum values of certain parameters contained in the formulation were obtained by the method of least squares from the results of combined axial-torsional strain cycling test of 2--1/4 Cr-1 Mo steel conducted at 538 degrees C (1000 degrees F). The ability of this criterion to correlate the test results was compared with that of the Mises equivalent inelastic strain range criterion and was found to be superior. A procedure is described for calculating the required shear and normal components of strain range under general multiaxial strain cycling conditions. An improved definition of equivalent total strain range based on these considerations is directly applicable to the method of estimating fatigue damage in ASME Code Case N-47. 17 refs., 5 figs., 1 tab
Thermal regime of the State 2-14 well, Salton Sea Scientific Drilling Project
Sass, J.H.; Priest, S.S.; Duda, L.E.; Carson, C.C.; Hendricks, J.D.; Robison, L.C.
1988-01-01
Temperature logs were made repeatedly during breaks in drilling and both during and after flow tests in the Salton Sea Scientific Drilling Project well (State 2-14). The purpose of these logs was to assist in identifying zones of fluid loss or gain and to characterize reservoir temperatures. At the conclusion of the active phase of the project, a series of logs was begun in an attempt to establish the equilibrium temperature profile. Thermal gradients decrease from about 250 mK m-1 in the upper few hundred meters to just below 200 mK m-1 near the base of the conductive cap. Using one interpretation, thermal conductivities increase with depth (mainly because of decreasing porosity), resulting in component heat flows that agree reasonably well with the mean of about 450 mW m-2. This value agrees well with heat flow data from the shallow wells within the Salton Sea geothermal field. A second interpretation, in which measured temperature coefficients of quartz- and carbonate-rich rocks are used to correct thermal conductivity, results in lower mean conductivities that are roughly constant with depth and, consequently, systematically decreasing heat flux averaging about 350 mW m-2 below 300 m. This interpretation is consistent with the inference (from fluid inclusion studies) that the rocks in this part of the field were once several tens of degrees Celsius hotter than they are now. The age of this possible disturbance is estimated at a few thousand years. -from Authors
Khorasani-Motlagh, Mozhgan; Noroozifar, Meissam
2003-12-01
A novel modified glassy carbon electrode containing Ni(Me2(CH3CO)2[14]tetraenoN4) complex was used as an electrocatalytic sensor for the determination of L-ascorbic acid in pH = 6.6. The peak potential shifted to negative by 205 mV compared with that for a bare electrode in cyclic voltammograms. The calibration curve was linear up to 6.2 x 10(-3) M with a detection limit 3.1 x 10(-7) M and an RSD% better than 2.47%. This newly modified electrode was applied to commercial pharmaceutical tablets, injections and foods. The obtained results were identical to those obtained by the classical 2,6-dichlorophenolindophenol method.
Autoradiographic disposition of [1-methyl-14C]- and [2-14C]caffeine in mice
International Nuclear Information System (INIS)
Lachance, M.P.; Marlowe, C.; Waddell, W.J.
1983-01-01
Male, C57B1/6J mice received either [1-methyl-14C]caffeine or [2-14C]caffeine via the tail vein at a dose of 0.7 or 11 mg/kg, respectively. At 0.1, 0.33, 1, 3, 9, and 24 hr after treatment, the mice were anesthetized with ether and frozen by immersion in dry ice/hexane. The mice were processed for whole-body autoradiography by the Ullberg technique; this procedure does not allow thawing or contact with solvents. All autoradiographs revealed some retention of radioactivity at early time intervals in the lacrimal glands, seminal vesicle fluid, nasal and olfactory epithelium, and retinal melanocytes. The remaining portion of the animal was densitometrically uniform except for the lower levels noted in the CNS and adipose tissues. Excretion of radioactivity by the liver and kidneys seems to be the major routes of elimination. Localization in the liver at late time intervals was confined principally to the centrilobular region. Late sites of retention, observed only after [1-methyl-14C]caffeine administration, included the pancreas, minor and major salivary glands, splenic red pulp, thymal cortex, bone marrow, and gastrointestinal epithelium. Sites of localization present in both studies included the olfactory epithelium, lacrimal glands, hair follicles, and retinal melanocytes. Further studies are needed to determine whether the localization at these various sites is due to metabolic degradation, active transport, or possibly a specific receptor interaction
International Nuclear Information System (INIS)
Cole, D.I.
1980-08-01
The sedimentology of two uranium-bearing sandstones on the Waterval portion of the farm Brandewyns Gat 214 was studied by means of 36 vertical profiles measured across, through and adjacent to 4 mineralised deposits. The vertical profiles basically consist of a succession of sedimentary facies. A total of 19 facies was recognised within the fluvial sandstone sequence according to the criteria of grain-size and sedimentary structure. Transitions between the facies were subjected to a Markov chain analysis in order to delineate Markov-dependent transitions. Uranium mineralisation occurs mostly within the lower half of the fluvial sandstone sequence and is confined to the coarser-grained sedimentary facies. These facies probably acted as suitable aquifers for the transport of uraniferous solutions and permeability differences between the sandstone and the underlying mudstone and siltstone must have restricted these solutions to the lower half of the channel sandstone. The massive mudstone facies contains 13 per cent of the total cumulative thickness of mineralisation. This mineralisation probably originated from synchronously deposited tuffaceous material. Subsequent migration of uraniferous solutions may have concentrated the uranium
Directory of Open Access Journals (Sweden)
Honek John F
2005-10-01
Full Text Available Abstract Background The alkaline protease from Pseudomonas aeruginosa (AprA is a member of the metzincin superfamily of metalloendoproteases. A key feature of these proteases is a conserved methionine-containing 1,4-tight β turn at the base of the active site zinc binding region. Results To explore the invariant methionine position in this class of protease, incorporation of a nonnatural fluorinated methionine, L-difluoromethionine (DFM, into this site was accomplished. Although overproduction of the N-terminal catalytic fragment of AprA resulted in protein aggregates which could not be resolved, successful heterologous production of the entire AprA was accomplished in the presence and absence of the nonnatural amino acid. DFM incorporation was found to only slightly alter the enzyme kinetics of AprA. In addition, differential scanning calorimetry indicated no significant alteration in the thermal stability of the modified enzyme. Conclusion Although invariant in all metzincin proteases, the methionine 214 position in AprA can be successfully replaced by the nonnatural amino acid DFM resulting in little effect on protein structure and function. This study indicates that the increased size of the methyl group by the introduction of two fluorines is still sufficiently non-sterically demanding, and bodes well for the application of DFM to biophysical studies of protein structure and function in this class of protease.
Walasek, Paula; Honek, John F
2005-01-01
Background The alkaline protease from Pseudomonas aeruginosa (AprA) is a member of the metzincin superfamily of metalloendoproteases. A key feature of these proteases is a conserved methionine-containing 1,4-tight β turn at the base of the active site zinc binding region. Results To explore the invariant methionine position in this class of protease, incorporation of a nonnatural fluorinated methionine, L-difluoromethionine (DFM), into this site was accomplished. Although overproduction of the N-terminal catalytic fragment of AprA resulted in protein aggregates which could not be resolved, successful heterologous production of the entire AprA was accomplished in the presence and absence of the nonnatural amino acid. DFM incorporation was found to only slightly alter the enzyme kinetics of AprA. In addition, differential scanning calorimetry indicated no significant alteration in the thermal stability of the modified enzyme. Conclusion Although invariant in all metzincin proteases, the methionine 214 position in AprA can be successfully replaced by the nonnatural amino acid DFM resulting in little effect on protein structure and function. This study indicates that the increased size of the methyl group by the introduction of two fluorines is still sufficiently non-sterically demanding, and bodes well for the application of DFM to biophysical studies of protein structure and function in this class of protease. PMID:16221305
Angona, Anna; Alvarez-Larrán, Alberto; Bellosillo, Beatriz; Martínez-Avilés, Luz; Garcia-Pallarols, Francesc; Longarón, Raquel; Ancochea, Àgueda; Besses, Carles
2015-03-15
Two prognostic models to predict overall survival and thrombosis-free survival have been proposed: International Prognostic Score for Essential Thrombocythemia (IPSET) and IPSET-Thrombosis, respectively, based on age, leukocytes count, history of previous thrombosis, the presence of cardiovascular risk factors and the JAK2 mutational status. The aim of the present study was to assess the clinical and biological characteristics at diagnosis and during evolution in essential thrombocythemia (ET) patients as well as the factors associated with survival and thrombosis and the usefulness of these new prognostic models. We have evaluated the clinical data and the mutation status of JAK2, MPL and calreticulin of 214 ET patients diagnosed in a single center between 1985 and 2012, classified according to classical risk stratification, IPSET and IPSET-Thrombosis. With a median follow-up of 6.9 years, overall survival was not associated with any variable by multivariate analysis. Thrombotic history and leukocytes>10×10(9)/l were associated with thrombosis-free survival (TFS). In our series, IPSET prognostic systems of survival and thrombosis did not provide more clinically relevant information regarding the classic risk of thrombosis stratification. Thrombotic history and leukocytosis>10×10(9)/l were significantly associated with lower TFS, while the prognostic IPSET-Thrombosis system did not provide more information than classical thrombotic risk assessment. Copyright © 2014 Elsevier España, S.L.U. All rights reserved.
An aerial radiological survey of the Nevada Test Site
International Nuclear Information System (INIS)
Hendricks, T.J.; Riedhauser, S.R.
1999-01-01
A team from the Remote Sensing Laboratory conducted an aerial radiological survey of the US Department of Energy's Nevada Test Site including three neighboring areas during August and September 1994. The survey team measured the terrestrial gamma radiation at the Nevada Test Site to determine the levels of natural and man-made radiation. This survey included the areas covered by previous surveys conducted from 1962 through 1993. The results of the aerial survey showed a terrestrial background exposure rate that varied from less than 6 microroentgens per hour (mR/h) to 50 mR/h plus a cosmic-ray contribution that varied from 4.5 mR/h at an elevation of 900 meters (3,000 feet) to 8.5 mR/h at 2,400 meters (8,000 feet). In addition to the principal gamma-emitting, naturally occurring isotopes (potassium-40, thallium-208, bismuth-214, and actinium-228), the man-made radioactive isotopes found in this survey were cobalt-60, cesium-137, europium-152, protactinium-234m an indicator of depleted uranium, and americium-241, which are due to human actions in the survey area. Individual, site-wide plots of gross terrestrial exposure rate, man-made exposure rate, and americium-241 activity (approximating the distribution of all transuranic material) are presented. In addition, expanded plots of individual areas exhibiting these man-made contaminations are given. A comparison is made between the data from this survey and previous aerial radiological surveys of the Nevada Test Site. Some previous ground-based measurements are discussed and related to the aerial data. In regions away from man-made activity, the exposure rates inferred from the gamma-ray measurements collected during this survey agreed very well with the exposure rates inferred from previous aerial surveys
International Nuclear Information System (INIS)
Gupta, Anil K.; Dhingra, Hitesh
2004-01-01
Planktic foraminiferal faunal and isotope data from Deep Sea Drilling Project (DSDP) Site 214 reveal a major change in surface water properties in the eastern Indian Ocean, coinciding with the mid-Pleistocene climate transition (MPT). A comparative study of Globigerinoides sacculifer (a surface dwelling, warm water, mixed layer tropical planktic foraminifera), Globorotalia menardii Complex (a deep dwelling, tropical species group), and Orbulina universa (an intermediate depth warm-water subtropical foraminifera) with the stable isotope record of Globigerinoides ruber suggests a warm, thick mixed layer in the eastern Indian Ocean during,∼ 2000 Kyr to ∼ 900 Kyr. Since,∼ 900 Kyr the surface water mass stratification weakened, and the mixed layer as well as thermocline were shallow. A decrease in the population abundance of Gs. sacculifer, together with a decrease in δ 13 C and increase in δ 18 O values suggest a continuous cool climate and increased surface productivity over the last ∼ 900 Kyr. This coincides with an increased variance in the 400 ∼Kyr component of Earth's eccentricity cycle. (author)
Energy Technology Data Exchange (ETDEWEB)
Harangozo, M; Toelgyessy, J; Lesny, J; Cik, G [Slovak Technical Univ., Bratislava (Slovakia). Fac. of Chemical Technology, Dept. of Environmental Science
1996-12-31
In this paper the activities of radium-226, actinium-228 and potassium-40 in fly ashes and building materials of Slovakia were determined. Different origin of coals combusted results in significant differences in specific activities of radium-226 and activities-228 of measured fly-ashes and building materials. The knowledge of the specific activity of selected nuclides contained in fly-ashes is, therefore, very important and in specific cases can indicate the possibilities of their further technological use. (J.K.) 1 tab., 3 refs.
A Radium-223 microgenerator from cyclotron-produced trace Actinium-227
International Nuclear Information System (INIS)
Abou, Diane S.; Pickett, Juile; Mattson, John E.; Thorek, Daniel L.J.
2017-01-01
The alpha particle emitter Radium-223 dichloride ("2"2"3RaCl_2) has recently been approved for treatment of late-stage bone metastatic prostate cancer. There is considerable interest in studying this new agent outside of the clinical setting, however the supply of "2"2"3Ra is limited and expensive. We have engineered a "2"2"3Ra microgenerator using traces of "2"2"7Ac previously generated from cyclotron-produced "2"2"5Ac. Radiochemically pure "2"2"3RaCl_2 was made, characterized, evaluated in vivo, and the source was recovered in high yield for regeneration of the microgenerator. - Highlights: • A "2"2"3Ra microgenerator was built using residual "2"2"7Ac from cyclotron-produced "2"2"5Ac. • Following "2"2"5Ac decay, the residual "2"2"7Ac was processed into pure "2"2"3Ra. • "2"2"7Ac and "2"2"7Th were recovered in high yield for a permanent supply of "2"2"3Ra. • Clinically supplied and generator-produced "2"2"3Ra have equivalent in vivo distribution. • Microdose column provides sufficient material for research use.
Purification of cerium, neodymium and gadolinium for low background experiments
Directory of Open Access Journals (Sweden)
Boiko R.S.
2014-01-01
Full Text Available Cerium, neodymium and gadolinium contain double beta active isotopes. The most interesting are 150Nd and 160Gd (promising for 0ν2β search, 136Ce (2β+ candidate with one of the highest Q2β. The main problem of compounds containing lanthanide elements is their high radioactive contamination by uranium, radium, actinium and thorium. The new generation 2β experiments require development of methods for a deep purification of lanthanides from the radioactive elements. A combination of physical and chemical methods was applied to purify cerium, neodymium and gadolinium. Liquid-liquid extraction technique was used to remove traces of Th and U from neodymium, gadolinium and for purification of cerium from Th, U, Ra and K. Co-precipitation and recrystallization methods were utilized for further reduction of the impurities. The radioactive contamination of the samples before and after the purification was tested by using ultra-low-background HPGe gamma spectrometry. As a result of the purification procedure the radioactive contamination of gadolinium oxide (a similar purification efficiency was reached also with cerium and neodymium oxides was decreased from 0.12 Bq/kg to 0.007 Bq/kg in 228Th, from 0.04 Bq/kg to <0.006 Bq/kg in 226Ra, and from 0.9 Bq/kg to 0.04 Bq/kg in 40K. The purification methods are much less efficient for chemically very similar radioactive elements like actinium, lanthanum and lutetium.
International Nuclear Information System (INIS)
Keller, C.
1988-01-01
Fifty years after the discovery of fission, the scientific community is aware that this type of nuclear reaction could have been discovered more than a decade earlier. Noddack, Tacke and Berg announced in 1925 the discovery of elements Z = 43 (masurium) and rhenium (Z = 75), the first one could be detected only in U-bearing minerals. A recent re-examination by P.H.M. von Assche of the published data clearly showed that the original claim for element Z = 43 of the authors in 1925 was correct and, therefore, they detected not only element Z = 43 but also the first fission product. Because this discovery of element Z = 43 could not be repeated by other authors as that time, the scientific credibility of Noddack-Tacke was very low in order to give credit to her proposal that the 'early' transuranium elements by Enrico Fermi might also be fragments of known (lighter) elements. Enrico Fermi in 1934 obtained these 'early' (and as we today know: wrong) transuranium isotopes by irradiation of uranium with neutrons. A 'wrong' periodic system in the thirties which placed Th, Pa and U as 6d-elements and not as 5f-actinides chemically helped to consider these fission products as transuranium elements Z = 93/94. In 1937/38 I. Curie and P. Savitch discovered an 'actinium-nuclide' with 3,5 h half-life which, however, had properties similar to lanthanium and not to actinium, as they stated. (orig.) [de
Shape of intrinsic alpha pulse height spectra in lanthanide halide scintillators
Wolszczak, W.; Dorenbos, P.
2017-06-01
Internal contamination with actinium-227 and its daughters is a serious drawback in low-background applications of lanthanide-based scintillators. In this work we showed the important role of nuclear γ de-excitations on the shape of the internal alpha spectrum measured in scintillators. We calculated with Bateman equations the activities of contamination isotopes and the time evolution of actinium-227 and its progenies. Next, we measured the intrinsic background spectra of LaBr3(Ce), LaBr3(Ce,Sr) and CeBr3 with a digital spectroscopy technique, and we analyzed them with a pulse shape discrimination method (PSD) and a time-amplitude analysis. Finally, we simulated the α background spectrum with Geant4 tool-kit, consequently taking into account complex α-γ-electron events, the α / β ratio dependence on the α energy, and the electron/γ nonproportionality. We found that α-γ mixed events have higher light yield than expected for alpha particles alone, which leads to overestimation of the α / β ratio when it is measured with internal 227Th and 223Ra isotopes. The time-amplitude analysis showed that the α peaks of 219Rn and 215Po in LaBr3(Ce) and LaBr3(Ce,Sr) are not symmetric. We compared the simulation results with the measured data and provided further evidence of the important role of mixed α-γ-electron events for understanding the shape of the internal α spectrum in scintillators.
International Nuclear Information System (INIS)
Martinot, L.; Fuger, J.
1985-01-01
The oxidation behavior of the actinides is explained on the basis of their electronic structure. The actinide elements, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium, curium, berkelium, californium, einsteinium, fermium, mendelevium, nobelium, and laurencium are included. For all except the last three elements, the points of discussion are oxidation states, Gibbs energies and potentials, and potential diagram for the element in acid solution; and thermodynamic properties of these same elements are tabulated. References are cited following discussion of each element with a total of 97 references being cited. 13 tables
International Nuclear Information System (INIS)
Tekuchev, V.V.; Barashkov, B.I.; Rygalov, L.N.; Dolzhikov, Yu.S.
2001-01-01
For the first time one obtained the polytherms of ultrasound velocity for liquid high-melting metals within wide temperature range. In terms of the rigid sphere model on the basis of the acoustic data one calculated the entropy values for 34 liquid metals at the melting point. The average discrepancy of the calculated values of entropy with the published one constitutes 8.2%. With increase of metal valency the error increases from 2.8 up to 13%. In case of francium, radium, promethium, actinium, hafnium, polonium, rhenium one obtained data for the first time [ru
Status of the lanthanides and actinides in the periodic table
International Nuclear Information System (INIS)
Holden, N.E.
1985-01-01
In extended discussions and correspondence with Ekkehard Fluck, the author was made aware of a problem with the Periodic Table, i.e., which element should be shown in the main table as the representative of the lanthanide series and the actinide series. In earlier discussion, he came to the conclusion that lanthanum and actinium are not the elements which should appear, but rather lutetium and lawrencium are more appropriate for inclusion in their place. This paper will attempt to justify the reasons for the above conclusions. 4 refs
Directory of Open Access Journals (Sweden)
Kirsten eCatthoor
2015-07-01
Full Text Available Stigmatization is a major hindrance in adult psychiatric patients with Axis-I diagnoses, as shown consistently in most studies. Significantly fewer studies on the emergence of psychiatric stigma in adult patients with personality disorders exist, although the resulting evidence is conclusive. Some authors consider patients with personality disorders at risk for severe stigmatization because of intense difficulties during interpersonal contact, even in a psychotherapeutic relationship. The aim of this study was primarily the assessment of pre-existing stigma in patients referred for intensive treatment for personality disorders. The study enrolled 214 patients admitted to the adult department of a highly specialized mental health care institute offering psychotherapy for patients with severe and complex personality pathology. All patients underwent a standard assessment with self-report questionnaires and a semi-structured interview to measure Axis II personality disorders. The Stigma Consciousness Questionnaire (SCQ and the Perceived Devaluation-Discrimination Questionnaire (DDQ, both validated instruments, were used to measure perceived and actual experiences of stigma. Independent sample t-tests were used to investigate differences in the mean total stigma scores for patients both with and without a personality disorder. One-way ANOVA’s were performed to assess the differences between having a borderline personality disorder, another personality disorder, or no personality disorder diagnosis.Multiple regression main effect analyses were conducted in order to explore the impact of the different personality disorder diagnosis on the level of stigma. The mean scores across all patient groups were consistent with rather low stigma. No differences were found for patients with or without a personality disorder diagnosis. Level of stigma in general was not associated with an accumulating number of personality disorders.
International Nuclear Information System (INIS)
Payne, T.E.
1991-01-01
One way to gain confidence in modelling possible radionuclide releases is to study natural systems which are similar to components of the multibarrier waste repository. Several such analogues are currently under study and these provide useful data about radionuclide behaviour in the natural environment. One such system is the Koongarra uranium deposit in the Northern Territory. In this dissertation, the migration of actinides, primarily uranium and thorium, has been studied as an analogue for the behaviour of transuranics in the far-field of a waste repository. The major findings of this study are: 1. the main process retarding uranium migration in the dispersion fan at Koongarra is sorption, which suppresses dissolved uranium concentrations well below solubility limits, with ferrihydrite being a major sorbing phase; 2. thorium is extremely immobile, with very low dissolved concentrations and corresponding high distribution ratios for 230 Th. Overall, it is estimated that colloids are relatively unimportant in Koongarra groundwater. Uranium migrates mostly as dissolved species, whereas thorium and actinium are mostly adsorbed to larger, relatively immobile particles and the stationary phase. However, of the small amount of 230 Th that passes through a 1μm filter, a significant proportion is associated with colloidal particles. Actinium appears to be slightly more mobile than thorium and is associated with colloids to a greater extent, although generally present in low concentrations. These results support the possibility of colloidal transport of trivalent and tetravalent actinides in the vicinity of a nuclear waste repository. 112 refs., 23 tabs., 32 figs
An eighteen-membered macrocyclic ligand for actinium-225 targeted alpha therapy
International Nuclear Information System (INIS)
Thiele, Nikki A.; MacMillan, Samantha N.; Wilson, Justin J.; Rodriguez-Rodriguez, Cristina
2017-01-01
The 18-membered macrocycle H 2 macropa was investigated for 225 Ac chelation in targeted alpha therapy (TAT). Radiolabeling studies showed that macropa, at submicromolar concentration, complexed all 225 Ac (26 kBq) in 5 min at RT. [ 225 Ac(macropa)] + remained intact over 7 to 8 days when challenged with either excess La 3+ ions or human serum, and did not accumulate in any organ after 5 h in healthy mice. A bifunctional analogue, macropa-NCS, was conjugated to trastuzumab as well as to the prostate-specific membrane antigen-targeting compound RPS-070. Both constructs rapidly radiolabeled 225 Ac in just minutes at RT, and macropa-Tmab retained >99 % of its 225 Ac in human serum after 7 days. In LNCaP xenograft mice, 225 Ac-macropa-RPS-070 was selectively targeted to tumors and did not release free 225 Ac over 96 h. These findings establish macropa to be a highly promising ligand for 225 Ac chelation that will facilitate the clinical development of 225 Ac TAT for the treatment of soft-tissue metastases. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)
An eighteen-membered macrocyclic ligand for actinium-225 targeted alpha therapy
Energy Technology Data Exchange (ETDEWEB)
Thiele, Nikki A.; MacMillan, Samantha N.; Wilson, Justin J. [Cornell Univ., Ithaca, NY (United States). Chemistry and Chemical Biology; Brown, Victoria; Jermilova, Una; Ramogida, Caterina F.; Robertson, Andrew K.H.; Schaffer, Paul; Radchenko, Valery [TRIUMF, Vancouver, BC (Canada). Life Science Div.; Kelly, James M.; Amor-Coarasa, Alejandro; Nikolopoulou, Anastasia; Ponnala, Shashikanth; Williams, Clarence Jr.; Babich, John W. [Radiology, Weill Cornell Medicine, New York, NY (United States); Rodriguez-Rodriguez, Cristina [British Columbia Univ., Vancouver, BC (Canada). Dept. of Physics and Astronomy and Centre for Comparative Medicine
2017-11-13
The 18-membered macrocycle H{sub 2}macropa was investigated for {sup 225}Ac chelation in targeted alpha therapy (TAT). Radiolabeling studies showed that macropa, at submicromolar concentration, complexed all {sup 225}Ac (26 kBq) in 5 min at RT. [{sup 225}Ac(macropa)]{sup +} remained intact over 7 to 8 days when challenged with either excess La{sup 3+} ions or human serum, and did not accumulate in any organ after 5 h in healthy mice. A bifunctional analogue, macropa-NCS, was conjugated to trastuzumab as well as to the prostate-specific membrane antigen-targeting compound RPS-070. Both constructs rapidly radiolabeled {sup 225}Ac in just minutes at RT, and macropa-Tmab retained >99 % of its {sup 225}Ac in human serum after 7 days. In LNCaP xenograft mice, {sup 225}Ac-macropa-RPS-070 was selectively targeted to tumors and did not release free {sup 225}Ac over 96 h. These findings establish macropa to be a highly promising ligand for {sup 225}Ac chelation that will facilitate the clinical development of {sup 225}Ac TAT for the treatment of soft-tissue metastases. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)
Journal of Naval Science. Volume 2. Number 3. July 1976
1976-07-01
supplementary food to the beakers containing stage VI nauplii: cyprids do not feed. The larvae in each beaker were con- fined within a close-fitting plastic...99-274% of Natural U) Uranium-234 (234U) (0-006% of Natural U) 2-48 X 10"’yrs Thorium-230 (230Th) Polonium -218(2I8Po) /through short lived...Natural U) Actinium-227 (--7Ac) FIG. 1. Nuclide chart. 4-51 X 10’Yrs 7 hours P 8 X 10’ Yrs 4 days Lead- 210 (210Pb) (22 yrs,/3"). 1-39 X 10
Qiu, Yu-Ying; Zhang, Ying-Wei; Qian, Xiu-Fen; Bian, Tao
2017-01-01
Asthma is tightly related to the imbalance of Th1/Th2 cells, and Runx3 plays a pivotal role in the differentiation of T helper cells. The present study aimed to investigate dysregulated microRNAs that may target Runx3 in CD4 + T cells from asthmatic patients and reveal Runx3 function in Th1/Th2 balance regulation. We detected the levels of Th1- and Th2-related cytokines by ELISA and analyzed the differentiation marker gene of T helper cells by qRT-PCR. Results indicated that an imbalance of Th1/Th2 cells was present in our asthmatic subject. Runx3 expression was reduced in the CD4 + T cells from asthmatic patients. Overexpression of Runx3 could restore the Th1/Th2 balance. After performing microRNA microarray assay, we found a series of microRNAs that were considerably altered in the CD4 + T cells from asthmatic patients. Among these upregulated microRNAs, eight microRNAs that may target Runx3 were selected by bioinformatics prediction. Five microRNAs, namely miR-371, miR-138, miR-544, miR-145, and miR-214, were confirmed by qRT-PCR and selected as candidate microRNAs. Luciferase reporter assay showed that these five microRNAs could directly target the 3'-UTR of Runx3. However, only simultaneous inhibition of these five microRNAs could alter the expression of Runx3. Most importantly, only simultaneous inhibition could improve the Th1/Th2 balance. Thus, we suggest that miR-371, miR-138, miR-544, miR-145, and miR-214 can modulate the Th1/Th2 balance in asthma by regulating Runx3 in a combinatorial manner.
Energy Technology Data Exchange (ETDEWEB)
Lewandowski, Robert J.; Memon, Khairuddin; Hickey, Ryan; Gates, Vanessa L.; Atassi, Bassel; Vouche, Michael; Atassi, Rohi; Desai, Kush; Hohlastos, Elias; Sato, Kent; Habib, Ali [Robert H. Lurie Comprehensive Cancer Center, Department of Radiology, Section of Interventional Radiology, Northwestern Memorial Hospital, Chicago, IL (United States); Mulcahy, Mary F.; Kircher, Sheetal; Newman, Steven B.; Nimeiri, Halla; Benson, Al B. [Northwestern University, Department of Medicine, Division of Hematology and Oncology, Robert H. Lurie Comprehensive Cancer Center, Chicago, IL (United States); Marshall, Karen; Williams, Melissa; Salzig, Krystina; Salem, Riad [Robert H. Lurie Comprehensive Cancer Center, Department of Radiology, Section of Interventional Radiology, Northwestern Memorial Hospital, Chicago, IL (United States); Northwestern University, Department of Medicine, Division of Hematology and Oncology, Robert H. Lurie Comprehensive Cancer Center, Chicago, IL (United States)
2014-10-15
The aim of this study was to analyze the safety, treatment characteristics and survival outcomes of Yttrium-90 (Y90) radioembolization for unresectable colorectal carcinoma (CRC) liver metastases refractory to standard of care therapy. A total of 214 patients with CRC metastases were treated with Y90 radioembolization over 12 years. Toxicity was assessed using National Cancer Institute common terminology criteria. Overall survival was analyzed from date of diagnosis of primary cancer, hepatic metastases and from the first Y90. Uni/multivariate analyses were performed. Substratification by era of chemotherapeutics was performed. Most patients were male (60 %) and <65 years old (61 %). Of them, 98 % had been exposed to chemotherapy. Grade 3 lymphocyte, bilirubin, albumin, ALP and AST toxicities were observed in 39 %, 11 %, 10 %, 8 % and 4 % of patients, respectively. Grade 4 lymphocyte and ALP toxicities were observed in 5 % and 3 % of patients, respectively. Median overall survival was 43.0, 34.6, and 10.6 months from date of diagnosis of primary cancer, hepatic metastases and first Y90, respectively. Survival was significantly longer in patients: (1) who received ≤2 cytotoxic drugs (n = 104) than those who received 3 (
Directory of Open Access Journals (Sweden)
Fay E Dawes
Full Text Available This study characterizes the 21.4 kilobase plasmid pECTm80 isolated from Escherichia coli strain 80, an α hemolytic human clinical diarrhoeal isolate (serotype O108:H-. DNA sequence analysis of pECTm80 revealed it belonged to incompatibility group X1, and contained plasmid partition and toxin-antitoxin systems, an R6K-like triple origin (ori replication system, genes required for replication regulation, insertion sequences IS1R, ISEc37 and a truncated transposase gene (Tn3-like ΔtnpA of the Tn3 family, and carried a class 2 integron. The class 2 integron of pECTm80 contains an intact cassette array dfrA1-sat2, encoding resistance to trimethoprim and streptothricin, and an aadA1 gene cassette truncated by the insertion of IS1R. The complex plasmid replication system includes α, β and γ origins of replication. Pairwise BLASTn comparison of pECTm80 with plasmid pE001 reveals a conserved plasmid backbone suggestive of a common ancestral lineage. Plasmid pECTm80 is of potential clinical importance, as it carries multiple genes to ensure its stable maintenance through successive bacterial cell divisions and multiple antibiotic resistance genes.
