WorldWideScience

Sample records for actinium 212

  1. Extraction of actinium with di-(2-ethylhexyl)phosphoric acid from hydrochloric and nitric acid solutions

    The extraction of actinium with HDEHP from Cl- and NO3- systems has been investigated. It was found that extraction of actinium from HCl solutions is much better than from HNO3 solutions. Stability constants of actinium complexes Ac(X-)+2 with Cl- and NO3- ligands were determined. Our results show that the actinium formed less stable complexes with Cl- than with NO3- ligands. 5 refs., 3 figs., 1 tab. (author)

  2. The sorption of polonium, actinium and protactinium onto geological materials

    This paper describes a combined experimental and modeling program of generic sorption studies to increase confidence in the performance assessment for a potential high-level radioactive waste repository in Japan. The sorption of polonium, actinium and protactinium onto geological materials has been investigated. Sorption of these radioelements onto bentonite, tuff and granodiorite from equilibrated de-ionized water was studied under reducing conditions at room temperature. In addition, the sorption of actinium and protactinium was investigated at 60 C. Thermodynamic chemical modeling was carried out to aid interpretation of the results

  3. 48 CFR 212.212 - Computer software.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Computer software. 212.212... Acquisition of Commercial Items 212.212 Computer software. (1) Departments and agencies shall identify and... technology development), opportunities for the use of commercial computer software and other...

  4. Discovery of the actinium, thorium, protactinium, and uranium isotopes

    Fry, C; Thoennessen, M

    2012-01-01

    Currently, 31 actinium, 31 thorium, 28 protactinium, and 23 uranium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  5. Separation of Actinium 227 from the uranium minerals

    The purpose of this work was to separate Actinium 227, whose content is 18%, from the mineral carnotite found in Gomez Chihuahua mountain range in Mexico. The mineral before processing is is pre-concentrated and passed, first through anionic exchange resins, later the eluate obtained is passed through cationic resins. The resins were 20-50 MESH QOWEX and 100-200 MESH 50 X 8-20 in some cased 200-400 MESH AG 50W-X8, 1X8 in other cases. The eluates from the ionic exchange were electrodeposited on stainless steel polished disc cathode and platinum electrode as anode; under a current ODF 10mA for 2.5 to 5 hours and of 100mA for .5 of an hour. it was possible to identify the Actinium 227 by means of its descendents, TH-227 and RA-223, through alpha spectroscopy. Due to the radiochemical purity which the electro deposits were obtained the Actinium 227 was low and was not quantitatively determined. A large majority of the members of the natural radioactive series 3 were identified and even alpha energies reported in the literature with very low percentages of non-identified emissions were observed. We conclude that a more precise study is needed concerning ionic exchange and electrodeposit to obtain an Actinium 227 of radiochemical purity. (Author)

  6. Spectroscopic and computational investigation of actinium coordination chemistry.

    Ferrier, Maryline G; Batista, Enrique R; Berg, John M; Birnbaum, Eva R; Cross, Justin N; Engle, Jonathan W; La Pierre, Henry S; Kozimor, Stosh A; Lezama Pacheco, Juan S; Stein, Benjamin W; Stieber, S Chantal E; Wilson, Justin J

    2016-01-01

    Actinium-225 is a promising isotope for targeted-α therapy. Unfortunately, progress in developing chelators for medicinal applications has been hindered by a limited understanding of actinium chemistry. This knowledge gap is primarily associated with handling actinium, as it is highly radioactive and in short supply. Hence, Ac(III) reactivity is often inferred from the lanthanides and minor actinides (that is, Am, Cm), with limited success. Here we overcome these challenges and characterize actinium in HCl solutions using X-ray absorption spectroscopy and molecular dynamics density functional theory. The Ac-Cl and Ac-OH2O distances are measured to be 2.95(3) and 2.59(3) Å, respectively. The X-ray absorption spectroscopy comparisons between Ac(III) and Am(III) in HCl solutions indicate Ac(III) coordinates more inner-sphere Cl(1-) ligands (3.2±1.1) than Am(III) (0.8±0.3). These results imply diverse reactivity for the +3 actinides and highlight the unexpected and unique Ac(III) chemical behaviour. PMID:27531582

  7. Production of high-purity radium-223 from legacy actinium-beryllium neutron sources.

    Soderquist, Chuck Z; McNamara, Bruce K; Fisher, Darrell R

    2012-07-01

    Radium-223 is a short-lived alpha-particle-emitting radionuclide with potential applications in cancer treatment. Research to develop new radiopharmaceuticals employing (223)Ra has been hindered by poor availability due to the small quantities of parent actinium-227 available world-wide. The purpose of this study was to develop innovative and cost-effective methods to obtain high-purity (223)Ra from (227)Ac. We obtained (227)Ac from two surplus actinium-beryllium neutron generators. We retrieved the actinium/beryllium buttons from the sources and dissolved them in a sulfuric-nitric acid solution. A crude actinium solid was recovered from the solution by coprecipitation with thorium fluoride, leaving beryllium in solution. The crude actinium was purified to provide about 40 milligrams of actinium nitrate using anion exchange in methanol-water-nitric acid solution. The purified actinium was then used to generate high-purity (223)Ra. We extracted (223)Ra using anion exchange in a methanol-water-nitric acid solution. After the radium was separated, actinium and thorium were then eluted from the column and dried for interim storage. This single-pass separation produces high purity, carrier-free (223)Ra product, and does not disturb the (227)Ac/(227)Th equilibrium. A high purity, carrier-free (227)Th was also obtained from the actinium using a similar anion exchange in nitric acid. These methods enable efficient production of (223)Ra for research and new alpha-emitter radiopharmaceutical development. PMID:22697483

  8. Radium, thorium, and actinium extraction from seawater using an improved manganese-oxide-coated fiber

    Laboratory experiments were conducted to determine the efficiency with which improved manganese-oxide-coated acrylic fibers extract radium, thorium, and actinium from seawater. Tests were made using surface seawater spiked with 227Ac, 227Th and 223Ra. For sample volumes of approximately 30 liters and flow rates up to 0.5 liters per minute, radium and actinium are removed quantitatively. Approximately 80-95% of the thorium is removed under these same conditions. (Auth.)

  9. Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232

    Harvey, James T.; Nolen, Jerry; Vandergrift, George; Gomes, Itacil; Kroc, Tom; Horwitz, Phil; McAlister, Dan; Bowers, Del; Sullivan, Vivian; Greene, John

    2011-12-30

    The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces {approx}100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 Ge

  10. Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232

    The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces ∼100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 GeV protons

  11. Comment: 212 [Taxonomy Icon

    Full Text Available Oryzias javanicus Oryzias javanicus Oryzias_javanicus_L.png 212.png Kiyoshi Naruse ...(National Institute for Basic Biology) licensed under CC Attribution2.1 Japan ジャワメダカ (Oryzias javanicus) インド

  12. Neutron-Induced Fission of Actinium-227, Protactinium-231 and Neptunium-237: Mass Distribution

    Results of radiochemical studies on the mass distribution in the neutron-induced fission of actinium-227, protactinium-231 and neptunium-237 have been presented. This work has been carried out as part of a programme to determine the mass distribution in the fission of heavy elements as a function of Z and A. All irradiations have been carried out in the core of the swimming-pool type reactor APSARA with cadmium shielding wherever necessary. Relative yields of several fission product nuclides have been obtained by a method involving a comparison of the fission product activities from the respective targets with those formed from uranium-235 simultaneously irradiated. Thermal-neutron fission yields of uranium-235 have been assumed. These results indicate a predominantly asymmetric mass distribution in all the three cases, and also a distinct though small symmetric peak in the case of actinium-227. (author)

  13. A new method for the determination of low-level actinium-227 in geological samples

    We developed a new method for the determination of 227Ac in geological samples. The method uses extraction chromatographic techniques and alpha-spectrometry and is applicable for a range of natural matrices. Here we report on the procedure and results of the analysis of water (fresh and seawater) and rock samples. Water samples were acidified and rock samples underwent total dissolution via acid leaching. A DGA (N,N,N',N'-tetra-n-octyldiglycolamide) extraction chromatographic column was used for the separation of actinium. The actinium fraction was prepared for alpha spectrometric measurement via cerium fluoride micro-precipitation. Recoveries of actinium in water samples were 80 ± 8 % (number of analyses n = 14) and in rock samples 70 ± 12 % (n = 30). The minimum detectable activities (MDA) were 0.017-0.5 Bq kg-1 for both matrices. Rock sample 227Ac activities ranged from 0.17 to 8.3 Bq kg-1 and water sample activities ranged from below MDA values to 14 Bq kg-1of 227Ac. From the analysis of several standard rock and water samples with the method we found very good agreement between our results and certified values. (author)

  14. Analysis of the gamma spectra of the uranium, actinium, and thorium decay series

    Momeni, M.H.

    1981-09-01

    This report describes the identification of radionuclides in the uranium, actinium, and thorium series by analysis of gamma spectra in the energy range of 40 to 1400 keV. Energies and absolute efficiencies for each gamma line were measured by means of a high-resolution germanium detector and compared with those in the literature. A gamma spectroscopy method, which utilizes an on-line computer for deconvolution of spectra, search and identification of each line, and estimation of activity for each radionuclide, was used to analyze soil and uranium tailings, and ore.

  15. Analysis of the gamma spectra of the uranium, actinium, and thorium decay series

    This report describes the identification of radionuclides in the uranium, actinium, and thorium series by analysis of gamma spectra in the energy range of 40 to 1400 keV. Energies and absolute efficiencies for each gamma line were measured by means of a high-resolution germanium detector and compared with those in the literature. A gamma spectroscopy method, which utilizes an on-line computer for deconvolution of spectra, search and identification of each line, and estimation of activity for each radionuclide, was used to analyze soil and uranium tailings, and ore

  16. In-source laser spectroscopy developments at TRILIS—towards spectroscopy on actinium and scandium

    Resonance Ionization Laser Ion Sources (RILIS) have become a versatile tool for production and study of exotic nuclides at Isotope Separator On-Line (ISOL) facilities such as ISAC at TRIUMF. The recent development and addition of a grating tuned spectroscopy laser to the TRIUMF RILIS solid state laser system allows for wide range spectral scans to investigate atomic structures on short lived isotopes, e.g., those from the element actinium, produced in uranium targets at ISAC. In addition, development of new and improved laser ionization schemes for rare isotope production at ISAC is ongoing. Here spectroscopic studies on bound states, Rydberg states and autoionizing (AI) resonances on scandium using the existing off-line capabilities are reported. These results allowed to identify a suitable ionization scheme for scandium via excitation into an autoionizing state at 58,104 cm − 1 which has subsequently been used for ionization of on-line produced exotic scandium isotopes.

  17. 48 CFR 36.212 - Preconstruction orientation.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Preconstruction orientation. 36.212 Section 36.212 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION... Contracting for Construction 36.212 Preconstruction orientation. (a) The contracting officer will inform...

  18. 22 CFR 212.21 - Public records.

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Public records. 212.21 Section 212.21 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT PUBLIC INFORMATION Availability of Information for Public Inspection and Copying § 212.21 Public records. In accordance with this subpart, USAID makes the...

  19. 28 CFR 36.212 - Insurance.

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Insurance. 36.212 Section 36.212 Judicial... COMMERCIAL FACILITIES General Requirements § 36.212 Insurance. (a) This part shall not be construed to... benefit plan that is not subject to State laws that regulate insurance. (b) Paragraphs (a) (1), (2),...

  20. 12 CFR 741.212 - Share insurance.

    2010-01-01

    ... 12 Banks and Banking 6 2010-01-01 2010-01-01 false Share insurance. 741.212 Section 741.212 Banks... INSURANCE Regulations Codified Elsewhere in NCUA's Regulations as Applying to Federal Credit Unions That Also Apply to Federally Insured State-Chartered Credit Unions § 741.212 Share insurance. (a)...

  1. 32 CFR 212.5 - Responsibilities.

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 212.5 Section 212.5 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS...) INSTALLATIONS § 212.5 Responsibilities. (a) The Principal Deputy Under Secretary for Personnel and...

  2. 25 CFR 212.20 - Leasing procedures.

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Leasing procedures. 212.20 Section 212.20 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND MINERALS LEASING OF ALLOTTED LANDS FOR MINERAL DEVELOPMENT How To Acquire Leases § 212.20 Leasing procedures. (a) Application for leases shall...

  3. Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL

    Raeder, S.; Bastin, B.; Block, M.; Creemers, P.; Delahaye, P.; Ferrer, R.; Fléchard, X.; Franchoo, S.; Ghys, L.; Gaffney, L. P.; Granados, C.; Heinke, R.; Hijazi, L.; Huyse, M.; Kron, T.; Kudryavtsev, Yu.; Laatiaoui, M.; Lecesne, N.; Luton, F.; Moore, I. D.; Martinez, Y.; Mogilevskiy, E.; Naubereit, P.; Piot, J.; Rothe, S.; Savajols, H.; Sels, S.; Sonnenschein, V.; Traykov, E.; Van Beveren, C.; Van den Bergh, P.; Van Duppen, P.; Wendt, K.; Zadvornaya, A.

    2016-06-01

    To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.

  4. Dicty_cDB: SSI212 [Dicty_cDB

    Full Text Available SS (Link to library) SSI212 (Link to dictyBase) - - - Contig-U16354-1 SSI212E (Link... to Original site) - - - - - - SSI212E 608 Show SSI212 Library SS (Link to library) Clone ID SSI212 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSI2-A/SSI212Q.Seq.d/ Representative seq. ID SSI21...2E (Link to Original site) Representative DNA sequence >SSI212 (SSI212Q) /CSM/SS/SSI2-A/SSI212Q.Seq.d/ TTGTT... E Sequences producing significant alignments: (bits) Value SSI212 (SSI212Q) /CSM/SS/SSI2-A/SSI212Q.Seq.d/ 1

  5. 36 CFR 2.12 - Audio disturbances.

    2010-07-01

    ... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Audio disturbances. 2.12... RESOURCE PROTECTION, PUBLIC USE AND RECREATION § 2.12 Audio disturbances. (a) The following are prohibited..., motorized toy, or an audio device, such as a radio, television set, tape deck or musical instrument, in...

  6. 36 CFR 212.3 - Cooperative work.

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Cooperative work. 212.3... MANAGEMENT Administration of the Forest Transportation System § 212.3 Cooperative work. (a) Cooperative... for expenditure from the appropriation “Cooperative Work, Forest Service.” If a State, county or...

  7. 48 CFR 871.212 - Contract clauses.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Contract clauses. 871.212... Rehabilitation and Employment Service 871.212 Contract clauses. Contracting officers must use the following clauses, as appropriate, in solicitations and contracts for vocational rehabilitation and...

  8. 32 CFR 212.4 - Policy.

    2010-07-01

    ....4 Policy. It is DoD policy, consistent with 32 CFR part 213, that procedures be established for the... 32 National Defense 2 2010-07-01 2010-07-01 false Policy. 212.4 Section 212.4 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS PROCEDURES...

  9. 31 CFR 800.212 - Foreign entity.

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Foreign entity. 800.212 Section 800... TAKEOVERS BY FOREIGN PERSONS Definitions § 800.212 Foreign entity. (a) The term foreign entity means any... corporation, or organization organized under the laws of a foreign state if either its principal place...

  10. 40 CFR 86.212-94 - [Reserved

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false 86.212-94 Section 86.212-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) CONTROL OF... Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium-Duty...

  11. Dicty_cDB: SSG212 [Dicty_cDB

    Full Text Available SS (Link to library) SSG212 (Link to dictyBase) - - - Contig-U09907-1 SSG212E (Link to Original site) SS...G212F 593 SSG212Z 678 SSG212P 1271 SSG212E 1008 Show SSG212 Library SS (Link to library) Clone ID SS...ginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SS/SSG2-A/SSG212Q.Seq.d/ Representative seq. ID SS...G212E (Link to Original site) Representative DNA sequence >SSG212 (SSG212Q) /CSM/SS/SSG2-A/SS...qnqpkdyycpmdlinh*yhyqklldhftfltlvfn*lrlq flkl*ihssfvmdlvkklqre*fqnqlkrcfsii*fnhlkkilsqtlfhlwvvplplnil lmlnq*iklmtvact*fkmnklfilihss

  12. 48 CFR 12.212 - Computer software.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Computer software. 12.212... software. (a) Commercial computer software or commercial computer software documentation shall be acquired... required to— (1) Furnish technical information related to commercial computer software or...