49 CFR 571.214 - Standard No. 214; Side impact protection.
2010-10-01
...) of 4,536 kilograms (kg) (10,000 pounds (lb)) or less, except for walk-in vans, or otherwise specified..., in part or in total. Raised roof is used as defined in paragraph S4 of 49 CFR 571.216. Walk-in van... in S6 (door crush resistance), S7 (moving deformable barrier test), and S9 (vehicle-to-pole test...
International Nuclear Information System (INIS)
Sanfeliu, C.; Sola, C.; Camon, L.; Martinez, E.; Rodriguez-Farre, E.
1990-01-01
Lindane-induced dose- and time-related changes in regional 2-14C-deoxyglucose (2-DG) uptake were examined in 59 discrete rat brain structures using the 2-DG autoradiographic technique. At different times (0.5-144 hr) after administration of a seizure-inducing single dose of lindane (60 mg/kg), 2-DG uptake was significantly increased in 18 cortical and subcortical regions mainly related to the limbic system (e.g., Ammon's horn, dentate gyrus, septal nuclei, nucleus accumbens, olfactory cortex) and extrapyramidal and sensory-motor areas (e.g., cerebellar cortex, red nucleus, medial vestibular nucleus). There was also a significant increase in superior colliculus layer II. In addition, significant decreases occurred in a group of 6 regions (e.g., auditory and motor cortices). Non-convulsing animals treated with the same dose of lindane showed a regional pattern of 2-DG uptake less modified than the convulsant group. A non-convulsant single dose of lindane (30 mg/kg) also modified significantly the 2-DG uptake (0.5-24 hr) in some brain areas. Although the various single doses of lindane tested produced different altered patterns of brain 2-DG uptake, some structures showed a similar trend in their modification (e.g., superior colliculi and accumbens, raphe and red nuclei). Repeated non-convulsant doses of lindane produced defined and long-lasting significant elevations of 2-DG uptake in some subcortical structures. Considering the treated groups all together, 2-DG uptake increased significantly in 26 of the 59 regions examined but only decreased significantly in 9 of them during the course of lindane effects. This fact can be related to the stimulant action described for this neurotoxic agent. The observed pattern provides a descriptive approach to the functional alterations occurring in vivo during the course of lindane intoxication
Zöller, Bengt; Li, Xinjun; Sundquist, Jan; Sundquist, Kristina
2014-06-01
Venous thromboembolism (VTE) clusters in families, but the familial risk of VTE has not been determined among adoptees. The aim was to disentangle the contributions of genetic and environmental factors to the familial transmission of VTE. The Swedish Multi-Generation Register was used to follow all Swedish-born adoptees born from 1932 to 2004 (n=80,214) between January 1, 1964, and December 31, 2010, for VTE. The risk of VTE was estimated in adoptees with ≥1 biological parent with VTE compared with adoptees without a biological parent with VTE. The risk of VTE was also estimated in adoptees with ≥1 adoptive parent with VTE compared with adoptees without an adoptive parent with VTE. Adoptees with ≥1 biological parent with VTE (n=137) were more likely to have VTE than adoptees without a biological parent with VTE (standardized incidence ratio) 1.51 (95% confidence interval, 1.27-1.79). The standardized incidence ratio for VTE was highest for adoptees with a biological parent diagnosed with VTE before the age of 50 years (standardized incidence ratio=2.03, 1.24-3.14). In contrast, adoptees with ≥1 adoptive parent with VTE (n=156) were not at increased risk of VTE (standardized incidence ratio=1.07, 0.91-1.25). These novel findings suggest that genetic factors make a stronger contribution to the familial transmission of VTE from parents to offspring than family environmental factors. © 2014 American Heart Association, Inc.
Energy Technology Data Exchange (ETDEWEB)
Marx, Sebastian Markus
2014-09-23
The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.
Energy Technology Data Exchange (ETDEWEB)
NONE
2006-07-01
In a previous study which concerned the catchment basin of the harbour of Brest, the A.C.R.O. put in evidence a marking by artificial radioelements around the power plant of Brennilis which can be imputed without ambiguities to the nuclear installation. It also put in evidence abnormalities concerning the natural radioactivity which justifies this new study. In the area of the Monts d'Arree, actinium 227 ({sup 227}Ac), non born by its ascendents which are {sup 235}U and {sup 231}Pa is observed. This phenomenon is characterized by mass activities superior to these ones of {sup 235}U and able to reach these ones of {sup 238}U. Its presence corresponds with the drainage of the Ellez river since the former channel of radioactive effluents releases from the nuclear power plant EL-4 up to the reservoir Saint-Herblot situated 6 km downstream. The strongest values of radioactivity are registered near the disused power plant, at this place a relationship exists between the level of actinium 227 and this one of the artificial radioactivity as it exists a relationship with the decay products of radon exhaled from the subsoil ({sup 210}Pb). But its presence is not limited to a part of the Ellez river, it is equally observed in terrestrial medium, in places in priori not influenced by the direct liquid effluents of the power plant. This place is situated at more than 4 km and without any connection with the Ellez waters. At this stage of the study, it is not possible to answer with certainty the question of the origin of this phenomenon. A new reorientation is considered indispensable to clarify definitively the origin of this unknown phenomenon in the scientific publications and the environmental monitoring. (N.C.)
International Nuclear Information System (INIS)
2006-01-01
In a previous study which concerned the catchment basin of the harbour of Brest, the A.C.R.O. put in evidence a marking by artificial radioelements around the power plant of Brennilis which can be imputed without ambiguities to the nuclear installation. It also put in evidence abnormalities concerning the natural radioactivity which justifies this new study. In the area of the Monts d'Arree, actinium 227 ( 227 Ac), non born by its ascendents which are 235 U and 231 Pa is observed. This phenomenon is characterized by mass activities superior to these ones of 235 U and able to reach these ones of 238 U. Its presence corresponds with the drainage of the Ellez river since the former channel of radioactive effluents releases from the nuclear power plant EL-4 up to the reservoir Saint-Herblot situated 6 km downstream. The strongest values of radioactivity are registered near the disused power plant, at this place a relationship exists between the level of actinium 227 and this one of the artificial radioactivity as it exists a relationship with the decay products of radon exhaled from the subsoil ( 210 Pb). But its presence is not limited to a part of the Ellez river, it is equally observed in terrestrial medium, in places in priori not influenced by the direct liquid effluents of the power plant. This place is situated at more than 4 km and without any connection with the Ellez waters. At this stage of the study, it is not possible to answer with certainty the question of the origin of this phenomenon. A new reorientation is considered indispensable to clarify definitively the origin of this unknown phenomenon in the scientific publications and the environmental monitoring. (N.C.)
International Nuclear Information System (INIS)
Blass, J.J.
1982-01-01
An improved multiaxial fatigue failure criterion was developed based on the results of combined axial-torsional strain cycling tests of AISI 304 and 2-1/4 Cr-1 Mo steel conducted at 538 0 C (1000 0 F). The formulation of this criterion involves the shear and normal components of inelastic strain range on the planes of maximum inelastic shear strain range. Optimum values of certain parameters contained in the formulation were obtained for each material by the method of least squares. The ability of this criterion to correlate the test results was compared with that of the usual (Mises) equivalent inelastic strain range criterion. An improved definition of equivalent inelastic strain range resulting from these considerations was used to generalize the theory of Strain Range Partitioning to multiaxial stress-strain conditions and was also applied to the linear summation of creep and fatigue damage
Radionuclide interactions with marine sediments
International Nuclear Information System (INIS)
Higgo, J.J.W.
1987-09-01
A critical review of the literature on the subject of the interactions of radionuclides with marine sediments has been carried out. On the basis of the information available, an attempt has been made to give ranges and 'best estimates' for the distribution ratios between seawater and sediments. These estimates have been based on an understanding of the sediment seawater system and the porewater chemistry and mineralogy. Field measurements, laboratory measurements and estimates based on stable-element geochemical data are all taken into account. Laboratory measurements include distribution-ratio and diffusion-coefficient determinations. The elements reviewed are carbon, chlorine, calcium, nickel, selenium, strontium, zirconium, niobium, technetium, tin, iodine, caesium, lead, radium, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium and curium. (author)
Calculation technique of free and impurity ion electronic structures
International Nuclear Information System (INIS)
Kulagin, N.A.; Sviridov, D.T.
1986-01-01
The monograph deals with calculation technique of free and impurity ion spectra with completed nl N -shell. The principles of the theory of irreducible tensor operators, genealogical coefficients, calculation technique of angular and radial parts of matrix elements operators are stated. The correlation accounting methods in free ions are considered in detail. The principles of the theory of crystal field and ligand field, the method of self-consistent field for impurity ions are reported. The technique efficiency based on example of lanthanum and actinium group ions is shown. Experimental data by nf N -ion spectra are given. The tables of angular coefficients, energy values of X-ray lines of rare earth ions and genealogical coefficients are given in the appendix
International Nuclear Information System (INIS)
Kitamura, Akira; Fujiwara, Kenso; Yui, Mikazu
2010-01-01
Within the scope of the JAEA thermodynamic database project for performance assessment of geological disposal of high-level radioactive and TRU wastes, the refinement of the thermodynamic data for the inorganic compounds and complexes of trivalent actinoids (actinium(III), plutonium(III), americium(III) and curium(III)) and samarium(III) was carried out. Refinement of thermodynamic data for these elements was based on the thermodynamic database for americium published by the Nuclear Energy Agency in the Organisation for Economic Co-operation and Development (OECD/NEA). Based on the similarity of chemical properties among trivalent actinoids and samarium, complementary thermodynamic data for their species expected under the geological disposal conditions were selected to complete the thermodynamic data set for the performance assessment of geological disposal of radioactive wastes. (author)
Energy Technology Data Exchange (ETDEWEB)
None
1979-09-01
Results of two radiological surveys of the St. Louis-Lambert Airport property, formerly known as the Airport Storage Site, St. Louis, Missouri, are presented. Uranium- and radium-bearing waste materials were stored from the 1940's to the late 1960's in this area. The surveys included direct measurements of beta-gamma radiation; determination of uranium, actinium, and radium concentrations in soil samples and from bore holes; determination of radionuclide concentrations in groundwater and surface water; measurement of radon flux from the ground surface; and measurements of /sup 222/Rn in air near the site. Results indicate that some offsite drainage pathways are becoming contaminated, probably by runoff from the site; no migration of /sup 222/Rn from the site was observed.
Sundquist, Kristina; Winkleby, Marilyn; Li, Xinjun; Ji, Jianguang; Hemminki, Kari; Sundquist, Jan
2011-08-01
Studies of adoptees have the potential to disentangle the contributions of genetic versus family environmental factors in the familial [corrected] transmission of coronary heart disease (CHD) because adoptees do not share the same family environment as their biological parents. The aims of this study were as follows: (1) to examine the risk of CHD in adopted men and women with at least one biological parent with CHD and (2) to examine the risk of CHD in adopted men and women with at least one adoptive parent with CHD. The Swedish Multigenerational register was used to follow all Swedish-born adoptees (born in or after 1932, n = 80,214) between January 1, 1973, and December 31, 2008, for CHD. The risk of CHD was estimated in adopted men and women with at least one biological parent with CHD and adopted men and women with at least one adoptive parent with CHD. The control groups consisted of adopted men or women without a biological parent with CHD or adopted men or women without an adoptive parent with CHD. Adopted men and women with at least one biological parent with CHD (n = 749) were 1.4 to 1.6 times (statistically significant, 95% CI) more likely to have CHD than adoptees without a biological parent with CHD. In contrast, men and women with at least one adoptive parent with CHD (n = 1,009) were not at increased risk of the disease. These findings (based on validated hospital diagnoses unbiased by recall) suggest that the familial [corrected] transmission of CHD from parents to offspring is more related to genetic factors than to family environmental factors. Copyright © 2011 Mosby, Inc. All rights reserved.
Dissolved Concentration Limits of Radioactive Elements
Energy Technology Data Exchange (ETDEWEB)
Y. Chen; E.R. Thomas; F.J. Pearson; P.L. Cloke; T.L. Steinborn; P.V. Brady
2003-06-20
The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of radioactive elements under possible repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, and measurements made in laboratory experiments and field work. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 radioactive elements (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium), which are important to calculated dose. Model outputs are mainly in the form of look-up tables plus one or more uncertainty terms. The rest are either in the form of distributions or single values. The results of this analysis are fundamental inputs for total system performance assessment to constrain the release of these elements from waste packages and the engineered barrier system. Solubilities of plutonium, neptunium, uranium, americium, actinium, thorium, protactinium, lead, and radium have been re-evaluated using the newly updated thermodynamic database (Data0.ymp.R2). For all of the actinides, identical modeling approaches and consistent environmental conditions were used to develop solubility models in this revision. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, activity coefficients, and selection of solubility controlling phase have been quantified or otherwise addressed. Moreover, a new blended plutonium solubility model has been developed in this revision, which gives a mean solubility that is three orders of magnitude lower than the plutonium solubility model used for the Total System Performance Assessment for the Site Recommendation. Two alternative neptunium solubility models have also been
Dissolved Concentration Limits of Radioactive Elements
International Nuclear Information System (INIS)
Y. Chen; E.R. Thomas; F.J. Pearson; P.L. Cloke; T.L. Steinborn; P.V. Brady
2003-01-01
The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of radioactive elements under possible repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, and measurements made in laboratory experiments and field work. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 radioactive elements (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium), which are important to calculated dose. Model outputs are mainly in the form of look-up tables plus one or more uncertainty terms. The rest are either in the form of distributions or single values. The results of this analysis are fundamental inputs for total system performance assessment to constrain the release of these elements from waste packages and the engineered barrier system. Solubilities of plutonium, neptunium, uranium, americium, actinium, thorium, protactinium, lead, and radium have been re-evaluated using the newly updated thermodynamic database (Data0.ymp.R2). For all of the actinides, identical modeling approaches and consistent environmental conditions were used to develop solubility models in this revision. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, activity coefficients, and selection of solubility controlling phase have been quantified or otherwise addressed. Moreover, a new blended plutonium solubility model has been developed in this revision, which gives a mean solubility that is three orders of magnitude lower than the plutonium solubility model used for the Total System Performance Assessment for the Site Recommendation. Two alternative neptunium solubility models have also been
Chapman, A G; Riley, K; Evans, M C; Meldrum, B S
1982-09-01
Amino acid concentrations have been determined in rat brain regions (cortex, striatum, cerebellum, and hippocampus) by HPLC after administration of acute anticonvulsant doses of sodium valproate (400 mg/kg, i.p.) and gamma-vinyl-GABA (1 g/kg, i.p.). After valproate administration the GABA level increases only in the cortex; aspartic acid concentration decreases in the cortex and hippocampus, and glutamic acid decreases in the hippocampus and striatum and increases in the cortex and cerebellum. There are no changes in the concentrations of glutamine, taurine, glycine, serine, and alanine following valproate administration. Only the GABA level increases in all the regions after gamma-vinyl-GABA administration. Cortical analyses 2, 4 and 10 minutes after pulse labeling with 2-[14C]glucose, i.v., show no change in the rate of cortical glucose utilization in the valproate treated group. The rate of labeling of glutamic acid is also unchanged, but the rate of labeling of GABA is reduced following valproate administration. After gamma-vinyl-GABA administration there is no change in the rate of labeling of GABA. These biochemical findings can be interpreted in terms of a primary anticonvulsant action of valproate on membrane receptors with secondary effects on the metabolism of amino acid neurotransmitters. This contrasts with the primary action of gamma-vinyl-GABA on GABA-transaminase activity.
International Nuclear Information System (INIS)
Fluegge, S.
1989-01-01
After the great survey of neutron induced radioactivity by Fermi and co-workers, the laboratories in Paris and Berlin-Dahlen tried to disentangle the complex results found in uranium. At that time neutron sources were small, activities low, and equipment very simple. Chemistry beyond uranium still was unknown. Hahn and Meitner believed to have observed three transuranic isomeric chains, a doubtful result even then. Early in 1938, Curie and Savic in Paris found an activity interpreted to be actinium, and Hahn and Meitner another to be radium. Both interpretations seemed impossible from energy considerations. Hahn and Strassmann, therefore, continued this work and succeeded to separate the new activity from radium. There remained no doubt that a barium isotope had been produced, the uranium nucleus splitting in the yet-unknown process we now call fission
Energy Technology Data Exchange (ETDEWEB)
Machaj, B. [Institute of Nuclear Chemistry and Technology, Warsaw (Poland)
1996-12-31
Employing an earlier elaborated computer program for simulation of depositing radon decay products: {sup 214}Po, {sup 214}Pb, {sup 214}Bi ({sup 214}Po) on air filter and for computing variation of their activity against time, an assessment of errors was carried out of a methods employing measurement of {sup 218}Po + {sup 214}Po alpha activity in three time intervals. Additionally errors of the methods measuring {sup 218}Po + {sup 214}Po alpha activity in three, two and one time intervals, were assessed. A few attempts were also made to measure the alpha activity in different time intervals and to assess their measuring errors. (authors). 10 refs, 4 figs, 14 tabs.
New method for large scale production of medically applicable Actinium-225 and Radium-223
International Nuclear Information System (INIS)
Aliev, R.A.; Vasilyev, A.N.; Ostapenko, V.; Kalmykov, S.N.; Zhuikov, B.L.; Ermolaev, S.V.; Lapshina, E.V.
2014-01-01
Alpha-emitters ( 211 At, 212 Bi, 213 Bi, 223 Ra, 225 Ac) are promising for targeted radiotherapy of cancer. Only two alpha decays near a cell membrane result in 50% death of cancer cell and only a single decay inside the cell is required for this. 225 Ac may be used either directly or as a mother radionuclide in 213 Bi isotope generator. Production of 225 Ac is provided by three main suppliers - Institute for Transuranium Elements in Germany, Oak Ridge National Laboratory in USA and Institute of Physics and Power Engineering in Obninsk, Russia. The current worldwide production of 225 Ac is approximately 1.7 Ci per year that corresponds to only 100-200 patients that could be treated annually. The common approach for 225 Ac production is separation from mother 229 Th or irradiation of 226 Ra with protons in a cyclotron. Both the methods have some practical limitations to be applied routinely. 225 Ac can be also produced by irradiation of natural thorium with medium energy protons . Cumulative cross sections of 225 Ac, 227 Ac, 227 Th, 228 Th formations have been obtained recently. Thorium targets (1-9 g) were irradiated by 114-91 MeV proton beam (1-50 μA) at INR linear accelerator. After dissolution in 8 M HNO 3 + 0.004 M HF thorium was removed by double LLX by HDEHP in toluene (1:1). Ac and REE were pre-concentrated and separated from Ra and most fission products by DGA-Resin (Triskem). After washing out by 0.01 M HNO 3 Ac was separated from REE by TRU Resin (Triskem) in 3 M HNO 3 media. About 6 mCi 225 Ac were separated in hot cell with chemical yield 85%. The method may be upscaled for production of Ci amounts of the radionuclide. The main impurity is 227 Ac (0.1% at the EOB) but it does not hinder 225 Ac from being used for medical 225 Ac/ 213 Bi generators. (author)
The marine geochemistry of actinium-227: Evidence for its migration through sediment pore water
International Nuclear Information System (INIS)
Nozaki, Yoshiyuki; Yamada, Masatoshi; Nikaido, Hirofumi
1990-01-01
227 Ac with a half life of 21.8 years has a potential utility as a tracer of deep water circulation and mixing studies on time scales less than 100 years. Here the authors present the first measurement of 227 Ac profile in the pore water of Northwest Pacific deep-sea sediment and in the ∼10,000 m long water column of Izu-Ogasawara Trench. The results clearly show that 227 Ac is supplied from the sediment to the overlying water through migration in the pore water. The model calculation indicates that the molecular diffusion alone through sediment porewater can support only a half of the standing crop of excess 227 Ac in the water column and the enhanced supply of 227 Ac by particle mixing is necessary to account for the remainder. Thus, bioturbation in the deep sea plays an important role in controlling the flux of some short-lived radionuclides such as 227 Ac and 228 Ra across the sediment-water interface
Kartal, Zeki; Yavuz, Abdülkerim
2018-03-01
In this study, the clathrates of fumarate-tetracyanonickel-dioxane, given by the formula M2[(fumarate)Ni(CN)4]·2(1,4-Dioxane) (M = Co, Ni, Cd and Hg), have been obtained for the first time through chemical methods. These clathrates have been characterized by elemental, thermal, FT-IR, and FT-Raman spectroscopies. The parameters of structures of clathrates have been determined by X-ray powder diffraction. The thermal behaviors of these clathrates have been also investigated by thermo-gravimetric analysis (TGA), differential thermal analysis (DTA), and derivative thermal gravimetric analysis (DTG) in the range of 20-900 °C. X-ray powder diffraction data have been recorded at ambient temperature in the 2θ range 5-50°. The FT-IR and FT-Raman spectra of clathrates have been recorded in the region of 4000-400 cm-1 and 4000-100 cm-1, respectively. The results of the spectral and thermal analyses of the newly synthesized clathrates of fumarate-tetracyanonickel-dioxane suggest that these clathrates are new examples of the Hofmann-type dioxane clathrates. In our study, the Hofmann-type dioxane clathrates, which are formed by bounding electrons of oxygen-donor atoms of fumarate ion ligand molecule to transition metal atoms, consist of the corrugated |M-Ni(CN)4|∞ polymeric layers, which are held in parallel through the chain of (-M-fumarate-M-).
Process for radioisotope recovery and system for implementing same
Meikrantz, David H [Idaho Falls, ID; Todd, Terry A [Aberdeen, ID; Tranter, Troy J [Idaho Falls, ID; Horwitz, E Philip [Naperville, IL
2009-10-06
A method of recovering daughter isotopes from a radioisotope mixture. The method comprises providing a radioisotope mixture solution comprising at least one parent isotope. The at least one parent isotope is extracted into an organic phase, which comprises an extractant and a solvent. The organic phase is substantially continuously contacted with an aqueous phase to extract at least one daughter isotope into the aqueous phase. The aqueous phase is separated from the organic phase, such as by using an annular centrifugal contactor. The at least one daughter isotope is purified from the aqueous phase, such as by ion exchange chromatography or extraction chromatography. The at least one daughter isotope may include actinium-225, radium-225, bismuth-213, or mixtures thereof. A liquid-liquid extraction system for recovering at least one daughter isotope from a source material is also disclosed.
Directory of Open Access Journals (Sweden)
Khaidem A. Devi
2017-09-01
Full Text Available A plant growth promoting bacterial endophyte designated as AL2-14B isolated from the leaves of Achyranthes aspera L. was identified as Pseudomonas aeruginosa based on its phenotypic and physiological features, and 16S rRNA gene sequence analysis. AL2-14B had plant growth stimulating attributes including siderophore and indole acetic acid release, inorganic phosphate solubilization, along with nitrogenase, ammonification, and protease activities. It also exhibited antifungal property against Rhizoctonia solani. The plantlets grown in germ-free condition were inoculated with AL2-14B and studied for the colonization of endophyte. Significant increase in population of AL2-14B between 3rd and 5th days after inoculation was recorded. The treatment of plants with endophytic P. aeruginosa AL2-14B increased nitrogen, phosphorus, potassium (NPK contents in plant by 3.8, 12.59, and 19.15%, respectively. Significant enhancement of shoot and root length, dry leaf, dry shoot and dry root weight, and leaf surface area as compared to control (P < 0.05 was recorded in AL2-14B inoculated plants. The antioxidant activities increased in plants grown in germ-free conditions and inoculated with AL2-14B. The present study emphasizes on the role of diazotrophic endophyte P. aeruginosa AL2-14B in stimulating growth of A. aspera L. and improvement of its medicinal properties. Significant increase in growth and antioxidant content of P. aeruginosa AL2-14B treated plants suggests the possibility of an economical and eco-friendly mean of achieving antioxidants rich, healthier A. aspera plants.
2010-10-01
... OFFICE OF SCIENCE AND TECHNOLOGY POLICY AND NATIONAL SECURITY COUNCIL PROCEDURES FOR THE USE AND... the use of radio frequencies upon proclamation by the President that there exists war, or a threat of war or a state of public peril or other wartime emergency or in order to preserve the neutrality of...
2010-10-01
...-highway ground transportation that run on rails or electro-magnetic guideways, including (1) commuter or other short-haul rail passenger service in a metropolitan or suburban area, and (2) high-speed ground... structures, whether of timber, stone, concrete, metal, or any combination thereof. Railroad bridge worker or...
2010-01-01
... care, housing, social services, or parks and recreation; or (ii) The entire plant or other comparable... or any part of structures, equipment, or other real or personal property or interests therein, and... Federal funds; (2) The grant or donation of Federal property and interests in property; (3) The detail of...
2010-04-01
... Southwest, Mid-Atlantic, New England: (i) Housing counseling services through its branches or affiliates or.... Virgin Islands. Subgrantee. An affiliate of a HUD-approved intermediary or SHFA that receives a subgrant...
2010-04-01
... to the severity and nature of the failure or misconduct. Such sanction may include— (1) In the case... claim or defense; (3) Striking pleadings, in whole or in part; (4) Staying the proceedings; (5...
2010-01-01
... STANDARDS AND TECHNOLOGY, DEPARTMENT OF COMMERCE ACCREDITATION AND ASSESSMENT PROGRAMS FASTENER QUALITY... conducted in a fair and impartial manner by the administrative law judge, who may limit attendance at any... may nevertheless proceed, and that party's failure to appear will not affect the validity of the...
2010-04-01
... HUD PROGRAM REQUIREMENTS; WAIVERS Disclosure and Verification of Social Security Numbers and Employer... Administration (including wages, net earnings from self-employment, and payments of retirement income), as... respect to which the individual actually received such compensation; (4) Unearned IRS income and self...
2010-04-01
... crossing improvements. (1) All traffic control devices proposed shall comply with the latest edition of the Manual on Uniform Traffic Control Devices for Streets and Highways supplemented to the extent applicable... use by traffic or the project accepted by FHWA until adequate warning devices for the crossing are...
Trepp, Ilme
2002-01-01
Rööptekst vene k. lk. 33-34. Ühistute huvide eest seismiseks loodi Mustamäe Korteriühistute Nõukoda, mis seab eesmärgiks esindada Mustamäe korteriühistuid, teha koostööd linnavalitsusega, vahetada infot ja kasulikke kogemusi
International Nuclear Information System (INIS)
Bonotto, D.M.; Mello, C.B.
2006-01-01
A combined method for evaluating radon ( 222 Rn) and progeny ( 214 Pb and 214 Bi) in water was developed by using inexpensive alpha scintillation counting and gamma ray spectrometry through NaI(Tl) scintillation detectors. A groundwater sample collected at the Pocos de Caldas alkaline massif in Brazil was submitted to the technique in order to assure its applicability by comparing the volumetric activities by different methods. Similar volumetric activity was determined for 214 Pb and 214 Bi in the sample analyzed that is compatible with the expected condition of radioactive equilibrium between these nuclides. The combined method was successfully used to analyze groundwater samples from Guarani aquifer in Sao Paulo State, Brazil, and the results of the measurements indicated that 214 Pb and 214 Bi provide useful information concerning the evaluation of the drinking water quality in terms of radiological aspects. This is because they are directly identified in the water samples, without the need of requiring the assumption of the establishment of the transient equilibrium condition with its parent 222 Rn
Energy Technology Data Exchange (ETDEWEB)
Bonotto, D.M. [Departamento de Petrologia e Metalogenia, Universidade Estadual Paulista (UNESP), IGCE-Instituto de Geociencias e Ciencias Exatas, Av. 24-A, No. 1515, C.P. 178, CEP 13506-900, Rio Claro, Sao Paulo (Brazil)]. E-mail: dbonotto@rc.unesp.br; Mello, C.B. [Departamento de Petrologia e Metalogenia, Universidade Estadual Paulista (UNESP), IGCE-Instituto de Geociencias e Ciencias Exatas, Av. 24-A, No. 1515, C.P. 178, CEP 13506-900, Rio Claro, Sao Paulo (Brazil)
2006-07-01
A combined method for evaluating radon ({sup 222}Rn) and progeny ({sup 214}Pb and {sup 214}Bi) in water was developed by using inexpensive alpha scintillation counting and gamma ray spectrometry through NaI(Tl) scintillation detectors. A groundwater sample collected at the Pocos de Caldas alkaline massif in Brazil was submitted to the technique in order to assure its applicability by comparing the volumetric activities by different methods. Similar volumetric activity was determined for {sup 214}Pb and {sup 214}Bi in the sample analyzed that is compatible with the expected condition of radioactive equilibrium between these nuclides. The combined method was successfully used to analyze groundwater samples from Guarani aquifer in Sao Paulo State, Brazil, and the results of the measurements indicated that {sup 214}Pb and {sup 214}Bi provide useful information concerning the evaluation of the drinking water quality in terms of radiological aspects. This is because they are directly identified in the water samples, without the need of requiring the assumption of the establishment of the transient equilibrium condition with its parent {sup 222}Rn.
Bonotto, D M; Mello, C B
2006-01-01
A combined method for evaluating radon (222Rn) and progeny (214Pb and 214Bi) in water was developed by using inexpensive alpha scintillation counting and gamma ray spectrometry through NaI(Tl) scintillation detectors. A groundwater sample collected at the Poços de Caldas alkaline massif in Brazil was submitted to the technique in order to assure its applicability by comparing the volumetric activities by different methods. Similar volumetric activity was determined for 214Pb and 214Bi in the sample analyzed that is compatible with the expected condition of radioactive equilibrium between these nuclides. The combined method was successfully used to analyze groundwater samples from Guarani aquifer in São Paulo State, Brazil, and the results of the measurements indicated that 214Pb and 214Bi provide useful information concerning the evaluation of the drinking water quality in terms of radiological aspects. This is because they are directly identified in the water samples, without the need of requiring the assumption of the establishment of the transient equilibrium condition with its parent 222Rn.