  13. 48 CFR 212.207 - Contract type.

    2010-10-01

    ... OF DEFENSE ACQUISITION PLANNING ACQUISITION OF COMMERCIAL ITEMS Special Requirements for the Acquisition of Commercial Items 212.207 Contract type. b) In accordance with Section 805 of the National... contracts for the acquisition of commercial items is authorized only for the following: (i)...

  14. Development and Testing of a 212Pb/212Bi Peptide for Targeting Metastatic Melanoma

    Fisher, Darrell R.

    2012-10-25

    The purpose of this project is to develop a new radiolabeled peptide for imaging and treating metastatic melanoma. The immunoconjugate consists of a receptor-specific peptide that targets melanoma cells. The beta-emitter lead-212 (half-life = 10.4 hours) is linked by coordination chemistry to the peptide. After injection, the peptide targets melanoma receptors on the surfaces of melanoma cells. Lead-212 decays to the alpha-emitter bismuth-212 (half-life = 60 minutes). Alpha-particles that hit melanoma cell nuclei are likely to kill the melanoma cell. For cancer cell imaging, the lead-212 is replaced by lead-203 (half-life = 52 hours). Lead-203 emits 279 keV photons (80.1% abundance) that can be imaged and measured for biodistribution analysis, cancer imaging, and quantitative dosimetry.

  15. Synthesis and evaluation of tetraphosphonates labelled with 212Bi, 212Pb and 165Er

    The main goal of this work has been to achieve a synthesis of radiolabelled phosphonates for the improvement of diagnostic and therapy of osteoblastic osteosarcoma and sclerotic bone metastases. 212Bi-DOTMP is shown to be an in vivo stable bone seeking radiopharmaceutical with a potential for a α-particle therapy of the above mentioned diseases. It has biodistribution characteristics similar to 153Sm-EDTMP, which is now formally approved in several countries, most recently in the US. 212Pb-DOTMP is also a promising candidate having the advantage of increasing the effective half life of the α-emitter, although loss of some of the in vivo generated 212Bi may be a problem. A generator has been developed for the production of the α-emitting radionuclide 212Bi and its parent nuclide 212Pb. The generator is based on the emanation of 220Rn from (228Th)barium stearate. The decay product of 220Rn, 212Pb deposits on the walls of a polyethylene bottle, and can be wasted off with distilled water. The generator shows no leakage of any long-lived parent nuclides, is easy to operate and has a high degree of radiation safety

  16. 12 CFR 212.4 - Interlocking relationships permitted by statute.

    2010-01-01

    .... 212.4 Section 212.4 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM MANAGEMENT OFFICIAL INTERLOCKS § 212.4 Interlocking relationships permitted by statute. The... subsidiary thereof: (a) A depository organization that has been placed formally in liquidation, or which...

  17. 10 CFR 212.78 - Tertiary incentive crude oil.

    2010-01-01

    ... 10 Energy 3 2010-01-01 2010-01-01 false Tertiary incentive crude oil. 212.78 Section 212.78 Energy DEPARTMENT OF ENERGY OIL MANDATORY PETROLEUM PRICE REGULATIONS Producers of Crude Oil § 212.78 Tertiary incentive crude oil. Annual prepaid expenses report. By January 31 of each year after 1980, the...

  18. 49 CFR 195.212 - Bending of pipe.

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Bending of pipe. 195.212 Section 195.212... PIPELINE Construction § 195.212 Bending of pipe. (a) Pipe must not have a wrinkle bend. (b) Each field bend must comply with the following: (1) A bend must not impair the serviceability of the pipe. (2)...

  19. 7 CFR 1400.212 - Growers of hybrid seed.

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Growers of hybrid seed. 1400.212 Section 1400.212... AND SUBSEQUENT CROP, PROGRAM, OR FISCAL YEARS Payment Eligibility § 1400.212 Growers of hybrid seed. The existence of a hybrid seed contract for a person or legal entity will not be taken into...

  20. 46 CFR 179.212 - Watertight bulkheads for subdivision.

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Watertight bulkheads for subdivision. 179.212 Section 179.212 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) SMALL PASSENGER VESSELS (UNDER 100 GROSS TONS) SUBDIVISION, DAMAGE STABILITY, AND WATERTIGHT INTEGRITY Subdivision and Damage Stability Requirements § 179.212...

  1. 5 CFR 179.212 - Procedures for salary offset.

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Procedures for salary offset. 179.212 Section 179.212 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS CLAIMS COLLECTION STANDARDS Salary Offset § 179.212 Procedures for salary offset. (a) The Director or his or...

  2. 22 CFR 212.11 - Materials to be published.

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Materials to be published. 212.11 Section 212... Federal Register § 212.11 Materials to be published. (a) USAID separately states and currently publishes... section. (b) USAID Public Notice No. 1 and the USAID Regulations published in chapter II of Title 22...

  3. 25 CFR 212.56 - Geological and geophysical permits.

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Geological and geophysical permits. 212.56 Section 212.56... FOR MINERAL DEVELOPMENT Rents, Royalties, Cancellations, and Appeals § 212.56 Geological and geophysical permits. (a) Permits to conduct geological and geophysical operations on Indian lands which do...

  4. 40 CFR 211.212 - Compliance audit testing.

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Compliance audit testing. 211.212 Section 211.212 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS PRODUCT NOISE LABELING Hearing Protective Devices § 211.212 Compliance audit testing....

  5. 48 CFR 212.602 - Streamlined evaluation of offers.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Streamlined evaluation of offers. 212.602 Section 212.602 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS... for Evaluation and Solicitation for Commercial Items 212.602 Streamlined evaluation of offers....

  6. 45 CFR 212.7 - Repayment to the United States.

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false Repayment to the United States. 212.7 Section 212... UNITED STATES CITIZENS RETURNED FROM FOREIGN COUNTRIES § 212.7 Repayment to the United States. (a) An..., any or all of the cost of such assistance to the United States, except insofar as it is...

  7. 27 CFR 24.212 - High fermentation wine.

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false High fermentation wine. 24.212 Section 24.212 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Production of Other Than Standard Wine § 24.212 High fermentation wine. High fermentation wine is wine...

  8. The chemical fate of 212Bi-DOTA formed by β- decay of 212Pb(DOTA)2-

    The increasing use of inert metal complexes in radioimmunotherapy prompted us to explore the potential use of 212Pb chelates. Herein, we report a study of the chemical fate of the 212Bi-DOTA complex formed by β- decay of 212Pb(DOTA)2-(H4DOTA = 1,4,7,10-tetraazacyclododecanetetraacetic acid). To assure that both parent and daughter complexes were thermally stable, kinetic studies were performed with 203Pb(II) and 206Bi(III) which showed that both lead and bismuth complexes with DOTA undergo chemical exchange only very slowly in aqueous solution at pH 4-10. To investigate whether the complex ion which results from decay of 212Pb(DOTA)2- was intact and also stable, solutions initially containing only this ion were analyzed for amounts of DOTA-complexed and uncomplexed 212Bi after attaining transient equilibrium with 212Bi. The fraction of 212Bi radioactivity not complexed to DOTA, vide infra, was found to be 36±2%. This value represents the fraction of breakup of 212Bi(DOTA)- formed from β- decay of the parent complex. By considering the various extranuclear processes responsible for kinetic and electronic excitation of the 212Bi daughter, break-up of the 212Bi-DOTA complex is ascribed to the internal conversion of γ-rays emitted by the excited 212Bi nuclide. (orig.)

  9. New method for large scale production of medically applicable Actinium-225 and Radium-223

    Alpha-emitters (211At, 212Bi, 213Bi, 223Ra, 225Ac) are promising for targeted radiotherapy of cancer. Only two alpha decays near a cell membrane result in 50% death of cancer cell and only a single decay inside the cell is required for this. 225Ac may be used either directly or as a mother radionuclide in 213Bi isotope generator. Production of 225Ac is provided by three main suppliers - Institute for Transuranium Elements in Germany, Oak Ridge National Laboratory in USA and Institute of Physics and Power Engineering in Obninsk, Russia. The current worldwide production of 225Ac is approximately 1.7 Ci per year that corresponds to only 100-200 patients that could be treated annually. The common approach for 225Ac production is separation from mother 229Th or irradiation of 226Ra with protons in a cyclotron. Both the methods have some practical limitations to be applied routinely. 225Ac can be also produced by irradiation of natural thorium with medium energy protons . Cumulative cross sections of 225Ac, 227Ac, 227Th, 228Th formations have been obtained recently. Thorium targets (1-9 g) were irradiated by 114-91 MeV proton beam (1-50 μA) at INR linear accelerator. After dissolution in 8 M HNO3 + 0.004 M HF thorium was removed by double LLX by HDEHP in toluene (1:1). Ac and REE were pre-concentrated and separated from Ra and most fission products by DGA-Resin (Triskem). After washing out by 0.01 M HNO3 Ac was separated from REE by TRU Resin (Triskem) in 3 M HNO3 media. About 6 mCi 225Ac were separated in hot cell with chemical yield 85%. The method may be upscaled for production of Ci amounts of the radionuclide. The main impurity is 227Ac (0.1% at the EOB) but it does not hinder 225Ac from being used for medical 225Ac/213Bi generators. (author)

  10. Groundwater seepage from the Ranger uranium mine tailings dam: radioisotopes of radium, thorium and actinium. Supervising Scientist report 106

    Monitoring of bores near the Ranger uranium mine tailings dam has revealed deterioration in water quality in several bores since 1983. In a group of bores to the north of the dam, increases have been observed of up to 500 times for sulphate concentrations and of up to 5 times for 226Ra concentrations. Results are presented here of measurements of members of the uranium, thorium and actinium decay series in borewater samples collected between 1985 and 1993. In particular, measurements of all four naturally-occurring radium isotopes have been used in an investigation of the mechanism of radium concentration changes. For the most seepage-affected bores the major findings of the study include: 228Ra/226Ra 223Ra /226Ra and 224Ra/228Ra ratios all increased over the course of the study; barium concentrations show high seasonal variability, being lower in November than May, but strontium concentrations show a steady increase with time. Calculations show that the groundwater is probably saturated with respect to barite but not with respect to celestite or anglesite; sulphide concentrations are low in comparison with sulphate, and are higher in November than in May; and 227Ac concentrations have increased with time, but do not account for the high 223Ra/226Ra ratios. It is concluded on the basis of these observations that increases in Ra isotope concentrations observed in a number of seepage-affected bores arise from increases in salinity leading to desorption of radium from adsorption sites in the vicinity of the bore rather by direct transport of radium from the tailings. Increased salinity is also causing the observed increases in 227Ac and strontium concentrations, while formation of a barite solid phase in the groundwater is causing the removal of some radium from solution. This is the cause of the increasing radium isotope ratios noted above

  11. 212-Angstrom neonlike zinc laser of LULI

    Jamelot, Gerard; Jaegle, Pierre; Rus, Bedrich; Carillon, Antoine; Klisnick, Annie; Nantel, Marc; Sebban, Stephane; Albert, F.; Zeitoun, Philippe; Plankl, E.; Sirgand, A.; Lewis, Ciaran L. S.; MacPhee, Andrew G.; Tallents, Gregory J.; Krishnan, J.; Holden, M.

    1995-09-01

    The main feature of x-ray laser research at LULI is the development of a saturated laser at 212 angstrom with a relatively small pump laser of 0.4 kJ in 600 ps. The laser works with the 3p- 3s J equals O yields 1 transition of neon-like zinc, by using the double-pass of amplified radiation in the active medium. Plasma parameters (temperature, density, homogeneity), and x-ray laser emission properties (intensity, pointing angle, divergence, and coherence) have been studied. Lasing action needs the main laser pulse to be preceded by a ten-prepulse train (contrast ratio less than 103) due to the remnant oscillator. The effect of a single prepulse was investigated as a function of contrast ratio and delay between the prepulse and the main pulse.

  12. 42 CFR 1002.212 - State agency notifications.

    2010-10-01

    ... 42 Public Health 5 2010-10-01 2010-10-01 false State agency notifications. 1002.212 Section 1002.212 Public Health OFFICE OF INSPECTOR GENERAL-HEALTH CARE, DEPARTMENT OF HEALTH AND HUMAN SERVICES OIG... agency notifications. When the State agency initiates an exclusion under § 1002.210, it must provide...

  13. 33 CFR 160.212 - When to submit an NOA.

    2010-07-01

    ...) Vessels carrying break bulk cargo operating under a USCS exemption granted under 19 CFR 4.7(b)(4)(ii) may... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false When to submit an NOA. 160.212... Conditions, and Certain Dangerous Cargos § 160.212 When to submit an NOA. (a) Submission of NOA. (1)...

  14. 14 CFR 221.212 - Special tariff permission.

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Special tariff permission. 221.212 Section... PROCEEDINGS) ECONOMIC REGULATIONS TARIFFS Electronically Filed Tariffs § 221.212 Special tariff permission. (a) When a filer submits an electronic tariff or an amendment to an electronic tariff for which...

  15. 22 CFR 1203.735-212 - Wearing of uniforms.

    2010-04-01

    ... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Wearing of uniforms. 1203.735-212 Section 1203.735-212 Foreign Relations UNITED STATES INTERNATIONAL DEVELOPMENT COOPERATION AGENCY EMPLOYEE... employees are not considered uniforms within the meaning of this section except that, for ICA, MOA VII...

  16. 48 CFR 212.7003 - Technical data and computer software.

    2010-10-01

    ... computer software. 212.7003 Section 212.7003 Federal Acquisition Regulations System DEFENSE ACQUISITION... data and computer software. For purposes of establishing delivery requirements and license rights for technical data under 227.7102 and for computer software under 227.7202, there shall be a...

  17. 14 CFR 212.6 - Operation of gambling junket charters.

    2010-01-01

    ... (AVIATION PROCEEDINGS) ECONOMIC REGULATIONS CHARTER RULES FOR U.S. AND FOREIGN DIRECT AIR CARRIERS § 212.6..., hotel, or cruise line or its agents, from requiring prospective passengers to pay nominal...

  18. Dicty_cDB: AFO212 [Dicty_cDB

    Full Text Available AF (Link to library) AFO212 (Link to dictyBase) - - - Contig-U10734-1 AFO212Z (Link to Original ... RT1 Zarlenga v1 Ascaris suum cDNA 5' similar to SW:ERP 5_CAEEL Q11067 PROBABLE PROTEIN DISULFIDE ISOMERASE ... PROTEIN DISULFIDE ISOMERASE A4 PRECURSOR (PROTEIN ERP -72) (ERP 72), mRNA sequence. 60 4e-05 1 dna update ...

  19. Dicty_cDB: CHR212 [Dicty_cDB

    Full Text Available CH (Link to library) CHR212 (Link to dictyBase) - - - Contig-U10972-1 | Contig-U131... library) Clone ID CHR212 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U109...72-1 | Contig-U13146-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/C...SVETFACHVYGIHGIQKLLQYLSPDQVESIIASIKGKVIQLSKDNKGNYLIQS FLKQFSPEVNQFVCDATMGNIEEICTHKVGCTVVNRCIDNANPEQLEKLVDKIT...SVETFACHVYGIHGIQKLLQYLSPDQVESIIASIKGKVIQLSKDNKGNYLIQS FLKQFSPEVNQFVCDATMGNIEEICTHKVGCTVVNRCIDNANPEQLEKLVDKIT

  20. Synthesis and evaluation of tetraphosphonates labelled with {sup 212}Bi, {sup 212}Pb and {sup 165}Er

    Hassfjell, S.P

    1997-08-01

    The main goal of this work has been to achieve a synthesis of radiolabelled phosphonates for the improvement of diagnostic and therapy of osteoblastic osteosarcoma and sclerotic bone metastases. {sup 212}Bi-DOTMP is shown to be an in vivo stable bone seeking radiopharmaceutical with a potential for a {alpha}-particle therapy of the above mentioned diseases. It has biodistribution characteristics similar to {sup 153}Sm-EDTMP, which is now formally approved in several countries, most recently in the US. {sup 212}Pb-DOTMP is also a promising candidate having the advantage of increasing the effective half life of the {alpha}-emitter, although loss of some of the in vivo generated {sup 212}Bi may be a problem. A generator has been developed for the production of the {alpha}-emitting radionuclide {sup 212}Bi and its parent nuclide {sup 212}Pb. The generator is based on the emanation of {sup 220}Rn from ({sup 228}Th)barium stearate. The decay product of {sup 220}Rn, {sup 212}Pb deposits on the walls of a polyethylene bottle, and can be wasted off with distilled water. The generator shows no leakage of any long-lived parent nuclides, is easy to operate and has a high degree of radiation safety.

  1. Atmospheric concentrations of 212Pb and an observation of 212Pb originating from the 2000 eruptive activity of Miyake-jima volcano, at Kawasaki, Japan

    Atmospheric concentrations of 212Pb were observed with aerosol samples during the period from June, 1999 to December, 2000 at Kawasaki. The atmospheric concentrations of 212Pb ranged from 20 to 130 mBq/m3. Seasonal variations in 212Pb concentration showed the ''one-peak'' variation pattern: high concentrations appeared in winter season. The atmospheric concentration of 212Pb and SO2 after the eruption of Miyake-jima volcano on Aug. 29, 2000 were higher than average value in the season. After the eruption, the variation in the concentration of SO2 correlates with that of 212Pb. The atmospheric concentration of 212Pb showed an unusual and temporal increase in the period from late August to early September, 2000, being inferred to be attributed partly to the 212Pb fallout originating from the 2000 eruption of Miyake jima volcano, Japan. (author)

  2. Dicty_cDB: VHB212 [Dicty_cDB

    Full Text Available VH (Link to library) VHB212 (Link to dictyBase) - - - Contig-U16430-1 - (Link to Original site) ... mRNA f... 84 1e-15 DQ383787_1( DQ383787 |pid:none) Rhodomonas ... salina 82 kDa heat shoc... 83 3e-15 ( P08238 ) Rec ...

  3. 48 CFR 14.212 - Economic purchase quantities (supplies).

    2010-10-01

    ... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Economic purchase... REGULATION CONTRACTING METHODS AND CONTRACT TYPES SEALED BIDDING Solicitation of Bids 14.212 Economic purchase quantities (supplies). Contracting officers shall comply with the economic purchase...

  4. 26 CFR 1.212-1 - Nontrade or nonbusiness expenses.

    2010-04-01

    ... nonbusiness expenses. (a) An expense may be deducted under section 212 only if: (1) It has been paid or... ordinary and necessary expense for any of the purposes stated in subparagraph (1) of this paragraph. (b... at a profit or will otherwise be productive of income and even though the property is held merely...

  5. 34 CFR 668.212 - Loan servicing appeals.

    2010-07-01

    ... identifies a sample that is large enough to derive an estimate, acceptable at a 95 percent confidence level... EDUCATION, DEPARTMENT OF EDUCATION STUDENT ASSISTANCE GENERAL PROVISIONS Cohort Default Rates § 668.212 Loan... Program lender or the Direct Loan Servicer, as defined in 34 CFR 685.102, failed to perform one or more...

  6. 9 CFR 113.212 - Bursal Disease Vaccine, Killed Virus.

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Bursal Disease Vaccine, Killed Virus..., DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.212 Bursal Disease Vaccine, Killed Virus. Bursal Disease...

  7. Free radical detection by means of 212Pb mirrors

    Radicals have been detected at low temperatures (550-700 degree centigrade) in the thermal decomposition of dimethyl and methyl-ethyl-ketone by the Paneth method. the sensitivity of the method has been increased by the use of radioactive mirrors of PB212. They have proved to detect one radical among 2.106 molecules. (Author) 18 refs

  8. 48 CFR 52.212-2 - Evaluation-Commercial Items.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Evaluation-Commercial....212-2 Evaluation—Commercial Items. As prescribed in 12.301(c), the Contracting Officer may insert a provision substantially as follows: Evaluation—Commercial Items (JAN 1999) (a) The Government will award...

  9. 31 CFR 0.212 - Influencing legislation or petitioning Congress.

    2010-07-01

    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Influencing legislation or... DEPARTMENT OF THE TREASURY EMPLOYEE RULES OF CONDUCT Rules of Conduct § 0.212 Influencing legislation or... Congress to favor or oppose any legislation. This prohibition does not apply to the official...

  10. Study of in vivo generators Pb-212/Bi--212 and U-230/Th-226 for alpha radioimmunotherapy

    Alpha-radioimmunotherapy is a promising cancer therapy that uses a-particles vectorized by monoclonal antibody to break down cancerous tumors. The notion of in vivo generator was introduced in 1989 by Leonard Mausner. The concept involves labeling of various molecular carriers (antibodies, peptides, etc) with intermediate half-life generator parents, which after accumulation in the desired tissue generate much shorter half-life daughter radionuclide. This thesis focuses on the study of two in vivo generators potentially interesting for alpha-radioimmunotherapy: Pb-212 / Bi-212 generator and U-230 / Th-226 generator. The first part of this work presents the Pb-212 / Bi-212 generator, two approaches allowing the vectorization. Chelation approach on a protein and an approach by encapsulation in liposomes have been proposed. This last approach appears to be the most interesting. In vitro stability studies have been performed on these labeling. The second part of this work presents the U-230 / Th-226 generator. Studies have first been made to achieve a theoretical model to describe the speciation of Th(IV) in human serum. The efficacy of DTPA as chelating agent for complexation of Th(IV) in human serum could thus be estimated. (author)

  11. Tl-208, Pb-212, Bi-212, Ra-226 and Ac-228 adsorption onto polyhydroxyethylmethacrylate-bentonite composite

    The adsorption of naturally occurring radionuclides (208Tl+, 212Pb2+, 226Ra2+, 212Bi3+ and 228Ac3+) onto Polyhydroxyethylmethacrylate-bentonite (PHEMA-B) composite was investigated. Experimentally obtained isotherms were evaluated with reference to Langmuir, Freundlich and Dubinin-Radushkevich (DR) models. The adsorption isotherms were L type of Giles classification proving that PHEMA-B had a high affinity adsorbent for the studied radionuclides. The Langmuir adsorption capacities (XL) were in the order of 226Ra (2.8 MBq kg-1)>212Bi (0.4 MBq kg-1)>212Pb (0.3 MBq kg-1)>228Ac and 208Tl (0.2 MBq kg-1). The adsorption process was physical via complex formation after proton exchanger for which the adsorption energies obtained from DR model was evidence. The enthalpy and entropy changes were positive and the negative free enthalpy change was proof for the spontaneity of adsorption. The reusability tests for PHEMA-B for five uses demonstrated that the adsorbent could be reused after complete recovery of the loaded radionuclide ions by 1 M HCl. The chemical structure of the composite did not change after the reuses and storage foregoing.

  12. 8 CFR 212.5 - Parole of aliens into the United States.

    2010-01-01

    ... or her parole status terminated upon notice, as specified in 8 CFR 212.5(e)(2)(i), if he or she makes... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Parole of aliens into the United States. 212.5 Section 212.5 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION...

  13. 31 CFR 585.212 - Prohibited transactions related to scientific and technical cooperation, cultural exchanges, and...

    2010-07-01

    ... scientific and technical cooperation, cultural exchanges, and other official visits. 585.212 Section 585.212... § 585.212 Prohibited transactions related to scientific and technical cooperation, cultural exchanges....S. person related to scientific and technical cooperation and cultural exchanges involving...

  14. 5 CFR 875.212 - Is there a minimum application age?

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Is there a minimum application age? 875.212 Section 875.212 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS (CONTINUED) FEDERAL LONG TERM CARE INSURANCE PROGRAM Eligibility § 875.212 Is there a...

  15. 40 CFR 80.212 - What requirements apply to oxygenate blenders?

    2010-07-01

    ... 40 Protection of Environment 16 2010-07-01 2010-07-01 false What requirements apply to oxygenate blenders? 80.212 Section 80.212 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR....212 What requirements apply to oxygenate blenders? Effective January 1, 2004, oxygenate blenders...

  16. 40 CFR 180.212 - S-Ethyl cyclohexylethylthio-carbamate; tolerances for residues.

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false S-Ethyl cyclohexylethylthio-carbamate; tolerances for residues. 180.212 Section 180.212 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... Tolerances § 180.212 S-Ethyl cyclohexylethylthio-carbamate; tolerances for residues. (a) General....

  17. 36 CFR 212.7 - Access procurement by the United States.

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Access procurement by the United States. 212.7 Section 212.7 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE TRAVEL MANAGEMENT Administration of the Forest Transportation System § 212.7 Access procurement...

  18. (212)Pb as tracer for PM deposition on urban vegetation.

    Voltaggio, Mario; Spadoni, Massimo; Carloni, Serena; Guglietta, Daniela

    2016-11-01

    (212)Pb concentration in outdoor air is closely correlated with fine suspended particulate matter in the atmosphere. Thanks to this association, this isotope can be used to trace the sinking processes of particulate matter due to the vegetation, also providing accurate estimations of the deposition velocity on foliar surfaces. This approach is particularly effective in areas with high thoron fluxes and, consequently, high (212)Pb fluxes from soil. The contribution of vegetation to the improvement of air quality (AQImp) in the municipality area (MA) of Rome (Latium, Italy), almost entirely located on Th-enriched volcanic soils, was estimated by studying (212)Pb deposition velocity on the grasses (0.9-2.5mm·s(-1)) and on the most common tree classes, namely conifers (1.5-15mm·s(-1)), evergreen (1-4mm·s(-1)) and deciduous (0.2-1.5mm·s(-1)). (212)Pb activity in outdoor air was determined by gamma spectrometry after air pumping with accumulation on cellulose filters and after collection on artificial electrostatically charged surfaces (ECS). The high (212)Pb activity values obtained from this analysis (0.90±0.6Bqm(-3) and 0.58±0.15Bqm(-3), respectively near and far from the soil) are consistent both with the average regional thoron flux from volcanic soils (2.9·10(4)Bqm(-2)·h(-1)) and with the thoron flux measured in the volcanic soils of the study area. Thoron and (212)Pb fluxes were also measured both in laboratory and in the field under different soil moisture conditions. The total AQImp for the period from September 2014 to September 2015, calculated after the classification of the MA of Rome into six classes of vegetation, provided a value of 0.20 corresponding to 2.3 Tons per day of removed PM10. The role of grasslands in the PM10 removal, the contribution of the vegetation to the improvement of AQImp and the possibility of improving the sinking efficiency of green areas by increasing conifer trees coverage were also highlighted. PMID:27323332

  19. Preparation of radionuclide 212Pb by emanation technique of 232Th

    The paper is focused on preparation of radionuclide 212Pb for its further application. 212Pb radioisotope has radiogenic origin of a series of 232Th. The given radionuclide 212Pb (10.6 h) was captured from Th-source on niobium emmanator shims by influence of electric field at a voltage of 310 V. 212Pb was then eluted from the shims to dilute solution of HNO3. 212Pb thus prepared in this way was then applied at radioindicator study of adsorption processes of clay rocks - bentonites.

  20. Tribological and mechanical comparison of sintered and hipped PM212: High temperature self-lubricating composites

    Dellacorte, Christopher; Sliney, Harold E.; Bogdanski, Michael S.

    1992-01-01

    Selected tribological, mechanical and thermophysical properties of two versions of PM212 (sintered and hot isostatically pressed, HIPped) are compared. PM212, a high temperature self-lubricating composite, contains 70 wt percent metal bonded chromium carbide, 15 wt percent CaF2/BaF2 eutectic and 15 wt percent silver. PM212 in the sintered form is about 80 percent dense and has previously been shown to have good tribological properties from room temperature to 850 C. Tribological results of a fully densified, HIPped version of PM212 are given. They are compared to sintered PM212. In addition, selected mechanical and thermophysical properties of both types of PM212 are discussed and related to the tribological similarities and differences between the two PM212 composites. In general, both composites display similar friction and wear properties. However, the fully dense PM212 HIPped composite exhibits slight lower friction and wear than sintered PM212. This may be attributed to its generally higher strength properties. The sintered version displays stable wear properties over a wide load range indicating its promise for use in a variety of applications. Based upon their properties, both the sintered and HIPped PM212 have potential as bearing and seal materials for advanced high temperature applications.

  1. Quality control of the tribological coating PS212

    Sliney, Harold E.; Dellacorte, Christopher; Deadmore, Daniel L.

    1989-01-01

    PS212 is a self-lubricating, composite coating that is applied by the plasma spray process. It is a functional lubricating coating from 25 C (or lower) to 900 C. The coating is prepared from a blend of three different powders with very dissimilar properties. Therefore, the final chemical composition and lubricating effectiveness of the coatings are very sensitive to the process variables used in their preparation. Defined here are the relevant variables. The process and analytical procedures that will result in satisfactory tribological coatings are discussed.

  2. Alpha Decay Width of $^{212}$Po from a quartetting wave function approach

    Xu, Chang; Röpke, G; Schuck, P; Funaki, Y; Horiuchi, H; Tohsaki, A; Yamada, T; Zhou, Bo

    2015-01-01

    A microscopic calculation of $\\alpha$-cluster preformation probability and $\\alpha$ decay width in the typical $\\alpha$ emitter $^{212}$Po is presented. Results are obtained by improving a recent approach to describe $\\alpha$ preformation in $^{212}$Po [Phys. Rev. C 90, 034304 (2014)] implementing four-nucleon correlations (quartetting). Using the actually measured density distribution of the $^{208}$ Pb core, the calculated alpha decay width of $^{212}$Po agrees fairly well with the measured one.

  3. 222Rn and 212Pb exposures at a Brazilian SPA

    Termas de Araxa spa is located in Araxa, State of Minas Gerais. In this region, several minerals rich in uranium and thorium are found. The mineral waters and mud from Termas de Araxa spa have been used for therapeutic and recreation purposes. In this study, the committed effective dose was evaluated for workers and patients at Araxa spa due to 222Rn and 212Pb inhalation. Radon measurements were carried out through the passive method with solid state nuclear track detectors (Makrofol E) over a period of 21 months, with results varying from 258 ± 20 to 1634 ± 111 Bq m-3. The 212Pb air concentration was assessed through the modified Kusnetz's method, the results varying from 0.3 ± 0.1 to 2.1 ± 0.2 Bq m-3. Doses received by the spa workers are below 20 mSv y-1, suggested by ICRP 60 as an annual effective dose limit for occupational exposure. The radiation doses for the patients are below the mean annual effective dose due to natural sources estimated to be 2.4 mSv.y-1. (authors)

  4. Tracking of activity of major daughter products (212Bi, 212Pb and 228Ac) in Thorium ore with time in a hermetically sealed container

    During this work activities of 212Bi, 212 Pb and 228Ac were tracked at different time intervals for 30 days in hermetically sealed closed container. IAEA-RGTh-1 reference materials having 2.89% Th with floated silica powder of similar grain size distribution ( 232Th in the composite sample (ore) is 3250 ± 270 Bq kg-1. Gamma measurement was carried on a high-purity p-type germanium (HPGe) detector having a relative efficiency of 50%. Data obtained during this work clearly shows that there is only minor variation in the concentration of 212Bi, 212Pb and 228Ac from the time of sealing to 30th day. Mean concentration of 232Th evaluated using gamma energy line of 228Ac (912 keV) and 212Bi (728 keV) shows a deviation of only 0.05%, and 5.66% respectively from the certified mean value of 232Th, whereas a large negative deviation of 29.9% was observed in the case of 212Pb (239 keV). (author)

  5. 25 CFR 212.46 - Inspection of premises, books, and accounts.

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Inspection of premises, books, and accounts. 212.46 Section 212.46 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND MINERALS LEASING OF... premises, books, and accounts. The provisions of § 211.46 of this subchapter are applicable to leases...