The chemistry of the actinide elements. Volume I
International Nuclear Information System (INIS)
Katz, J.J.; Seaborg, G.T.; Morss, L.R.
1986-01-01
The Chemistry of the Actinide Elements is a comprehensive, contemporary and authoritative exposition of the chemistry and related properties of the 5f series of elements: actinium, thorium, protactinium, uranium and the first eleven. This second edition has been completely restructured and rewritten to incorporate current research in all areas of actinide chemistry and chemical physics. The descriptions of each element include accounts of their history, separation, metallurgy, solid-state chemistry, solution chemistry, thermo-dynamics and kinetics. Additionally, separate chapters on spectroscopy, magnetochemistry, thermodynamics, solids, the metallic state, complex ions and organometallic compounds emphasize the comparative chemistry and unique properties of the actinide series of elements. Comprehensive lists of properties of all actinide compounds and ions in solution are given, and there are special sections on such topics as biochemistry, superconductivity, radioisotope safety, and waste management, as well as discussion of the transactinides and future elements
A neutron source of variable fluence
International Nuclear Information System (INIS)
Brachet, Guy; Demichel, Pascal; Prigent, Yvon; Riche, J.C.
1975-01-01
The invention concerns a variable fluence neutron source, like those that use in the known way a reaction between a radioactive emitter and a target, particularly of type (α,n). The emitter being in powder form lies in a carrier fluid forming the target, inside a closed containment. Facilities are provided to cause the fluidisation of the emitter by the carrier fluid in the containment. The fluidisation of the emitting powder is carried out by a booster with blades, actuated from outside by a magnetic coupling. The powder emitter is a α emitter selected in the group of curium, plutonium, thorium, actinium and americium oxides and the target fluid is formed of compounds of light elements selected from the group of beryllium, boron, fluorine and oxygen 18. The target fluid is a gas used under pressure or H 2 O water highly enriched in oxygen 18 [fr
International Nuclear Information System (INIS)
Roselli, C.; Desideri, D.; Feduzi, L.; Rongoni, A.; Saetta, D.
2013-01-01
This research was dedicated to the study of the background levels of 210 Po and natural gamma emitters as 40 K, 214 Pb, 214 Bi, 228 Ac, 212 Pb and 212 Bi in coffee powder and in coffee beverage; also the artificial 137 Cs was determined. In the coffee powder the mean 210 Po activity resulted 7.25 ± 2.25 x 10 -2 Bq kg -1 . 40 K showed a mean activity of 907.4 ± 115.6 Bq kg -1 . The mean activity concentration of 214 Pb and 214 Bi, indicators of 226 Ra, given as mean value of the two radionuclides, resulted 10.61 ± 4.02 Bq kg -1 . 228 Ac, 228 Ra indicator, showed a mean activity concentration of 13.73 ± 3.20 Bq kg -1 . The mean activity concentration of 212 Pb, 224 Ra indicator, was 8.28 ± 2.88 Bq kg -1 . 208 Tl, 224 Ra indicator, presented a mean activity concentration of 11.03 ± 4.34 Bq kg -1 . In all samples, the artificial 137 Cs resulted below the detection limit (2.0 Bq kg -1 ). The arithmetical mean value of percentage of 210 Po extraction in coffee beverage resulted 20.5 ± 6.9. The percentage of transfer of gamma emitters, 40 K, 214 Pb, 214 Bi, 228 Ac, 212 Pb, 208 Tl resulted of 80.0, 33.5, 24.7, 30.0, 35.1 and 53.5 % for 40 K, 214 Pb, 214 Bi, 228 Ac, 212 Pb and 208 Tl respectively. (author)
International Nuclear Information System (INIS)
Finck, R.R.; Persson, B.R.R.
1980-01-01
The photon fluence from radionuclides in the ground and air was measured continuously with a Ge(Li) spectrometer during several weeks. The most prominent change in photon fluence rate near the ground was obtained during periods of heavy rainfall. Deposition of the short-lived radon daughters 214 Pb and 214 Bi on the ground surface can cause a temporary increase in the external absorbed dose rate of approximately 2μrads/h. The photon fluence from airborne radon daughters can be correlated to the degree of atmospheric stability. During stable conditions the photon fluence increases and the activity ratio 214 Bi/ 214 Pb decreases
International Nuclear Information System (INIS)
Marx, Sebastian Markus
2014-01-01
The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.
International Nuclear Information System (INIS)
Ragavan, Anpalaki J.
2006-01-01
Linear free energy relationships for trivalent cations with crystalline M 2 O 3 and, M(OH) 3 phases of lanthanides and actinides were developed from known thermodynamic properties of the aqueous trivalent cations, modifying the Sverjensky and Molling equation. The linear free energy relationship for trivalent cations is as ΔG f,MvX 0 =a MvX ΔG n,M 3+ 0 +b MvX +β MvX r M 3+ , where the coefficients a MvX , b MvX , and β MvX characterize a particular structural family of MvX, r M 3+ is the ionic radius of M 3+ cation, ΔG f,MvX 0 is the standard Gibbs free energy of formation of MvX and ΔG n,M 3+ 0 is the standard non-solvation free energy of the cation. The coefficients for the oxide family are: a MvX =0.2705, b MvX =-1984.75 (kJ/mol), and β MvX =197.24 (kJ/molnm). The coefficients for the hydroxide family are: a MvX =0.1587, b MvX =-1474.09 (kJ/mol), and β MvX =791.70 (kJ/molnm).
Development of ion beam sputtering techniques for actinide target preparation
International Nuclear Information System (INIS)
Aaron, W.S.; Zevenbergen, L.A.; Adair, H.L.
1985-01-01
Ion beam sputtering is a routine method for the preparation of thin films used as targets because it allows the use of minimum quantity of starting material, and losses are much lower than most other vacuum deposition techniques. Work is underway in the Isotope Research Materials Laboratory (IRML) at ORNL to develop the techniques that will make the preparation of actinide targets up to 100 μg/cm 2 by ion beam sputtering a routinely available service from IRML. The preparation of the actinide material in a form suitable for sputtering is a key to this technique, as is designing a sputtering system that allows the flexibility required for custom-ordered target production. At present, development work is being conducted on low-activity in a bench-top system. The system will then be installed in a hood or glove box approved for radioactive materials handling where processing of radium, actinium, and plutonium isotopes among others will be performed. (orig.)
Development of ion beam sputtering techniques for actinide target preparation
Aaron, W. S.; Zevenbergen, L. A.; Adair, H. L.
1985-06-01
Ion beam sputtering is a routine method for the preparation of thin films used as targets because it allows the use of a minimum quantity of starting material, and losses are much lower than most other vacuum deposition techniques. Work is underway in the Isotope Research Materials Laboratory (IRML) at ORNL to develop the techniques that will make the preparation of actinide targets up to 100 μg/cm 2 by ion beam sputtering a routinely available service from IRML. The preparation of the actinide material in a form suitable for sputtering is a key to this technique, as is designing a sputtering system that allows the flexibility required for custom-ordered target production. At present, development work is being conducted on low-activity actinides in a bench-top system. The system will then be installed in a hood or glove box approved for radioactive materials handling where processing of radium, actinium, and plutonium isotopes among others will be performed.
International Nuclear Information System (INIS)
Berven, B.A.; Goldsmith, W.A.; Haywood, F.F.; Schiager, K.J.
1979-01-01
Many sites used during the early days of the US atomic energy program are contaminated with radionuclides of the primordial decay chains (uranium, thorium, and actinium series). This contamination consists of residues resulting from refining and processing uranium and thorium. Preparation of these sites for release to unrestricted private use will involve the assistance of construction workers, many of whom have limited knowledge of the hazards associated with radioactive materials. Therefore, there is a need to educate these workers in the fundamentals of radioactive material handling to minimize exposures and possible spread of contamination. This training should disseminate relevant information at an appropriate educational level and should instill a cautious, common-sense attitude toward the handling of radioactive materials. The training should emphasize basic information concerning environmental radiation within a context of relative risk. A multi-media format, including colorful visual aids, demonstration, and discussion, should be used to maximize motivation and retention. A detailed, proposed training program design is presented
Measurement of airborne radon daughters - a Bayesian approach
International Nuclear Information System (INIS)
Groer, P.G.; Lo, Y.
1997-01-01
The standard mathematical treatment of the build-up and decay of airborne radionuclides on a filter paper uses the solutions of the so-called Bateman equations adapted to the sampling process. These equations can be interpreted as differential equations for the expectation of an underlying stochastic process, which describes the random fluctuations in the accumulation and decay of the sampled radioactive atoms. The probability distribution for the number of 218 Po, 214 Pb and 214 Bi atoms, accumulated after sampling time t, is the product of three Poisson distributions. It is shown that the distribution of the number of counts, registered by a detector with efficiency ε during a counting period T after the end of sampling, is also the product of three Poisson distributions. Its mean is dependent on ε, t, T, flow rate, and N A 0 , N B 0 and N C 0 , the number of 218 Po, 214 Pb and 214 Bi atoms per unit volume. This joint Poisson distribution was used to construct the likelihood given the observed number of counts. Using Bayes' Theorem posterior densities were obtained for N A 0 , N B 0 and N C 0 . These densities characterise the remaining uncertainty about the unknown airborne concentrations of 218 Po, 214 Pb and 214 Bi atoms. (author)
Publications | Page 214 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. We share the results of our funded research, and offer free training materials to guide researchers and institutions. Want more? Explore outputs from more than four decades of ...
47 CFR 214.4 - Planned actions.
2010-10-01
... Telecommunication OFFICE OF SCIENCE AND TECHNOLOGY POLICY AND NATIONAL SECURITY COUNCIL PROCEDURES FOR THE USE AND... 13471; 3 CFR, 1984 Comp., p. 193). (b) In this connection, and concurrently with the war or national... the use of the radio spectrum in areas of active combat, where such control is necessary to the...
25 CFR 214.8 - Acreage limitation.
2010-04-01
..., silver, copper, or other useful metals, 640 acres. (b) For beds of placer gold, gypsum, asphaltum, phosphate, iron ores, and other useful minerals, other than coal, lead, and zinc, 960 acres. (c) For coal, 4...
24 CFR 214.303 - Performance criteria.
2010-04-01
... mortgage lenders, brokers, builders, or real estate sales agents or brokers in which the officer, employee... referring a client to mortgage lenders, brokers, builders, or real estate sales agents or brokers. (3) A...) Conflicts of interest. (1) A director, employee, officer, contractor, or agent of a participating agency...
25 CFR 214.3 - Corporate information.
2010-04-01
... company, and its value. (e) What the total indebtedness of the company is, and the nature of its... share remains unpaid and subject to assessment. (c) How much cash the company has in its treasury and...
Proclamation No. 214, 3 February 1988.
1988-01-01
This Proclamation declares the second week of February 1988 and every year thereafter as Respect and Care for Life Week. The text of the Proclamation, including its preamble, is as follows: "Whereas, the UN Declaration on Rights of the Child provides that 'the Child, by reason of his physical and mental immaturity, needs special safeguards and care, including appropriate legal protection, before as well as after birth'; Whereas, Section 12, Article 2 of the Constitution provides that it is the policy of the State to 'protect the life of the mother and the life of the unborn from conception'; Whereas, available statistics detail the frightening losses of innocent human lives by abortion; and Whereas, in pursuance of the above constitutional mandate and in support of the UN universal declaration and in order to instill the same, as well as the value and sacredness of human life, in the minds and hearts of the Filipino people and thereby help reverse the above statistical trend, it becomes imperative to set aside a period of time for them to ponder and focus attention on their moral and constitutional obligations to protect human life or one's inherent right to life; Now, Therefore, I, Corazon C. Aquino, President of the Philippines, by virtue of the powers vested in me by law, do hereby declare the second week of February 1988 and every year thereafter as "Respect and Care for Life Week" under the auspices of the Department of Social Welfare and Development and Pro-Life Philippines, and other involved entities or organization[s]." full text
4 CFR 21.4 - Protective orders.
2010-01-01
... material, as well as other information the release of which could result in a competitive advantage to one... the applicant is not involved in competitive decision-making for any firm that could gain a competitive advantage from access to the protected information and that there will be no significant risk of...
25 CFR 214.10 - Royalty rates.
2010-04-01
... and allied substances, the lessee shall pay quarterly a royalty of 10 cents per ton of 2,000 pounds on crude material, and 60 cents per ton on refined substances. (d) For substances other than gold, silver... in the selling price per ton thereof over and above the following, which shall be the agreed base or...
Publications | Page 214 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
... studies, we aim to widen the impact of our investment and advance development research. ... However, the institutional context of decision making and planning for coastal... Fiscal decentralization and local tax effort (restricted access) ... cultural and economic needs of local communities with the long-term sustainability of ...
24 CFR 214.103 - Approval criteria.
2010-04-01
... status and tax-exempt status under section 501(a), pursuant to section 501(c) of the Internal Revenue..., including agencies offering similar or related services to non-English speaking clients. (k) State and local...
Publications | Page 214 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
evidence from local Panchayat elections in rural India (restricted access) ... Case study : ISIF - the Information Society Innovation Fund (ISIF) (restricted access). Utilization Focused Evaluation (UFE) begins with the premise that ... Proposals.
International Nuclear Information System (INIS)
Sheets, R.W.; Thompson, C.C.
1993-01-01
Different models relating the dependence of radon ( 222 Rn)- and thoron ( 220 Rn)-progeny activities on room ventilation rates are presented in the literature. Some of these models predict that, as the rate of ventilation increases, activities of thoron progeny decrease more rapidly than those of radon progeny. Other models predict the opposite trend. In this study alpha activities of the radon progeny, 218 Po, 214 Pb, and 214 Bi, together with the thoron progeny 212 Pb, were measured over periods of several days in two rooms of a closed, heated house. Effective ventilation rates were calculated from measured 214 Pb/ 214 Bi ratios. A simple model in which progeny concentrations decrease by radioactive decay and by dilution with outside air has been used to calculate 212 Pb/ 214 Pb ratios as a function of ventilation rate. Calculated ratios are found to correlate significantly with experimentally-determined ratios (R 2 ∼ 0.5--0.8 at p < 0.005) confirming that, for this house, thoron progeny activities decrease faster than radon progeny activities with increasing rates of ventilation
Energy Technology Data Exchange (ETDEWEB)
Koumarianou, Eftychia [Institute R-RP, NCSR ' Demokritos' , Athens (Greece); IAE, Radioisotope Centre POLATOM, 05-400 Swierk-Otwock (Poland)], E-mail: eytyxiak@yahoo.com; Mikolajczak, Renata; Pawlak, Dariusz [IAE, Radioisotope Centre POLATOM, 05-400 Swierk-Otwock (Poland); Zikos, Xhristos; Bouziotis, Pinelopi [Institute R-RP, NCSR ' Demokritos' , Athens (Greece); Garnuszek, Piotr; Karczmarczyk, Urszula; Maurin, Michal [Department of Radiopharmaceuticals, National Medicines Institute, Chelmska 30/34, 00-725 Warsaw (Poland); Archimandritis, Spyridon C. [Institute R-RP, NCSR ' Demokritos' , Athens (Greece)
2009-08-15
Introduction: The aim of the study was to compare in vitro and in vivo a novel DOTA-chelated bombesin (BN) analog of the amino acid sequence, QRLGNQWAVGHLM-CONH{sub 2} (BN[2-14]NH{sub 2}), labeled with {sup 90}Y and {sup 177}Lu, for its potential use in targeted radiotherapy of tumors expressing gastrin releasing peptide (GRP) receptors. The same amino acid sequence, but with different chelator, referred as BN1.1 (Gly-Gly-Cys-Aca-QRLGNQWAVGHLM-CONH{sub 2}), has already been studied and reported; however, the DOTA-chelated one, suitable for labeling with M{sup +3} type radiometals, was not yet described. Methods: The conditions for labeling of DOTA-BN[2-14]NH{sub 2} with noncarrier added {sup 90}Y and with {sup 177}Lu [specific activity (SA), 15 Ci/mg Lu] were investigated and optimized to provide {sup 90}Y-DOTA-BN[2-14]NH{sub 2} and {sup 177}Lu-DOTA-BN[2-14]NH{sub 2} of high SA. The stability of the radiolabeled compounds in human serum was evaluated over a period of 24 h. The human prostate cancer cell line PC-3, known to express GRP receptors, was used for in vitro evaluation of radiolabeled peptide affinity to GRP receptors and for assessment of cytotoxicity of both nonlabeled and radiolabeled peptide. Biodistribution accompanied by receptor blocking was studied in normal Swiss mice. Results: {sup 90}Y-DOTA-BN[2-14]NH{sub 2} and {sup 177}Lu-DOTA-BN[2-14]NH{sub 2} were obtained with radiochemical yield >98% and high SA (67.3 GBq {sup 90}Y/{mu}mol and 33.6 GBq {sup 177}Lu/{mu}mol, respectively). They were stable when incubated in human serum for up to 24 h. The binding affinities of DOTA-BN[2-14]NH{sub 2} and both {sup nat}Y- and {sup nat}Lu-labeled analogs to GRP receptors were high (IC{sub 50}=1.78, 1.99, and 1.34 nM, respectively), especially for the {sup nat}Lu-DOTA-BN[2-14]NH{sub 2} complex. The cytotoxicity study of DOTA-BN[2-14]NH{sub 2} to PC-3 cells revealed an IC{sub 50}=6300 nM after 72 h of exposition, while the labeled derivatives showed no
International Nuclear Information System (INIS)
Koumarianou, Eftychia; Mikolajczak, Renata; Pawlak, Dariusz; Zikos, Xhristos; Bouziotis, Pinelopi; Garnuszek, Piotr; Karczmarczyk, Urszula; Maurin, Michal; Archimandritis, Spyridon C.
2009-01-01
Introduction: The aim of the study was to compare in vitro and in vivo a novel DOTA-chelated bombesin (BN) analog of the amino acid sequence, QRLGNQWAVGHLM-CONH 2 (BN[2-14]NH 2 ), labeled with 90 Y and 177 Lu, for its potential use in targeted radiotherapy of tumors expressing gastrin releasing peptide (GRP) receptors. The same amino acid sequence, but with different chelator, referred as BN1.1 (Gly-Gly-Cys-Aca-QRLGNQWAVGHLM-CONH 2 ), has already been studied and reported; however, the DOTA-chelated one, suitable for labeling with M +3 type radiometals, was not yet described. Methods: The conditions for labeling of DOTA-BN[2-14]NH 2 with noncarrier added 90 Y and with 177 Lu [specific activity (SA), 15 Ci/mg Lu] were investigated and optimized to provide 90 Y-DOTA-BN[2-14]NH 2 and 177 Lu-DOTA-BN[2-14]NH 2 of high SA. The stability of the radiolabeled compounds in human serum was evaluated over a period of 24 h. The human prostate cancer cell line PC-3, known to express GRP receptors, was used for in vitro evaluation of radiolabeled peptide affinity to GRP receptors and for assessment of cytotoxicity of both nonlabeled and radiolabeled peptide. Biodistribution accompanied by receptor blocking was studied in normal Swiss mice. Results: 90 Y-DOTA-BN[2-14]NH 2 and 177 Lu-DOTA-BN[2-14]NH 2 were obtained with radiochemical yield >98% and high SA (67.3 GBq 90 Y/μmol and 33.6 GBq 177 Lu/μmol, respectively). They were stable when incubated in human serum for up to 24 h. The binding affinities of DOTA-BN[2-14]NH 2 and both nat Y- and nat Lu-labeled analogs to GRP receptors were high (IC 50 =1.78, 1.99, and 1.34 nM, respectively), especially for the nat Lu-DOTA-BN[2-14]NH 2 complex. The cytotoxicity study of DOTA-BN[2-14]NH 2 to PC-3 cells revealed an IC 50 =6300 nM after 72 h of exposition, while the labeled derivatives showed no significant cytotoxic effect. The internalization rate to PC-3 cells was more rapid for 177 Lu-labeled peptide (84.87%) than for the 90 Y
Determination of samples with TSP size at PLTU Pacitan, Jawa Timur have been done
International Nuclear Information System (INIS)
Rusmanto, Tri; Mulyono; Irianto, Bambang
2013-01-01
Sampling is done using equipment High Volume Air Sampler (HVAS) and analysis using gamma spectrometer. Sampling at 3 locations, each location of the sampling carried out 24 hours, air samples on filter conditioned at room temperature, weighed to a contained weight, counting for 24 hours with gamma spectrometer. The result of qualitative and quantitative analysis of filter TSP was contained of locations I Ra-226 = 0,000888 Bq/m 3 , Pb-212 = 0,000356 Bq/m 3 , Pb-214 = 0,000859 Bq/m 3 , Bi-214 = 0,000712 Bq/m 3 , Ac-228 = 0,004447 Bq/m 3 , K-40 = 0,035454 Bq/m 3 ) , Locations II Ra-226 = 0,00113 Bq/m 3 , Pb-212 = 0,00079 Bq/m 3 , Pb-214 = 0,001351 Bq/m 3 , Bi-214 = 0,000433 Bq/m 3 , Ac-228 = 0,007138 Bq/m 3 , K-40 = 0,018532 Bq/m 3 , Locations III Ra-226 = 0,001424 Bq/m 3 , Pb-212 = 0,000208 Bq/m 3 , Pb-214 = 000052 Bq/m 3 , Bi-214 = 0,001408 Bq/m 3 , Ac-228 = 0,008362 Bq/m 3 , K-40 = 0,020536 Bq/m 3 . Radionuclides activity was all still below quality of air enabled by BAPETEN. Become the activities of ambient air of PLTU area still be peaceful enough as settlement area. (author)
Full Text Available ... Health Administration 5,188 views 2:14 Managing Stress with the Moving Forward App: An Overview - Duration: ... 1,852 views 7:19 Maintaining Your Weight Management Efforts - Duration: 0:56. Veterans Health Administration 214 ...
Full Text Available ... the Misconceptions - Duration: 2:14. Veterans Health Administration 5,188 views 2:14 Managing Stress with the ... 847 views 3:45 Kitchen Knife Skills - Duration: 5:31. Veterans Health Administration 2,605 views 5: ...
75 FR 343 - Fresh Garlic From the People's Republic of China: Initiation of New Shipper Reviews
2010-01-05
... from Zhengzhou Huachao Industrial Co., Ltd. (Huachao) in accordance with 19 CFR 351.214(c) and 351.214... establishing the following: (1) the date on which it first shipped fresh garlic for export to the United States...
Radiation protection in brachytherapy
International Nuclear Information System (INIS)
Benitez, Manuel
1996-02-01
It covers technical procedures in medical applications for cancer treatment. Radiation protection principles in brachytherapy. Medical uses in therapy for Sr-90, Cs-137, Co-60, Ra-226, Ir-192, Au-198, Bi-214, Pb-214. (The author)
Feng, Zhenxing; Crumlin, Ethan J.; Hong, Wesley T.; Lee, Dongkyu; Mutoro, Eva; Biegalski, Michael D.; Zhou, Hua; Bluhm, Hendrik; Christen, Hans M.; Shao-Horn, Yang
2013-01-01
Perovskites are used to promote the kinetics of oxygen electrocatalysis in solid oxide fuel cells and oxygen permeation membranes. Little is known about the surface structure and chemistry of perovskites at high temperatures and partial oxygen pressures. Combining in situ X-ray reflectivity (XRR) and in situ ambient pressure X-ray photoelectron spectroscopy (APXPS), we report, for the first time, the evolution of the surface structure and chemistry of (001)-oriented perovskite La0.8Sr0.2CoO 3-δ (LSC113) and (La0.5Sr 0.5)2CoO4+δ (LSC214)-decorated LSC113 (LSC113/214) thin films as a function of temperature. Heating the (001)-oriented LSC113 surface leads to the formation of surface LSC214-like particles, which is further confirmed by ex situ Auger electron spectroscopy (AES). In contrast, the LSC113/214 surface, with activities much higher than that of LSC 113, is stable upon heating. Combined in situ XRR and APXPS measurements support that Sr enrichment may occur at the LSC113 and LSC214 interface, which can be responsible for its markedly enhanced activities. © 2013 American Chemical Society.
Feng, Zhenxing
2013-05-02
Perovskites are used to promote the kinetics of oxygen electrocatalysis in solid oxide fuel cells and oxygen permeation membranes. Little is known about the surface structure and chemistry of perovskites at high temperatures and partial oxygen pressures. Combining in situ X-ray reflectivity (XRR) and in situ ambient pressure X-ray photoelectron spectroscopy (APXPS), we report, for the first time, the evolution of the surface structure and chemistry of (001)-oriented perovskite La0.8Sr0.2CoO 3-δ (LSC113) and (La0.5Sr 0.5)2CoO4+δ (LSC214)-decorated LSC113 (LSC113/214) thin films as a function of temperature. Heating the (001)-oriented LSC113 surface leads to the formation of surface LSC214-like particles, which is further confirmed by ex situ Auger electron spectroscopy (AES). In contrast, the LSC113/214 surface, with activities much higher than that of LSC 113, is stable upon heating. Combined in situ XRR and APXPS measurements support that Sr enrichment may occur at the LSC113 and LSC214 interface, which can be responsible for its markedly enhanced activities. © 2013 American Chemical Society.
On the removal efficiency of padon decay products by fog droplets
International Nuclear Information System (INIS)
Girgzhdis, A.I.; Girgzhdene, R.V.; Shopauskas, K.K.
1978-01-01
The results of the experimental investigations on quantitative evaluation of the 218 Po and 214 Bi washout efficiency by fog in an aerosol chamber are presented. The radioactivity has been measured by means of α-spectrometric method. Comparison of eXperimental and calculated data is made. The 218 Po and 214 Bi washout efficiency ratio is found to be dependent mainly on the aerosol concentration. The change of 218 Po concentration imitates the process of coagulation of free atoms of light ions, and that of 214 Bi - of aerosol particles by fog droplets
African Journals Online (AJOL)
2016-11-04
Nov 4, 2016 ... versus 6 (21.4%), and blindness 6 (21.4%) versus 7 (25%), P < 0.001. The most common ... Implications for designing preventive health education message. Trop J Health Sci .... game changers in this scenario. Conclusion: ...
Integrated inventory information system
Digital Repository Service at National Institute of Oceanography (India)
Sarupria, J.S.; Kunte, P.D.
stream_size 5 stream_content_type text/plain stream_name Handbook_Lib_Archives_Inf_Cen_India_7_214.pdf.txt stream_source_info Handbook_Lib_Archives_Inf_Cen_India_7_214.pdf.txt Content-Encoding ISO-8859-1 Content-Type text...
Traks, Kristina, 1976-
2011-01-01
Viis aastat tagasi võitis 214 peret võimaluse osta eluase Tallinnas Kakumäel Saviliiva elamurajoonis. Toona läks 214 majast või korterist sundüürnikele vaid 64. Praeguseks pole enamik loosivõitjaid oma elukohta vahetanud
African Journals Online (AJOL)
Items 201 - 214 of 214 ... Vol 23, No 2 (2008), Training for human security, Abstract ... Vol 29, No 2 (2014), University of KwaZulu-Natal's vision of 'African scholarship' and information ... Vol 26, No 2 (2011), Water: An Economic or Social Good?
Radon Progeny in Egyptian Underground Phosphate Mines
International Nuclear Information System (INIS)
El-Hady, M.A.; Mohammed, A.; El-Hussein, A.; Ali, A.E.; Ahmed, A.A.
2001-01-01
In addition to the workers in uranium mines, the staff of other underground mines, such as workers in underground phosphate mines, can be exposed to 222 Rn and its progeny. In this study the individual radon progeny concentrations were measured in three Egyptian underground phosphate mines to estimate the occupational exposure of the workers at those sites. A filter method was used to measure individual radon progeny concentrations ( 218 Po, 214 Pb and 214 Po). The reported mean values of radon progeny concentrations exceed the action levels which are recommended by ICRP 65 (1993). Based on the measured individual radon progeny concentrations ( 218 Po, 214 Pb and 214 Po) in these mines, the annual effective dose for the workers has been calculated using the lung dose model of ICRP 66 (1994). According to the obtained results, some countermeasures were recommended in this study to minimise these exposure levels. (author)
Assessment of Effective Dose Equivalent of Indoor 222Rn Daughters in Inchass
International Nuclear Information System (INIS)
Ali, E.M.; Taha, T.M.; Gomaa, M.A.; El-Hussein, A.M.; Ahmad, A.A.
2000-01-01
The dominant component of natural radiation dose for the general population comes from the radon gas 222 Rn and its short-lived decay products, Ra A ( 214 Po), Ra B ( 214 Pb), Ra C ( 214 Bi), Ra C( 214 Po) in the breathing air. The objective of the present work is to assess the affective dose equivalent of the inhalation exposure of indoor 222 Rn for occupational workers. Average indon concentrations (Bqm -3 ) were monitored in several departments in Nuclear Research Center by radon monitor. We have calculated the lung dose equivalent and the effective dose equivalent for the Egyptian workers due to inhalation exposure of an equilibrium equivalent concentrations of radon daughters which varies from 0.27 to 2.5 mSvy -1 and 0.016 to 0.152mSvy -1 respectively. The annual effective doses obtained are within the accepted range of ICRP recommendations
International Nuclear Information System (INIS)
Katona, T.; Kanyar, B.; Jobbagy, V.; Kavasi, N.; Molnar, A.; Imre, K.
2004-01-01
The aim was to determine the radioactivities of the radon progenies ( 218 Po, 214 Pb, 214 Bi and 214 Po) attached to the carrier aerosol particles with respect to the size distribution in order to improve the assessment of the inhalation dose. We derived the radionuclide-specific activity concentrations from gross alpha and gross beta measurements provided during 2 hours after sampling and model calculations including parameter estimation. For the aerosol sampling we used an electrical low pressure impactor, which is able to collect aerosol particles in 12 different diameter ranges. In our test investigations the aerosol particles were collected from a closed chamber in a common laboratory building. The chamber contained a relatively high radon concentration (60-90 kBq/m 3 ) in equilibrium with the short lived daughters generated previously without any additional aerosol sources. For the nuclear measurements of the aerosol samples ZnS/plastic sandwich detectors have been used. The time series data of gross alpha and gross beta activities were fitted simultaneously and the initial activities of the daughters were estimated. According to the results from two different fractions (0.06 and 0.7 μm) just followed the end of sampling they contain a higher 218 Po activity than the 214 Pb and 214 Bi ones. The preliminary assessments for the special air conditions show that the 214 Pb-to- 218 Po activity ratios are higher for the small aerosol particles than for the larger ones. The estimated errors of the initial activities were near to 50% in a large part of cases. (author)
2006-09-01
min. β Bismuth-214 19.9 min. β Polonium -214 1.5 x 10-4 sec. α Lead- 210 22 years β Bismuth- 210 5 days β Polonium - 210 140 days α Lead-206 stable...Uranium-234 2.5 x 105 years α Thorium-230 7.7 x 104 years α Radium-226 1600 years α Radon-222 3.8235 days α Polonium -218 3.05 min. α Lead-214 26.8...the degraded areas where ordnance delivery occurs. This also applies to DU use. These areas do not provide food or habitat resources likely to
Study of gel materials as radioactive 222Rn gas detectors
International Nuclear Information System (INIS)
Espinosa, G.; Golzarri, J. I.; Rickards, J.; Gammage, R. B.