  6. 7 CFR 330.212 - Movement of plant pests by baggage.

    2010-01-01

    ... 7 Agriculture 5 2010-01-01 2010-01-01 false Movement of plant pests by baggage. 330.212 Section... INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE FEDERAL PLANT PEST REGULATIONS; GENERAL; PLANT PESTS; SOIL, STONE, AND QUARRY PRODUCTS; GARBAGE Movement of Plant Pests § 330.212 Movement of plant pests by...

  7. 23 CFR 972.212 - Federal lands safety management system (SMS).

    2010-04-01

    ... inspection and copying as prescribed at 49 CFR part 7. (c) The FWS shall utilize the SMS to ensure that... 23 Highways 1 2010-04-01 2010-04-01 false Federal lands safety management system (SMS). 972.212....212 Federal lands safety management system (SMS). In addition to the requirements provided in §...

  8. 23 CFR 973.212 - Indian lands safety management system (SMS).

    2010-04-01

    ... inspection and copying as prescribed at 49 CFR part 7. (d) The BIA and ITGs shall utilize the SMSs to ensure... 23 Highways 1 2010-04-01 2010-04-01 false Indian lands safety management system (SMS). 973.212... PROGRAM Bureau of Indian Affairs Management Systems § 973.212 Indian lands safety management system...

  9. 21 CFR 212.10 - What personnel and resources must I have?

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false What personnel and resources must I have? 212.10 Section 212.10 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES... a sufficient number of personnel with the necessary education, background, training, and...

  10. 30 CFR 212.200 - Maintenance of and access to records.

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false Maintenance of and access to records. 212.200 Section 212.200 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR MINERALS REVENUE... prices. (3) Costs of mining, processing, handling, and transportation....

  11. 18 CFR 157.212 - Synthetic and liquefied natural gas facilities.

    2010-04-01

    ... natural gas facilities. 157.212 Section 157.212 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION, DEPARTMENT OF ENERGY REGULATIONS UNDER NATURAL GAS ACT APPLICATIONS FOR CERTIFICATES... 7 OF THE NATURAL GAS ACT Interstate Pipeline Blanket Certificates and Authorization Under Section...

  12. 20 CFR 702.212 - Notice; when given; when given for certain occupational diseases.

    2010-04-01

    ...). (b) In the case of an occupational disease which does not immediately result in disability or death... employment, the disease and the death or disability. For purposes of these occupational diseases, therefore... occupational diseases. 702.212 Section 702.212 Employees' Benefits EMPLOYMENT STANDARDS...

  13. 49 CFR 180.212 - Repair of seamless DOT 3-series specification cylinders and seamless UN pressure receptacles.

    2010-10-01

    ... cylinders and seamless UN pressure receptacles. 180.212 Section 180.212 Transportation Other Regulations... Qualification, Maintenance and Use of Cylinders § 180.212 Repair of seamless DOT 3-series specification cylinders and seamless UN pressure receptacles. (a) General requirements for repair of DOT...

  14. Novel gene PUS3 c.A212G mutation in Ukrainian family with intellectual disability

    Gulkovskyi R. V.

    2015-04-01

    Full Text Available Aim. To evaluate a possible role of a novel c.A212G substitution in the PUS3 gene at intellectual disability (ID. Methods. The observed group consisted of the ID Ukrainian family members (parents and two affected children and the control group – of 300 healthy individuals from general population of Ukraine. Sanger sequencing of the PUS3 gene exon 1 was performed for the family members. Polymorphic variants of c.A212G were analyzed using ARMS PCR. The homology models of wild type and p.Y71C mutant catalytic domains of human Pus3 were generated using the crystal structure of the human Pus1 catalytic domain (PDB ID: 4NZ6 as a template. Results. It was shown that the father of the affected siblings was the c.A212G substitution heterozygous carrier whereas the mother was a wild type allele homozygote, and the exom sequencing result was confirmed – the affected children are 212G homozygotes. We supposed de novo mutation in the maternal germ line. A low frequency of 212G allele (0.0017 was shown in the population of Ukraine. Homology modelling of the wild type and p.Y71C mutant catalytic domain of human Pus3 revealed that substitution p.Y71C is located in close proximity to its active site. Conclusions. The absence of hypoproteinemia in our patients, homozygous for the 212C allele allows us to assume that the mutation c.A212G PUS3 is rather neutral and cannot be the major cause of ID. However, considering a low frequency of the 212G allele in the population and close localization of p.Y71C substitution to the active site of hPus3 we cannot exclude that the c.A212G mutation in PUS3 may be a modifier for some pathologies including syndromic ID.

  15. The tribology of PS212 coatings and PM212 composites for the lubrication of titanium 6Al-4V components of a Stirling engine space power system

    Sliney, Harold E.; Lukaszewicz, Victor; Dellacorte, Christopher

    1994-01-01

    The Stirling space power machine incorporates a linear alternator to generate electrical power. The alternator is a reciprocating device that is driven by a solar or nuclear-powered Stirling engine. The power piston and cylinder are made of titanium 6Al-4V (Ti6-4) alloy, and are designed to be lubricated by a hydrodynamically-generated gas film. Rubbing occurs during starts and stops and there is the possibility of an occasional high speed rub. Since titanium is known to have a severe galling tendency in sliding contacts, a 'back-up', self-lubricating coating on the cylinder and/or the piston is needed. This report describes the results of a research program to study the lubrication of Ti6-4 with the following chromium carbide based materials: plasma-sprayed PS212 coatings and sintered PM212 counterfaces. Program objectives are to achieve adherent coatings on Ti6-4 and to measure the friction and wear characteristics of the following sliding combinations under conditions simulative of the Stirling-driven space power linear alternator: Ti6-4/Ti6-4 baseline, Ti6-4/PS212-coated Ti6-4, and PS212-coated Ti6-4/PM212.

  16. α -decay width of 212Po from a quartetting wave function approach

    Xu, Chang; Ren, Zhongzhou; Röpke, G.; Schuck, P.; Funaki, Y.; Horiuchi, H.; Tohsaki, A.; Yamada, T.; Zhou, Bo

    2016-01-01

    A microscopic calculation of α -cluster preformation probability and α -decay width in the typical α emitter 212Po is presented. Results are obtained by improving a recent approach to describe α preformation in 212Po [Phys. Rev. C 90, 034304 (2014), 10.1103/PhysRevC.90.034304] implementing four-nucleon correlations (quartetting). Using the actually measured density distribution of the 208Pb core, the calculated α -decay width of 212Po agrees fairly well with the measured one.

  17. 5 CFR 575.212 - Internal monitoring requirements and revocation or suspension of authority.

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Internal monitoring requirements and... MANAGEMENT CIVIL SERVICE REGULATIONS RECRUITMENT, RELOCATION, AND RETENTION INCENTIVES; SUPERVISORY DIFFERENTIALS; AND EXTENDED ASSIGNMENT INCENTIVES Relocation Incentives § 575.212 Internal...

  18. Tacrolimus for myasthenia gravis: a clinical study of 212 patients.

    Ponseti, José M; Gamez, Josep; Azem, Jamal; López-Cano, Manuel; Vilallonga, Ramón; Armengol, Manuel

    2008-01-01

    Tacrolimus is a macrolide T cell immunomodulator that is used in myasthenia gravis (MG) patients to affect muscle contraction (ryanodine receptor by modulating intracellular calcium-release channels and increasing muscular strength), glucocorticoid receptors (increasing intracellular concentration of steroids and blocking the steroid export mechanism), and an increase in T cell apoptosis. In this study, we report the results of low-dose tacrolimus (0.1 mg/kg/day) treatment in 212 MG patients. There were 110 thymectomized, cyclosporine- and prednisone-dependent patients; 68 thymectomized patients who started tacrolimus early postoperatively (24 h after operation); and 34 patients over 60 years old with nonthymomatous generalized MG or in whom thymectomy was contraindicated. The mean follow-up time was 49.3 +/- 18.1 months. Muscular strength showed an increase of 23% after 1 month of treatment and 29% at the end of the study. The acetylcholine receptor antibodies decreased significantly from a mean of 33.5 nmol/L at base line to 7.8 nmol/L at the final visit. In the thymectomy group with combined prednisone and tacrolimus stratified by histology of the thymus, the mean probability to attain complete stable remission at 5 years was 80.8% in patients with hyperplasia, 48.1% in thymic involution, and 9.3% in patients with thymoma. In 4.9% of patients, tacrolimus was withdrawn because of major adverse effects. Our results suggest that a low dose of tacrolimus is effective for MG and could be included to the armamentarium for this autoimmune disease. The present results should be interpreted considering the limitations of a retrospective clinical study. Confirmation of these results in randomized studies is desirable. PMID:18096852

  19. Spectroscopy of high spin states in sup(211,212,213)Fr

    The level structures of 211Fr, 212Fr and 213Fr have been observed to high spins, approx. 28(h/2π) (and excitation energies approx. 8 MeV) using a variety of gamma-ray spectroscopic techniques. The structure of these nuclides is discussed in terms of couplings of single particle states through empirical shell model calculations. Good agreement with experiment is obtained. In 212Fr and 213Fr core-excited configurations are required to explain the properties of the highest states. A number of long lived states were observed in each nucleus some of which decay by by enhanced E3 transitions. The E3 transition strengths are discussed

  20. 48 CFR 212.570 - Applicability of certain laws to contracts and subcontracts for the acquisition of commercially...

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Applicability of certain laws to contracts and subcontracts for the acquisition of commercially available off-the-shelf items. 212.570 Section 212.570 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE ACQUISITION...

  1. 48 CFR 212.504 - Applicability of certain laws to subcontracts for the acquisition of commercial items.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Applicability of certain laws to subcontracts for the acquisition of commercial items. 212.504 Section 212.504 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE ACQUISITION PLANNING ACQUISITION OF COMMERCIAL...

  2. 48 CFR 212.503 - Applicability of certain laws to executive agency contracts for the acquisition of commercial items.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Applicability of certain laws to executive agency contracts for the acquisition of commercial items. 212.503 Section 212.503 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE ACQUISITION PLANNING ACQUISITION OF...

  3. 22 CFR 212.41 - Exemptions from publication and disclosure requirements of subparts B, C, and D.

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Exemptions from publication and disclosure requirements of subparts B, C, and D. 212.41 Section 212.41 Foreign Relations AGENCY FOR INTERNATIONAL... privacy; (4) Could reasonably be expected to disclose the identity of a confidential source, including...

  4. 25 CFR 212.42 - Annual rentals and expenditures for development on leases other than oil and gas, and geothermal...

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Annual rentals and expenditures for development on leases other than oil and gas, and geothermal resources. 212.42 Section 212.42 Indians BUREAU OF INDIAN AFFAIRS... other than oil and gas, and geothermal resources. The provisions of § 211.42 of this subchapter...

  5. 20 CFR 30.212 - How does a claimant establish that the employee contracted cancer after beginning employment at a...

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false How does a claimant establish that the employee contracted cancer after beginning employment at a DOE facility, an atomic weapons employer facility or a RECA section 5 facility? 30.212 Section 30.212 Employees' Benefits OFFICE OF WORKERS' COMPENSATION PROGRAMS, DEPARTMENT OF LABOR...

  6. Tribological properties of PM212 - A high temperature, self-lubricating, powder metallurgy composite

    Dellacorte, Christopher; Sliney, Harold E.

    1990-01-01

    This paper describes a research program to develop and evaluate a new high temperature, self-lubricating powder metallurgy composite, PM212. PM212 has the same composition as the plasma-sprayed coating, PS212, which contains 70 wt percent metal-bonded chromium carbide, 15 wt percent silver and 15 wt percent barium fluoride/calcium fluoride eutectic. The carbide acts as a wear resistant matrix and the silver and fluorides act as low and high temperature lubricants, respectively. The material is prepared by sequential cold press, cold isostatic pressing and sintering techniques. In this study, hemispherically tipped wear pins of PM212 were prepared and slid against superalloy disks at temperatures from 25 to 850 C in air in a pin-on-disk tribometer. Friction coefficients range from 0.29 to 0.38 and the wear of both the composite pins and superalloy disks was moderate to low in the 10(exp -5) to 10(exp -6) cubic mm/N-m range. Preliminary tests indicate that the material has a compressive strength of at least 130 MPa over the entire temperature range of 25 to 900 C. This material has promise for use as seal inserts, bushings, small inside diameter parts and other applications where plasma-sprayed coatings are impractical or too costly.

  7. Tribological properties of PM212: A high-temperature, self-lubricating, powder metallurgy composite

    Dellacorte, Christopher; Sliney, Harold E.

    1989-01-01

    This paper describes a research program to develop and evaluate a new high temperature, self-lubricating powder metallurgy composite, PM212. PM212 has the same composition as the plasma-sprayed coating, PS212, which contains 70 wt percent metal-bonded chromium carbide, 15 wt percent silver and 15 wt percent barium fluoride/calcium fluoride eutectic. The carbide acts as a wear resistant matrix and the silver and fluorides act as low and high temperature lubricants, respectively. The material is prepared by sequential cold press, cold isostatic pressing and sintering techniques. In this study, hemispherically tipped wear pins of PM212 were prepared and slid against superalloy disks at temperatures from 25 to 850 C in air in a pin-on-disk tribometer. Friction coefficients range from 0.29 to 0.38 and the wear of both the composite pins and superalloy disks was moderate to low in the 10(exp -5) to 10(exp -6) cubic mm/N-m range. Preliminary tests indicate that the material has a compressive strength of at least 130 MPa over the entire temperature range of 25 to 900 C. This material has promise for use as seal inserts, bushings, small inside diameter parts and other applications where plasma-sprayed coatings are impractical or too costly.

  8. The sl(2|1)(2) Gaudin magnet with diagonal boundary terms

    This work is concerned with the quasi-classical limit of the boundary quantum inverse scattering method for the twisted sl(2|1)(2) vertex model with diagonal K-matrices. In this limit Gaudin's Hamiltonians with diagonal boundary terms are presented and diagonalized

  9. 10 CFR 72.212 - Conditions of general license issued under § 72.210.

    2010-01-01

    ... INDEPENDENT STORAGE OF SPENT NUCLEAR FUEL, HIGH-LEVEL RADIOACTIVE WASTE, AND REACTOR-RELATED GREATER THAN CLASS C WASTE General License for Storage of Spent Fuel at Power Reactor Sites § 72.212 Conditions of... general license is limited to storage of spent fuel in casks approved under the provisions of this...

  10. 23 CFR 970.212 - Federal lands safety management system (SMS).

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Federal lands safety management system (SMS). 970.212... Federal lands safety management system (SMS). In addition to the requirements provided in § 970.204, the SMS must meet the following requirements: (a) The NPS shall have an SMS for all transportation...

  11. 23 CFR 971.212 - Federal lands safety management system (SMS).

    2010-04-01

    ... available for inspection and copying as prescribed at 49 CFR part 7. (c) The tri-party partnership shall... 23 Highways 1 2010-04-01 2010-04-01 false Federal lands safety management system (SMS). 971.212... lands safety management system (SMS). In addition to the requirements provided in § 971.204, the...

  12. 8 CFR 212.15 - Certificates for foreign health care workers.

    2010-01-01

    ... perform labor in the United States as an occupational or physical therapist must obtain the following... language proficiency testing. (3) Physical therapists. An alien physical therapist who has graduated from a... section, if 8 CFR 212.1 requires an alien who is described in paragraph (a) of this section and who...

  13. 21 CFR 212.2 - What is current good manufacturing practice for PET drugs?

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false What is current good manufacturing practice for... HUMAN SERVICES (CONTINUED) DRUGS: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR POSITRON EMISSION TOMOGRAPHY DRUGS (Eff. 12-12-2011) General Provisions § 212.2 What is current good manufacturing practice...

  14. 27 CFR 25.212 - Beer returned to brewery from which removed.

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Beer returned to brewery... TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS BEER Beer Returned to Brewery § 25.212 Beer returned to brewery from which removed. If beer on which the tax has been determined or paid is returned...

  15. 19 CFR 212.07 - Rulemaking on maximum rates for attorney fees.