2006-01-01
Commercial hair gel material (polyvinyl pyrolidone triethanolamine carbo-pol in water) and bacteriological agar (phycocolloid extracted from a group of red-purple algae, usually Gelidium sp.) have been studied as radioactive radon gas detectors. The detection method is based on the diffusion of the radioactive gas in the gel material, and the subsequent measurement of trapped products of the natural decay of radon by gamma spectrometry. From the several radon daughters with gamma radiation emission ( 214 Pb, 214 Bi, 214 Po, 210 Pb, 210 Po), two elements, 214 Pb (0.352 MeV) and 214 Bi (0.609 MeV), were chosen for the analysis in this work; in order to determine the best sensitivity, corrections were made for the short half-life of the analysed isotopes. For the gamma spectrometry analysis, a hyper-pure germanium solid state detector was used, associated with a PC multichannel analyser card with Maestro R and Microsoft R Excel R software. The results show the viability of the method: a linear response in a wide radon concentration range (450-10,000 Bq m -3 ), reproducibility of data, easy handling and low cost of the gel material. This detection methodology opens new possibilities for measurements of radon and other radioactive gases. (authors)
International Nuclear Information System (INIS)
Shiotsuki, Masao; Miyahara, Kaname
2003-01-01
The second draft for R and D of geological disposal (second draft) was arranged in 1999. The idea of security of geological disposal in the second draft is explained. The evaluation results of the uncertainty analysis and an example of evaluation of the effect of separation nuclear transmutation on the geological disposal are shown. The construction of strong engineered barrier is a basic idea of geological disposal system. Three processes such as isolation, engineering countermeasures and safety evaluation are carried out for the security of geological disposal. The security of geological environment for a long time of 12 sites in Japan was studied by data. Provability of production and enforcement of engineered barrier were confirmed by trial of over pack, tests and the present and future technologies developed. By using the conditions of reference case in the second draft, the evaluation results of dose effects in the two cases: 1) 90 to 99% Cs and Sr removed from HLW (High Level radioactive Waste) and 2) high stripping ratio of actinium series are explained. (S.Y.)
Ac, La, and Ce radioimpurities in {sup 225}Ac produced in 40-200 MeV proton irradiations of thorium
Energy Technology Data Exchange (ETDEWEB)
Engle, Jonathan W.; Ballard, Beau D. [Los Alamos National Laboratory, NM (United States); Weidner, John W. [Air Force Institute of Technology, Wright Patterson Air Force Base, OH (United States); and others
2014-10-01
Accelerator production of {sup 225}Ac addresses the global supply deficiency currently inhibiting clinical trials from establishing {sup 225}Ac's therapeutic utility, provided that the accelerator product is of sufficient radionuclidic purity for patient use. Two proton activation experiments utilizing the stacked foil technique between 40 and 200 MeV were employed to study the likely co-formation of radionuclides expected to be especially challenging to separate from {sup 225}Ac. Foils were assayed by nondestructive γ-spectroscopy and by α-spectroscopy of chemically processed target material. Nuclear formation cross sections for the radionuclides {sup 226}Ac and {sup 227}Ac as well as lower lanthanide radioisotopes {sup 139}Ce, {sup 141}Ce, {sup 143}Ce, and {sup 140}La whose elemental ionic radii closely match that of actinium were measured and are reported. The predictions of the latest MCNP6 event generators are compared with measured data, as they permit estimation of the formation rates of other radionuclides whose decay emissions are not clearly discerned in the complex spectra collected from {sup 232}Th(p,x) fission product mixtures. (orig.)
Background radiation and individual dosimetry in the coastal area of Tamil Nadu (India)
International Nuclear Information System (INIS)
Matsuda, N.; Brahmanandhan, G. M.; Yoshida, M.; Takamura, N.; Suyama, A.; Koguchi, Y.; Juto, N.; Raj, Y. L.; Winsley, G.; Selvasekarapandian, S.
2011-01-01
South coast of India is known as the high-level background radiation area (HBRA) mainly due to beach sands that contain natural radionuclides as components of the mineral monazite. The rich deposit of monazite is unevenly distributed along the coastal belt of Tamil Nadu and Kerala. An HBRA site that laid in 2x7 m along the sea was found in the beach of Chinnavillai, Tamil Nadu, where the maximum ambient dose equivalent reached as high as 162.7 mSv y -1 . From the sands collected at the HBRA spot, the high-purity germanium semi-conductor detector identified six nuclides of thorium series, four nuclides of uranium series and two nuclides belonging to actinium series. The highest radioactivity observed was 43.7 Bq g -1 of Th-228. The individual dose of five inhabitants in Chinnavillai, as measured by the radiophotoluminescence glass dosimetry system, demonstrated the average dose of 7.17 mSv y -1 ranging from 2.79 to 14.17 mSv y -1 . (authors)
Soil nuclide distribution coefficients and their statistical distributions
International Nuclear Information System (INIS)
Sheppard, M.I.; Beals, D.I.; Thibault, D.H.; O'Connor, P.
1984-12-01
Environmental assessments of the disposal of nuclear fuel waste in plutonic rock formations require analysis of the migration of nuclides from the disposal vault to the biosphere. Analyses of nuclide migration via groundwater through the disposal vault, the buffer and backfill, the plutonic rock, and the consolidated and unconsolidated overburden use models requiring distribution coefficients (Ksub(d)) to describe the interaction of the nuclides with the geological and man-made materials. This report presents element-specific soil distribution coefficients and their statistical distributions, based on a detailed survey of the literature. Radioactive elements considered were actinium, americium, bismuth, calcium, carbon, cerium, cesium, iodine, lead, molybdenum, neptunium, nickel, niobium, palladium, plutonium, polonium, protactinium, radium, samarium, selenium, silver, strontium, technetium, terbium, thorium, tin, uranium and zirconium. Stable elements considered were antimony, boron, cadmium, tellurium and zinc. Where sufficient data were available, distribution coefficients and their distributions are given for sand, silt, clay and organic soils. Our values are recommended for use in assessments for the Canadian Nuclear Fuel Waste Management Program
214 Using Appropriate Strategies to Improve Students ...
African Journals Online (AJOL)
User
2011-07-21
Jul 21, 2011 ... As a result, learners lack the skills and strategies involved in reading and hence having .... Readers must intentionally and purposefully work to ... anticipating what is going to happen or come ..... Life long Learning: The Adult.
Gender | Page 214 | IDRC - International Development Research ...
International Development Research Centre (IDRC) Digital Library (Canada)
Uncontrolled development was threatening to destroy the forest environment and the traditional way of life of the hill people of Ratanakiri. Researchers worked with the villagers to produce unique maps and resource use plans that convinced the government of the people's traditional resource use and management rights, ...
48 CFR 2052.214-70 - Prebid conference.
2010-10-01
... prebid conference is scheduled for: Date: * Location: * Time: * (b) This conference is to afford... amendment to the solicitation. If you plan to attend the conference, notify * by letter or telephone * , no later than close of business * . Notification of your intention to attend is essential in the event the...
34 CFR 685.214 - Closed school discharge.
2010-07-01
... the school's closing with any third party, such as the holder of a performance bond or a tuition... their successors, its sureties, and any private fund, including the portion of a public fund that represents funds received from a private party. (2) The provisions of this section apply notwithstanding any...
49 CFR 214.321 - Exclusive track occupancy.
2010-10-01
... printed document directly, by relay through a designated employee, in a data transmission, or by oral... train dispatcher or control operator in charge of the track shall make a written or electronic record of...
Fungal Planet description sheets: 214–280
Crous, P.W.; Shivas, R.G.; Quaedvlieg, W.; Bank, van der M.; Zhang, Y.; Summerell, B.A.; Guarro, J.; Wingfield, M.J.; Wood, A.R.; Alfenas, A.C.; Braun, U.; Cano-Lira, J.F.; Garcia, D.; Marin-Felix, Y.; Alvarado, P.; Andrade, J.P.; Armengol, J.; Assefa, A.; Breeÿen, den A.; Camele, I.; Cheewangkoon, R.; Souza, De J.T.; Duong, T.A.; Esteve-Raventós, F.; Fournier, J.; Frisullo, S.; García-Jiménez, J.; Gardiennet, A.; Gené, J.; Hernández-Restrepo, M.; Hirooka, Y.; Hospenthal, D.R.; King, A.; Lechat, C.; Lombard, L.; Mang, S.M.; Marbach, P.A.S.; Marincowitz, S.; Montaño-Mata, N.J.; Moreno, G.; Perez, C.A.; Pérez Sierra, A.M.; Robertson, J.L.; Roux, J.; Rubio, E.; Schumacher, R.K.; Stchigel, A.M.; Sutton, D.A.; Tan, Y.P.; Thompson, E.H.; Vanderlinde, E.; Walker, A.K.; Walker, D.M.; Wickes, B.L.; Wong, P.T.W.; Groenewald, J.Z.
2014-01-01
Novel species of microfungi described in the present study include the following from South Africa: Cercosporella dolichandrae from Dolichandra unguiscati, Seiridium podocarpi from Podocarpus latifolius, Pseudocercospora parapseudarthriae from Pseudarthria hookeri, Neodevriesia coryneliae from
27 CFR 9.214 - Haw River Valley.
2010-04-01
... significance. (b) Approved maps. The two United States Geological Survey 1:100,000-scale metric topographic...) Greensboro, North Carolina, 1984; and (2) Chapel Hill, North Carolina, 1984. (c) Boundary. The Haw River... line southeast 2 miles to the intersection of North Carolina State Highway 49 and an unnamed, light...
49 CFR 214.101 - Purpose and scope.
2010-10-01
... scope. (a) The purpose of this subpart is to prevent accidents and casualties arising from the performance of work on railroad bridges. (b) This subpart prescribes minimum railroad safety rules for railroad employees performing work on bridges. Each railroad and railroad contractor may prescribe...
Lecker, S. H.; Solomon, V.; Price, S. R.; Kwon, Y. T.; Mitch, W. E.; Goldberg, A. L.
1999-01-01
Insulin deficiency (e.g., in acute diabetes or fasting) is associated with enhanced protein breakdown in skeletal muscle leading to muscle wasting. Because recent studies have suggested that this increased proteolysis is due to activation of the ubiquitin-proteasome (Ub-proteasome) pathway, we investigated whether diabetes is associated with an increased rate of Ub conjugation to muscle protein. Muscle extracts from streptozotocin-induced insulin-deficient rats contained greater amounts of Ub-conjugated proteins than extracts from control animals and also 40-50% greater rates of conjugation of (125)I-Ub to endogenous muscle proteins. This enhanced Ub-conjugation occurred mainly through the N-end rule pathway that involves E2(14k) and E3alpha. A specific substrate of this pathway, alpha-lactalbumin, was ubiquitinated faster in the diabetic extracts, and a dominant negative form of E2(14k) inhibited this increase in ubiquitination rates. Both E2(14k) and E3alpha were shown to be rate-limiting for Ub conjugation because adding small amounts of either to extracts stimulated Ub conjugation. Furthermore, mRNA for E2(14k) and E3alpha (but not E1) were elevated 2-fold in muscles from diabetic rats, although no significant increase in E2(14k) and E3alpha content could be detected by immunoblot or activity assays. The simplest interpretation of these results is that small increases in both E2(14k) and E3alpha in muscles of insulin-deficient animals together accelerate Ub conjugation and protein degradation by the N-end rule pathway, the same pathway activated in cancer cachexia, sepsis, and hyperthyroidism.
CHANG, Weihua; WANG, Juanhong; TAO, Dayong; ZHANG, Yong; HE, Jianzhong; SHI, Changqing
2015-01-01
MicroRNAs (miRNAs) are a class of short endogenous, single-stranded, non-coding small RNA molecules, about 19–25 nucleotides in length that regulate gene expression at the translation level and influence many physiological process, such apoptosis, metabolism, signal transduction, and occurrence and development of diseases. In this study, we constructed a library from the ovine luteal phase ovary by using next-generation sequencing technology (Solexa high-throughput sequencing technique) and identified 267 novel miRNAs by bioinformatics. One of the novel miRNAs (ovis_aries_ovary-m0033_3p), which expressed in the sheep ovary and testis, was confirmed by real time PCR and northern blot. Ovis_aries_ovary-m0033_3p was 21 nucleotides in length and located on chromosome 12, and it had 100% similarity to hsa-miR-214-3p, mmu-miR-214-3p, dre-miR-214and ssc-miR-214. Meanwhile, the pre-miRNA was 82 nucleotides in length and had a standard hairpin stem-loop structure. From the consistency of the sequence and structure, we speculated that ovis_aries_ovary-m0033_3p had a function similar to hsa-miR-214-3p, which is involved in the fine regulation of cell survival, embryonic development, breeding activities and resistance to ovarian cancer, so we defined it as oar-miR-214-3p. These experimental results will enrich the miRNA database for ovis aries and provide the basis for researching the regulation mechanism of miRNA in relation to breeding activities of seasonal breeding animals. PMID:26268666
Studies on spatial distribution of indoor radon concentration at Mysore city, India
International Nuclear Information System (INIS)
Pruthvi Rani, K.S.; Chandrashekara, M.S.; Paramesh, L.
2016-01-01
Radon is a radioactive inert gas, with a half life of 3.82 days. Radium present in soil rocks and building material are the sources of atmospheric radon. Radon and its short-lived decay products ( 218 Po, 214 Pb, 214 Bi, and 214 Po) can be deposited in the lung tissues and give rise to higher radiation doses. Radon is now recognized as the second most important cause of lung cancer after smoking in the general population. In the present investigation a systematic study of the distribution of radon concentration has been carried out in a small room at different co-ordinates and time scales
UK Citizens Lack Simple, Objective Knowledge of the European Union
DEFF Research Database (Denmark)
Manners, Ian James
2017-01-01
214); ‘A direct European tax will be created’ (EBS 214); ‘National citizenship will disappear’ (EBS 214); and ‘Most of the European budget is spent on administrative and personnel costs’ (EB65) UK respondents were far more likely to answer incorrectly that these were true. This is likely the result...... of disinformation in UK politics and media. The data suggests that not only are UK respondents unable to answer simple questions about the EU, but that they are relatively more likely to answer incorrectly rather than admit they did not know, reflecting disinformation about the EU in the UK. This lack of simple...
75 FR 81680 - Submission for OMB Review; Comment Request
2010-12-28
... Section 214 of the FACT Act as applied to brokers, dealers, and investment companies, as well as... Persons''). As directed by Section 214 of the FACT Act, before a receiving affiliate may make marketing... right to prohibit such marketing. The regulation potentially applies to all of the approximately 21,496...
Ion transfer voltammetry of metformin and phenformin at a polarized ionic liquid-membrane
Czech Academy of Sciences Publication Activity Database
Langmaier, Jan; Samec, Zdeněk; Samcová, E.
2015-01-01
Roč. 61, č. 3 (2015), s. 214-214 ISSN 0034-6691. [Annual Meeting of the Polarographic Society of Japan /61./. 24.11.2015-25.11.2015, Himeji] R&D Projects: GA ČR(CZ) GA15-03139S Institutional support: RVO:61388955 Keywords : electrochemistry * voltammetry Subject RIV: CG - Electrochemistry
Sadhana | Indian Academy of Sciences
Indian Academy of Sciences (India)
The cavitation erosion is highly dependent on microstructure and mechanical properties. The results show that hot rolled 21-4-N steel is more cavitation erosion resistant than the 13/4 and 21-4-N steels in as cast condition. The eroded surfaces were analysed through optical microscope and scanning electron microscope ...
TRASH TO TREASURE: CONVERTING COLD WAR LEGACY WASTE INTO WEAPONS AGAINST CANCER
International Nuclear Information System (INIS)
Nicholas, R.G.; Lacy, N.H.; Butz, T.R.; Brandon, N.E.
2004-01-01
As part of its commitment to clean up Cold War legacy sites, the U.S. Department of Energy (DOE) has initiated an exciting and unique project to dispose of its inventory of uranium-233 (233U) stored at Oak Ridge National Laboratory (ORNL), and extract isotopes that show great promise in the treatment of deadly cancers. In addition to increasing the supply of potentially useful medical isotopes, the project will rid DOE of a nuclear concern and cut surveillance and security costs. For more than 30 years, DOE's ORNL has stored over 1,200 containers of fissile 233U, originally produced for several defense-related projects, including a pilot study that looked at using 233U as a commercial reactor fuel. This uranium, designated as special nuclear material, requires expensive security, safety, and environmental controls. It has been stored at an ORNL facility, Building 3019A, that dates back to the Manhattan Project. Down-blending the material to a safer form, rather than continuing to store it, will eliminate a $15 million a year financial liability for the DOE and increase the supply of medical isotopes by 5,700 percent. During the down-blending process, thorium-229 (229Th) will be extracted. The thorium will then be used to extract actinium-225 (225Ac), which will ultimately supply its progeny, bismuth-213 (213Bi), for on-going cancer research. The research includes Phase II clinical trials for the treatment of acute myelogenous leukemia at Sloan-Kettering Memorial Cancer Center in New York, as well as other serious cancers of the lungs, pancreas, and kidneys using a technique known as alpha-particle radioimmunotherapy. Alpha-particle radioimmunotherapy is based on the emission of alpha particles by radionuclides. 213Bi is attached to a monoclonal antibody that targets specific cells. The bismuth then delivers a high-powered but short-range radiation dose, effectively killing the cancerous cells but sparing the surrounding tissue. Production of the actinium and
Natural and artificial radionuclides in southern of Gulf of Mexico marine sediments
International Nuclear Information System (INIS)
Rodriguez-Espinosa, P.F.; Vidal-Lorandi, V.M.V.; Vidal-Lorandi, F.V.
1999-01-01
Preliminary results of quantitative analysis of natural and artificial radionuclides in sediment cores of the Southern Gulf of Mexico, reveal the presence of 22.01 Bq/kg 226 Ra, 15.56 Bq/kg 214 Bi, 18.17 Bq/kg 214 Pb, 485.81 Bq/kg 40 K and 2.84 Bq/kg 137 Cs
International Nuclear Information System (INIS)
Nikezic, D.; Yu, K.N.
2010-01-01
We developed the theoretical basis for long-term determination of airborne concentrations of unattached and attached radon progeny. The work was separated into two parts. First, we showed that (stacked and multiply etched) LR 115 detectors could be used to determine airborne concentrations of the short-lived radon progeny, 218 Po and 214 Bi. The equilibrium factor F between radon and its progeny could then be determined through the use of the reduced equilibrium factor F red . The airborne concentrations of 214 Pb could then be determined. Second, we developed a method based on the airborne concentrations of 218 Po, 214 Pb and 214 Bi to determine the parameters of the Jacobi room model, viz., the ventilation rate λ v , aerosol attachment rate λ a , deposition rate of unattached progeny λ d u and the deposition rate of attached progeny λ d u . With these parameters, the unattached fraction f p of the potential alpha energy concentration could also be determined. Knowledge of f p , together with F, would enable more accurate determination of the effective dose in the human lung.
Mean size among the particles of short-lived radon daughter products in the atmosphere
International Nuclear Information System (INIS)
Nakatani, S.
1980-01-01
The diffusion-battery method is used to classify the radioactive particles according to their sizes. The diffusion coefficient is determined from the fractional penetration of the particles through the battery. Particle radii are derived from the diffusion coefficients with the Stokes-Cunningham-Millikan formula. At the exit and entrance of the battery, individual concentrations of radon daughter products 218 Po, 214 Pb, 214 Bi are determined. Thus the mean sizes of individual radon daughters can be obtained from the fractional penetration of individual nuclides through the diffusion battery. Despite large statistical fluctuations the mean size of 214 Bi is always shifted toward the larger size region as compared with those of other radionuclides
A 'delayed' counting method to determine indoor Rn-222 levels indirectly
Iannopollo, V; Trimarchi, M; Tripepi, M G; Vermiglio, G
2001-01-01
A new indirect and 'delayed' way is presented to determine indoor concentration of Rn-222 by best-fitting methods. If a rapid knowledge of Rn-222 levels is required and if a detection system is not available in situ, it is possible to obtain concentration of radioactive gas by determining of 'delayed' counts of Po-214. The 'delay' time consists of two or three hours. The method is based on the use of cellulose filters for particulate collection and on the analysis of samples by alpha spectroscopy. It is also possible to obtain concentrations of short-lived radon daughters Po-218, Pb-214, Bi-214, which are very important quantities in a medical framework.
International Nuclear Information System (INIS)
Reiter, R.; Kanter, H.J.; Jaeger, H.; Munzert, K.
1985-01-01
The objective was to clarify the effect of stratospheric intrusions on the tropospheric ozone budget. The correlation between stratospheric-tropospheric exchange and solar events was also investigated. Tropospheric ozone was recorded at three different levels. The radioisotopes 7 Be and radon daughter products 214 Pb and 214 Bi were used as tracers to identify the source of ozone
7 CFR 917.459 - California Peach Grade and Size Regulation.
2010-01-01
... inch in length; and mold, brown rot, and decay; and (ii) Free from serious damage due to cuts, skin... Sugar Time (214LC68) I Summer Fling L Summer Kist J Summer Lady L Summerset I Summer Zee L Suncrest G... Snow, Springtreat (60EF32), Sugar Time (214LC68), Supecheight (012-094), Supechnine, Sweet Scarlet...
Sadhana | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Sadhana. Akhilesh K Chauhan. Articles written in Sadhana. Volume 38 Issue 1 February 2013 pp 25-35. Cavitation erosion resistance of 13/4 and 21-4-N steels · Akhilesh K Chauhan · More Details Abstract Fulltext PDF. Nitrogen strengthened austenitic stainless steel (termed as 21-4-N steel) in as cast and ...
20 CFR 404.1220 - Identification numbers.
2010-04-01
.... The special number will also be assigned to an interstate instrumentality if pre-1987 coverage is obtained and SSA will send a Form SSA-214-CD to the interstate instrumentality to notify it of the number.... SSA will send the State a Form SSA-214-CD, “Notice of Identifying Number,” to inform the State of the...
International Nuclear Information System (INIS)
Abu-Samreh, Mohammad M.
2005-01-01
Radon, as a natural noble gas, has three main natural isotopes; namely, radon 222 (Rn), a decay product of 238U, radon-220(220Rn, known as thoron), produced in the decay series of thorium-232(232Th), and radon-219 (219Rn), a decay product from the chain originating with 235U [1]. Both 238U and 232th occur naturally in soil and rocks at variable concentrations of about 1pCi/g and also 226Ra, the parent of 222Rn [2]. The 222Rn isotope has half-life of 3.82 days; while 220Rn isotope has a half-life of 55 seconds and 219Rn isotope has a half-life of about 3.96 seconds. 222Rn decays into polonium-218(218Po), which in turn decays within minutes to lead-214 (214Pb), bismuth-214 (214Bi), and polonium-218 (218Po), which in turn decays within minutes to lead-214 (214Pb), bismuth 214 (214Bi), and polonium-214 (214Po)[3]. In particular, 222Rn poses a major concern in regard to radiation pollution and human health hazard [4, 5]. The radon gas can diffuse easily out of the soil surface into air or houses; it can be trapped in poorly ventilated houses and so its concentration can build up to higher levels. Although soil is considered to be the main source of indoor radon concentration, raw building materials (especially quartz, cement, etc.) can make a significant contribution to the level of natural radioactivity in closed spaces such as stores and badly-ventilated dwelling [6]. Moreover, the production rate of radon in dwellings depends on the concentration of radium content in the subsoil, building materials, and porosity as well as the density of the wall material [7, 8]. The emission of radon from building materials is found to be a function of ventilation as well as of the radium content in building materials. The nongaseous 222 Rn decay products are partially suspended in air as mixture of attached and unattached fractions and partially deposited on walls and furniture [9]. Over the past four decades, natural radiation exposure due to 222Rn and its progeny inside houses
International Nuclear Information System (INIS)
Kraut, W.; Schwarz, W.; Wilhelm, A.
1994-01-01
A multivariate regression analysis is applied to decay measurements of α-resp. β-filter activcity. Activity concentrations for Po-218, Pb-214 and Bi-214, resp. for the Rn-222 equilibrium equivalent concentration are obtained explicitly. The regression analysis takes into account properly the variances of the measured count rates and their influence on the resulting activity concentrations. (orig.) [de
2011-01-18
... DEPARTMENT OF HOMELAND SECURITY [Docket No. DHS-2010-0087] RIN 1601-ZA09 Identification of Foreign Countries Whose Nationals Are Eligible To Participate in the H-2A and H-2B Nonimmigrant Worker Programs... determination that such participation is in the U.S. interest. See 8 CFR 214.2(h)(5)(i)(F) and 8 CFR 214.2(h)(6...
The role of non-operative management (NOM) in blunt hepatic trauma
African Journals Online (AJOL)
Complications occurred more in the operative group, chest infection occurred in 21.4% with a p value of 0.001, hyperpyrexia occurred in 21.4% with a p value of 0.001, and wound infection in 14.2% with a p value of 0.025. Mortality occurred in 7 patients. The cause of death in patients with blunt hepatic trauma was liver ...
Natural and artificial radioactivity determination of some medicinal plants
International Nuclear Information System (INIS)
Desideri, Donatella; Meli, Maria Assunta; Roselli, Carla
2010-01-01
Several medicinal plants used in Italy were analysed to determine natural and artificial radioactivity in those parts (leaves, fruits, seeds, roots, peduncles, flowers, barks, berries, thallus) used generally as remedies. The radionuclides were determined by alpha ( 238 U, 210 Po) and gamma ( 214 Pb-Bi, 210 Pb, 40 K and 137 Cs) spectrometry. 238 U ranged between dry -1 ; 210 Po between dry -1 ; 214 Pb- 214 Bi between dry -1 ; 210 Pb between dry -1 ; 40 K between 66.2 and 3582.0 Bq kg dry -1 ; 137 Cs between dry -1 . The percentage of 210 Po extraction in infusion and decoction was also determined; the arithmetical mean value of percentage of 210 Po extraction resulted 20.7 ± 7.5.
International Nuclear Information System (INIS)
Hesketh, K.; Porsch, D.; Rimpault, G.; Taiwo, T.; Worrall, A.
2013-01-01
The actinides (or actinoids) are those elements in the periodic table from actinium upwards. Uranium (U) and plutonium (Pu) are two of the principal elements in nuclear fuel that could be classed as major actinides. The minor actinides are normally taken to be the triad of neptunium (Np), americium (Am) and curium (Cm). The combined masses of the remaining actinides (i.e. actinium, thorium, protactinium, berkelium, californium, einsteinium and fermium) are small enough to be regarded as very minor trace contaminants in nuclear fuel. Those elements above uranium in the periodic table are known collectively as the transuranics (TRUs). The operation of a nuclear reactor produces large quantities of irradiated fuel (sometimes referred to as spent fuel), which is either stored prior to eventual deep geological disposal or reprocessed to enable actinide recycling. A modern light water reactor (LWR) of 1 GWe capacity will typically discharge about 20-25 tonnes of irradiated fuel per year of operation. About 93-94% of the mass of uranium oxide irradiated fuel is comprised of uranium (mostly 238 U), with about 4-5% fission products and ∼1% plutonium. About 0.1-0.2% of the mass is comprised of neptunium, americium and curium. These latter elements accumulate in nuclear fuel because of neutron captures, and they contribute significantly to decay heat loading and neutron output, as well as to the overall radio-toxic hazard of spent fuel. Although the total minor actinide mass is relatively small - approximately 20-25 kg per year from a 1 GWe LWR - it has a disproportionate impact on spent fuel disposal, and thus the longstanding interest in transmuting these actinides either by fission (to fission products) or neutron capture in order to reduce their impact on the back end of the fuel cycle. The combined masses of the trace actinides actinium, thorium, protactinium, berkelium and californium in irradiated LWR fuel are only about 2 parts per billion, which is far too low for
Reversible Compositional Control of Oxide Surfaces by Electrochemical Potentials
Mutoro, Eva
2012-01-05
Perovskite oxides can exhibit a wide range of interesting characteristics such as being catalytically active and electronically/ionically conducting, and thus, they have been used in a number of solid-state devices such as solid oxide fuel cells (SOFCs) and sensors. As the surface compositions of perovskites can greatly influence the catalytic properties, knowing and controlling their surface compositions is crucial to enhance device performance. In this study, we demonstrate that the surface strontium (Sr) and cobalt (Co) concentrations of perovskite-based thin films can be controlled reversibly at elevated temperatures by applying small electrical potential biases. The surface compositional changes of La 0.8Sr 0.2CoO 3-δ (LSC 113), (La 0.5Sr 0.5) 2CoO 4±δ (LSC 214), and LSC 214-decorated LSC 113 films (LSC 113/214) were investigated in situ by utilizing synchrotron-based X-ray photoelectron spectroscopy (XPS), where the largest changes of surface Sr were found for the LSC 113/214 surface. These findings offer the potential of reversibly controlling the surface functionality of perovskites. © 2011 American Chemical Society.
Rain-Induced Increase in Background Radiation Detected by Radiation Portal Monitors
Energy Technology Data Exchange (ETDEWEB)
Hausladen, Paul [ORNL; Blessinger, Christopher S [ORNL; Guzzardo, Tyler [ORNL; Livesay, Jake [ORNL
2012-07-01
A complete understanding of both the steady state and transient background measured by Radiation Portal Monitors (RPMs) is essential to predictable system performance, as well as maximization of detection sensitivity. To facilitate this understanding, a test bed for the study of natural background in RPMs has been established at the Oak Ridge National Laboratory. This work was performed in support of the Second Line of Defense Program's mission to detect the illicit movement of nuclear material. In the present work, transient increases in gamma ray counting rates in RPMs due to rain are investigated. The increase in background activity associated with rain, which has been well documented in the field of environmental radioactivity, originates from the atmospheric deposition of two radioactive daughters of radon-222, namely lead-214 and bismuth-214 (henceforth {sup 222}Rn, {sup 214}Pb and {sup 214}Bi). In this study, rainfall rates recorded by a co-located weather station are compared with RPM count rates and High Purity Germanium spectra. The data verifies these radionuclides are responsible for the dominant transient natural background fluctuations in RPMs. Effects on system performance and potential mitigation strategies are discussed.
Electronic structure and dynamics of ordered clusters with ME or RE ions on oxide surface
Energy Technology Data Exchange (ETDEWEB)
Kulagin, N.A., E-mail: nkulagin@bestnet.kharkov.u [Kharkiv National University for Radio Electronics, Avenue Shakespeare 6-48, 61045 Kharkiv (Ukraine)
2011-03-15
Selected data of ab initio simulation of the electronic structure and spectral properties of either cluster with ions of iron, rare earth or actinium group elements have been presented here. Appearance of doped Cr{sup +4} ions in oxides, Cu{sup +2} in HTSC, Nd{sup +2} in solids has been discussed. Analysis of experimental data for plasma created ordered structures of crystallites with size of about 10{sup -9} m on surface of separate oxides are given, too. Change in the spectroscopic properties of clusters and nano-structures on surface of strontium titanate crystals discussed shortly using the X-ray line spectroscopy experimental results. - Research highlights: External influence and variation of technology induce changes in valence of nl ions in compounds. Wave function of cluster presented as anti-symmetrical set of ions wave functions. The main equation describes the self-consistent field depending on state of all electrons of cluster. Level scheme of Cr{sup 4+} ions in octo- and tetra-site corresponds to doped oxides spectra after treatment. Plasma treatment effects in appearance of systems of unit crystallites with size of about 10{sup -6}-10{sup -9} m.
Electronic structure and dynamics of ordered clusters with ME or RE ions on oxide surface
International Nuclear Information System (INIS)
Kulagin, N.A.
2011-01-01
Selected data of ab initio simulation of the electronic structure and spectral properties of either cluster with ions of iron, rare earth or actinium group elements have been presented here. Appearance of doped Cr +4 ions in oxides, Cu +2 in HTSC, Nd +2 in solids has been discussed. Analysis of experimental data for plasma created ordered structures of crystallites with size of about 10 -9 m on surface of separate oxides are given, too. Change in the spectroscopic properties of clusters and nano-structures on surface of strontium titanate crystals discussed shortly using the X-ray line spectroscopy experimental results. - Research highlights: → External influence and variation of technology induce changes in valence of nl ions in compounds. → Wave function of cluster presented as anti-symmetrical set of ions wave functions. → The main equation describes the self-consistent field depending on state of all electrons of cluster. → Level scheme of Cr 4+ ions in octo- and tetra-site corresponds to doped oxides spectra after treatment. → Plasma treatment effects in appearance of systems of unit crystallites with size of about 10 -6 -10 -9 m.
Review of radionuclide source terms used for performance-assessment analyses
International Nuclear Information System (INIS)
Barnard, R.W.
1993-06-01
Two aspects of the radionuclide source terms used for total-system performance assessment (TSPA) analyses have been reviewed. First, a detailed radionuclide inventory (i.e., one in which the reactor type, decay, and burnup are specified) is compared with the standard source-term inventory used in prior analyses. The latter assumes a fixed ratio of pressurized-water reactor (PWR) to boiling-water reactor (BWR) spent fuel, at specific amounts of burnup and at 10-year decay. TSPA analyses have been used to compare the simplified source term with the detailed one. The TSPA-91 analyses did not show a significant difference between the source terms. Second, the radionuclides used in source terms for TSPA aqueous-transport analyses have been reviewed to select ones that are representative of the entire inventory. It is recommended that two actinide decay chains be included (the 4n+2 ''uranium'' and 4n+3 ''actinium'' decay series), since these include several radionuclides that have potentially important release and dose characteristics. In addition, several fission products are recommended for the same reason. The choice of radionuclides should be influenced by other parameter assumptions, such as the solubility and retardation of the radionuclides
Seasonal variations of aerosol residence time in the lower atmospheric boundary layer
International Nuclear Information System (INIS)
Ahmed, A.A.; Mohamed, A.; Ali, A.E.; Barakat, A.; Abd El-Hady, M.; El-Hussein, A.
2004-01-01
During a one year period, from Jan. 2002 up to Dec. 2002, approximately 130 air samples were analyzed to determine the atmospheric air activity concentrations of short- and long-lived ( 222 Rn) decay products 214 Pb and 210 Pb. The samples were taken by using a single-filter technique and γ-spectrometry was applied to determine the activity concentrations. A seasonal fluctuation in the concentration of 214 Pb and 210 Pb in surface air was observed. The activity concentrations of both radionuclides were observed to be relatively higher during the winter/autumn season than in spring/summer season. The mean activity concentration of 214 Pb and 210 Pb within the whole year was found to be 1.4±0.27 Bq m -3 and 1.2±0.15 mBq m -3 , respectively. Different 210 Pb: 214 Pb activity ratios during the year varied between 1.78x10 -4 and 1.6x10 -3 with a mean value of 8.9x10 -4 ±7.6x10 -5 . From the ratio between the activity concentrations of the radon decay products 214 Pb and 210 Pb a mean residence time (MRT) of aerosol particles in the atmosphere of about 10.5±0.91 d could be estimated. The seasonal variation pattern shows relatively higher values of MRT in spring/summer season than in winter/autumn season. The MRT data together with relative humidity (RH), air temperature (T) and wind speed (WS), were used for a comprehensive regression analysis of its seasonal variation in the atmospheric air
International Nuclear Information System (INIS)
Nakamura, Mariko; Esaka, Takao; Kamata, Masahiro
1999-01-01
This paper presents a practical example of educational experiment conducted at Tottori University, whose theme is to separate 214 Bi(+ 214 Pb) from superphosphate of lime or the soil sampled at Ningyo-Touge mountain pass. The results of this experiment are quantitative enough for educational purpose, although the amount of radioactivity is so small that it is free from any regulation in Japan. (author)
48 CFR 52.214-5 - Submission of Bids.
2010-10-01
... authorized by the solicitation. (e) Bids submitted by electronic commerce shall be considered only if the electronic commerce method was specifically stipulated or permitted by the solicitation. (End of provision...
The synthesis of 2-14C-N-nitrosothiazolidine
International Nuclear Information System (INIS)
Cragin, D.W.; Shibamoto, Takayuki
1989-01-01
2- 14 C-N-Nitrosothiazolidine was synthesized with a chemical purity of 99.6%, a radio chemical purity of 99.4%, and an overall yield of 30.7%. Unlabelled N-nitrosothiazolidine, synthesized using the same method, resulted in a purity of 99.85% by capillary GC and 99.7% by HPLC. Analysis of N-nitrosothiazolidine by GC was found to require a low injection port temperature of 160 0 C to prevent denitrosation in the injection port. During the nitrosation of thiazolidine, if the pH was reduced below 4 with hydrochloric acid, ring hydrolysis occurred, and chlorinated disulfide compounds formed. (author)
48 CFR 633.214-70 - Alternative dispute resolution.
2010-10-01
... situations; (vi) There is a need for independent expert analysis; or, (vii) The claim has merit but its value... of either the trial's conclusion or receipt of a trial transcript. (4) Mediation. Mediation is a... decisionmaking authority and cannot impose a decision. Mediation assistance involves working with the parties to...
22 CFR 214.36 - Records of advisory committees.
2010-04-01
..., working papers, drafts, studies, agenda, and other documents which were made available to, or prepared for... according to procedures prescribed in the Agency's Handbook 21—Communications, Part III, Records Filing and...
13 CFR 400.214 - Participations in guaranteed loans.
2010-01-01
...) Subject to paragraphs (b), (c) and (d) of this section, a Lender may distribute the risk of a portion of a... the Guarantee is assigned, conveyed, sold, or transferred in whole or in part; (2) The Lender remains... Lenders; (2) Private investment funds and insurance companies that do not usually invest in commercial...
Human factors assessment of SC-214 message set
2010-08-18
This is a presentation that was given at the Communication Navigation and Surveillance (CNS) Task Force Meeting. It discusses a review of current literature, analysis of Pilot Deviations and ASRS reports involving data link communications, and discus...
48 CFR 1233.214 - Alternative dispute resolution (ADR).
2010-10-01
... Alternative dispute resolution (ADR). (c) The Administrative Dispute Resolution Act (ADRA) of 1990, Public Law... Specialist, who is responsible for the operations of the Center for Alternative Dispute Resolution, (C-4... alternative means of dispute resolution set forth in the ADRA, 5 U.S.C. 571(3) on a non-reimbursable basis for...
48 CFR 833.214 - Alternative dispute resolution (ADR).
2010-10-01
... Alternative dispute resolution (ADR). Contracting officers and contractors are encouraged to use alternative dispute resolution (ADR) procedures. CBCA guidance on ADR may be obtained at http://www.cbca.gsa.gov. ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Alternative dispute...
Energy Technology Data Exchange (ETDEWEB)
Schwartz, J; O' Donoghue, J A; Humm, J L [Department of Medical Physics, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); Jaggi, J S [Bristol-Myers Squibb, Plainsboro, NJ (United States); Ruan, S; Larson, S M [Nuclear Medicine Service Department of Radiology, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); McDevitt, M; Scheinberg, D A, E-mail: schwarj1@mskcc.org [Molecular Pharmacology and Chemistry, Sloan-Kettering Institute, 1275 York Avenue, New York, NY 10065 (United States)
2011-02-07
Clinical therapeutic studies using {sup 225}Ac-labeled antibodies have begun. Of major concern is renal toxicity that may result from the three alpha-emitting progeny generated following the decay of {sup 225}Ac. The purpose of this study was to determine the amount of {sup 225}Ac and non-equilibrium progeny in the mouse kidney after the injection of {sup 225}Ac-huM195 antibody and examine the dosimetric consequences. Groups of mice were sacrificed at 24, 96 and 144 h after injection with {sup 225}Ac-huM195 antibody and kidneys excised. One kidney was used for gamma ray spectroscopic measurements by a high-purity germanium (HPGe) detector. The second kidney was used to generate frozen tissue sections which were examined by digital autoradiography (DAR). Two measurements were performed on each kidney specimen: (1) immediately post-resection and (2) after sufficient time for any non-equilibrium excess {sup 213}Bi to decay completely. Comparison of these measurements enabled estimation of the amount of excess {sup 213}Bi reaching the kidney ({gamma}-ray spectroscopy) and its sub-regional distribution (DAR). The average absorbed dose to whole kidney, determined by spectroscopy, was 0.77 (SD 0.21) Gy kBq{sup -1}, of which 0.46 (SD 0.16) Gy kBq{sup -1} (i.e. 60%) was due to non-equilibrium excess {sup 213}Bi. The relative contributions to renal cortex and medulla were determined by DAR. The estimated dose to the cortex from non-equilibrium excess {sup 213}Bi (0.31 (SD 0.11) Gy kBq{sup -1}) represented {approx}46% of the total. For the medulla the dose contribution from excess {sup 213}Bi (0.81 (SD 0.28) Gy kBq{sup -1}) was {approx}80% of the total. Based on these estimates, for human patients we project a kidney-absorbed dose of 0.28 Gy MBq{sup -1} following administration of {sup 225}Ac-huM195 with non-equilibrium excess {sup 213}Bi responsible for approximately 60% of the total. Methods to reduce renal accumulation of radioactive progeny appear to be necessary for the success of {sup 225}Ac radioimmunotherapy.
International Nuclear Information System (INIS)
Koyama, Mutsuo
1989-01-01
Distribution profiles of trace elements in land plants were studied by neutron activation analysis and radioactivity measurements without activation. Number of botanical samples analyzed were more than three thousand in which more than three hundred botanical species were included. New accumulator plants of Co, Cr, Zn, Cd, rare earth elements, Ac, U, etc., were found. Capabilities of accumulating trace elements can be related to the botanical taxonomy. Discussions are given from view points of inorganic chemistry as well as from botanical physiology
Evaluation of the external exposure to Rn-222 progeny in air
International Nuclear Information System (INIS)
Ali, E.M.; Taha, T.M.; Gomaa, M.A.; El-Hussein, A.M.; Ahmed, A.A.
2003-01-01
The aim of this paper is to evaluate the Rn-222 progeny annual effective dose, skin dose and effective doses to different organs such as Gonad, Lung, Red Marrow, Bone surface, Thyroid, and the Remainder. Dose Coefficients of external exposure to Rn-222 in air was used in mSv s/Bqm -3 to calculate the organ doses. The study was monitored for two places, Nuclear Research Center and Al-Minia University. We have confirmed that the inhalation modes, sleep, sitting, light and heavy exercise influence the activity inhalation rate Bq/hr. It varies from 0.3 to 39.6 Bq/hr., the organ doses of Pb-214 is higher than Bi-214/Po-214 and Po-218 respectively in the case of the organ dose relative to environmental media
International Nuclear Information System (INIS)
Andrade Marinho, E.V. de.
1985-09-01
The correlations between the activity of the short half-life radon decay products in the low atmosphere and the meterological parameters, measuring the atmospheric polonium 214 are studied. The aerosols were collected on membrane filters and analysed by alpha spectrometry. Measurements have been made in Sao Jose dos Campos and Cachoeira Paulista, in Brazil. At S. Jose dos Campos the influence of the pluviometry on the concentration of atmospheric Po 214 has been analysed, showing that high activity correspond to low pluviometry and inversely, low activities correspond to high pluviometry. At Cachoeira Paulista, the variation in the atmospheric Po 214 activity in corresation with the air stability, measured, showing the accumulation of radioactive aerosols during the greater stability in the the lower atmospheric layers, was studied. (author) [pt
Simulation of radon short lived decay daughters' inhalation using the lung compartmental model
International Nuclear Information System (INIS)
Tomulescu, Vlad C.
2002-01-01
Radon and its short-lived decay daughters are the main source of radiation on natural ways for population. The radon gas, released from soil, water or construction materials is producing by radioactive decay the following solid daughters: Po-218, Bi-214, Pb-214, and Po-214, which can attach to aerosols, and consequently penetrate the organism by inhalation. The human respiratory tract can be approximated by aid of a compartment model that takes into account the different anatomical structures exposed to contamination and irradiation, as well as the respective physiological processes. This model is associated to a mathematical equation system that describes the behavior of the radioactive material inside the body. The results represent the dose equivalent on different organs and tissues, as a function of subject and the activity performed in contaminating environment. (author)
Measurement of Ra-226 in building materials, with a Na I (Tl) scintillation counter
International Nuclear Information System (INIS)
Vallejo, L.R.; Fuenteseca, J.W.; Rivera, C.A.; Aros, F.H.
1992-01-01
Ra-226 concentration in building materials is determined using gamma-ray spectrometry. Ra-226 contained in sundry materials employed in the construction of dwelling houses and public buildings in Antofagasta city is determined by counting the Pb-214 peaks at 295 KeV and 352 keV, and the Bi-214 peak at 609 keV recorded by means of a 7.5-cm Nal (TI) scintillation counter. (author)
International Nuclear Information System (INIS)
Suckow, A.; Michels, K.; Kudrass, H.R.; Kottke, B.
1999-01-01
This paper presents results from a study related to storm history and sediment balance off Bangladesh. Sediment cores and high-resolution seismic and bathymetric records were obtained during two cruises of research vessel 'Sonne' in 1994 (So93) and 1997 (So126). Sediments were dated using the natural and fallout radionuclides 137 Cs, 210 Pb, 214 Pb, 214 Bi and 228 Ra, measured by gamma spectrometry on freeze-dried samples
Energy Technology Data Exchange (ETDEWEB)
Nisti, Marcelo Bessa; Campos, Marcia Pires de, E-mail: mbnisti@ipen.b, E-mail: mpcampos@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)
2011-10-26
The radon exhalation was estimated through the adsorption in activated carbon technique. Classified as TENORM, the radon exhalation determination on the phosphogypsum piles was performed through the adsorption ratio of radon in activated carbon, from the concentration of descendants of {sup 222}Rn, {sup 214}Pb and {sup 214}Bi obtained by gamma spectrometry. The results obtained in this work were compatibles with the values found in the literature
Radon Measurements In Preschool And School Facilities In The Municipality Of Bank's Kapur
International Nuclear Information System (INIS)
Kadic, I.; Deljkic, D.; Ilic, Z.
2015-01-01
Radon is a radioactive noble gas, chemically inert and motile at room temperature. It is a colorless and odorless gas, but the characteristic of radioactivity enables us to detect it and measure it by two methods - the passive and the active one. The results of a research on concentration of radon activity in the air of preschool's and school's indoors in the area of the municipality of Bosanska Krupa in 2013 is shown in this work. To determine radon concentration, passive measuring method was used, canisters of radon with active carbon, with correction for the air humidity. The active carbon is placed into a canister that is opened during measurements and placed on the wanted location. Radon from the air arrives into the canister and is adsorbed on the active carbon which has high affinity towards few gases and steams, including 222Rn. Adsorbed radon in granules of active carbon is decomposed to short-living progeny: 218Po, 214Pb, 214Bi, 214Po and 210Pb. Radon's progeny 214Pb and 214Bi emit gamma-rays, it permits determination of the radon concentration via gamma-spectrometry through mentioned transitions, because three hours later the equilibrium between radon and its progeny in the carbon has already been established. The measurements have been conducted on high-resolution gamma spectrometer Ortec with 30 percent relative efficiency, integrated electronic system (Ortec) and GAMMA VISION (Ortec) software for spectra processing, analysis and evaluation of the results of measurements. The purpose of this work was to detect the levels of radon, targeting the protection of the youngest population in case of high radon concentrations in residential areas. (author).
Directory of Open Access Journals (Sweden)
L.R. Bergsten-Torralba
2009-12-01
Full Text Available The objective of this study was to investigate the capacity of decolorization and detoxification of the textile dyes Reactive Red 198 (RR198, Reactive Blue 214 (RB214, Reactive Blue 21 (RB21 and the mixture of the three dyes (MXD by Penicillium simplicissimum INCQS 40211. The dye RB21, a phthalocyanine, was totally decolorized in 2 days, and the others, the monoazo RR198, the diazo RB214 and MXD were decolorized after 7 days by P. simplicissimum. Initially the dye decolorization involved dye adsorption by the biomass followed by degradation. The acute toxicity after fungal treatment was monitored with the microcrustacean Daphnia pulex and measured through Effective Concentration 50% (EC50. P. simplicissimum reduced efficiently the toxicity of RB21 from moderately acutely toxic to minor acutely toxic and it also reduced the toxicity of RB214 and MXD, which remained minor acutely toxic. Nevertheless, the fungus increased the toxicity of RR198 despite of the reduction of MXD toxicity, which included this dye. Thus, P. simplicissimum INCQS 40211 was efficient to decolorize different textile dyes and the mixture of them with a significant reduction of their toxicity. In addition this investigation also demonstrated the need of toxicological assays associated to decolorization experiments.
Crumlin, Ethan J.; Mutoro, Eva; Hong, Wesley T.; Biegalski, Michael D.; Christen, Hans M.; Liu, Zhi; Bluhm, Hendrik; Shao-Horn, Yang
2013-01-01
Heterostructured oxide interfaces have demonstrated enhanced oxygen reduction reaction rates at elevated temperatures (∼500-800 C); however, the physical origin underlying this enhancement is not well understood. By using synchrotron-based in situ ambient pressure X-ray photoelectron spectroscopy (APXPS), we focus on understanding the surface electronic structure, elemental composition, and chemical nature of epitaxial La0.8Sr 0.2CoO3-δ (LSC113), (La 0.5Sr0.5)2CoO4±δ (LSC214), and LSC214-decorated LSC113 (LSC 113/214) thin films as a function of applied electrical potentials (0 to -800 mV) at 520 C and p(O2) of 1 × 10-3 atm. Shifts in the top of the valence band binding energy and changes in the Sr 3d and O 1s spectral components under applied bias reveal key differences among the film chemistries, most notably in the degree of Sr segregation to the surface and quantity of active oxygen sites in the perovskite termination layer. These differences help to identify important factors governing the enhanced activity of oxygen electrocatalysis observed for the LSC113/214 heterostructured surface. © 2013 American Chemical Society.
Radon Daughters Background Reduction in Alpha Particles Counting System
International Nuclear Information System (INIS)
Dadon, S. S.; Pelled, O.; Orion, I.
2014-01-01
The ABPC method is using a serially occurring events of the beta decay of the 214Bi fallow by alpha decay of the 214Po that take place almost simultaneously to detect the Pseudo Coincidence Event (PCE) from the RDP, and to subtract them from the gross alpha counts. 267 This work showed that it is possible to improve the efficiency of RDP background reduction, including subtracting the 218Po contribution by using the ABPC method based on a single solid state silicon PIPS detector. False counts percentage obtained at the output of the PCE circuit were smaller than 0.1%. The results show that the PCE circuit was not influenced by non RDP alpha emitters. The PCE system did not reduce the non PCE of the 218Po. After 20 minutes the 218Po was strongly decayed, and its contribution became negligible. In order to overcome this disadvantage, a mathematical matching calculations for the 214Po and the 218Po decay equations were employed, and a constant ratio of the APo214(0) / APo218(0) was obtained. This ratio can be used to estimate the count rate of the 218Po at the first 20 minutes, and to subtract it from the total count rate in order to obtain correct RDP reduction
Directory of Open Access Journals (Sweden)
Inderbir Singh
2011-06-01
Full Text Available OBJECTIVE: the purpose of this research was to formulate taste masked complexes of cefuroxime axetil and to evaluate them for taste, drug loading and characterized by FTIR, XRD. Tablets were formulated of selected batches and evaluated for drug release and physical parameters. METHODS: complexation technique is used to prepare complexes of drug where ion exchange resins such as Indion® 214, Indion® 234 and Indion® 414 were used with a drug-resin ratio of 1:0.5, 1:1, 1:2. The drug resinates were characterized by Infrared Spectroscopy, DSC and X-Ray Diffraction pattern and evaluated for drug loading and taste. Direct compression method was used to formulate tablets. In vitro dissolution was carried out using USP II apparatus. RESULT: potential taste masking increased with increasing concentration of resin. Indion® 214 resin showed better taste masking effect as compared to Indion® 234 and Indion® 414. Percent of drug loading was maximum at drug : resin ratio of 1:1, after that it decreased. Prolonged (upto 5 h and slow drug release was observed with resin 214 at higher concentration. CONCLUSIONS: out of three resins chosen, Indion® 214 at higher concentration exhibit excellent taste masking as well as sustained drug release action.
Sun, Meng; Lu, Ming-Xing; Tang, Xiao-Tian; Du, Yu-Zhou
2014-12-12
The pink stem borer, Sesamia inferens (Walker), is a major pest of rice and is endemic in China and other parts of Asia. Small heat shock proteins (sHSPs) encompass a diverse, widespread class of stress proteins that have not been characterized in S. inferens. In the present study, we isolated and characterized three S. inferens genes that encode members of the α-crystallin/sHSP family, namely, Sihsp21.4, Sihsp20.6, and Sihsp19.6. The three cDNAs encoded proteins of 187, 183 and 174 amino acids with calculated molecular weights of 21.4, 20.6 and 19.6 kDa, respectively. The deduced amino acid sequences of the three genes showed strong similarity to sHSPs identified in other lepidopteran insects. Sihsp21.4 contained an intron, but Sihsp20.6 and Sihsp19.6 lacked introns. Real-time quantitative PCR analyses revealed that Sihsp21.4 was most strongly expressed in S. inferens heads; Whereas expression of Sihsp20.6 and Sihsp19.6 was highest in eggs. The three S. inferens sHSP genes were up-regulated during low temperature stress. In summary, our results show that S. inferens sHSP genes have distinct regulatory roles in the physiology of S. inferens.
Directory of Open Access Journals (Sweden)
Meng Sun
2014-12-01
Full Text Available The pink stem borer, Sesamia inferens (Walker, is a major pest of rice and is endemic in China and other parts of Asia. Small heat shock proteins (sHSPs encompass a diverse, widespread class of stress proteins that have not been characterized in S. inferens. In the present study, we isolated and characterized three S. inferens genes that encode members of the α-crystallin/sHSP family, namely, Sihsp21.4, Sihsp20.6, and Sihsp19.6. The three cDNAs encoded proteins of 187, 183 and 174 amino acids with calculated molecular weights of 21.4, 20.6 and 19.6 kDa, respectively. The deduced amino acid sequences of the three genes showed strong similarity to sHSPs identified in other lepidopteran insects. Sihsp21.4 contained an intron, but Sihsp20.6 and Sihsp19.6 lacked introns. Real-time quantitative PCR analyses revealed that Sihsp21.4 was most strongly expressed in S. inferens heads; Whereas expression of Sihsp20.6 and Sihsp19.6 was highest in eggs. The three S. inferens sHSP genes were up-regulated during low temperature stress. In summary, our results show that S. inferens sHSP genes have distinct regulatory roles in the physiology of S. inferens.
Crumlin, Ethan J.
2013-08-08
Heterostructured oxide interfaces have demonstrated enhanced oxygen reduction reaction rates at elevated temperatures (∼500-800 C); however, the physical origin underlying this enhancement is not well understood. By using synchrotron-based in situ ambient pressure X-ray photoelectron spectroscopy (APXPS), we focus on understanding the surface electronic structure, elemental composition, and chemical nature of epitaxial La0.8Sr 0.2CoO3-δ (LSC113), (La 0.5Sr0.5)2CoO4±δ (LSC214), and LSC214-decorated LSC113 (LSC 113/214) thin films as a function of applied electrical potentials (0 to -800 mV) at 520 C and p(O2) of 1 × 10-3 atm. Shifts in the top of the valence band binding energy and changes in the Sr 3d and O 1s spectral components under applied bias reveal key differences among the film chemistries, most notably in the degree of Sr segregation to the surface and quantity of active oxygen sites in the perovskite termination layer. These differences help to identify important factors governing the enhanced activity of oxygen electrocatalysis observed for the LSC113/214 heterostructured surface. © 2013 American Chemical Society.
International Nuclear Information System (INIS)
Ma, Jun; Zhang, Lei; Li, Shanshan; Liu, Shulin; Ma, Cui; Li, Weiyang; Falck, J.R.; Manthati, Vijay L.; Reddy, D. Sudarshan; Medhora, Meetha; Jacobs, Elizabeth R.; Zhu, Daling
2010-01-01
Epoxyeicosatrienoic acids (EETs), metabolites of arachidonic acid (AA) catalyzed by cytochrome P450 (CYP), have many essential biologic roles in the cardiovascular system including inhibition of apoptosis in cardiomyocytes. In the present study, we tested the potential of 8,9-EET and derivatives to protect pulmonary artery smooth muscle cells (PASMCs) from starvation induced apoptosis. We found 8,9-epoxy-eicos-11(Z)-enoic acid (8,9-EET analog (214)), but not 8,9-EET, increased cell viability, decreased activation of caspase-3 and caspase-9, and decreased TUNEL-positive cells or nuclear condensation induced by serum deprivation (SD) in PASMCs. These effects were reversed after blocking the Rho-kinase (ROCK) pathway with Y-27632 or HA-1077. Therefore, 8,9-EET analog (214) protects PASMC from serum deprivation-induced apoptosis, mediated at least in part via the ROCK pathway. Serum deprivation of PASMCs resulted in mitochondrial membrane depolarization, decreased expression of Bcl-2 and enhanced expression of Bax, all effects were reversed by 8,9-EET analog (214) in a ROCK dependent manner. Because 8,9-EET and not the 8,9-EET analog (214) protects pulmonary artery endothelial cells (PAECs), these observations suggest the potential to differentially promote apoptosis or survival with 8,9-EET or analogs in pulmonary arteries.
Energy Technology Data Exchange (ETDEWEB)
Ma, Jun; Zhang, Lei; Li, Shanshan [Department of Biopharmaceutical Sciences, College of Pharmacy, Harbin Medical University, 157 Baojian Road, Nangang District, Harbin, Heilongjiang 150081 (China); Liu, Shulin [Department of Biopharmaceutical Sciences, College of Pharmacy, Harbin Medical University, 157 Baojian Road, Nangang District, Harbin, Heilongjiang 150081 (China); Bio-pharmaceutical Key Laboratory of Heilongjiang Province, Harbin 150081 (China); Ma, Cui [Department of Biopharmaceutical Sciences, College of Pharmacy, Harbin Medical University, 157 Baojian Road, Nangang District, Harbin, Heilongjiang 150081 (China); Li, Weiyang [Mudanjiang Medical College, Mudanjiang 157011 (China); Falck, J.R.; Manthati, Vijay L.; Reddy, D. Sudarshan [University of Texas Southwestern Medical Center, Dallas, TX 75390 (United States); Medhora, Meetha; Jacobs, Elizabeth R. [Division of Pulmonary and Critical Care, Department of Medicine, Cardiovascular Center, Medical College of Wisconsin, Milwaukee, WI 53226 (United States); Zhu, Daling, E-mail: dalingz@yahoo.com [Department of Biopharmaceutical Sciences, College of Pharmacy, Harbin Medical University, 157 Baojian Road, Nangang District, Harbin, Heilongjiang 150081 (China); Bio-pharmaceutical Key Laboratory of Heilongjiang Province, Harbin 150081 (China)
2010-08-15
Epoxyeicosatrienoic acids (EETs), metabolites of arachidonic acid (AA) catalyzed by cytochrome P450 (CYP), have many essential biologic roles in the cardiovascular system including inhibition of apoptosis in cardiomyocytes. In the present study, we tested the potential of 8,9-EET and derivatives to protect pulmonary artery smooth muscle cells (PASMCs) from starvation induced apoptosis. We found 8,9-epoxy-eicos-11(Z)-enoic acid (8,9-EET analog (214)), but not 8,9-EET, increased cell viability, decreased activation of caspase-3 and caspase-9, and decreased TUNEL-positive cells or nuclear condensation induced by serum deprivation (SD) in PASMCs. These effects were reversed after blocking the Rho-kinase (ROCK) pathway with Y-27632 or HA-1077. Therefore, 8,9-EET analog (214) protects PASMC from serum deprivation-induced apoptosis, mediated at least in part via the ROCK pathway. Serum deprivation of PASMCs resulted in mitochondrial membrane depolarization, decreased expression of Bcl-2 and enhanced expression of Bax, all effects were reversed by 8,9-EET analog (214) in a ROCK dependent manner. Because 8,9-EET and not the 8,9-EET analog (214) protects pulmonary artery endothelial cells (PAECs), these observations suggest the potential to differentially promote apoptosis or survival with 8,9-EET or analogs in pulmonary arteries.