    2010-04-01

    ....07 Section 212.07 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION INVESTIGATIONS OF UNFAIR PRACTICES IN IMPORT TRADE IMPLEMENTATION OF THE EQUAL ACCESS TO JUSTICE ACT General Provisions... conduct any rulemaking proceedings for this purpose under the informal rulemaking procedures of...

  16. Half-life of 214Po and 212Po measured with CTF at LNGS

    Polonium isotopes 214Po and 212Po are part of the 238U and 232Th decay chains, respectively. There exist only a few measurements of these two mean lifetimes with precision better than one or two percent. Since we have been studying decay spectra of 214Bi and 212Bi with the purpose of experimentally constraining anti-neutrino spectral shape important for geoneutrino studies, we have a large statistics of decays of 214Po and 212Po collected with the Counting Test Facility (CTF), which was operational in the underground I.N.F.N. Gran Sasso National Laboratory. The apparatus consisted of an external cylindrical water tank (diameter ∼ 11 m, high ∼ 10 m; ∼ 1000 tons of water) serving as passive shielding for 4.8 m3 of liquid organic scintillator contained in an inner spherical vessel with a diameter of ∼ 2 m. The inner vessel was realized with a nylon membrane (∼ 500 ?m thick), with excellent optical clarity, which allowed the effective transmission of the scintillation light to the 100 phototubes (PMTs) forming the optical read-out, anchored on a 7 m diameter support structure inside the water tank. The high purity and low background in CTF allows a favourable signal to background ratio for these measurements. More specifically the ratio of signal to background of the present measurements is more than three orders of magnitude larger than the best existing measurements. We have studied the decays of 214Po into 210Pb and of 212Po into 208Pb tagged by the coincidence with the previously decays from 214Bi and 212Bi by using 222Rn, 232Th and 220Rn sources sealed inside quartz vials and inserted in the CTF

  17. Microwave sintering of ZrO2-12 mol% CeO2

    Sintering of ZrO2-12 mol% CeO2 was accelerated by microwave processing at 2.45 GHz as compared with conventional firing. However, the size of the ''microwave effect'' was significantly smaller than that which was previously observed for microwave sintering of ZrO2-8 mol% Y2O3. The difference in the effect that the microwave field had on the two zirconia systems is interpreted in terms of their ionic conductivities

  18. Examination results of the Three Mile Island radiation detector HP-R-212

    Area radiation detector HP-R-212 was removed from the Three Mile Island containment building on November 13, 1981. The detector apparently started to fail during November 1979 and by the first part of December 1979 the detector readings had degraded from 1 R/hr to 20 mR/hr. This report discusses the cause of failure, detector radiation measurement characteristics, and our estimates of the total gamma radiation dose received by the detector electronics

  19. Metallothionein bioconjugates as delivery vehicles for bismuth-212 alpha particle therapy

    Metallothioneins (MTHs) are small cysteine-rich polypeptides that binds cationic metals at physiologic pH ranges through noncovalent -SH ligand interactions. Some leucine-rich renal MTHs have a particular avidity for bismuth. The authors have examined the ability of MTHs to selectively incorporate Bi-212, a short-lived high-energy alpha particle emitter currently under exploration as a potential therapeutic radiolabel for use in molecularly targeted cancer therapy. They find that under physiologic conditions, MTH will selectively incorporate Bi-212 after incubation with an equilibrium mixture of its upstream and downstream parents. The MTH moieties may be linked to tumor-binding macromolecules such as antibodies via thiolation reactions using SPDP, and the resultant Bismuth-avid molecules may be used either as primary delivery vehicles for the Bi-212 or as part of a 2-step release-and-catch isotope localization system in which the MTH-antibody conjugate is pre-localized at the tumor site and the radiometal is then administered and chelated in situ. They present the chemistry, dosimetry and potential clinical applications of this system

  20. miR-132 and miR-212 are increased in pancreatic cancer and target the retinoblastoma tumor suppressor

    Park, Jong-Kook [College of Pharmacy, Ohio State University, Columbus, OH 43210 (United States); Henry, Jon C. [Department of Surgery, Ohio State University, Columbus, OH 43210 (United States); Jiang, Jinmai [College of Pharmacy, Ohio State University, Columbus, OH 43210 (United States); Esau, Christine [Regulus Therapeutics, Carlsbad, CA (United States); Gusev, Yuriy [Lombardi Cancer Center, Georgetown University, Washington, DC (United States); Lerner, Megan R. [Veterans Affairs Medical Center, Oklahoma City, OK (United States); Postier, Russell G. [Department of Surgery, University of Oklahoma Health Sciences Center, Oklahoma City, OK (United States); Brackett, Daniel J. [Veterans Affairs Medical Center, Oklahoma City, OK (United States); Schmittgen, Thomas D., E-mail: Schmittgen.2@osu.edu [College of Pharmacy, Ohio State University, Columbus, OH 43210 (United States)

    2011-03-25

    Research highlights: {yields} The expression of miR-132 and miR-212 are significantly increased in pancreatic cancer. {yields} miR-132 and miR-212 target the tumor suppressor pRb, resulting in enhanced proliferation. {yields} miR-132 and miR-212 expression is increased by a {beta}2 adrenergic receptor agonist, suggesting a novel mechanism for pancreatic cancer progression. -- Abstract: Numerous microRNAs (miRNAs) are reported as differentially expressed in cancer, however the consequence of miRNA deregulation in cancer is unknown for many miRNAs. We report that two miRNAs located on chromosome 17p13, miR-132 and miR-212, are over-expressed in pancreatic adenocarcinoma (PDAC) tissues. Both miRNAs are predicted to target the retinoblastoma tumor suppressor, Rb1. Validation of this interaction was confirmed by luciferase reporter assay and western blot in a pancreatic cancer cell line transfected with pre-miR-212 and pre-miR-132 oligos. Cell proliferation was enhanced in Panc-1 cells transfected with pre-miR-132/-212 oligos. Conversely, antisense oligos to miR-132/-212 reduced cell proliferation and caused a G{sub 2}/M cell cycle arrest. The mRNA of a number of E2F transcriptional targets were increased in cells over expressing miR-132/-212. Exposing Panc-1 cells to the {beta}2 adrenergic receptor agonist, terbutaline, increased the miR-132 and miR-212 expression by 2- to 4-fold. We report that over-expression of miR-132 and miR-212 result in reduced pRb protein in pancreatic cancer cells and that the increase in cell proliferation from over-expression of these miRNAs is likely due to increased expression of several E2F target genes. The {beta}2 adrenergic pathway may play an important role in this novel mechanism.

  1. miR-132 and miR-212 are increased in pancreatic cancer and target the retinoblastoma tumor suppressor

    Research highlights: → The expression of miR-132 and miR-212 are significantly increased in pancreatic cancer. → miR-132 and miR-212 target the tumor suppressor pRb, resulting in enhanced proliferation. → miR-132 and miR-212 expression is increased by a β2 adrenergic receptor agonist, suggesting a novel mechanism for pancreatic cancer progression. -- Abstract: Numerous microRNAs (miRNAs) are reported as differentially expressed in cancer, however the consequence of miRNA deregulation in cancer is unknown for many miRNAs. We report that two miRNAs located on chromosome 17p13, miR-132 and miR-212, are over-expressed in pancreatic adenocarcinoma (PDAC) tissues. Both miRNAs are predicted to target the retinoblastoma tumor suppressor, Rb1. Validation of this interaction was confirmed by luciferase reporter assay and western blot in a pancreatic cancer cell line transfected with pre-miR-212 and pre-miR-132 oligos. Cell proliferation was enhanced in Panc-1 cells transfected with pre-miR-132/-212 oligos. Conversely, antisense oligos to miR-132/-212 reduced cell proliferation and caused a G2/M cell cycle arrest. The mRNA of a number of E2F transcriptional targets were increased in cells over expressing miR-132/-212. Exposing Panc-1 cells to the β2 adrenergic receptor agonist, terbutaline, increased the miR-132 and miR-212 expression by 2- to 4-fold. We report that over-expression of miR-132 and miR-212 result in reduced pRb protein in pancreatic cancer cells and that the increase in cell proliferation from over-expression of these miRNAs is likely due to increased expression of several E2F target genes. The β2 adrenergic pathway may play an important role in this novel mechanism.

  2. SU-C-201-05: Imaging 212Pb-TCMC-Trastuzumab for Alpha Radioimmunotherapy for Ovarian Cancer

    Shen, S; Meredith, R; Azure, M; Yoder, D [University of Alabama, Birmingham, AL (United States); Torgue, J; Banaga, E [AREVA Med LLC, Bethesda, MD (United States)

    2015-06-15

    Purpose: To support the phase I trial for toxicity, biodistribution and pharmacokinetics of intra-peritoneal (IP) 212Pb-TCMC-trastuzumab in patients with HER-2 expressing malignancy. A whole body gamma camera imaging method was developed for estimating amount of 212Pb-TCMC-trastuzumab left in the peritoneal cavity. Methods: {sup 212}Pb decays to {sup 212}Bi via beta emission. {sup 212}Bi emits an alpha particle at an average of 6.1 MeV. The 238.6 keV gamma ray with a 43.6% yield can be exploited for imaging. Initial phantom was made of saline bags with 212Pb. Images were collected for 238.6 keV with a medium energy general purpose collimator. There are other high energy gamma emissions (e.g. 511keV, 8%; 583 keV, 31%) that penetrate the septae of the collimator and contribute scatter into 238.6 keV. An upper scatter window was used for scatter correction for these high energy gammas. Results: A small source containing 212Pb can be easily visualized. Scatter correction on images of a small 212Pb source resulted in a ∼50% reduction in the full width at tenth maximum (FWTM), while change in full width at half maximum (FWHM) was <10%. For photopeak images, substantial scatter around phantom source extended to > 5 cm outside; scatter correction improved image contrast by removing this scatter around the sources. Patient imaging, in the 1st cohort (n=3) showed little redistribution of 212Pb-TCMC-trastuzumab out of the peritoneal cavity. Compared to the early post-treatment images, the 18-hour post-injection images illustrated the shift to more uniform anterior/posterior abdominal distribution and the loss of intensity due to radioactive decay. Conclusion: Use of medium energy collimator, 15% width of 238.6 keV photopeak, and a 7.5% upper scatter window is adequate for quantification of 212Pb radioactivity inside peritoneal cavity for alpha radioimmunotherapy of ovarian cancer. Research Support: AREVA Med, NIH 1UL1RR025777-01.

  3. The tribology of PS212 coatings and PM212 composites for the lubrication of titanium 6A1-4V components of a Stirling engine space power system

    Sliney, Harold E.; Dellacorte, Christopher; Lukaszewicz, Victor

    1995-07-01

    The Stirling space power machine incorporates a linear alternator to generate electrical power. The alternator is a reciprocating device that is driven by a solar or nuclear-powered Stirling engine. The power piston and cylinder are made of titanium 6A1-4V (Ti6-4) alloy, and are designed to be lubricated by a hydrodynamically-generated gas film. Rubbing occurs during starts and stops and there is a possibility of an occasional high speed rub. Since titanium is known to have a severe galling tendency in sliding contacts, a 'backup,' self-lubricating coating on the cylinder and/or the piston is needed. This report describes the results of a research program to study the lubrication of Ti6-4 with the following chromium carbide based materials: plasma-sprayed PS212 coatings and sintered PM212 counterfaces. Program objectives are to achieve adherent coatings on Ti6-4 and to measure the friction and wear characteristics of the following sliding combinations under conditions simulative of the Stirling-driven space power linear alternator: Ti6-4/Ti6-4 baseline, Ti6-4/PS212 coated Ti6-4, and Ps212 coated Ti6-4/PM212

  4. Recombinant protein of heptad-repeat HR212, a stable fusion inhibitor with potent anti-HIV action in vitro

    HR212, a recombinant protein expressed in Escherichia coli, has been previously reported to inhibit HIV-1 membrane fusion at low nanomolar level. Here we report that HR212 is effective in blocking laboratory strain HIV-1IIIB entry and replication with EC50 values of 3.92 ± 0.62 and 6.59 ± 1.74 nM, respectively, and inhibiting infection by clinic isolate HIV-1KM018 with EC50 values of 44.44 ± 10.20 nM, as well as suppressing HIV-1-induced cytopathic effect with an EC50 value of 3.04 ± 1.20 nM. It also inhibited HIV-2ROD and HIV-2CBL-20 entry and replication in the μM range. Notably, HR212 was highly effective against T20-resistant strains with EC50 values ranging from 5.09 to 7.75 nM. Unlike T20, HR212 showed stability sufficient to inhibit syncytia formation in a time-of-addition assay, and was insensitive to proteinase K digestion. These results suggest that HR212 has great potential to be further developed as novel HIV-1 fusion inhibitor for treatment of HIV/AIDS patients, particularly for those infected by T20-resistant variants

  5. Deuterated formaldehyde in HH212: physics and chemistry of a typical protostar

    Sahu, Dipen; Chakrabarti, Sandip Kumar; Minh, Young Chol

    2016-07-01

    HH212 is a nearby (400 pc) source in Orion. Recent observation (Codella et al., 2014) with ALMA using 24 no. of 12 m antenna revealed the source with high angular resolution and sensitivity (HPBW=0.65arc × 0.47 arc, σ - 3 to 4 mJy/beam/0.43 km s^-1) than previous SMA observation (Lee et al., 2007). This allows observations of several molecular lines e.g., SO, SO^2, C^{17}O, CO, and SiO. Emissions from these species probe different regions of this young stellar object, e.g., the outflow, the molecular jet, the envelop and the disk. The source might be the Class 0 protostellar system with a Keplerian disc and collimated bipolar SiO jets. Physics and chemistry of this region are very interesting. No deuterated molecule has been reported in this source except the recent report of deuterated water, HDO (Codella et al., 2016). Here, we report the HDCO (deuterated formaldehyde) line observation from ALMA data to probe the inner region of HH212. We compare HDCO line with other molecular lines to explain the possible chemistry and physics of the source, and also discussed the deuterium enrichment of molecular species.

  6. Effective chelators for 90Y and 212Bi radioimmunotherapy of cancer

    Advances in synthesis and evaluation of monoclonal antibody (mAb)-ligand bioconjugates are required to further use of 90Y, 212Bi labeled mAb in cancer therapy. The authors have used ligand 1B4M-DTPA for preparation of 90Y-mAb-anti-TAC for an ongoing clinical trial of treatment of adult T-cell leukemia. Good results have been obtained in that of 10 evaluable patients, two are in complete remission 1 yr after initiation of therapy and six experienced partial remissions. Radiochemical dose was limited by marrow suppression, leading the authors to suspect that some 90Y was reaching bone. For this reason, they have prepared ultra-pure 88Y and thereafter 88Y-mAb conjugates with bifunctional DOTA and CHX-DTPA ligands which they have measured to be thermodynamically stronger for yttrium than the 1B4M ligand. The CHX ligand has also been useful for 212Bi-leukemia therapy in mice

  7. An evaluation of the membership probability of 212 $\\lambda$ Boo stars: I. A Catalogue

    Murphy, Simon J; Gray, Richard O; Cheng, Kwang-Ping; Neff, James E; Koen, Chris; Kuehn, Charles A; Newsome, Ian; Riggs, Quinlin

    2015-01-01

    The literature on the $\\lambda$ Boo stars has grown to become somewhat heterogenous, as different authors have applied different criteria across the UV, optical and infrared regions to determine the membership status of $\\lambda$ Boo candidates. We aim to clear up the confusion by consulting the literature on 212 objects that have been considered as $\\lambda$ Boo candidates, and subsequently evaluating the evidence in favour of their admission to the $\\lambda$ Boo class. We obtained new spectra of $\\sim$90 of these candidates and classified them on the MK system to aid in the membership evaluations. The re-evaluation of the 212 objects resulted in 64 members and 103 non-members of the $\\lambda$ Boo class, with a further 45 stars for which membership status is unclear. We suggest observations for each of the stars in the latter category that will allow them to be confidently included or rejected from the class. Our reclassification facilitates homogenous analysis on group members, and represents the largest co...