Intra-Operational Area Coordination: The Zone EOC Concept
2015-09-01
200, operating as Asiana Airlines flight 214 , was on approach to runway 28L when it struck a seawall at San Francisco International Airport (SFIA...training and lacked the necessary training and experience to land a jumbo jet onto an airstrip with a sea wall. The Asiana Airline incident also...Crash of Asiana Flight 214 Accident Report Summary, 2014, accessed August 31, 2015, http://www.ntsb.gov/news/events/Pages/ 2014_Asiana_BMG
International Nuclear Information System (INIS)
Winkler, R.
2001-09-01
Daily and seasonal variation of the equilibrium equivalent radon concentration (EEC Rn-222 ) and of the concentration of the short-lived radon decay product 214 Pb in ground-level air was investigated at Munich-Neuherberg from 1982 to 2000, and from 1989 to 2000, respectively. For this, the EEC was measured continuously with an alpha/beta aerosol monitor at 2.5 m above ground, and 214 Pb was determined by online gamma spectrometry at about 12 m above ground. The resulting time series were analysed statistically. For the respective periods, the measurements yielded a long-term average concentration of 7.8 Bq m -3 (geometric mean: 6.1 Bq m -3 ) for the EEC, and 6.0 Bq m -3 (geom. mean: 5.0 Bq m -3 ) for 214 Pb. In these periods, daily averages ranged from 0.6 to 49 Bq m -3 (EEC), and from 0.6 to 43 Bq m -3 ( 214 Pb). Monthly mean concentrations varied between 3.0 Bq m -3 in March 1988 and 20 Bq m -3 in October 1985 (EEC), and from 3.4 Bq m -3 in April 1992 to 11 Bq m -3 in October 1995 ( 214 Pb), respectively. The annual average concentrations were from 5.9 Bq m -3 in 1999 to 10.6 Bq m -3 in 1985 (EEC), and from 5.3 Bq m -3 in 1999 to 6.8 Bq m -3 in 1991 ( 214 Pb). From the long-term average equilibrium equivalent radon concentration (EEC), an average annual effective dose of 0.13 mSv due to the short-lived radon progeny outdoors was estimated. The time series showed distinct daily and seasonal variations. The variations from day to day are mainly caused by the actual weather conditions (wind, rain, etc.), i.e. the short-term turbulent conditions. The seasonal pattern is characterised by an autumn to winter maximum and an early summer minimum, and reflects the prevailing turbulent conditions at the respective seasons. As known, at Munich-Neuherberg during autumn and winter months (October/November to February) inversion weather conditions frequently occur, while the other months are characterised by more turbulent conditions. (orig.)
Continual monitoring of radon decay products concentration in indoor and outdoor air
International Nuclear Information System (INIS)
Petruf, P.; Holy, K.; Stanys, T.
1998-01-01
The goal of this work was the development of the method and construction and testing of measurement device for continual monitoring of radon daughters concentrations in the indoor and outdoor environment with regard to make possible to determine very low activities in the outdoor air (below % Bq/m 3 ). In this method air sample is drawn through the appropriate filter material. Radon and thoron daughters both attached and unattached on aerosols particles are collected on the filter surface and then the filter activity is counted. The silicon surface barrier detector with the active area of 200 mm 2 in monitor was used. The Millipore AW19-type filter was chosen and sampling rate of 30 l/min for collecting of the air samples. The determination of the individual activity concentrations in three-count method is based on the solution of the simultaneous equations describing the number of atoms of measured nuclides on the filter during and after sampling. The monitor was tested in three different environments (the average values of the activity concentrations of radon and its decay products in Bq/m 3 are given): in the basement of the building: 61.4 ± 5.0 of 222 Rn, 29.5 ± 2.8 of 218 Po, 14.1 ± 1.8 of 214 Pb and 12.1 ± 1.6 of 214 Bi; in the room on the second floor of the same building:22.2 ± 7.9 of 222 Rn, 7.3 ± 2.8 of 218 Po, 4.6 ± 1.9 of 214 Pb and 2.6 ± 1.2 of 214 Bi ; in the outdoor air in front of the building: 4.1 ± 2.7 of 222 Rn, 2.3 ± 0.9 of 218 Po, 1.5 ± 0.8 of 214 Pb and 1.4 ± 0.6 of 214 Bi. The results show a good agreement with expectations of the activity concentrations in three different environments. The monitor enables to determine low activity concentrations in the outdoor with an acceptable precision during one hour counting. The monitor can be used for the research of the correlation between the atmospheric stability and activity concentrations of radon decay products
Impaired pulmonary function after treatment for tuberculosis: the end of the disease?
Chushkin, Mikhail Ivanovich; Ots, Oleg Nikolayevich
2017-01-01
To evaluate the prevalence of pulmonary function abnormalities and to investigate the factors affecting lung function in patients treated for pulmonary tuberculosis. A total of 214 consecutive patients (132 men and 82 women; 20-82 years of age), treated for pulmonary tuberculosis and followed at a local dispensary, underwent spirometry and plethysmography at least one year after treatment. Pulmonary impairment was present in 102 (47.7%) of the 214 patients evaluated. The most common functional alteration was obstructive lung disease (seen in 34.6%). Of the 214 patients, 60 (28.0%) showed reduced pulmonary function (FEV1 below the lower limit of normal). Risk factors for reduced pulmonary function were having had culture-positive pulmonary tuberculosis in the past, being over 50 years of age, having recurrent tuberculosis, and having a lower level of education. Nearly half of all tuberculosis patients evolve to impaired pulmonary function. That underscores the need for pulmonary function testing after the end of treatment. Avaliar a prevalência de alterações da função pulmonar e investigar os fatores que afetam a função pulmonar em pacientes tratados para tuberculose pulmonar. Um total de 214 pacientes consecutivos (132 homens e 82 mulheres; 20-82 anos de idade), tratados para tuberculose pulmonar e acompanhados em um dispensário local, foi submetido a espirometria e pletismografia pelo menos um ano após o tratamento. O comprometimento pulmonar estava presente em 102 (47,7%) dos 214 pacientes avaliados. A alteração funcional mais comum foi o distúrbio ventilatório obstrutivo (observado em 34,6%). Dos 214 pacientes, 60 (28,0%) apresentaram função pulmonar reduzida (VEF1 abaixo do limite inferior de normalidade). Os fatores de risco para função pulmonar reduzida foram tuberculose pulmonar com cultura positiva no passado, idade acima de 50 anos, recidiva de tuberculose e menor nível de escolaridade. Quase metade de todos os pacientes com tuberculose
Post-concussion driving behaviors and opinions: A survey of collegiate student-athletes.
Schmidt, Julianne D; Lynall, Robert C; Lempke, Landon Bryce; Weber, Michelle L; Devos, Hannes
2018-05-08
Post-concussion driving restrictions are eminent, but we lack understanding of current behaviors and opinions about driving following concussion among populations at risk of concussion. We aimed to describe post-concussion driving behaviors and opinions among collegiate student-athletes. Student-athletes completed a survey (response rate=45.3%, 223/492) regarding their post-concussion driving behaviors and opinions. Response frequencies and percentages are presented. Student-athletes self-reported a total of 169 lifetime concussions (0.76±1.02 each). Of the 169 concussions, 52.1% (88/169) were diagnosed and 52.7% (89/169) occurred while the student-athlete possessed a valid driver's license. Student-athletes refrained from driving following 43.8% (39/89) of the concussive events. Student-athletes that refrained most commonly did so for only 24-48 hours (20.5%, 8/39) and because a health care provider advised them to (33.3%: 13/39). Student-athletes most commonly reported that they would feel "very unsafe" driving a car immediately following injury (38.4%, 84/219). When asked whether driving restrictions would influence your decision to report the injury to a health care provider, 7.9% reported that it "definitely would" (17/214), 26.6% "probably would" (57/214), 17.8% "neutral" (38/214), 24.8% "probably would not" (53/214), and 22.9% "definitely would not" (49/214). Despite generally believing that driving immediately following a concussion is unsafe, a majority of student-athletes did not refrain from driving at any point following their previous concussions. Post-concussion driving restrictions may have some influence on student-athletes' decisions to report the injury to a health care provider. Health care providers play a critical role in post-concussion driving restriction, but lack standardized recommendations to guide their care.
International Nuclear Information System (INIS)
Reineking, A.; Porstendoerfer, J.
1990-01-01
The unattached fraction fp of potential alpha energy of short-lived Rn decay products was measured under realistic, natural conditions in different dwellings and in the open atmosphere by a single-screen technique. An improved data evaluation method was developed where the measured activities of 218 Po (RaA) and 214 Pb (RaB) were corrected by the screen-attached activities of 214 Bi ( 214 Po) [RaC (RaC')]. This method is based on the experimental observation that the 214 Bi ( 214 Po) unattached activities are negligible under realistic living conditions and that the size distributions of the aerosol-attached activities of all short-lived Rn daughters are identical. In closed rooms without additional aerosol sources, a mean unattached fraction fp of the potential alpha energy of 0.096 was obtained at a mean aerosol particle concentration of 6100 cm-3 and at a mean equilibrium factor F of 0.30. This mean fp value is about three times higher than the value used in the literature for the radiation exposure calculation of the human public. In closed rooms with additional aerosol sources (cigarette smoke, heating systems, aerosols from a burning candle), the aerosol particle concentrations ranged up to 10(6) cm-3 and the attachment rates, X, increased up to 1000 h-1. The fp values sometimes decreased below the detection limit of 0.005, and the F values increased to as high as 0.77. In the ambient atmosphere in the vicinity of Goettingen, a mean unattached fraction fp of 0.02 and a mean aerosol particle concentration of 3.4 x 10(4) cm-3 were measured at 1 m above the ground. The mean equilibrium factor F was determined to be 0.7.A
Asgar, Md Ali; Senawong, Gulsiri; Sripa, Banchob; Senawong, Thanaset
2016-01-01
Clinical application of cisplatin against cholangiocarcinoma is often associated with resistance and toxicity posing urgent demand for combination therapy. In this study, we evaluated the combined anticancer effect of cisplatin and histone deacetylase inhibitors (HDACIs), suberoylanilide hydroxamic acid (SAHA) and trichostatin A (TSA), on the cholangiocarcinoma KKU-100 and KKU-M214 cell lines. Antiproliferative activity was evaluated using MTT assay. Apoptosis induction and cell cycle arrest were analyzed by flow cytometry. Cell cycle and apoptosis regulating proteins were evaluated by western blot analysis. MTT assay showed that cisplatin, SAHA and TSA dose-dependently reduced the viability of KKU-100 and KKU-M214 cells. The combination of cisplatin and HDACIs exerted significantly more cytotoxicity than the single drugs. Combination indices below 1.0 reflect synergism between cisplatin and HDACIs, leading to positive dose reductions of cisplatin and HDACIs. Cisplatin and HDACIs alone induced G0/G1 phase arrest in KKU-100 cells, but the drug combinations increased sub-G1 percent more than either drug. However, cisplatin and HDACIs alone or in combination increased only the sub-G1 percent in KKU-M214 cells. Annexin V-FITC staining revealed that cisplatin and HDACIs combinations induced more apoptotic cell death of both KKU-100 and KKU-M214 cells than the single drug. In KKU-100 cells, growth inhibition was accompanied by upregulation of p53 and p21 and downregulation of CDK4 and Bcl-2 due to exposure to cisplatin, SAHA and TSA alone or in combination. Moreover, combination of agents exerted higher impacts on protein expression. Single agents or combination did not affect p53 expression, however, combination of cisplatin and HDACIs increased the expression of p21 in KKU-M214 cells. Taken together, cisplatin and HDACIs combination may improve the therapeutic outcome in cholangiocarcinoma patients.
Energy Technology Data Exchange (ETDEWEB)
Berico, M.; Formignani, M. [ENEA, Div. Protezione dell' Uomo e degli Ecosistemi, Centro Ricerche E. Clementel, Bologna (Italy); Mariotti, F. [Bologna Univ., Bologna (Italy). Dipt. di Fisica
2001-07-01
In the frame of the program of the Institute for Radiation Protection of ENEA, related to the evaluation of dose from radon and thoron progeny, an alpha spectrometer for the continuous air monitoring (CAM type) of radon and thoron has been realized. The constructive characteristics of the device are here presented together with energy and efficiency calibration. The device allows, by means of a screen type diffusion battery and a filter, to determinate the single radioactivity of each radionuclide of the progeny selecting them in relation to their diffusive behaviour (dichotomous particle size selection). The three-count filter method has been employed to measure the concentrations of {sup 218}Po, {sup 214}Pb and {sup 214}Bi in air. Radon and thoron effective doses using a dosimetric, instead of an epidemiologic approach, will be then evaluated. [Italian] Presso l'Istituto per la Radioprotezione, nell'ambito del programma di valutazione di dose da radon e' stato progettato e realizzato uno spettrometro alfa per il monitoraggio continuo in aria (CAM) della progenie del radon e del toron. Le caratteristiche costruttive dello strumento permettono, tramite l'utilizzo di batterie a diffusione a reti, di determinare l'attivita' individuale della progenie per diverse dimensioni granulometriche in particolare per la frazione attaccata e non al particolato amosferico con un taglio granulometrico di qualche nanometro. E' stato inoltre applicato un metodo spettrometrico a tre conteggi per il calcolo delle concentrazioni individuali della progenie del radon, {sup 218}Po, {sup 214}Pb and {sup 214}Bi, effettuando un conteggio alfa di {sup 218}Po e due conteggi alfa di {sup 214}Po. Tale informazione consentira' una valutazione della dose di radon utilizzando il modello dosimetrico in alternativa a quello epidemiologico.
A Guide for the Perspective Navy Contractor
1991-01-01
11. FAR 52.214-26, Audit -Sealed Bidding (APR 1985) (Applicable if award exceeds $100,000) 12. FAR 52.214-27, Price Reduction for Defective Cost or...services in acca . -ce itih theter_ s and conditions. (3) For progress payzents, Goer-ent arowa! shall be deenedd to have occurred on the 5the working day...the event that an audit or other review of a specific financing request is required to ensure compliance with the terms and conditions of the contract
Di Luccia, Blanda; Riccio, Antonio; Vanacore, Adele; Baccigalupi, Loredana; Molinaro, Antonio; Ricca, Ezio
2015-10-21
The ability to produce an extracellular matrix and form multicellular communities is an adaptive behavior shared by many bacteria. In Bacillus subtilis, the model system for spore-forming bacteria, matrix production is one of the possible differentiation pathways that a cell can follow when vegetative growth is no longer feasible. While in B. subtilis the genetic system controlling matrix production has been studied in detail, it is still unclear whether other spore formers utilize similar mechanisms. We report that SF214, a pigmented strain of Bacillus pumilus isolated from the marine environment, can produce an extracellular matrix relying on orthologs of many of the genes known to be important for matrix synthesis in B. subtilis. We also report a characterization of the carbohydrates forming the extracellular matrix of strain SF214. The isolation and characterization of mutants altered in matrix synthesis, pigmentation, and spore formation suggest that in strain SF214 the three processes are strictly interconnected and regulated by a common molecular mechanism.
DEFF Research Database (Denmark)
Galan-Diez, Marta; Isa, Adiba; Ponzetti, Marco
2016-01-01
of hematopoiesis and leukemogenic properties of β-catenin activation in osteoblasts, that lead to development of acute myeloid leukemia (AML). Using mice with gain-of-function (GOF) Lrp5 alleles (Lrp5(A214V)) that recapitulate the human high bone mass (HBM) phenotype, as well as patients with the T253I HBM Lrp5...... mutation, we show here that Lrp5 GOF mutations in both humans and mice do not activate β-catenin signaling in osteoblasts. Consistent with a lack of β-catenin activation in their osteoblasts, Lrp5(A214V) mice have normal trilinear hematopoiesis. In contrast to leukemic mice with constitutive activation...... of β-catenin in osteoblasts (Ctnnb1(CAosb)), accumulation of early myeloid progenitors, a characteristic of AML, myeloid-blasts in blood, and segmented neutrophils or dysplastic megakaryocytes in the bone marrow, are not observed in Lrp5(A214V) mice. Likewise, peripheral blood count analysis in HBM...
Impaired pulmonary function after treatment for tuberculosis: the end of the disease?
Chushkin, Mikhail Ivanovich; Ots, Oleg Nikolayevich
2017-01-01
ABSTRACT Objective: To evaluate the prevalence of pulmonary function abnormalities and to investigate the factors affecting lung function in patients treated for pulmonary tuberculosis. Methods: A total of 214 consecutive patients (132 men and 82 women; 20-82 years of age), treated for pulmonary tuberculosis and followed at a local dispensary, underwent spirometry and plethysmography at least one year after treatment. Results: Pulmonary impairment was present in 102 (47.7%) of the 214 patients evaluated. The most common functional alteration was obstructive lung disease (seen in 34.6%). Of the 214 patients, 60 (28.0%) showed reduced pulmonary function (FEV1 below the lower limit of normal). Risk factors for reduced pulmonary function were having had culture-positive pulmonary tuberculosis in the past, being over 50 years of age, having recurrent tuberculosis, and having a lower level of education. Conclusions: Nearly half of all tuberculosis patients evolve to impaired pulmonary function. That underscores the need for pulmonary function testing after the end of treatment. PMID:28380187
Surface deposition of 222Rn decay products with and without enhanced air motion
International Nuclear Information System (INIS)
Rudnick, S.N.; Maher, E.F.
1986-01-01
The effectiveness of fan-induced air motion in reducing airborne activities of short-lived 222 Rn decay products was evaluated in a 78.5-m3 chamber. Observed reductions were as high as 50% for 218Po (RaA), 79% for 214 Pb (RaB), and 86% for 214 Bi (RaC). Activity measurements of these nuclides on chamber and fan surfaces, along with airborne activities, were used to calculate material balances. Greater than about 90% of deposited activity was found on chamber surfaces, although areal activity densities were higher on fan surfaces. Deposition velocities for decay products not attached to particles were 2.3 mm s-1 when no fans were in operation and 9.2 to 13 mm s-1 when fans were used. Mean boundary layer thicknesses for unattached decay products were estimated to be about four times the recoil distance of a 214 Pb atom when no fans were used and about equal to the recoil distance when fans were used
Directory of Open Access Journals (Sweden)
Inderbir Singh
2011-06-01
Full Text Available OBJECTIVE: the purpose of this research was to formulate taste masked complexes of cefuroxime axetil and to evaluate them for taste, drug loading and characterized by FTIR, XRD. Tablets were formulated of selected batches and evaluated for drug release and physical parameters. METHODS: complexation technique is used to prepare complexes of drug where ion exchange resins such as Indion® 214, Indion® 234 and Indion® 414 were used with a drug-resin ratio of 1:0.5, 1:1, 1:2. The drug resinates were characterized by Infrared Spectroscopy, DSC and X-Ray Diffraction pattern and evaluated for drug loading and taste. Direct compression method was used to formulate tablets. In vitro dissolution was carried out using USP II apparatus. RESULT: potential taste masking increased with increasing concentration of resin. Indion® 214 resin showed better taste masking effect as compared to Indion® 234 and Indion® 414. Percent of drug loading was maximum at drug : resin ratio of 1:1, after that it decreased. Prolonged (upto 5 h and slow drug release was observed with resin 214 at higher concentration. CONCLUSIONS: out of three resins chosen, Indion® 214 at higher concentration exhibit excellent taste masking as well as sustained drug release action.OBJETIVO: el objetivo de esta investigación fue formular los complejos con sabor amargo de cefuroxime acetil y evaluarlos por sabor, carga medicamentosa y caracterización por FTIR, XRD. Las tabletas fueron formuladas a partir de lotes seleccionados y evaluados en busca de la liberación medicamentosa y parámetros físicos. MÉTODOS: la técnica de complejación se utilizó para preparar complejos farmacológicos donde las resinas de intercambio iónico como Indion® 214, Indion® 234 y el Indion® 414 se emplearon a una proporción resina-medicamento de 1:0.5, 1:1, 1:2. Los resinados medicamentosos fueron caracterizados mediante espectroscopia infrarroja, DSC y el patrón de difracción-rayos-X, y evaluados
Emanations and 'induced' radioactivity: from mystery to (mis)use
International Nuclear Information System (INIS)
Kolar, Z.I.
1999-01-01
The natural Rn isotopes were discovered within the period 1899-1902 and at that time referred to as emanations because they came out (emanated) of sources/materials containing actinium, thorium and radium, respectively. The (somewhat mysterious) emanations appeared to disintegrate into radioactive decay products which by depositing at solid surfaces gave rise to 'induced' radioactivity i.e. radioactive substances with various half-lives. Following the discovery of the emanations the volume of the research involving them and their disintegration products grew steeply. The identity of a number of these radioactive products was soon established. Radium emanation was soon used as a source of RaD ( 210 Pb) to be applied as an 'indicator' (radiotracer) for lead in a study on the solubility of lead sulphide and lead chromate. Moreover, radium and its emanation were introduced into the medical practice. Inhaling radon and drinking radon-containing water became an accepted medicinal use (or misuse?) of that gas. Shortly after the turn of the century, the healing (?) action of natural springs (spas) was attributed to their radium emanation, i.e. radon. Bathing in radioactive spring water and drinking it became very popular. Even today, bathing in radon-containing water is still a common medical treatment in Jachymov, Czech Republic. (author)
Study of Soil Decontamination Method Using Supercritical Carbon Dioxide and TBP
International Nuclear Information System (INIS)
Park, Jihye; Park, Kwangheon; Jung, Wonyoung
2014-01-01
The result of this study means that we have a possible new method for cheap and less wasteful nuclear waste decontamination. When severe accidents such as the incident at the Fukushima nuclear site occur, the soil near the power plant is contaminated with fission products or the activation metal structure of the power plant. The soil pollution form depends on the environment and soil characteristics of the contaminated areas. Thus, a- single-decontamination method is not effective for site cleanup. In addition, some soil decontamination methods are expensive and large amounts of secondary waste are generated. Therefore, we need new soil decontamination methods. In this study, instead of using a conventional solvent method that generates secondary waste, supercritical carbon dioxide was used to remove metal ions from the soil. Supercritical carbon dioxide is known for good permeation characteristics. We expect that we will reduce the cost of soil pollution management. Supercritical carbon dioxide can decontaminate soil easily, as it has the ability to penetrate even narrow gaps with very good moisture permeability. We used TBP, which is a known for extractant of actinium metal. TBP is usually used for uranium and strontium extraction. Using TBP-HNO 3 complex and supercritical carbon dioxide, we did extraction experiments for several heavy metals in contaminated soil
Study of Soil Decontamination Method Using Supercritical Carbon Dioxide and TBP
Energy Technology Data Exchange (ETDEWEB)
Park, Jihye; Park, Kwangheon; Jung, Wonyoung [Kyunghee Univ., Yongin (Korea, Republic of)
2014-05-15
The result of this study means that we have a possible new method for cheap and less wasteful nuclear waste decontamination. When severe accidents such as the incident at the Fukushima nuclear site occur, the soil near the power plant is contaminated with fission products or the activation metal structure of the power plant. The soil pollution form depends on the environment and soil characteristics of the contaminated areas. Thus, a- single-decontamination method is not effective for site cleanup. In addition, some soil decontamination methods are expensive and large amounts of secondary waste are generated. Therefore, we need new soil decontamination methods. In this study, instead of using a conventional solvent method that generates secondary waste, supercritical carbon dioxide was used to remove metal ions from the soil. Supercritical carbon dioxide is known for good permeation characteristics. We expect that we will reduce the cost of soil pollution management. Supercritical carbon dioxide can decontaminate soil easily, as it has the ability to penetrate even narrow gaps with very good moisture permeability. We used TBP, which is a known for extractant of actinium metal. TBP is usually used for uranium and strontium extraction. Using TBP-HNO{sub 3} complex and supercritical carbon dioxide, we did extraction experiments for several heavy metals in contaminated soil.
28 CFR 2.214 - Probable cause hearing and determination.
2010-07-01
... adverse witnesses (i.e., witnesses who have given information upon which revocation may be based) at a... confrontation. Whenever a probable cause hearing is postponed to secure the appearance of adverse witnesses (or...
48 CFR 52.214-10 - Contract Award-Sealed Bidding.
2010-10-01
... the solicitation, will be most advantageous to the Government considering only price and the price... quantity less than the quantity offered, at the unit prices offered, unless the bidder specifies otherwise in the bid. (d) A written award or acceptance of a bid mailed or otherwise furnished to the...
Electrical Experiments. VT-214-12-5. Part V. Transformers.
Connecticut State Dept. of Education, Hartford. Div. of Vocational Education.
Designed for high school electronics students, this fifth document in a series of six electrical learning activity packages focuses on transformers. An introductory section gives the objective for the activities, an introduction, and an outline of the content. The remainder of the activity book is comprised of information sheets and job sheets on…
38 CFR 21.214 - Furnishing supplies for special programs.
2010-07-01
... the veteran's farm by an individual instructor, VA will furnish to a student only those textbooks and...; and (3) Other related assistance such as business license fees. (Authority: 38 U.S.C. 3104(a)(12)) (f...
All projects related to | Page 214 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
2012-02-21
The Greater Mekong Subregion-Development Analysis Network (GMS-DAN) is a collaborative development research network of leading research institutes and think tanks in Cambodia, Laos, Thailand, and China's Yunnan province. Start Date: February 21, 2012. End Date: November 17, 2014. Topic: SOUTHEAST ASIA ...
Determination of natural occurring radionuclides concentrations
International Nuclear Information System (INIS)
Stajic, J.; Markovic, V.; Krstic, D.; Nikezic, D.
2011-01-01
Tobacco smoke contains certain concentrations of naturally occurring radionuclides from radioactive chains of uranium and thorium - 214 Pb, 214 Bi, 228 Ac, 208 Tl, 226 Ra, 232 Th and 40 K. Inhaling of tobacco smoke leads to internal exposure of man. In order to estimate absorbed dose of irradiation it is necessary to determine concentrations of radionuclides present in the tobacco leaves. In this paper specific activities of naturally occurring radionuclides were measured in tobacco samples from cigarettes which are used in Serbia. [sr
ORF Alignment: NC_006370 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ery: 155 GIALGAEDYVRDLRTQRSPEGTELLFARCSILQAARSAGIMAFDTVYSDANNEEGFIREA 214 ... GIALGAEDYVRDLRTQRSPEGTELLFARC...SILQAARSAGIMAFDTVYSDANNEEGFIREA Sbjct: 121 GIALGAEDYVRDLRTQRSPEGTELLFARCSILQAARSAGIMAFDTVYSDANNEEGFIREA 180 ...
γ-Ray spectrometry of radon in water and the role of radon to representatively sample aquifers
International Nuclear Information System (INIS)
Talha, S.A.; Lindsay, R.; Newman, R.T.; Meijer, R.J. de; Maleka, P.P.; Hlatshwayo, I.N.; Mlwilo, N.A.; Mohanty, A.K.
2008-01-01
Measurement of radon in water by γ-ray spectrometry using a HPGe detector has been investigated to determine aquifer characteristics. The radon activity concentration is determined by taking the weighted average of the concentrations derived from γ-ray lines associated with 214 Pb and 214 Bi decay. The role of accurate radon data to representatively sample aquifers was also investigated by studying a semi-cased borehole. A simplified physical model describing the change of radon concentration with the pumping time, reproduces the data and predicts the time for representative sampling of the aquifer
Energy Technology Data Exchange (ETDEWEB)
El Aassy, Ibrahim E. [Nuclear Materials Authority (Egypt); Nada, Afaf A., E-mail: afafhero_nada@yahoo.com [Faculty of Women for Arts, Science and Education (Egypt); El Galy, Mohamed M.; El Feky, Mohamed G. [Nuclear Materials Authority (Egypt); Abd El Maksoud, Thanaa M.; Talaat, Shadia M. [Faculty of Women for Arts, Science and Education (Egypt); Ibrahim, Eman M. [Nuclear Materials Authority (Egypt)
2012-06-15
The hydrometallurgy of radionuclides means getting the radioelements from the rocks into solution by leaching, getting the radionuclides from the solution by extraction process, and then precipitation of the desired elements to obtain concentrate. The follow-up of the radionuclides during these processes is the main target of this work to identify the identity of the original samples, pregnant solutions (leachates), residuals and the concentrate. Six samples were chosen to achieve this work. The leaching process was carried out under the conditions; 20-30% acid (H{sub 2}SO{sub 4}) concentration, 1:3 solid/liquid ratios, 60 min stirring time at room temperature. The activity concentrations of {sup 238}U, {sup 235}U, {sup 234}U, {sup 226}Ra, {sup 214}Pb, {sup 214}Bi, {sup 232}Th and {sup 40}K were measured in the original samples, residuals and U-concentrate (Bq/kg), and leachates (Bq/ Script-Small-L). The results indicate that, the radionuclides before {sup 226}Ra in the {sup 238}U decay series are more leachable (released) than those from {sup 226}Ra to {sup 214}Bi in the order; {sup 234}U>{sup 238}U={sup 235}U Much-Greater-Than {sup 226}Ra>{sup 214}Pb>{sup 214}Bi. {sup 232}Th and {sup 40}K are immobile under the present conditions. The radiological hazards of natural radioactivity in the original samples, leachates, residuals and U-concentrate were calculated and compared with the internationally recommended values and were found to be much higher than the world average values. - Highlights: Black-Right-Pointing-Pointer Original rocks, leachates, residuals and concentrate were studied. Black-Right-Pointing-Pointer Radionuclides concentrations were examined through different phases. Black-Right-Pointing-Pointer Radionuclides are more leachable before than that after {sup 226}Ra series. Black-Right-Pointing-Pointer Radiological hazards were compared with the international values. Black-Right-Pointing-Pointer Cautions should be taken in considerations during mining
ORF Alignment: NC_002505 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available IMFDLEDSVALREKDTARMLVFHALQHPMYQEMETVVRVNPLDSEFGIKDLNAVVRXGAK 60 ... Query: 155 GIALGAEDYVRDLRTQRSAEGIELLFARC...SILQAARAAGIMAFDTVYSDANNEEGFLREA 214 ... GIALGAEDYVRDLRTQRSAEGIELLFARCSILQAAR...AAGIMAFDTVYSDANNEEGFLREA Sbjct: 121 GIALGAEDYVRDLRTQRSAEGIELLFARCSILQAARAAGIMAFDTVYSDANNEEGFLREA 180 ...
International Nuclear Information System (INIS)
Chu, C.W.; Hor, P.H.; Lin, J.G.; Xiong, Q.; Huang, Z.J.; Meng, R.L.; Xue, Y.Y.; Jean, Y.C.
1991-01-01
The superconducting transition temperature (T c ) has been measured in YBa 2 Cu 3 O 6.7 , YBa 2 Cu 3 O 7 , Y 2 Ba 4 Cu 7 O 15 , YBa 2 Cu 4 O 8 , Tl 2 Ba 2 Ca n-1 Cu n O n+4-δ , La 2-x Sr x CuO 4 , and La 2-x Ba x CuO 4 under high pressures. The pressure effect on the positron lifetime (τ) has also been determined in the first four compounds. Based on these and other high pressure data, the authors suggest that (1) all known cuprate high temperature superconductors (HTS's) may be no more than mere modifications of either 214-T, 214-T', 123, or a combination of 214-T' and 123, (2) a nonmonotonic T c -behavior may govern the T c -variation of all hole cuprate HTS's and (3) pressure can induce charge transfer leading to a T c -change. The implications of these suggestions will also be discussed
Energy Technology Data Exchange (ETDEWEB)
Ludden, J.N.; Thompson, G.; Bryan, W.B.; Frey, F.A.
1980-08-10
Ferrobasalts from DSDP sites 214 and 216 on the Ninetyeast Ridge are characterized by high absolute iron (FeO>12.9 wt %), FeO/MgO>1.9, and TiO/sub 2/>2.0 wt %. Their trace element abundances indicate a tholeiitic affinity; however, they are distinct from midocean ridge incompatible element-depleted tholeiites owing to higher contents of Ba, Zr, and Sr and flat to slightly light-REE-enriched, chondrite-normalized REE patterns. Calculations using major and trace element abundances and phase compositions are generally consistent with a model relating most major elements and phase compositions in site 214 and 216 ferrobasalts by fractionation of clinopyroxene and plagio-class. However, some incompatible element abundances for site 216 basalts are not consistent with the fractional crystallization models. Baslats from site 214 can be related to andesitic rocks from the same site by fractionating clinopyroxene, plagioclase and titanomagnetite. Site 254 basalts, at the southern end of the Ninetyeast Ridge, and island tholeiites in the southern Indian Ocean (Amsterdam-St. Paul or Kerguelen-Heard volcanic provinces) possibly represent the most recent activity associated with a hot spot forming the Ninetyeast Ridge. These incompatible-element-enriched tholeiites have major element compositions consistent with those expected for a parental liquid for the site 214 and 216 ferrobasalts. However, differences in the trace element contents of the basalts from the Ninetyeast Ridge sites are not consistent with simple fractional crystallization derivation but require either a complex melting model or a heterogeneous mantle source.
Child Abuse and the Eye in an African Population
Adebayo, Modupe
2017-01-01
Purpose There is a paucity of data on child abuse and the eye in West Africa. Therefore, a need exists to determine the causes and circumstances surrounding these occurrences and their effects on the eye and vision in a pediatric population. Methods A 3-year study of consecutive cases of ocular features that presented to an eye clinic following a history suggestive of child abuse along with any associated eye injury was carried out. Socio-demographic characteristics were obtained, as were the presenting and posttreatment visual acuity, and a full clinical eye examination was also done. Results Fifty-six children with 56 affected eyes were examined. The male to female ratio was 1.8 : 1; the mean age was 8.25 ± 3.5 years; and the subjects were predominately primary school children 30 (53.6%). The most common ocular disorders were conjunctiva hyperemia (46.4%), corneal abrasion/ulcer (25.4%), hyphema/uveitis (42.9%), retinal detachment (7.1%), sclera rupture (7.1%), and globe perforation (21.4%). The intraocular pressure was raised in 17.9% of participants. Presenting versus posttreatment visual acuities showed normal vision in four (7.1%) vs. eighteen (32.1%), visual impairment in 12 (21.4%) vs. six (10.7%), severe visual impairment in 20 (35.7%) vs. 12 (21.4%), and blindness in 12 (21.4%) vs. 14 (25%), p corporal punishment, accidents, and assaults. Legislation and laws need to be enacted to prevent negative psychosocial and economic impacts on the child, family and country as a whole. PMID:28367043
Energy Technology Data Exchange (ETDEWEB)
Machaj, B. [Institute of Nuclear Chemistry and Technology, Warsaw (Poland)
1996-12-31
This research is aimed to develop a device for continuous monitoring of radon in the air, by measuring alpha activity of radon and its short lived decay products. The influence of alpha activity variation of radon and its daughters on the measured results is of importance and requires a knowledge of this variation with time. Employing the measurement of alpha radiation of radon and of its short lived decay products, require knowledge of radon concentration variation and its decay products against the time. A computer program in Turbo Pascal language was therefore developed performing the computations employing the known relations involved, the program being adapted for IBM PC computers. The presented program enables computation of activity of {sup 222}Rn and its daughter products: {sup 218}Po, {sup 214}Pb, {sup 214}Bi and {sup 214}Po every 1 min within the period of 0-255 min for any state of radiation equilibrium between the radon and its daughter products. The program permits also to compute alpha activity of {sup 222}Rn + {sup 218}Po + {sup 214}Po against time and the total alpha activity at selected interval of time. The results of computations are stored on the computer hard disk in ASCII format and are used a graphic program e.g. by DrawPerfect program to make diagrams. Equations employed for computation of the alpha activity of radon and its decay products as well as the description of program functions are given. (author). 2 refs, 4 figs.
Safety evaluation for packaging (onsite) SERF cask
International Nuclear Information System (INIS)
Edwards, W.S.
1997-01-01
This safety evaluation for packaging (SEP) documents the ability of the Special Environmental Radiometallurgy Facility (SERF) Cask to meet the requirements of WHC-CM-2-14, Hazardous Material Packaging and Shipping, for transfer of Type B quantities (up to highway route controlled quantities) of radioactive material within the 300 Area of the Hanford Site. This document shall be used to ensure that loading, tie down, transport, and unloading of the SERF Cask are performed in accordance with WHC-CM-2-14. This SEP is valid until October 1, 1999. After this date, an update or upgrade to this document is required
Experimental setup for radon exposure and first diffusion studies using gamma spectroscopy
Energy Technology Data Exchange (ETDEWEB)
Maier, Andreas, E-mail: a.maier@gsi.de [GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Beek, Patrick van [GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Technical University Darmstadt, Hochschulstraße 6, 64289 Darmstadt (Germany); Hellmund, Johannes [GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Durante, Marco [GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Technical University Darmstadt, Hochschulstraße 6, 64289 Darmstadt (Germany); Schardt, Dieter; Kraft, Gerhard; Fournier, Claudia [GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany)
2015-11-01
In order to measure the uptake and diffusion of {sup 222}Rn in biological material, an exposure chamber was constructed where cell cultures, biological tissues and mice can be exposed to {sup 222}Rn-activities similar to therapy conditions. After exposure, the material is transferred to a gamma spectrometer and the decay of {sup 214}Pb and {sup 214}Bi is analyzed. From the time kinetics of these decays the total amount of the initial {sup 222}Rn concentration can be calculated. In this paper the design and construction as well as first test measurements are reported.
ORF Alignment: NC_003888 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available Streptomyces coelicolor ... Length = 117 ... Query: 214 ETPVRDLMAPAAGIVAVDXX...XXXXXXXXXXXXHDRTRLLVRQEDAILGSVHARDVLVXXX 273 ... ETPVRDLMAPAAGIVAVD ... HDRTRLLVRQEDAILGSVHA...RDVLV ... Sbjct: 1 ... ETPVRDLMAPAAGIVAVDAGAEAEEILALAAAHDRTRLLVRQEDAILGSVHARDVLVARA 60 ...
Oxidation of sodium (2-14C) acetate with alkaline permanganate
International Nuclear Information System (INIS)
Zielinski, M.
1983-01-01
The mechanism and kinetics of the oxidation of sodium acetate with permanganate in alkile and neutral media have been investigated using (2- 14 C) acetate. The reaction is first order with respect to both permanganate and acetate ions. The initial second order rate constants depend linearly on the square of the hydroxide ion concentration. Arrhenius activation energy of the oxidation reaction carried out in 12M NaOH is 24.0 kcal/mole in the temperature interval of 50-100 deg C. The mechanism of the principal path leading to the oxalate formation and the mechanism of the side reaction resulting in the carbon dioxide production have been proposed and discussed. (author)
Low-frequency polarimetry of the millisecond pulsar PSR1937+214
Energy Technology Data Exchange (ETDEWEB)
Stinebring, D R [National Radio Astronomy Observatory, Charlottesville, VA (USA); Cordes, J M [Cornell Univ., Ithaca, NY (USA). Dept. of Astronomy; Cornell Univ., Ithaca, NY (USA). National Astronomy and Ionospheric Center)
1983-11-24
Polarization observations are reported at 431 MHz that have 4 ..mu..s time resolution and are free from the effects of interstellar dispersion. The interpulse polarization decreases towards lower frequencies, opposite in trend to the polarization of the main pulse and of most other pulsars. The position angles at the center of the main pulse and interpulse are approximately equal and the position angle gradients have the same sign, supporting a model in which the main pulse and interpulse are emitted above opposite magnetic poles.
23 CFR 971.214 - Federal lands congestion management system (CMS).
2010-04-01
... 23 Highways 1 2010-04-01 2010-04-01 false Federal lands congestion management system (CMS). 971... Federal lands congestion management system (CMS). (a) For purposes of this section, congestion means the...) Develop criteria to determine when a CMS is to be implemented for a specific FH; and (2) Have CMS coverage...
22 CFR 214.31 - A.I.D. Advisory Committee Representative.
2010-04-01
.... Advisory Committee Representative. (b) The designated A.I.D. employee performs functions required by section 10 of the Act and assigned herein. Such functions include: (1) Calling, or giving advance approval... Administrator; (4) Assuring that advance notices of each meeting (whether open or closed) are published in the...
48 CFR 214.407-3 - Other mistakes disclosed before award.
2010-10-01
... REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES SEALED BIDDING Opening of... Information Systems Agency: General Counsel, DISA. (iii) Defense Intelligence Agency: Principal Assistant for.... (v) National Geospatial-Intelligence Agency: General Counsel, NGA. (vi) Defense Threat Reduction...
Die skrywer. Esta Steyn. Kaapstad: Tafelberg, 2012. 214 pp. ISBN ...
African Journals Online (AJOL)
ningsromans in Duits, is die Christelike ele- mente en die humor. Die straatslim Anabella wat twee plaaswerkers aansê om nie die Here se naam te misbruik nie, toon kenmerke van die heldin in 'n Afrikaanse liefdesverhaal. Hierdie roman sal byval vind by lesers wat. Esta Steyn se vorige romans geniet het. Die humor in die ...
DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS
Energy Technology Data Exchange (ETDEWEB)
NA
2004-11-22
The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) important to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are in the form of tabulated functions with pH and log (line integral) CO{sub 2} as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. The output data from this report are fundamental inputs for Total System Performance Assessment for the License Application (TSPA-LA) to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for all of the actinides. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or otherwise addressed.
International Nuclear Information System (INIS)
Johansson, B.; Rosengren, A.
1975-01-01
A ''generalized'' phase diagram is constructed empirically for the lanthanides. This diagram makes it possible, not only in one picture, to assemble a lot of information but also to predict phase transitions not yet experimentally accessible. Further, it clearly illustrates the close relation between the members of the lanthanide group. To account for some of its features, the pseudopotential method is applied. The trend in crystal structure through the lanthanide series can thereby be qualitatively accounted for, as can the trend in crystal structure for an individual element, when compressed. A scaling procedure makes it possible to extend the treatment to elements neighboring the lanthanides in the Periodic Table. In total 25 elements are considered. An atomic parameter f (relatable to the pseudopotential) is introduced, by means of which different phase transitions, both for an individual rare-earth element and intra-rare-earth alloys, can be correlated to certain critical values of this parameter. A nonmagnetic rare-earth series (Sc, Lu, Y, La, and Ac) is introduced and the occurrence of superconductivity is discussed with special emphasis on the pressure dependence of the transition temperature. This temperature can be correlated to the above-mentioned parameter f, both for intra-rare-earth alloys and pure elements at different pressures. The correlation implies that actinium is a superconductor with a critical temperature which could be as high as (11--12) degree K
Stenson, Mary J.; Maurer, Matthew J.; Wellik, Linda E.; Link, Brian; Hege, Kristen; Dogan, Ahmet; Sotomayor, Eduardo; Witzig, Thomas; Gupta, Mamta
2015-01-01
Deregulated mRNA translation has been implicated in disease development and in part is controlled by a eukaryotic initiation complex eIF4F (composed of eIF4E, eIF4G and eIF4A). We demonstrate here that the cap bound fraction from lymphoma cells was enriched with eIF4G and eIF4E indicating that lymphoma cells exist in an activated translational state. Moreover, 77% (110/142) of diffuse large B cell lymphoma tumors expressed eIF4E and this was associated with an inferior event free survival. Over-expression of wild-type eIF4E (eIF4EWT) but not cap-mutant eIF4E (eIF4Ecap mutant) increased the activation of the eIF4F complex. Treatment with the active-site dual mTOR inhibitor CC214-1 reduced the level of the eIF4F complex by decreasing the cap bound fraction of eIF4G and increasing the levels of 4E-BP1. CC214-1 inhibited both the cap dependent and global protein translation. CC214-1 inhibited c-Myc, and cyclin D3 translation by decreasing polysomal fractions from lymphoma cells. Inhibition of eIF4E with shRNA further decreased the CC214-1 induced inhibition of the eIF4F complex, c-Myc, cyclin D3 translation, and colony formation. These studies demonstrate that the eIF4F complex is deregulated in aggressive lymphoma and that dual mTOR therapy has therapeutic potential in these patients. PMID:25839159
Energy Technology Data Exchange (ETDEWEB)
Dias, Danila Carrijo da Silva; Silva, Nivaldo Carlos da; Bonifacio, Rodrigo Leandro; Guerrero, Eder Tadeu Zenun [Comissao Nacional de Energia Nuclear (LAPOC/CNEN-MG), Pocos de Caldas, MG (Brazil). Laboratorio de Pocos de Caldas
2013-07-01
Radionuclides found in ore extraction waste materials are a great source of concern regarding public health and environmental safety. One technique to determine the concentration of substances is high resolution gamma ray spectrometry using HPGe. Validating a measurement technique is essential to warrant high levels of quality to any scientific work. The Laboratory of Pocos de Caldas of the Brazilian Commission for Nuclear Energy partakes into a Quality Management System project, seeking Accreditation under ISO/IEC 17025 through the validation of techniques of chemical and radiometric analysis of environmental samples from water, soil and sediment. The focus of the Radon Laboratory at LAPOC is validation of Ra-226, Ra-228 and Pb-210 concentration determinations in soil and sediment through a gamma spectrometer system. The stages of this validation process included sample reception and preparation, detector calibration and sample analyses. Dried samples were sealed in metallic containers and analyzed after radioactive equilibrium between Ra-226 and daughters Pb-214 and Bi-214. Gamma spectrometry was performed using CANBERRA HPGe detector and gamma spectrum software Genie 2000. The photo peaks used for Ra-226 determination were 609 keV and 1020 keV of Bi-214 and 351 keV of Pb-214. For the Ra-228 determination a photopeak of 911 keV was used from its short half-life daughter Ac-228 (T1/2 = 6.12 h). For Pb-210, the photopeak of 46.5 keV was used, which, due to the low energy, self-absorption correction was needed. Parameters such as precision, bias/accuracy, linearity, detection limit and uncertainty were evaluated for that purpose. The results have pointed to satisfying results. (author)
Massard, Christophe; Borget, Isabelle; Farace, Françoise; Aspeslagh, Sandrine; Le Deley, Marie-Cécile; Le Tourneau, Christophe; Bidard, François-Clement; Pierga, Jean-Yves; Dieras, Veronique; Hofman, Paul; Spano, Jean-Philippe; Ferte, Charles; Lacroix, Ludovic; Soria, Jean-Charles
2017-09-01
Circulating tumour cell (CTC) counting could be a new biomarker for better evaluation of tumour response to molecules tested in phase I trials. Consenting patients with advanced metastatic cancer referred to various phase I units were enrolled prospectively in this study. CTCs from 7.5 ml of whole blood drawn at baseline and after starting experimental therapy were counted using the CellSearch system, and tumour response was assessed using RECIST 1.1 criteria at baseline and 2 months after treatment initiation. Between March 2010 and May 2013, a total of 326 patients were enrolled, among whom 214 were evaluable (49% male, median age = 56; main cancer types: lung [28], colon [53], ovarian [18], breast [28]). At baseline, we detected ≥1 CTC/7.5 ml in 113/214 patients (53%), and at day 30, we observed ≥1 CTC/7.5 ml in 103/214 patients (48%). Two months after treatment initiation, 11 (5%) of the 214 patients were classified as having a partial response, with no CTCs in 9 of them or a decrease in the CTC count after therapy. In contrast, among the 104 patients (49%) classified as having progressive disease, 38 patients had a higher CTC count. The remaining 99 patients (49%), 33 of whom (33%) had a lower CTC count, were classified as having stable disease. The sensitivity and specificity of CTC variation for predicting progressive disease were 41% (32-51%) and 80% (73-88%) respectively. An early CTC change following therapy does not correlate with RECIST response in patients with advanced cancer enrolled in phase I trials. Copyright © 2017 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Dias, Danila Carrijo da Silva; Silva, Nivaldo Carlos da; Bonifacio, Rodrigo Leandro; Guerrero, Eder Tadeu Zenun
2013-01-01
Radionuclides found in ore extraction waste materials are a great source of concern regarding public health and environmental safety. One technique to determine the concentration of substances is high resolution gamma ray spectrometry using HPGe. Validating a measurement technique is essential to warrant high levels of quality to any scientific work. The Laboratory of Pocos de Caldas of the Brazilian Commission for Nuclear Energy partakes into a Quality Management System project, seeking Accreditation under ISO/IEC 17025 through the validation of techniques of chemical and radiometric analysis of environmental samples from water, soil and sediment. The focus of the Radon Laboratory at LAPOC is validation of Ra-226, Ra-228 and Pb-210 concentration determinations in soil and sediment through a gamma spectrometer system. The stages of this validation process included sample reception and preparation, detector calibration and sample analyses. Dried samples were sealed in metallic containers and analyzed after radioactive equilibrium between Ra-226 and daughters Pb-214 and Bi-214. Gamma spectrometry was performed using CANBERRA HPGe detector and gamma spectrum software Genie 2000. The photo peaks used for Ra-226 determination were 609 keV and 1020 keV of Bi-214 and 351 keV of Pb-214. For the Ra-228 determination a photopeak of 911 keV was used from its short half-life daughter Ac-228 (T1/2 = 6.12 h). For Pb-210, the photopeak of 46.5 keV was used, which, due to the low energy, self-absorption correction was needed. Parameters such as precision, bias/accuracy, linearity, detection limit and uncertainty were evaluated for that purpose. The results have pointed to satisfying results. (author)
Intercomparison of γ-spectrometry analysis of radionuclides between China and Japan in 2012–2013
International Nuclear Information System (INIS)
Zhou, Qiang; Wang, Xiaoqiang; Tuo, Fei; Han, Yanqing; Ikeuchi, Yoshihiro; Yang, Jia; Xu, Cuihua; Zhang, Jing; Li, Wenhong; Zhang, Qing; Su, Xu
2015-01-01
An intercomparison of γ-spectrometry measurement and analysis was organized by the Japan Chemical Analysis Center (JCAC), the National Institute for Radiological Protection, Chinese Center for Disease Control and Prevention (NIRP, China CDC), and the Radiation Monitoring Technical Center of Ministry of Environmental Protection, Chinese (RMTC). The main objective of this study was to assess the γ-spectrometry measurement and analysis technology. The JCAC completed the collection and preparation of soil and powdered rice samples. Three laboratories compared the measurement of seven radionuclides that included two samples of 214 Pb, 214 Bi, 208 Tl, 228 Ac, 40 K, 137 Cs, and 134 Cs with γ-spectrometry. During the studies conducted at the laboratory, the calculated value E n was found to be the total uncertainty data of the reported activity. Except 134 Cs in powdered rice sample, the calculated E n between each of the two laboratories was <1. The measurement results are acceptable except 134 Cs; therefore, measurement results in the three laboratories were consistent within a certain range except in the case of 134 Cs. Although there is a need to improve the accuracy of measurements and analysis of 134 Cs, an intercomparison was conducted of the tested levels on radionuclide analyzed in the three laboratories. - Highlights: • An intercomparison of γ-spectrometry measurement and analysis was organized. • Three laboratories compared the measurement of seven radionuclides. • Results for 40 K, 208 Tl, 214 Bi, 214 Pb, 228 Ac, and 137 Cs were well matched between two participants. • The results in the powder of the rice sample belonging to 134 Cs were the only ones assigned “not acceptable”.
Environmental radiocontamination
International Nuclear Information System (INIS)
Andrade, S.A. de.
1981-01-01
Search for and determination of 226 Ra and 210 Po in the environment are dealt with. Emphasis is given to water and atmospheric air collected in uranium mines and ore milling enclosures. It is known that natural radioactive elements of 238 U and 232 Th series are found dispersed in the environment and may cause major or minor problems in living beings. The harmful effects occur by external exposure, ingestion and inhalation. Among the most important nuclides are 226 Ra and its daughters: 222 Rn, 218 Po, 214 Pb, 214 Bi, 214 Po, 210 Bi and 210 Po, all of them belonging to the uranium series. 226 Ra and 210 Po were chosen for this search due to several important factors: their half-life; the fact that they are high-energy alpha emitters; the chemical similarity of radium and calcium which may result in bone irradiation when these elements are metabolized; and the fact that 210 Po is a chemical and radioactive toxic agent for the respiratory system. Results are compared with permissible values according to national and international radiation protection rules. (I.C.R.) [pt
Metabolism of xanthine and hypoxanthine in the tea plant (Thea sinensis L.).
Suzuki, T; Takahashi, E
1975-01-01
1. The metabolism of xanthine and hypoxanthine in excised shoot tips of tea was studied with micromolar amounts of [2(-14)C]xanthine or [8(-14)C]hypoxanthine. Almost all of the radioactive compounds supplied were utilized by tea shoot tips by 30 h after their uptake. 2. The main products of [2(-14)C]xanthine and [8(-14)C]hypoxanthine metabolism in tea shoots were urea, allantoin and allantoic acid. There was also incorporation of the label into theobromine, caffeine and RNA purine nucleotides. 3. The results indicate that tea plants can catabolize purine bases by the same pathways as animals. It is also suggested that tea plants have the ability to snythesize purine nucleotides from glycine by the pathways of purine biosynthesis de novo and from hypoxanthine and xanthine by the pathway of purine salvage. 4. The results of incorporation of more radioactivity from [8(-14)C]hypoxanthine than from [2(-14)C]xanthine into RNA purine nucleotides and caffeine suggest that hypoxanthine is a more effective precursor of caffeine biosynthesis than xanthine. The formation of caffeine from hypoxanthine is a result of nucleotide synthesis via the pathway of purine salvage. PMID:1147906
International Nuclear Information System (INIS)
Takamura, M.; Mukaida, M.; Horii, S.; Ichinose, A.; Kita, R.; Namba, M.; Awaji, S.; Watanabe, K.; Matsumoto, K.; Yoshida, Y.; Teranishi, R.; Yamada, K.; Mori, N.
2009-01-01
For a-axis oriented and c-axis in-plane aligned YBa 2 Cu 3 O 7-δ /artificial pinning center (Y123/APC) alternately-layered thin films, effects of the APC materials on the multilayer structures are discussed. Pr123, (Y 1-x Pr x )123 and Gd 2 CuO 4 (Gd214) were used as APCs. The multilayer structure was observed for Y123/Pr123 films and Y123/Gd214 films. However, some grains are also grown in the Y123/Gd214 film. For the Y123/Pr123 multilayer film, each Pr123 layer act as two-dimensional APCs (2D APCs) in the magnetic field angular dependences of the critical current density. The growth mechanism of the multilayer structure in the Y123/2D APC films is discussed by a transmission electron microscopy and an atomic force microscope. It is found that two conditions are needed to obtain the c-axis correlated pinning effects by 2D APC in the a-axis oriented and c-axis in-plane aligned Y123/APC multilayer films: the same structure as Y123; Y-free APC materials.
Assessing the deposition of radon progeny from a uranium glass necklace
International Nuclear Information System (INIS)
Hanse, M.F.; Moss, G.R.
2015-01-01
Could jewellery made from uranium glass beads pose an increased risk to skin cancer? The literature Eatough (Alpha-particle dosimetry for the basal layer of the skin and the radon progeny 218 Po and 214 Po. Phys. Med. Biol. 1997;42:1899-1911.) suggests that the alphas from the short-lived radon daughters, 218 Po and 214 Po, may reach the basal layer of the epidermis, which is believed to be important in the induction of skin cancers. The deposition of the alphas from the 218 Po and 214 Po daughters was investigated using PADC detector material. The expectation would be that no alpha particles would penetrate through the dead skin layer, assuming the average of 70 microns used in radiation protection, but the skin around the collar bone could potentially be thinner than the assumed average. It should be noticed that by inserting a slice of pig skin in between the necklace and the PADC, no great excess of alpha tracks were seen after 1 week of exposure in the freezer. There was, however, a clear signal through the pig skin from beta particles, confirming the potential of a uranium bead necklace posing a health risk. (authors)
International Nuclear Information System (INIS)
Shizuma, Kiyoshi; Wen, Xiao-qiong; Fukami, Kenji; Iwatani, Kazuo; Hamanaka, Shun-ichi
1998-01-01
A simple method for measuring radon concentration in air is presented. Airborne radon is adsorbed in a charcoal bed by an active air sampling. In time, the adsorbed radon comes to attain radioactive equilibrium with its short-lived progeny 214 Pb. Utilizing this fact, radon concentration is derived from γ-ray measurement of 214 Pb. This method is estimated to be capable of detecting radon concentration in air down to 0.79 Bq·m -3 . The adsorption coefficient obtained with the method is compared with what is obtainable with passive sampling. Applications of this method to indoor and outdoor radon measurements are described. (author)
International Nuclear Information System (INIS)
Sukhowattanakit, Jirapa; Kessaratikoon, Prasong; Udomsomporn, Suchin; Thorarit, Wutthidej
2005-10-01
The quantitative and qualitative measurement of radioactivity in 39 sand samples collected from Chalatat beach in Songkhla province are presented. Experimental results were obtained by using a high-purity germanium detector and gamma spectroscopy analysis system and comparing to the standard soil (IAEA SOIL 6) at the Office of Atoms for Peace (OAP). The measuring time of all sand samples is 10,000 seconds. Some radioisotopes such as K-40, Cs-137, Tl-208, Bi-212, Pb-212, Bi-214, Pb- 214, Ra-226 and Ac-228 were found in sand samples. In addition, the radioactivity of Ra-226 and Cs-137 in those samples were found in normal level
Measurement of radon concentration in air employing Lucas chamber
International Nuclear Information System (INIS)
Machaj, B.
1997-01-01
The results of investigations aimed to determine the main features of radon concentration gauge in air, employing 0.17 L Lucas chamber, and air sample forced by an air pump are presented. For two hour sampling and measuring cycle time the dynamic error in the worst case (first read out) equals 5 % relative to the step jump of radon concentration. This is due to the increase of activity of the decay products in the chamber. It was observed that the short lived radon decay products (Po-218, Pb-214, Bi-214) are depositing on the walls of the chamber and they are not removed by flushing the chamber with air. (author)
International Nuclear Information System (INIS)
French, D.C.; Anthony, E.Y.; Goodell, P.C.
2005-01-01
The Pena Blanca natural analog is located in the Sierra Pena Blanca, approximately 50 miles north of Chihuahua City, Mexico. The Sierra Pena Blanca is composed mainly of ash-flow tuffs, and the uranium in the region is contained in the brecciated zones of these tuffs. The Pena Blanca site is considered a natural analog to the proposed Yucca Mountain Nuclear Waste Repository because they share similar characteristics of structure, volcanic lithology, tectonic activity, and hydrologic regime. One of the mineralized zones, the Nopal I deposit, was mined in the early 1980s and the ore was stockpiled close to the mine. This stockpile area has subsequently been cleared and is referred to as the prior high-grade stockpile (PHGS) site. Soil surrounding boulders of high-grade ore associated with the PHGS site have been sampled. The purpose of this study is to characterize the transport of uranium series radioisotopes from the boulder to the soil during the past 25 years. Transport is characterized by determining the activities of individual radionuclides and daughter to parent ratios. The daughter to parent ratios are used to establish whether the samples are in secular equilibrium. Activities are determined using gamma-ray spectroscopy. Isotopes of the uranium series decay chain detected by gamma-ray spectroscopy include 210 Pb, 234 U, 234 Th, 230 Th, 226 Ra, 214 Pb, 214 Bi, and 234 Pa. Preliminary results indicate that some daughter to parent pairs appear to be in secular disequilibrium. Thorium is in excess relative to uranium, and radium is in excess relative to thorium. A deficiency appears to exist for 210 Pb relative to 214 Bi and 214 Pb. If these results are borne out by further analysis, they would suggest transport of nuclides from the high-grade boulder into its surroundings, followed by continued leaching of uranium and lead from the environment
Directory of Open Access Journals (Sweden)
Isabella Elias Burjato Raposo do Amaral
2008-03-01
Full Text Available OBJETIVO: Investigar o efeito inibitório da via eferente auditiva na variação do limiar e da latência do reflexo acústico ipsilateral com estimulação contralateral. MÉTODOS: Foram avaliados 17 pacientes entre 18 e 30 anos, com audição dentro dos padrões de normalidade submetidos à pesquisa de limiar e de latência do reflexo acústico, com e sem estimulação contralateral. RESULTADOS: Foram observadas médias de latência sem ruído contralateral para as freqüências de 500, 1000 e 2000 Hz respectivamente em 234,48, 214,96 e 236,71 milissegundos. Os valores de latência com ruído nas mesmas freqüências foram 230,74, 214,00 e 232,15 milissegundos. CONCLUSÃO: Houve diminuição da latência e aumento dos limiares do reflexo acústico quando apresentado estímulo supressor na orelha contralateral.PURPOSE: To investigate the inhibitory effect of the efferent auditory path in the variation of the threshold and the latency of ipsilateral acoustic reflex with contralateral stimulation. METHODS: Seventeen male and female patients, with ages between 18 and 30 years and with average normal hearing, were evaluated. After verification of inclusion criteria, the subjects were submitted to acoustic reflex threshold and latency testings, with and without contralateral masking. RESULTS: The latency average rates without contralateral noise at the frequencies 500 Hz, 1000 Hz and 2000 Hz were, respectively, 234,48, 214,96 and 236,71 milliseconds. The latency rates with noise at the same frequencies were 230,74, 214,00 and 232,15 milliseconds. CONCLUSION: The results showed latency decrease and increase on the acoustic reflex thresholds with contralateral white noise suppressor stimulus.