  8. Water and acetaldehyde in HH212: The first hot corino in Orion

    Codella, C; Cabrit, S; Podio, L; Bachiller, R; Fontani, F; Gusdorf, A; Lefloch, B; Leurini, S; Tafalla, M

    2016-01-01

    Aims: Using the unprecedented combination of high resolution and sensitivity offered by ALMA, we aim to investigate whether and how hot corinos, circumstellar disks, and ejected gas are related in young solar-mass protostars. Methods: We observed CH$_3$CHO and deuterated water (HDO) high-excitation ($E_{\\rm u}$ up to 335 K) lines towards the Sun-like protostar HH212--MM1. Results: For the first time, we have obtained images of CH$_3$CHO and HDO emission in the inner $\\simeq$ 100 AU of HH212. The multifrequency line analysis allows us to contrain the density ($\\geq$ 10$^{7}$ cm$^{-3}$), temperature ($\\simeq$ 100 K), and CH$_3$CHO abundance ($\\simeq$ 0.2--2 $\\times$ 10$^{-9}$) of the emitting region. The HDO profile is asymmetric at low velocities ($\\leq$ 2 km s$^{-1}$ from $V_{\\rm sys}$). If the HDO line is optically thick, this points to an extremely small ($\\sim$ 20--40 AU) and dense ($\\ge$ 10$^{9}$ cm$^{-3}$) emitting region. Conclusions: We report the first detection of a hot corino in Orion. The HDO asymm...

  9. Water and acetaldehyde in HH212: The first hot corino in Orion

    Codella, C.; Ceccarelli, C.; Cabrit, S.; Gueth, F.; Podio, L.; Bachiller, R.; Fontani, F.; Gusdorf, A.; Lefloch, B.; Leurini, S.; Tafalla, M.

    2016-02-01

    Aims: Using the unprecedented combination of high resolution and sensitivity offered by ALMA, we aim to investigate whether and how hot corinos, circumstellar disks, and ejected gas are related in young solar-mass protostars. Methods: We observed CH3CHO and deuterated water (HDO) high-excitation (Eu up to 335 K) lines towards the Sun-like protostar HH212-MM1. Results: For the first time, we have obtained images of CH3CHO and HDO emission in the inner ≃100 AU of HH212. The multifrequency line analysis allows us to contrain the density (≥107 cm-3), temperature (≃100 K), and CH3CHO abundance (≃0.2-2 × 10-9) of the emitting region. The HDO profile is asymmetric at low velocities (≤2 km s-1 from Vsys). If the HDO line is optically thick, this points to an extremely small (~20-40 AU) and dense (≥109 cm-3) emitting region. Conclusions: We report the first detection of a hot corino in Orion. The HDO asymmetric profile indicates a contribution of outflowing gas from the compact central region, possibly associated with a dense disk wind.

  10. Cellular uptake of {sup 212}BiOCl by Ehrlich ascites cells: A dosimetric analysis

    Roeske, J.C.; Whitlock, J.L.; Harper, P.V.; Rotmensch, J. [Univ. of Chicago, IL (United States); Stinchcomb, T.G. [DePaul Univ., Chicago, IL (United States). Dept. of Physics; Schwartz, J.L. [Univ. of Washington, Seattle, WA (United States). Dept. of Radiation Oncology; Hines, J.J. [Argonne National Lab., IL (United States). Chemistry Div.

    1999-01-01

    Bi-212 is an alpha-emitting radionuclide being investigated as a therapeutic agent in the intraperitoneal treatment of micrometastatic ovarian carcinoma. In evaluating a new therapeutic modality, cell-survival studies are often used as a means of quantifying the biological effects of radiation. In this analysis, Ehrlich ascites cells were irradiated under conditions similar to therapy in various concentrations of Bi-212. Immediately following irradiation, a cell survival assay was performed in which cells were plated and colonies were counted after 10--14 days. Both a macrodosimetric and a microdosimetric approach were used in analyzing these data. These models used as input the fraction of activity within the cell and in solution, the distribution of cell sizes, and the variation of LET along individual alpha-particle tracks. The results indicate that the energy deposited within the nucleus varies significantly among individual cells. There is a small fraction of cell nuclei which receive no hits, while the remaining cells receive energy depositions which can differ significantly from the mean value. These dosimetric parameters are correlated with measured cell survival and will be a useful predictor of outcome for therapeutic doses.

  11. Multiepoch Radio Observations of the Exciting Sources of HH 212 and HH 119

    R. Galván Madrid

    2004-01-01

    Full Text Available Presentamos observaciones de alta resolución angular (- 0.``3 hechas con el Very Large Array a 3.5 cm hacia las regiones de las fuentes excitadoras de dos sistemas Herbig-Haro: HH 212 en Orión y HH 119 en B335. Las observaciones fueron hechas durante tres épocas diferentes con el objetivo de medir posibles variaciones temporales rápidas (en la escala de una semana a un mes en las fuentes. En HH 212 detectamos, promediando las observaciones de las tres épocas, una fuente muy débil justo en la posición esperada para la fuente excitadora del sistema HH. La comparación con otras observaciones de radio de esta fuente indica variación temporal considerable en escala de años. En B335 detectamos en cada época al objeto previamente reportado por otros autores y nuestros resultados sugieren que esta fuente, un chorro térmico de radio, es variable en escalas de tiempo de un mes. Discutimos posibles explicaciones para esta rápida variabilidad.

  12. Expression and modulation of nerve growth factor in murine keratinocytes (PAM 212)

    Nerve growth factor (NGF) is a polypeptide that is required for normal development and maintenance of the sympathetic and sensory nervous systems. Skin has been shown to contain relatively high amounts of NGF, which is in keeping with the finding that the quantity of NGF in a tissue is proportional to the extent of sympathetic innervation of that organ. Since the keratinocyte, a major cellular constituent of the skin, is known to produce other growth factors and cytokines, our experiments were designed to determine whether keratinocytes are a source of NGF. Keratinocyte-conditioned media from the keratinocyte cell line PAM 212 contained NGF-like activity, approximately 2-3 ng/ml, as detected by the neurite outgrowth assay. Freshly isolated BALB/c keratinocytes contained approximately 0.1 ng/ml. Using a cDNA probe directed against NGF, we demonstrated the presence of a 1.3-kb NGF mRNA in both PAM 212 and BALB/c keratinocytes. Since ultraviolet radiation (UV) is a potentially important modulating factor for cytokines in skin, we examined the effect of UV on NGF mRNA expression. Although UV initially inhibited the expression of keratinocyte NGF mRNA (4 h), by 24 h an induction of NGF mRNA was seen. The NGF signal could also be induced by phorbol esters. Thus, keratinocytes synthesize and express NGF, and its expression is modulated by UVB and phorbol esters

  13. Mechanical strength and thermophysical properties of PM212: A high temperature self-lubricating powder metallurgy composite

    Edwards, Phillip M.; Sliney, Harold E.; Dellacorte, Christopher; Whittenberger, J. Daniel; Martineau, Robert R.

    1990-01-01

    A powder metallurgy composite, PM212, composed of metal bonded chromium carbide and solid lubricants is shown to be self-lubricating to a maximum application temperature of 900 C. The high temperature compressive strength, tensile strength, thermal expansion and thermal conductivity data needed to design PM212 sliding contact bearings and seals are reported for sintered and isostatically pressed (HIPed) versions of PM212. Other properties presented are room temperature density, hardness, and elastic modulus. In general, both versions appear to have adequate strength to be considered as sliding contact bearing materials, but the HIPed version, which is fully dense, is much stronger than the sintered version which contains about 20 percent pore volume. The sintered material is less costly to make, but the HIPed version is better where high compressive strength is important.

  14. Evaluation of PS 212 Coatings Under Boundary Lubrication Conditions with an Ester-based Oil to 300 C

    Sliney, Harold E.; Loomis, William R.; Dellacorte, Christopher

    1994-01-01

    High friction and wear of turbine engine components occur during high temperature excursions above the oxidation threshold of the liquid lubricant. This paper reports on research to study the use of a high temperature self lubricating coating, PS 212 for back-up lubrication in the event of failure of the liquid lubricant. Pin on disk tests were performed under dry and boundary-lubricated conditions at disk temperatures up to 300 C. The liquid lubricant was a formulated polyol ester qualified under MIL L-23699. At test temperatures above the oil's thermal degradation level, the use of PS 212 reduced wear, providing a back-up lubricant effect.

  15. Activities of AREVA Med. Extraction and purification of the 212Pb isotope from Thorium for radio-immunotherapy

    After having recalled the definition of radio-immunotherapy (RIT) and the benefits of alpha RIT for the treatment of some cancers, this document explains the choice of the 212-Pb isotope instead of the 212-Bi isotope (the first one has a longer half-life than the second). The Pb isotope in fact progressively transforms itself into the Bi isotope. The production process is evoked with its important steps. A second part reports the first clinic tests performed in the Alabama Centre for the treatment of different cancer (breast, colon, ovarian, pancreas, stomach). Processes and doses are discussed

  16. The microRNA-132/212 family fine-tunes multiple targets in Angiotensin II signalling in cardiac fibroblasts

    Eskildsen, Tilde V; Schneider, Mikael; Sandberg, Maria B; Skov, Vibe; Jensen, Hasse Brønnum; Thomassen, Mads; Kruse, Torben A; Andersen, Ditte Caroline; Sheikh, Søren P

    2015-01-01

    INTRODUCTION: MicroRNAs (miRNAs) are emerging as key regulators of cardiovascular development and disease; however, the cardiac miRNA target molecules are not well understood. We and others have described the Angiotensin II (AngII)-induced miR-132/212 family as novel regulators of cardiovascular ...... pathways that fine-tuned by miR-132/212, suggesting a role for this miRNA family as master signalling switches in cardiac fibroblasts. Our data underscore the potential for miRNA tools to manipulate a large array of molecules and thereby control biological function....

  17. (212)Pb-radioimmunotherapy induces G(2) cell-cycle arrest and delays DNA damage repair in tumor xenografts in a model for disseminated intraperitoneal disease.

    Yong, Kwon Joong; Milenic, Diane E; Baidoo, Kwamena E; Brechbiel, Martin W

    2012-03-01

    In preclinical studies, targeted radioimmunotherapy using (212)Pb-TCMC-trastuzumab as an in vivo generator of the high-energy α-particle emitting radionuclide (212)Bi is proving an efficacious modality for the treatment of disseminated peritoneal cancers. To elucidate mechanisms associated with this therapy, mice bearing human colon cancer LS-174T intraperitoneal xenografts were treated with (212)Pb-TCMC-trastuzumab and compared with the nonspecific control (212)Pb-TCMC-HuIgG, unlabeled trastuzumab, and HuIgG, as well as untreated controls. (212)Pb-TCMC-trastuzumab treatment induced significantly more apoptosis and DNA double-strand breaks (DSB) at 24 hours. Rad51 protein expression was downregulated, indicating delayed DNA double-strand damage repair compared with (212)Pb-TCMC-HuIgG, the nonspecific control. (212)Pb-TCMC-trastuzumab treatment also caused G(2)-M arrest, depression of the S phase fraction, and depressed DNA synthesis that persisted beyond 120 hours. In contrast, the effects produced by (212)Pb-TCMC-HuIgG seemed to rebound by 120 hours. In addition, (212)Pb-TCMC-trastuzumab treatment delayed open chromatin structure and expression of p21 until 72 hours, suggesting a correlation between induction of p21 protein and modification in chromatin structure of p21 in response to (212)Pb-TCMC-trastuzumab treatment. Taken together, increased DNA DSBs, impaired DNA damage repair, persistent G(2)-M arrest, and chromatin remodeling were associated with (212)Pb-TCMC-trastuzumab treatment and may explain its increased cell killing efficacy in the LS-174T intraperitoneal xenograft model for disseminated intraperitoneal disease. PMID:22238365

  18. El Decreto reglamentario de la Ley N° 18.212 (Usura: su ilegitimidad

    Roque Molla

    2010-07-01

    Full Text Available En nuestra entrega para el Tomo XXXIX del Anuario de Derecho Civil Uruguay, ratificamos nuestra opinión vertida en La Pluma No. 29 Junio 2008, en el sentido de que el régimen de la ley 18.212 no es aplicable a la cláusula penal pactada en una compraventa para el caso de resolución del contrato por incumplimiento de la obligación de pagar el precio.La cuestión debe resolverse en función de la materia regulada por la ley.En ese orden de ideas, en el trabajo publicado en el ADCU referido, siguiendo a Emilio Betti, manifestamos: "La materia (ratio legis de la ley es la disciplina de la usura civil y penal abarcativa no solamente de los intereses usurarios sino también de los negocios usurarios en las operaciones de crédito"

  19. Determination of 210Pb and 212Pb in water and their radiological impact to the public via drinking water

    A sensitive and accurate method for determining ultra low-level 210Pb and 212Pb in water samples through double measurements was developed. Pb was pre-concentrated as hydroxides, separated from alkaline earth elements as PbS precipitate, purified by an anion exchange resin chromatography column, precipitated as PbSO4 for source preparation and counted by a low background β-counter. The procedure was checked with IAEA reference materials, and the results agreed well with the recommended values. The minimum detectable activity was 0.062 mBq·L-1 for 210Pb and 0.053 mBq·L-1 for 212Pb with a 48 L water sample. Seventeen drinking water samples were analyzed,with a Pb recovery of 88.8±5.5%, and the typical activity concentrations were 0.191-15.1 mBq·L-1 for 210Pb and of 1.12-5.77 mBq·L-1 for 212Pb. The estimated committed effective doses to adult members of the public in Italy due to intake of 210Pb and 212Pb in drinking water were 0.096-7.59 μSv·a-1 and 0.005-0.025 μSv·a-1, respectively. (authors)

  20. 76 FR 68301 - Airworthiness Directives; Bell Helicopter Textron, Inc. (Bell), Model 205A-1, 205B, 210, and 212...

    2011-11-04

    ... same type designs, this AD supersedes AD 2010-03-03 (75 FR 5681, February 4, 2010), retaining the same... airworthiness directive (AD) for Bell Model 205B and 212 helicopters with certain main rotor blade (blade... of the helicopter. Since issuing AD 2010-03-03 (75 FR 5681, February 4, 2010), we have...

  1. 25 CFR 212.5 - Authority and responsibility of the Office of Surface Mining Reclamation and Enforcement (OSM).

    2010-04-01

    ... regulations for surface coal mining and reclamation operations are found in 30 CFR part 750. Those regulations... § 212.5 Authority and responsibility of the Office of Surface Mining Reclamation and Enforcement (OSM). The OSM is the regulatory authority for surface coal mining and reclamation operations on Indian...

  2. 77 FR 41795 - Exercise of Authority Under Section 212(d)(3)(B)(i) of the Immigration and Nationality Act

    2012-07-16

    ... SECURITY Office of the Secretary Exercise of Authority Under Section 212(d)(3)(B)(i) of the Immigration and...(d)(3)(B)(i) of the Immigration and ] Nationality Act (INA), 8 U.S.C. 1182(d)(3)(B)(i), as amended.... Implementation of this determination will be made by U.S. Citizenship and Immigration Services (USCIS),...

  3. 76 FR 14419 - Exercise of Authority Under Section 212(d)(3)(B)(i) of the Immigration and Nationality Act

    2011-03-16

    ... SECURITY Office of the Secretary Exercise of Authority Under Section 212(d)(3)(B)(i) of the Immigration and...(d)(3)(B)(i) of the Immigration and Nationality Act (INA), 8 U.S.C. 1182(d)(3)(B)(i), as amended, as.... Citizenship and Immigration Services (USCIS), in consultation with U.S. Immigration and Customs...

  4. 76 FR 14418 - Exercise of Authority Under Section 212(d)(3)(B)(i) of the Immigration and Nationality Act

    2011-03-16

    ... SECURITY Office of the Secretary Exercise of Authority Under Section 212(d)(3)(B)(i) of the Immigration and...(d)(3)(B)(i) of the Immigration and Nationality Act (INA), 8 U.S.C. 1182(d)(3)(B)(i), as amended, as... determination will be made by U.S. Citizenship and Immigration Services (USCIS), in consultation with...