Szabó, András; Ludwig, Maren; Hegyi, Eszter; Szépeová, Renata; Witt, Heiko; Sahin-Tóth, Miklós
2015-07-10
Human chymotrypsin C (CTRC) protects against pancreatitis by degrading trypsinogen and thereby curtailing harmful intra-pancreatic trypsinogen activation. Loss-of-function mutations in CTRC increase the risk for chronic pancreatitis. Here we describe functional analysis of eight previously uncharacterized natural CTRC variants tested for potential defects in secretion, proteolytic stability, and catalytic activity. We found that all variants were secreted from transfected cells normally, and none suffered proteolytic degradation by trypsin. Five variants had normal enzymatic activity, whereas variant p.R29Q was catalytically inactive due to loss of activation by trypsin and variant p.S239C exhibited impaired activity possibly caused by disulfide mispairing. Surprisingly, variant p.G214R had increased activity on a small chromogenic peptide substrate but was markedly defective in cleaving bovine β-casein or the natural CTRC substrates human cationic trypsinogen and procarboxypeptidase A1. Mutation p.G214R is analogous to the evolutionary mutation in human mesotrypsin, which rendered this trypsin isoform resistant to proteinaceous inhibitors and conferred its ability to cleave these inhibitors. Similarly to the mesotrypsin phenotype, CTRC variant p.G214R was inhibited poorly by eglin C, ecotin, or a CTRC-specific variant of SGPI-2, and it readily cleaved the reactive-site peptide bonds in eglin C and ecotin. We conclude that CTRC variants p.R29Q, p.G214R, and p.S239C are risk factors for chronic pancreatitis. Furthermore, the mesotrypsin-like CTRC variant highlights how the same natural mutation in homologous pancreatic serine proteases can evolve a new physiological role or lead to pathology, determined by the biological context of protease function. © 2015 by The American Society for Biochemistry and Molecular Biology, Inc.
International Nuclear Information System (INIS)
Lopez I, J. F.; Rios M, C.; Mireles G, F.; Saucedo A, S.; Davila R, I.; Pinedo, J.L.
2017-09-01
The environmental radioactivity evaluation is a key point in the assessment of the environmental quality. Through this, it can be found possible radioactive contamination, locate possible Uranium and Thorium deposits and evaluate the primordial isotopes concentration due to human activities. A radioactive map of the Zacatecas State, Mexico is under construction based on in situ gamma-ray spectrometry. The present work reports the results of the multivariate statistical approximation of the measured activity data. Based on Pearson correlation, the 228 Ac and 208 Tl activities are statistically significant, while the 214 Bi and 214 Pb activities are not statistically significant. These can be due to the existence or not of secular equilibrium in the Thorium and Uranium series. (Author)
Monitoring of radon isotopes and affiliated disintegration products (ADP) in soil air and water
International Nuclear Information System (INIS)
Anshakov, O. M.; Bogacheva, E. S.; Bouchawach, Fauzi Hadji; Chudakov, V. A.
2009-01-01
The subject of research is a physic and mathematical model of the process of radon determining in soil air and water by the way of its sampling for absorbent, preparation of a sample to measurement taking, ADP radiometry: Pb- 214, Bi-214 in a sample, calculation of radon activity concentration in an initial medium. The target of research is experimental determining of assignment parameters of devices, used for radon sampling and measurement of its ADP activity in relation to the methods being developed with estimation of their expected metrological performance, analysis of radon and ADP content for ecological research in relation to objectives of radon and ADP monitoring in environmental objects. (author)
Energy Technology Data Exchange (ETDEWEB)
Machaj, B.
1997-12-31
The results of investigations aimed to determine the main features of radon concentration gauge in air, employing 0.17 L Lucas chamber, and air sample forced by an air pump are presented. For two hour sampling and measuring cycle time the dynamic error in the worst case (first read out) equals 5 % relative to the step jump of radon concentration. This is due to the increase of activity of the decay products in the chamber. It was observed that the short lived radon decay products (Po-218, Pb-214, Bi-214) are depositing on the walls of the chamber and they are not removed by flushing the chamber with air. (author). 4 refs, 19 figs, 2 tabs.
Thermal fatigue strength estimation of 2.25Cr-1Mo steel under creep-fatigue interaction
International Nuclear Information System (INIS)
Kuwahara, Kazuo; Nitta, Akihito; Kitamura, Takayuki
1980-01-01
A 2-1/4Cr-1Mo steel is one of principal materials for high temperature equipments in nuclear and thermal power plants. The authors experimentally analyzed the high temperature fatigue strength and creep strength of a 2-1/4 Cr-1Mo steel main steam pipe which had been used in a thermal plant for operation up to 130,000 hours, and pointed out that the strain-range vs. life curves crossed each other due to the difference of temperature-strain phase in thermal fatigue. This suggests that it is difficult to estimate thermal fatigue life of steel materials having been subjected to different temperature-strain phase on the basis of isothermal low-cycle fatigue life at the upper limit temperature of thermal fatigue, and that it is urgently required to establish an appropriate method of evaluating thermal fatigue life. The authors attempted to prove that the strain range partitioning method used for the evaluation of thermal fatigue life in SUS 304 steels is applicable to this 2-1/4Cr-1Mo steel. Consequently, it was found that the thermal fatigue life could be estimated within a factor of 2.5 by the application of this method. (author)
Measurements of radon concentrations at caves in Jeju
Energy Technology Data Exchange (ETDEWEB)
Go, S. H.; Kang, D. H.; Jung, B. J. [Cheju National University, Cheju (Korea, Republic of)
2004-07-01
Radon is a radioactive gas emitting {alpha} particles. It is chemically stable due to its inert characteristic. While its daughter products, {sup 218}Po, {sup 214}Bi, {sup 214}Pb and {sup 214}Po, attached with aerosol particles, is known to cause lung cancer. As radon is produced from uranium and thorium, it accumulates in poorly ventilative underground voids such as caves and mine. Radon concentrations at caves in Jeju were measured in this study. The measurements were made by setting three CR-39 detectors for 70 days at 2 {approx} 4 positions in Manjang, Hyupjae and Ssangyong caves. The radon levels of the caves spread 403.1 . 606.7 Bq/m{sup 3}. With these results, it is concluded that the Jeju caves have 6 times higher radon concentrations than ordinary house of 65.3 Bq/m{sup 3} and that they are higher than Seoul subway stations due to poor ventilation. While, the caves in Jeju have lower radon concentrations than limestone caves of Robin Hood. The radon concentration in the middle of Manjang cave is slightly higher than the action level in the work place of 500 Bq/m{sup 3} suggested by the ICRP. The measurement errors are estimated to be less than 5 % from its calibration factor.
Measurements of radon concentrations at caves in Jeju
International Nuclear Information System (INIS)
Go, S. H.; Kang, D. H.; Jung, B. J.
2004-01-01
Radon is a radioactive gas emitting α particles. It is chemically stable due to its inert characteristic. While its daughter products, 218 Po, 214 Bi, 214 Pb and 214 Po, attached with aerosol particles, is known to cause lung cancer. As radon is produced from uranium and thorium, it accumulates in poorly ventilative underground voids such as caves and mine. Radon concentrations at caves in Jeju were measured in this study. The measurements were made by setting three CR-39 detectors for 70 days at 2 ∼ 4 positions in Manjang, Hyupjae and Ssangyong caves. The radon levels of the caves spread 403.1 . 606.7 Bq/m 3 . With these results, it is concluded that the Jeju caves have 6 times higher radon concentrations than ordinary house of 65.3 Bq/m 3 and that they are higher than Seoul subway stations due to poor ventilation. While, the caves in Jeju have lower radon concentrations than limestone caves of Robin Hood. The radon concentration in the middle of Manjang cave is slightly higher than the action level in the work place of 500 Bq/m 3 suggested by the ICRP. The measurement errors are estimated to be less than 5 % from its calibration factor
Clinical characteristics and SAP scintigraphic findings in 10 patients with AGel amyloidosis.
Rowczenio, Dorota; Tennent, Glenys A; Gilbertson, Janet; Lachmann, Helen J; Hutt, David F; Bybee, Alison; Hawkins, Philip N; Gillmore, Julian D
2014-12-01
The clinical features of hereditary gelsolin (AGel) amyloidosis include corneal lattice dystrophy, distal sensorimotor, cranial neuropathy and cutis laxa. To date, four mutations of the gelsolin (GSN) gene encoding the following variants have been identified as the cause of this malady; p.D214N, p.D214Y, p.G194R and p.N211K (this nomenclature includes the 27-residue signal peptide). Interestingly, the latter two variants are associated exclusively with a renal amyloidosis phenotype. Here we report the clinical features in 10 patients with AGel amyloidosis associated with the p.D214N mutation, all of whom underwent whole body (123)I-SAP scintigraphy and were followed up in a single UK Centre for a prolonged period. Two patients, from the same kindred presented with proteinuria; eight subjects had a characteristic AGel amyloidosis phenotype including cranial neuropathy and/or corneal lattice dystrophy. (123)I-SAP scintigraphy revealed substantial renal amyloid deposits in all 10 patients, including those with preserved renal function, and usually without tracer uptake into other visceral organs. (123)I-SAP scintigraphy is a non-invasive technique that aids early diagnosis of patients with this rare disease, especially those who lack a family history and/or present with an unusual clinical phenotype.
Radionuclide characterization of environmental air around nuclear facilities
International Nuclear Information System (INIS)
Gede Sutresna Wijaya; Anung Muharini
2015-01-01
Air is an important environmental component in human life. Presence of air pollutants or contaminants will have a negative impact on human health. According to the existence of a nuclear facility in Yogyakarta, the characterization of radionuclides in the air is absolutely necessary to ensure the safety of people and the environment and also to supervise the safe operation of the facility. In this research the characterization of radionuclides in the air was carried through the air sampling by using High Volume Air Sampler equipped with filter TFA 2133, followed by analysis using combination of a gamma and alpha spectrometers. The concentration of radioactivity in the air fluctuates depending on the time and duration of sampling. Characterization of gamma emitting radionuclides in the air is dominated by radon progeny radionuclides such as 214 Pb, 214 Bi with activity 20.09 ± 1.23 until 32.91 ± 4.87 Bq/m 3 and 31.22 ± 1.76 until 44.25 ± 4.91 Bq/m 3 . Alpha emitter radionuclide was dominated by 214 Po (7.69 MeV) which is also radon progeny and a primordial radionuclides. It can be concluded that the presence of radionuclides in the environmental air not as a product resulting from the operation of nuclear facilities in Yogyakarta. (author)
2012-02-29
... Henning, Office of Transportation and Air Quality, National Vehicle and Fuel Emissions Laboratory... number: 734-214- 4958; email address: henning[email protected] . SUPPLEMENTARY INFORMATION: How can I access...
Moskvas algab tagaselja protsess Berezovski üle / Igor Taro
Taro, Igor
2007-01-01
Vene poliitemigranti, Suurbritanniast asüüli palunud Boriss Berezovskit süüdistatakse lennukompaniist Aeroflot 214 miljoni rubla varastamises ning rahapesus, kriminaalasja eelistung algab juulis. Lisa: Aerofloti saaga
The incorporation of 2-[14C]glycine into porcine lens protein
International Nuclear Information System (INIS)
Lee, Y.B.; Kauffman, R.G.; DeVenecia, G.
1977-01-01
A series of experiments was conducted to estimate the apparent turnover rate of lens soluble protein, the incorporation rate of 2-[ 14 C]glycine into various soluble protein components and the effect of nutritional stress on the disappearance of radioactivity with time. Evidence is presented that there are two fractions of soluble lens protein with different turnover rates: one is a fast turnover fraction with a half-life of 20.8 hr and the other is a metabolically inert fraction with an infinitely long half-life. It is postulated that the fast turnover fraction is present in the newly-formed younger fibers in the periphery, whereas the inert fraction is in the old lens fibers of the cortex and nucleus. Sephadex G-200 column chromatography was used to separate the soluble lens protein into four components: A, B, C and D in the order of elution. The changes in specific activities of the four components with the time course after injection were followed. Prolonged starvation did not affect the disappearance of carbon incorporated into lens protein with the time course after injection, suggesting normal synthesis and degradation of lens protein without regard to dietary stress. (author)
49 CFR 214.337 - On-track safety procedures for lone workers.
2010-10-01
...-track equipment is not impaired by background noise, lights, precipitation, fog, passing trains, or any... performing routine inspection or minor correction may use individual train detection to establish on-track... worker retains an absolute right to use on-track safety procedures other than individual train detection...
48 CFR 52.214-22 - Evaluation of Bids for Multiple Awards.
2010-10-01
... will be evaluated on the basis of advantages and disadvantages to the Government that might result from... $500 would be the administrative cost to the Government for issuing and administering each contract... result in the lowest aggregate cost to the Government, including the assumed administrative costs. (End...
Electrical Experiments. VT-214-12-1. Part I. Electric Motor Control.
Connecticut State Dept. of Education, Hartford. Div. of Vocational Education.
Designed for high school electronics students, this first document in a series of six electrical learning activity packages focuses on electric motor control. An introductory section gives the objective for the activities, an introduction, and an outline of the content. The remainder of the activity book is comprised of information sheets and job…
Cavitation erosion resistance of 13/4 and 21-4-N steels
Indian Academy of Sciences (India)
small change in the operating efficiency can be very expensive. ... The samples for cavitation erosion tests were cut by diamond cutter of 10 × 10 × .... in which it has been reported that the graphite inclusions provide the required crack initiation.
Role of apical oxygen in 2-1-4 electron-doped superconductors
Czech Academy of Sciences Publication Activity Database
Richard, P.; Riou, G.; Jandl, S.; Poirier, M.; Furnier, P.; Nekvasil, Vladimír; Diviš, M.
408-410, - (2004), s. 830-831 ISSN 0921-4534 R&D Projects: GA ČR GA202/03/0552 Institutional research plan: CEZ:AV0Z1010914 Keywords : Nd 2-x Ce x CuO 4 * crystal-field * apical oxygen * HTSC Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 1.072, year: 2004
47 CFR 63.09 - Definitions applicable to international Section 214 authorizations.
2010-10-01
... telecommunications services offered to the public in that country within the meaning of the International... carriers are parties to, or the beneficiaries of, a contractual relation (e.g., a joint venture or market alliance) affecting the provision or marketing of international basic telecommunications services in the...
10 CFR 72.214 - List of approved spent fuel storage casks.
2010-01-01
... STORAGE OF SPENT NUCLEAR FUEL, HIGH-LEVEL RADIOACTIVE WASTE, AND REACTOR-RELATED GREATER THAN CLASS C... Systems, Inc. SAR Title: Topical Safety Analysis Report for the Castor V/21 Cask Independent Spent Fuel... Title: Topical Safety Analysis Report for the NAC Storage/Transport Cask for Use at an Independent Spent...
33 CFR 110.214 - Los Angeles and Long Beach harbors, California.
2010-07-01
... Angeles Harbor). A circular area with a radius of 400 yards (approximately 366 meters), centered in... 400 Transportation Corridor. (C) Outer Harbor: The western boundary of Commercial Anchorage B. (2... Thence along a line described as an arc, radius of 460 meters (approximately 1509 feet) centered on 33...
Role of apical oxygen in 2-1-4 electron-doped superconductors
Energy Technology Data Exchange (ETDEWEB)
Richard, P.; Riou, G.; Jandl, S.; Poirier, M.; Fournier, P.; Nekvasil, V.; Divis, M
2004-08-01
We report a crystal-field infrared transmission and Raman study of oxygenated and reduced Nd{sub 2-x}Ce{sub x}CuO{sub 4} single crystals. Some Nd{sup 3+} crystal-field absorption bands corresponding to rare-earth ions in non-regular sites are attributed to Nd{sup 3+} ions in the vicinity of apical oxygens. This is correlated with a study of the A{sup *} ({approx}580 cm{sup -1}) Raman local mode and with the transport properties of undoped materials. We show that the apical oxygen is not removed by the reduction.
49 CFR 1248.101 - Commodity codes required.
2010-10-01
... oils. 2095 Roasted coffee, including instant coffee. 2096 Shortening, table oils, margarine and other... noodles. 21 Tobacco Products: 211 Cigarettes. 212 Cigars. 213 Chewing and Smoking Tobacco and Snuff. 214...
2010-08-16
... Storage Casks: MAGNASTOR System, Revision 1, Confirmation of Effective Date AGENCY: Nuclear Regulatory... spent fuel storage regulations at 10 CFR 72.214 to revise the MAGNASTOR System listing to include...
Full Text Available ... Health Administration 7,915 views 4:50 Managing Stress with the Moving Forward App: An ... Maintaining Your Weight Management Efforts - Duration: 0:56. Veterans Health Administration 214 ...
Ecosystem models (a bibliography with abstracts). Report for 1964-Nov 1975
International Nuclear Information System (INIS)
Harrison, E.A.
1975-11-01
The bibliography contains abstracts which cover marine biology, natural resources, wildlife, plants, water pollution, microorganisms, food chains, radioactive substances, limnology, and diseases as related to ecosystem models. Contains 214 abstracts
Selective Decontamination Effect of Metal Ions in Soil Using Supercritical CO2 and TBP Complex
International Nuclear Information System (INIS)
Park, Jihye; Park, Kwangheon; Jung, Wonyoung
2014-01-01
Decontamination of soil pollution is difficult because the type of contamination largely depends on the characteristics of the pollutant and the area. Also, existing soil decontamination methods generate large quantities of secondary waste and additional process costs. For this reason, new decontamination methods are always under active investigation. A method involving the use of supercritical carbon dioxide with excellent permeability in place of chemical solvents is currently being studied. Unlike other heavy metals in fission products, uranium is used as fuel, and must be handled carefully. Therefore, in this paper, we studied a supercritical carbon dioxide method for decontaminating heavy metal ions in soil using tri-n-butyl phosphate(TBP), which is well known as a ligand for the extraction of metal ions of actinium. We investigated the decontamination effect of heavy metal ions in the soil using TBP-HNO 3 Complex and supercritical carbon dioxide. The study results showed that when heavy metals in soil are extracted using supercritical carbon dioxide, the extraction efficiency is different according to the type of pollutant metal ions in the soil. When TBP-HNO 3 Complex is used with an extractant, uranium extraction is very effective, but lithium, strontium, and cesium extraction is not effective. Therefore, in the case of a mixture of uranium and other metals such as lithium, strontium, cesium, and so on in soil contaminated by fission product leaks from nuclear power plants, we can selectively decontaminate uranium with supercritical carbon dioxide and TBP-HNO 3 Complex
Alpha-emitting nuclides in the marine environment
Pentreath, R. J.
1984-06-01
The occurrence of alpha-emitting nuclides and their daughter products in the marine environment continues to be a subject of study for many reasons. Those nuclides which occur naturally, in the uranium, thorium and actinium series, are of interest because of their value in determining the rates of geological and geochemical processes in the oceans. Studies of them address such problems as the determination of rates of transfer of particulate matter, deposition rates, bioturbation rates, and so on. Two of the natural alpha-series nuclides in which a different interest has been expressed are 210Po and 226Ra, because their concentrations in marine organisms are such that they contribute to a significant fraction of the background dose rates sustained both by the organisms themselves and by consumers of marine fish and shellfish. To this pool of naturally-occurring nuclides, human activities have added the transuranium nuclides, both from the atmospheric testing of nuclear devices and from the authorized discharges of radioactive wastes into coastal waters and the deep sea. Studies have therefore been made to understand the chemistry of these radionuclides in sea water, their association with sedimentary materials, and their accumulation by marine organisms, the last of these being of particular interest because the transuranics are essentially "novel" elements to the marine fauna and flora. The need to predict the long-term behaviour of these nuclides has, in turn, stimulated research on those naturally-occurring nuclides which may behave in a similar manner.
Determination of radium in water
International Nuclear Information System (INIS)
Hohorst, F.A.; Huntley, M.W.; Hartenstein, S.D.
1995-10-01
These detailed work instructions (DWIs) are tailored for the analysis of radium-226 and radium-228 in drinking water supplies from ground water and surface water sources and composites derived from them. The instructions have been adapted from several sources, including a draft EPA method. One objective was to minimize the generation of mixed wastes. Quantitative determinations of actinium-228 are made at 911 keV. The minimum detection level (MDL) for the gamma spectrometric measurements at this energy vary with matrix, volume, geometry, detector, background, and counting statistics. The range of MDL's for current detectors is 0.07 to 0.5 Bq/sample. Quantitative determinations of radium-226 are made by counting the high energy alpha particles which radium-226 progeny emit using liquid scintillation counting (LSC). The minimum detectable activity (MDA) is 3.8 E-3 Bq/sample. The maximum concentration which may be counted on available instruments without dilution is about 2 E + 5 Bq/sample. Typically, this determination of radium in a 2 L sample has a yield of 80%. If radium-228 is determined using a 16 h count after 50 h grow-in, the typical MDL is 1 E-9 to 8 E-9 μCi/mL (1 to 8 pCi/L). If radium-226 is determined using a 2.5 h count after 150 h grow-in, the typical MDA is about 1 E-10 μCi/mL (0. 1 pCi/L)
Mitigation of radiation nephropathy after internal α-particle irradiation of kidneys
International Nuclear Information System (INIS)
Jaggi, Jaspreet Singh; Seshan, Surya V.; McDevitt, Michael R.; Sgouros, George; Hyjek, Elizabeth; Scheinberg, David A.
2006-01-01
Purpose: Internal irradiation of kidneys as a consequence of radioimmunotherapy, radiation accidents, or nuclear terrorism can result in radiation nephropathy. We attempted to modify pharmacologically, the functional and morphologic changes in mouse kidneys after injection with the actinium ( 225 Ac) nanogenerator, an in vivo generator of α- and β-particle emitting elements. Methods and Materials: The animals were injected with 0.35 μCi of the 225 Ac nanogenerator, which delivers a dose of 27.6 Gy to the kidneys. Then, they were randomized to receive captopril (angiotensin-converting enzyme inhibitor), L-158,809 (angiotensin II receptor-1 blocker), spironolactone (aldosterone receptor antagonist), or a placebo. Results: Forty weeks after the 225 Ac injection, the placebo-control mice showed a significant increase in blood urea nitrogen (BUN) (87.6 ± 6.9 mg/dL), dilated Bowman spaces, and tubulolysis with basement membrane thickening. Captopril treatment accentuated the functional (BUN 119.0 ± 4.0 mg/dL; p <0.01 vs. placebo controls) and histopathologic damage. In contrast, L-158,809 offered moderate protection (BUN 66.6 ± 3.9 mg/dL; p = 0.02 vs. placebo controls). Spironolactone treatment, however, significantly prevented the development of histopathologic and functional changes (BUN 31.2 ± 2.5 mg/dL; p <0.001 vs. placebo controls). Conclusions: Low-dose spironolactone and, to a lesser extent, angiotensin receptor-1 blockade can offer renal protection in a mouse model of internal α-particle irradiation
Selective alpha-particle mediated depletion of tumor vasculature with vascular normalization.
Directory of Open Access Journals (Sweden)
Jaspreet Singh Jaggi
2007-03-01
Full Text Available Abnormal regulation of angiogenesis in tumors results in the formation of vessels that are necessary for tumor growth, but compromised in structure and function. Abnormal tumor vasculature impairs oxygen and drug delivery and results in radiotherapy and chemotherapy resistance, respectively. Alpha particles are extraordinarily potent, short-ranged radiations with geometry uniquely suitable for selectively killing neovasculature.Actinium-225 ((225Ac-E4G10, an alpha-emitting antibody construct reactive with the unengaged form of vascular endothelial cadherin, is capable of potent, selective killing of tumor neovascular endothelium and late endothelial progenitors in bone-marrow and blood. No specific normal-tissue uptake of E4G10 was seen by imaging or post-mortem biodistribution studies in mice. In a mouse-model of prostatic carcinoma, (225Ac-E4G10 treatment resulted in inhibition of tumor growth, lower serum prostate specific antigen level and markedly prolonged survival, which was further enhanced by subsequent administration of paclitaxel. Immunohistochemistry revealed lower vessel density and enhanced tumor cell apoptosis in (225Ac-E4G10 treated tumors. Additionally, the residual tumor vasculature appeared normalized as evident by enhanced pericyte coverage following (225Ac-E4G10 therapy. However, no toxicity was observed in vascularized normal organs following (225Ac-E4G10 therapy.The data suggest that alpha-particle immunotherapy to neovasculature, alone or in combination with sequential chemotherapy, is an effective approach to cancer therapy.
Determination of radium in water
Energy Technology Data Exchange (ETDEWEB)
Hohorst, F.A.; Huntley, M.W.; Hartenstein, S.D.
1995-10-01
These detailed work instructions (DWIs) are tailored for the analysis of radium-226 and radium-228 in drinking water supplies from ground water and surface water sources and composites derived from them. The instructions have been adapted from several sources, including a draft EPA method. One objective was to minimize the generation of mixed wastes. Quantitative determinations of actinium-228 are made at 911 keV. The minimum detection level (MDL) for the gamma spectrometric measurements at this energy vary with matrix, volume, geometry, detector, background, and counting statistics. The range of MDL`s for current detectors is 0.07 to 0.5 Bq/sample. Quantitative determinations of radium-226 are made by counting the high energy alpha particles which radium-226 progeny emit using liquid scintillation counting (LSC). The minimum detectable activity (MDA) is 3.8 E-3 Bq/sample. The maximum concentration which may be counted on available instruments without dilution is about 2 E + 5 Bq/sample. Typically, this determination of radium in a 2 L sample has a yield of 80%. If radium-228 is determined using a 16 h count after 50 h grow-in, the typical MDL is 1 E-9 to 8 E-9 {mu}Ci/mL (1 to 8 pCi/L). If radium-226 is determined using a 2.5 h count after 150 h grow-in, the typical MDA is about 1 E-10 {mu}Ci/mL (0. 1 pCi/L).
International Nuclear Information System (INIS)
Ferreira, F.S.; Lira, M.B.; Souza, E.M.; França, E.J.
2017-01-01
The natural radioactive isotopes come from the radioactive series of the 238 U (Uranium Series), the 235 U (Actinium Series) and the 232 Th (Thorium Series) series, or they can occur in isolation as is the case with the 40 K. Primordial radionuclides such as 40 K, 232 Th, 235 U and 238 U exist since the formation of the earth, being found in appreciable amounts in nature and in some cases may present a mass activity above the acceptable of environmental radiation. The objective of this work was to evaluate the mass activity of 40 K, 226 Ra and 228 Ra in the soils of a fragment of Atlantic Forest under ecological restoration process located in the Municipality of Paulista, PE, Brazil. Soil samples (0 - 15 cm) were collected under the projection of the treetops of the most abundant trees in the region. After drying and comminution, analytical portions of 40 g were transferred to polyethylene petri dishes, sealed and stored for 30 days to ensure secular equilibrium. Radioactivity was quantified by High Resolution Gamma Spectrometry - EGAR. The mean physical activities of 40 K, 226 Ra and 228 Ra were 12, 15 and 20 Bq kg -1 , respectively, for the surface soil of the Parque Natural Municipal Mata do Frio. The values found were lower than those found in mangroves in the state of Pernambuco and those considered normal for soils worldwide
Safety evaluation for packaging (onsite) plutonium recycle test reactor graphite cask
Energy Technology Data Exchange (ETDEWEB)
Romano, T.
1997-09-29
This safety evaluation for packaging (SEP) provides the evaluation necessary to demonstrate that the Plutonium Recycle Test Reactor (PRTR) Graphite Cask meets the requirements of WHC-CM-2-14, Hazardous Material Packaging and Shipping, for transfer of Type B, fissile, non-highway route controlled quantities of radioactive material within the 300 Area of the Hanford Site. The scope of this SEP includes risk, shieldling, criticality, and.tiedown analyses to demonstrate that onsite transportation safety requirements are satisfied. This SEP also establishes operational and maintenance guidelines to ensure that transport of the PRTR Graphite Cask is performed safely in accordance with WHC-CM-2-14. This SEP is valid until October 1, 1999. After this date, an update or upgrade to this document is required.
Safety evaluation for packaging (onsite) plutonium recycle test reactor graphite cask
International Nuclear Information System (INIS)
Romano, T.
1997-01-01
This safety evaluation for packaging (SEP) provides the evaluation necessary to demonstrate that the Plutonium Recycle Test Reactor (PRTR) Graphite Cask meets the requirements of WHC-CM-2-14, Hazardous Material Packaging and Shipping, for transfer of Type B, fissile, non-highway route controlled quantities of radioactive material within the 300 Area of the Hanford Site. The scope of this SEP includes risk, shieldling, criticality, and.tiedown analyses to demonstrate that onsite transportation safety requirements are satisfied. This SEP also establishes operational and maintenance guidelines to ensure that transport of the PRTR Graphite Cask is performed safely in accordance with WHC-CM-2-14. This SEP is valid until October 1, 1999. After this date, an update or upgrade to this document is required
Energy Technology Data Exchange (ETDEWEB)
Lopez I, J. F.; Rios M, C.; Mireles G, F.; Saucedo A, S.; Davila R, I.; Pinedo, J.L., E-mail: fernandolf498@gmail.com [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Cipres No. 10, Fracc. La Penuela, 98060 Zacatecas, Zac. (Mexico)
2017-09-15
The environmental radioactivity evaluation is a key point in the assessment of the environmental quality. Through this, it can be found possible radioactive contamination, locate possible Uranium and Thorium deposits and evaluate the primordial isotopes concentration due to human activities. A radioactive map of the Zacatecas State, Mexico is under construction based on in situ gamma-ray spectrometry. The present work reports the results of the multivariate statistical approximation of the measured activity data. Based on Pearson correlation, the {sup 228}Ac and {sup 208}Tl activities are statistically significant, while the {sup 214}Bi and {sup 214}Pb activities are not statistically significant. These can be due to the existence or not of secular equilibrium in the Thorium and Uranium series. (Author)
Determination of radon concentration in soil gas by gamma-ray spectrometry of olive oil
International Nuclear Information System (INIS)
Al-Azmi, Darwish; Karunakara, N.
2007-01-01
Measurements of radon concentration in soil gas have been carried out using a bubbling system in which the soil gas is drawn through an active pumping to bubble a liquid absorber (olive oil) for the deposition of the soil gas in it. After the bubbling process, the absorber is then taken for gamma-ray measurements. Gamma-ray photopeaks from the 214 Pb and the 214 Bi radon progeny are considered for the detection of the 222 Rn gas to study the concentration levels for radon soil gas. Results for some field measurements were obtained and compared with results obtained using AlphaGuard radon gas monitor. The technique provides a possible approach for the measurements of radon soil gas with gamma-ray spectrometry