  5. 76 FR 2130 - Exercise of Authority Under Section 212(d)(3)(B)(i) of the Immigration and Nationality Act

    2011-01-12

    ... SECURITY Office of the Secretary Exercise of Authority Under Section 212(d)(3)(B)(i) of the Immigration and...(d)(3)(B)(i) of the Immigration and Nationality Act (INA), 8 U.S.C. 1182(d)(3)(B)(i), as amended, as... Immigration Services (USCIS), in consultation with U.S. Immigration and Customs Enforcement (ICE), or by...

  6. 76 FR 2131 - Exercise of Authority Under Section 212(d)(3)(B)(i) of the Immigration and Nationality Act

    2011-01-12

    ... SECURITY Office of the Secretary Exercise of Authority Under Section 212(d)(3)(B)(i) of the Immigration and...(d)(3)(B)(i) of the Immigration and Nationality Act (INA), 8 U.S.C. 1182(d)(3)(B)(i), as amended, as.... Implementation of this determination will be made by U.S. Citizenship and Immigration Services (USCIS),...

  7. 47 CFR 36.212 - Basic local services revenue-Account 5000 (Class B telephone companies); Basic area revenue...

    2010-10-01

    ... Income Accounts Operating Revenues § 36.212 Basic local services revenue—Account 5000 (Class B telephone... 47 Telecommunication 2 2010-10-01 2010-10-01 false Basic local services revenue-Account 5000 (Class B telephone companies); Basic area revenue-Account 5001 (Class A telephone companies)....

  8. 40 CFR 262.212 - Making the hazardous waste determination at an on-site interim status or permitted treatment...

    2010-07-01

    ....212 Making the hazardous waste determination at an on-site interim status or permitted treatment... hazardous waste permit or interim status as soon as it arrives in the on-site treatment, storage or disposal... permitted treatment, storage or disposal facility. (e) If the unwanted material is a hazardous waste,...

  9. Bismuth-212-labeled anti-Tac monoclonal antibody: alpha-particle-emitting radionuclides as modalities for radioimmunotherapy

    Anti-Tac, a monoclonal antibody directed to the human interleukin 2 (IL-2) receptor, has been successfully conjugated to the alpha-particle-emitting radionuclide bismuth-212 by use of a bifunctional ligand, the isobutylcarboxycarbonic anhydride of diethylenetriaminepentaacetic acid. The physical properties of 212Bi are appropriate for radioimmunotherapy in that it has a short half-life, deposits its high energy over a short distance, and can be obtained in large quantities from a radium generator. Antibody specific activities of 1-40 microCi/microgram (1 Ci = 37 GBq) were achieved. Specificity of the 212Bi-labeled anti-Tac was demonstrated for the IL-2 receptor-positive adult T-cell leukemia line HUT-102B2 by protein synthesis inhibition and clonogenic assays. Activity levels of 0.5 microCi or the equivalent of 12 rad/ml of alpha radiation targeted by anti-Tac eliminated greater than 98% the proliferative capabilities of HUT-102B2 cells with more modest effects on IL-2 receptor-negative cell lines. Specific cytotoxicity was blocked by excess unlabeled anti-Tac but not by human IgG. In addition, an irrelevant control monoclonal antibody of the same isotype labeled with 212Bi was unable to target alpha radiation to cell lines. Therefore, 212Bi-labeled anti-Tac is a potentially effective and specific immunocytotoxic reagent for the elimination of IL-2 receptor-positive cells. These experiments thus provide the scientific basis for use of alpha-particle-emitting radionuclides in immunotherapy

  10. Rice OsRAD21-2 is Expressed in Actively Dividing Tissues and its Ectopic Expression in Yeast Results in Aberrant Cell Division and Growth

    Chunyan Gong; Tang Li; Qi Li; Longfeng Yan; Tai Wang

    2011-01-01

    Rad21 and its meiotic counterpart Rec8,the key components of the cohesin complex,are essential for sister chromatid cohesion and chromosome segregation in mitosis and meiosis,respectively.In contrast to yeast and vertebrates,which have only two RAD21/REC8 genes,the rice genome encodes four Rad21/Rec8 proteins.Here,we report on the cloning and characterization of OsRAD21-2 from rice (Oryza sativa L.).Phylogenetic analysis of the full-length amino acids showed that OsRad21-2 was grouped into the plant-specific Rad21 subfamily.Semi-quantitative reverse transcription-polymerase chain reaction revealed OsRAD21-2 preferentially expressed in premeiotic flowers.Further RNA in situ hybridization analysis and promoter::β-glucuronidase staining indicated that OsRAD21-2 was mainly expressed in actively dividing tissues including premeiotic stamen,stem intercalary meristem,leaf meristem,and root pericycle.Ectopic expression of OsRAD21-2 in fission yeast resulted in cell growth delay and morphological abnormality.Flow cytometric analysis revealed that the OsRAD21-2-expressed cells were arrested in G2 phase.Our results suggest that OsRad21-2 functions in regulation of cell division and growth.

  11. The Effect of Dorsal Hippocampal α2-Adrenegic Receptors on WIN55,212-2 State-Dependent Memory of Passive Avoidance

    Zarrindast M.R.

    2010-09-01

    Full Text Available Background and Objectives: Cannabinoids are a class of psychoactive compounds that produce a wide array of effects in a large number of species. In the present study, the effects of bilateral intra-CA1 injections of an α2-adrenergic receptor agents, on WIN55,212-2 state-dependent learning were examined in adult male Wistar rats. Methods: The animals were bilaterally implanted with chronic cannulae in the CA1 regions of the dorsal hippocampus, trained in a step-down type inhibitory avoidance task, and tested 24h after training to measure step-down latency.Results: Post-training intra-CA1 injection of WIN55,212-2 (0.25 and 0.5µg/rat induced impairment of memory retention. Amnesia produced by post-training WIN55,212-2 (0.5µg/rat was reversed by pre-test administration of the same dose of WIN55,212-2 that is due to a state-dependent effect. Pre-test intra-CA1 injection of clonidine (0.5 and 0.75µg/rat, intra-CA1 improved post-training WIN55,212-2 (0.5µg/rat, intra-CA1-induced retrieval impairment, while pre-test intra-CA1 injection of yohimbine (1µg/rat, intra-CA1 2min before the administration of WIN55,212-2 (0.5µg/rat, intra-CA1 inhibited WIN55,212-2 state-dependent memory. Conclusion: These results suggest that α2-adrenergic receptors of the dorsal hippocampal CA1 regions may play an important role in Win55,212-2-induced amnesia and WIN55,212-2 state-dependent memory.

  12. Production and in vivo imaging of (203)Pb as a surrogate isotope for in vivo (212)Pb internal absorbed dose studies.

    Máthé, Domokos; Szigeti, Krisztián; Hegedűs, Nikolett; Horváth, Ildikó; Veres, Dániel S; Kovács, Béla; Szűcs, Zoltán

    2016-08-01

    (212)Pb is a clinically relevant therapeutic alpha emitter isotope. A surrogate, (203)Pb, if prepared with sufficiently high specific activity could be used to estimate (212)Pb in vivo absorbed doses. An improved production procedure of (203)Pb with a simple, new separation method and high specific radioactivity for imaging is reported. We determined the in-vivo biodistribution of (203)Pb in mice by SPECT/CT. This highlights application possibilities of (203)Pb for further in vivo and clinical uses (radiolabeled (212)Pb-peptide co-injection, dosimetry calculation). PMID:27156049

  13. Fractal structure in the scalar λ(φ2-1)2 theory

    Head-on collisions of kink and antikink solitons are investigated numerically in the classical one-dimensional λ(φ2-1)2 model. It is shown that whether a kink-antikink interaction settles to a bound state or a two-soliton solution depends ''fractally'' on the impact velocity. We discuss the results using the framework of perturbation theory which helps to clarify the nature of the fractal structure in terms of resonances with the internal shape mode oscillations. We also review the technique of collective coordinates used to reduce the infinite-dimensional system to one with just two degrees of freedom. Although we do not expect exact agreement by using such a simplification, we show that the reduced system bears a striking qualitative resemblance to the full infinite-dimensional system, reproducing the fractal structure. The maximum Lyapunov exponents are computed for the bound-state oscillations and found to be ∼0.3 for both the full and reduced systems, demonstrating the chaotic nature of the bound state

  14. A 140 GHz pulsed EPR/212 MHz NMR spectrometer for DNP studies

    Smith, Albert A.; Corzilius, Björn; Bryant, Jeffrey A.; DeRocher, Ronald; Woskov, Paul P.; Temkin, Richard J.; Griffin, Robert G.

    2012-10-01

    We described a versatile spectrometer designed for the study of dynamic nuclear polarization (DNP) at low temperatures and high fields. The instrument functions both as an NMR spectrometer operating at 212 MHz (1H frequency) with DNP capabilities, and as a pulsed-EPR operating at 140 GHz. A coiled TE011 resonator acts as both an NMR coil and microwave resonator, and a double balanced (1H, 13C) radio frequency circuit greatly stabilizes the NMR performance. A new 140 GHz microwave bridge has also been developed, which utilizes a four-phase network and ELDOR channel at 8.75 GHz, that is then multiplied and mixed to obtain 140 GHz microwave pulses with an output power of 120 mW. Nutation frequencies obtained are as follows: 6 MHz on S = 1/2 electron spins, 100 kHz on 1H, and 50 kHz on 13C. We demonstrate basic EPR, ELDOR, ENDOR, and DNP experiments here. Our solid effect DNP results demonstrate an enhancement of 144 and sensitivity gain of 310 using OX063 trityl at 80 K and an enhancement of 157 and maximum sensitivity gain of 234 using Gd-DOTA at 20 K, which is significantly better performance than previously reported at high fields (⩾3 T).

  15. Production and optimization of curdlan produced by Pseudomonas sp. QL212.

    Yang, Min; Zhu, Ying; Li, Yumei; Bao, Jie; Fan, Xiangyu; Qu, Yanhong; Wang, Yiwei; Hu, Zhiheng; Li, Qiang

    2016-08-01

    Curdlan is a polysaccharide that consists of β-1,3-linked glucose residues. A polysaccharide-producing bacterium isolated from soil samples was identified as Pseudomonas sp. QL212. The polysaccharide was purified to homogeneity via sequential ethanol precipitation, deproteinization, CM ion-exchange, and gel chromatography sequentially. Analysis of the purified polysaccharide revealed that it consisted of many glucosyl residues, and its molecular weight was only 6.18×10(5)Da. This low molecular weight endowed it with excellent solubility. Infrared and nuclear magnetic resonance spectral analysis confirmed that the polysaccharide was curdlan. Single-factor and Response surface methodology experiments were used to optimize the culture medium and conditions. The optimal culture conditions consisted of seed culture age of 12h, and an incubation temperature of 30°C, with 10% inoculum and a total fluid volume of 75mL in a 250-mL Erlenmeyer flask. The maximum curdlan yield of about 5.92gL(-1) was achieved with an optimal medium consisting of 30.11gL(-1) of sucrose, 5.94gL(-1) of yeast extract, and an initial pH of 8.03. To our best knowledge, this is the highest reported yield of curdlan produced by Pseudomonas sp., and the curdlan production medium components were much simpler than those in previous reports. PMID:27086290

  16. Jet Motion, Internal Working Surfaces, and Nested Shells in the Protostellar System HH 212

    Lee, Chin-Fei; Zhang, Qizhou; Shang, Hsien; Ho, Paul T P; Mizuno, Yosuke

    2015-01-01

    HH 212 is a nearby (400 pc) highly collimated protostellar jet powered by a Class 0 source in Orion. We have mapped the inner 80" (~ 0.16 pc) of the jet in SiO (J=8-7) and CO (J=3-2) simultaneously at ~ 0.5 resolution with the Atacama Millimeter/Submillimeter Array at unprecedented sensitivity. The jet consists of a chain of knots, bow shocks, and sinuous structures in between. As compared to that seen in our previous observations with the Submillimeter Array, it appears to be more continuous, especially in the northern part. Some of the knots are now seen associated with small bow shocks, with their bow wings curving back to the jet axis, as seen in pulsed jet simulations. Two of them are reasonably resolved, showing kinematics consistent with sideways ejection, possibly tracing the internal working surfaces formed by a temporal variation in the jet velocity. In addition, nested shells are seen in CO around the jet axis connecting to the knots and bow shocks, driven by them. The proper motion of the jet is e...

  17. Study on the performance of Nafion 212 membrane in polymeric electrolyte fuel cells operating with air; Estudo do desempenho da membrana de Nafion 212 em celulas a combustivel de eletrolito polimerico operando com ar

    Fernandes, Adriano C.; Ticianelli, Edson Antonio [Universidade de Sao Paulo (USP), Sao Carlos, SP (Brazil). Inst. de Quimica]. E-mail: edsont@iqsc.usp.br

    2008-07-01

    The operational characteristics of the Nafion 212 membrane (N212) were investigated and compared to the Nafion 112 membrane (N112), both 50 thick, in polymer electrolyte fuel cell (PEFC). The polarization measurements were performed changing the cell and gases humidification temperature and the gases pressure. The kinetic parameters obtained from the polarization curve proved that the cell with membrane N212 showed better performance than membrane N112, when they operating with air at cathode. The electrochemical impedance studies were carried out to make clear the polarization phenomena due to the resistive and diffusive effects that limit the cell performance. At high frequency region is found an arc, which dimension in depends on the current density, whereas at the mid frequency region we can find two loops with different characteristics and both dependent of current density. This behavior becomes evident that there are polarization components linked to resistive processes at high frequency, as well as charge transference and diffusional at mid and low frequency, respectively. (author)

  18. Drug Survival and reasons for discontinuation of intramuscular methotrexate: a study of 212 consecutive patients switching from oral methotrexate

    Linde, Louise; Hetland, Merete Lund; Østergaard, Mikkel

    2006-01-01

    Drug survival and reasons for discontinuation of intramuscular methotrexate: a study of 212 consecutive patients switching from oral methotrexate.Linde L, Hetland ML, Ostergaard M. Department of Rheumatology, Copenhagen University Hospital, Hvidovre Hospital, Hvidovre, Denmark. louiselinde......@dadlnet.dk OBJECTIVES: To assess the drug survival and reasons for discontinuation of intramuscular methotrexate (imMTX) in rheumatological patients who had switched to imMTX from oral methotrexate (oMTX). METHODS: Data from 212 consecutive patients who switched from oMTX to imMTX therapy at our outpatient clinic...... had stopped oMTX because of adverse events, 22% also withdrew from imMTX because of adverse events. CONCLUSION: Half of the patients benefited from switching from oral to intramuscular methotrexate for at least 6 months, but only a minority adhered to the treatment for years. Lack of efficacy was the...

  19. Quantum yield of Cl∗ (21/2) production in the gas phase photolysis of CCl4 in the ultraviolet

    Manish Tak; Manabendra Chandra; Dulal Senapati; Puspendu K Das

    2006-07-01

    In this paper, we have probed the dynamics of chlorine atom production from the gas phase photodissociation of carbon tetrachloride at 222 and 235 nm. The quantum yield, * of Cl∗ (21/2) production has been determined by probing the nascent concentrations of both excited (21/2) and ground state (23/2) chlorine atoms by suitable resonance-enhanced multiphoton ionization (REMPI) detection schemes. Although at the photolysis wavelengths the absorption of carbon tetrachloride is weak, significant amounts of Cl∗ are produced. Surprisingly, the quantum yield of Cl∗ production does not follow the absorption spectrum closely, which gives rise to the possibility of an indirect dissociation mechanism present in CCl4 along with direct dissociation at these ultraviolet wavelengths.

  20. Nuclear g-factor measurements of the (9/2)- and (21/2)- isomeric states in 173Ta

    The nuclear g-factors of the one-quasiparticle isomeric state (9/2)- at 165.8 keV and the three-quasiparticle isomeric state (21/2)- at 1713.2 keV in 173Ta nuclei have been measured using the time differential perturbed angular distribution technique. The nuclear reaction 165Ho(12C, 4nγ)173Ta was used to populate these isomeric states, and the recoiling 173Ta nuclei were implanted into a thick tantalum backing in the presence of a 7.04(4) kG external magnetic field. The measured value g((9/2)-) = +0.591(18) shows that the (9/2)- isomeric state is not a pure single-particle state but may have a collective contribution due to the octupole excitation of the core. Based on the measured value g((21/2)-) = + 0.620(15) and multi-quasiparticle calculations, the (21/2)- isomeric state is assigned a mixed configuration: π3((9/2)-[514], (7/2)+[404] (5/2)+[402]) (39%) and π1((7/2)+[404])(multiply-in-circle sign) ν2((7/2)-[514], (7/2)+[633]) (61%)

  1. Oxygen Sensing via the Ethylene Response Transcription Factor RAP2.12 Affects Plant Metabolism and Performance under Both Normoxia and Hypoxia.

    Paul, Melanie Verena; Iyer, Srignanakshi; Amerhauser, Carmen; Lehmann, Martin; van Dongen, Joost T; Geigenberger, Peter

    2016-09-01

    Subgroup-VII-ethylene-response-factor (ERF-VII) transcription factors are involved in the regulation of hypoxic gene expression and regulated by proteasome-mediated proteolysis via the oxygen-dependent branch of the N-end-rule pathway. While research into ERF-VII mainly focused on their role to regulate anoxic gene expression, little is known on the impact of this oxygen-sensing system in regulating plant metabolism and growth. By comparing Arabidopsis (Arabidopsis thaliana) plants overexpressing N-end-rule-sensitive and insensitive forms of the ERF-VII-factor RAP2.12, we provide evidence that oxygen-dependent RAP2.12 stability regulates central metabolic processes to sustain growth, development, and anoxic resistance of plants. (1) Under normoxia, overexpression of N-end-rule-insensitive Δ13RAP2.12 led to increased activities of fermentative enzymes and increased accumulation of fermentation products, which were accompanied by decreased adenylate energy states and starch levels, and impaired plant growth and development, indicating a role of oxygen-regulated RAP2.12 degradation to prevent aerobic fermentation. (2) In Δ13RAP2.12-overexpressing plants, decreased carbohydrate reserves also led to a decrease in anoxic resistance, which was prevented by external Suc supply. (3) Overexpression of Δ13RAP2.12 led to decreased respiration rates, changes in the levels of tricarboxylic acid cycle intermediates, and accumulation of a large number of amino acids, including Ala and γ-amino butyric acid, indicating a role of oxygen-regulated RAP2.12 abundance in controlling the flux-modus of the tricarboxylic acid cycle. (4) The increase in amino acids was accompanied by increased levels of immune-regulatory metabolites. These results show that oxygen-sensing, mediating RAP2.12 degradation is indispensable to optimize metabolic performance, plant growth, and development under both normoxic and hypoxic conditions. PMID:27372243

  2. Experimental study of neonlike zinc J=0-1 soft X-ray lasing at 21.2 nm

    Rus, B.; Carillon, A.; Dhez, P.; Gauthé, B.; Goedtkindt, P.; Jaeglé, P.; Jamelot, G.; Klisnick, A.; Nantel, M.; Sureau, A.; Zeitoun, P.

    1995-05-01

    Since our first observation of intense J=0-1 lasing in neonlike zinc in early 1993, we have investigated various issues of this X-ray laser. The results of these experiments, performed at Laboratoire pour l'Utilisation des Lasers Intenses (LULI), are briefly reviewed. Gain coefficients of ˜5 cm-1 at 21.2 nm are now routinely obtained with ≊350 J delivered onto a Zn slab in ˜650 ps pulses—the net irradiance is ˜1.4×1013 W cm-2. The 21.2 nm emission appears in a ≊100 ps burst and precedes the lasing on the J=2-1 transitions at 26.2 and 26.7 nm which have a duration ≊350 ps. We have directly measured the gain regions of the J=0-1 line at 21.2 nm and the J=2-1 line at 26.7 nm and confirmed the initial claim that they are located at different distances from the target. We have also measured the refraction angles and divergences of the XRL beams of these two transitions. The beam at 21.2 nm was observed to be remarkably narrow with a divergence of ˜2.6 mrad, peaking ˜7 mrad off-axis. This contrasts to the beam at 26.7 nm which has a divergence of ≊10 mrad and peaks at ˜15 mrad. The most recent finding is that the J=0-1 lasing exists only when the main pump pulse is preceded by a pulse train of mJ level, which is a remnant from the laser oscillator. An important achievement in developing the XRL at 21.2 nm was the demonstration of half-cavity operation: with a gain-length product of ˜16.5, the emission exhibits saturation behavior. The absolute energy measurements indicate ˜400 μJ in the near-saturated beam.

  3. The new version 2.12 of BKG Ntrip Client (BNC)

    Stürze, Andrea; Mervart, Leos; Weber, Georg; Rülke, Axel; Wiesensarter, Erwin; Neumaier, Peter

    2016-04-01

    A new version of the BKG Ntrip Client (BNC) has been released. Originally developed in cooperation of the Federal Agency for Cartography and Geodesy (BKG) and the Czech Technical University (CTU) with a focus on multi-stream real-time access to GPS observations, the software has once again been substantially extended. Promoting Open Standards as recommended by the Radio Technical Commission for Maritime Services (RTCM) remains the prime subject. Beside its Graphical User Interface (GUI), the real-time software for Windows, Linux, Mac, and Linux platforms now comes with complete Command Line Interface (CLI) and considerable post processing functionality. RINEX Version 3 file editing & Quality Check (QC) with full support of Galileo, BeiDou, and SBAS - besides GPS and GLONASS - is part of the new features. Comparison of satellite orbit/clock files in SP3 format is another fresh ability of BNC. Simultaneous multi-station Precise Point Positioning (PPP) for real-time displacement-monitoring of entire reference station networks is one more recent addition to BNC. Implemented RTCM messages for PPP (under development) comprise satellite orbit and clock corrections, code and phase observation biases, and the Vertical Total Electron Content (VTEC) of the ionosphere. The well established, mature codebase is mostly written in C++ language. Its publication under GNU GPL is thought to be well-suited for test, validation and demonstration of new approaches in precise real-time satellite navigation when IP streaming is involved. The poster highlights BNC features which are new in version 2.12 and beneficial to IAG institutions and services such as IGS/RT-IGS and to the interested public in general.

  4. A new nonsyndromic X-linked sensorineural hearing impairment linked to Xp21.2

    Lalwani, A.K.; Brister, J.R.; Fex, J.; Grundfast, K.M.; Pikus, A.T.; Ploplis, B.; San Agustin, T.; Skarka, H.; Wilcox, E.R. [National Institutes of Health, Bethesda, MD (United States)

    1994-10-01

    X-linked deafness is a rare cause of hereditary hearing impairment. We have identified a family with X-linked dominant sensorineural hearing impairment, characterized by incomplete penetrance and variable expressivity in carrier females, that is linked to the Xp21.2, which contains the Duchenne muscular dystrophy (DMD) locus. The auditory impairment in affected males was congenital, bilateral, profound, sensorineural, affecting all frequencies, and without evidence of radiographic abnormality of the temporal bone. Adult carrier females manifested bilateral, mild-to-moderate high-frequency sensorineural hearing impairment of delayed onset during adulthood. Eighteen commercially available polymorphic markers from the X chromosome, generating a 10-15-cM map, were initially used for identification of a candidate region. DXS997, located within the DMD gene, generated a two-point LOD score of 2.91 at {theta} = 0, with every carrier mother heterozygous at this locus. Recombination events at DXS992 (located within the DMD locus, 3{prime} to exon 50 of the dystrophin gene) and at DXS1068 (5{prime} to the brain promoter of the dystrophin gene) were observed. No recombination events were noted with the following markers within the DMD locus: 5{prime}DYS II, intron 44, DXS997, and intron 50. There was no clinical evidence of Duchenne or Becker muscular dystrophy in any family member. It is likely that this family represents a new locus on the X chromosome, which when mutated results in nonsyndromic sensorineural hearing loss and is distinct from the heterogeneous group of X-linked hearing losses that have been previously described. 57 refs., 6 figs., 1 tab.

  5. FTIR Studies of Internal Water Molecules of Bacteriorhodopsin: Structural Analysis of Halide-bound D85S and D212N Mutants in the Schiff Base Region

    Shibata, Mikihiro; Kandori, Hideki

    2007-12-01

    Bacteriorhodopsin (BR), a membrane protein found in Halobacterium salinarum, functions as a light-driven proton pump. The Schiff base region has a quadropolar structure with positive charges located at the protonated Schiff base and Arg82, and counterbalancing negative charges located at Asp85 and Asp212 (Figure 1A). It is known that BR lacks a proton-pumping activity if Asp85 or Asp212 is neutralized by mutation. On the other hand, binding of C1- brings different effects for pumping functions in mutants at D85 and D212 position. While C1--bound D85T and D85S pump C1-, photovoltage measurements suggested that C1--bound D212N pumps protons at low pH. In this study, we measured low-temperature FTIR spectra of D85S and D212N containing various halides to compare the halide binding site of both proteins. In the case of D85S, the N-D stretching vibrations of the Schiff base were halide-dependent. This result suggests that the halide is a hydrogen-bond acceptor of the Schiff base, being consistent with the X-ray crystal structure. On the other hand, no halide dependence was observed for vibrational bands of the retinal skeleton and the Schiff base in the D212N mutant. This result suggests that the halide does not form a hydrogen bond with the Schiff base directly, unlike the mutation at D85 position. Halide-dependent water bands in the Schiff base region also differ between D85S and D212N. From these results, halide binding site of both proteins and role of two negative charges in BR will be discussed.

  6. Temperature dependence of gamma ray induced luminescence of ethanolamine based liquid scintillator between 212 and 273 K

    The luminescence response of ethanolamine based liquid scintillator (Ethanolamine + 1g/l Butyle PBD + 0.1g/l BBOT) has been investigated as a function of temperature in the range 212-273 K. It has been observed that under gamma excitation the scintillation efficiency increases by a factor of 1.37 with decrease in temperature. The data obtained conforms to Arrhenius relation in which activation energy of rate process (.20 ev) is typical for thermal activated diffusion controlled process. (author)

  7. Density-functional study of structural and electronic properties of AlnN(n=2-12) clusters

    The lowest energy structures and electronic properties of AlnN(n=2-12) clusters were studied using density-functional theory. The equilibrium geometries of AlnN clusters with up to n=12 were determined from a number of possible structural isomers at each size. The Al7N cluster was found be particularly stable with higher binding energy and larger electronic gap. For all the AlnN clusters studied, we found charge transfers from the Al to N site and co-existence of ionic and covalent bonding characteristics

  8. Ground- state structure and stabilities of Mon (n=2-12) clusters%Mon(n=2-12)团簇的基态结构及其稳定性

    张红美; 孔德国; 王玉梅

    2012-01-01

    从第一性原理出发,对Mon(n=2-12)团簇的最低能量结构和电子性质进行了研究.计算结果表明,Mon的最低能量结构可以看成是在Mon-1的基础上戴帽一个Mo原予生长而成.综合团簇的平均结合能和能隙可知,n=3,6,8,10时团簇的基态稳定性较高.%The geometric configuration and electronic structure of Mo. (n = 2- 12) clusters have been studied by using density functional theory. The results indicated that the lowest energy structure of Mon cluster may be seen as the Mon-1 elustercapping one Mo atom. The calculated results on the averaged binding energy and the HOMO - LUMO gap of the Mon (n=2-12) clusters indicate that the relative stabilities of Mo3 ,Mo6 ,Mo8 and Mo10are stronger than clusters of other sizes.

  9. Determination of 55Mn(n,γ) reaction cross-section at the neutron energies of 1.12 and 2.12 MeV

    In the present work, we determine the 55Mn(n,γ)56Mn reaction cross-section at the neutron energies of 1.12 and 2.12 MeV by using the off-line γ-ray spectrometric technique. The (n,γ) reaction cross-section 55Mn as a function of neutron energy was also calculated using nuclear reaction modular code TALYS-1.6 and compared with the present experimental data at 1.12 and 2.12 MeV as well as the literature data at other neutron energies

  10. Evaluation of the MICAST #2-12 AI-7wt%Si Sample Directionally Solidified Aboard the International Space Station

    Tewari, Surendra N.; Ghods, Masoud; Angart, Samuel G.; Lauer, Mark; Grugel, Richard N.; Poirier, David R.

    2016-01-01

    The US team of the European led "MIcrostructure Formation in CASTing of Technical Alloys under Diffusive and Magnetically Controlled Convective Conditions" (MICAST) program recently received a third Aluminum - 7wt% silicon alloy that was processed in the microgravity environment aboard the International Space Station. The sample, designated MICAST#2-12, was directionally solidified in the Solidification with Quench Furnace (SQF) at a constant rate of 40micometers/s through an imposed temperature gradient of 31K/cm. Procedures taken to evaluate the state of the sample prior to sectioning for metallographic analysis are reviewed and rational for measuring the microstructural constituents, in particular the primary dendrite arm spacing (Lambda (sub1)), is given. The data are presented, put in context with the earlier samples, and evaluated in view of a relevant theoretical model.

  11. Measurement of the Electric Quadrupole Moment of the 9/2- and 21/2- Isomers in 173Ta

    The electric quadrupole moments of the 9/2- and 21/2- isomeric states of 173Ta at 165.8 keV and 1713.2 keV, respectively, were measured as Q(9/2-)=2.92(15) b and Q(21/2-)=6.23(18) b for the first time using the TDPAD technique. A 66 MeV pulsed 12C ion beam from the 15UD pelletron accelerator facility of the Nuclear Science Centre at New Delhi was used in the reaction 165Ho(12C, 4nγ)173Ta. The experimental values of equilibrium deformations β2(9/2-)=0.251(7) and β2(21/2-)=0.391(7) were extracted

  12. 21 CFR 212.71 - What actions must I take if a batch of PET drug product does not conform to specifications?

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false What actions must I take if a batch of PET drug... Acceptance § 212.71 What actions must I take if a batch of PET drug product does not conform to specifications? (a) Rejection of nonconforming product. You must reject a batch of a PET drug product that...

  13. 8 CFR 1003.44 - Special motion to seek section 212(c) relief for aliens who pleaded guilty or nolo contendere to...

    2010-01-01

    ... basis of a crime that is an aggravated felony, except as provided in 8 CFR 1212.3(f)(4). (d) Effect of... or removal, and who are eligible to apply for relief under former section 212(c) of the Act and 8 CFR... adjudicated under the standards of this section and 8 CFR 1212.3. This section is not applicable with...

  14. 42 CFR 436.212 - Individuals who would be eligible for cash assistance if the State plan for OAA, AFDC, AB, APTD...

    2010-10-01

    ... may provide Medicaid to individuals who would meet the Federal definition of disability, 45 CFR 233.80... assistance if the State plan for OAA, AFDC, AB, APTD, or AABD were as broad as allowed under the Act. 436.212... cash assistance if the State plan for OAA, AFDC, AB, APTD, or AABD were as broad as allowed under...

  15. Polymorphisms in a Putative Enhancer at the 10q21.2 Breast Cancer Risk Locus Regulate NRBF2 Expression

    Darabi, Hatef; McCue, Karen; Beesley, Jonathan;

    2015-01-01

    Genome-wide association studies have identified SNPs near ZNF365 at 10q21.2 that are associated with both breast cancer risk and mammographic density. To identify the most likely causal SNPs, we fine mapped the association signal by genotyping 428 SNPs across the region in 89,050 European and 12,...

  16. Observation of atmospheric 210Pb and 212Pb originating from the 2004 eruptive activity of Asama volcano, Japan, and relevant 222Rn releasing from the erupting magma

    This paper describes a study of observation of atmospheric 210Pb and 212Pb possibly from the volcano (36 deg N, 138 deg E) activity in the title and of measurement of 222Rn releasing efficiency with the ash-fall deposit collected around the period. The aerosol sample was collected from Sep. 1, an eruption day, on a building terrace (10 m high) of Meiji University at Kawasaki, located at 140 km SE of the volcano, every 24 hr on the glass fiber filter using a high volume air sampler. The filter was cut out to 4 disks, which were packed into acrylic canisters with a window of a thin Mylar film for non-destructive γ-ray measurement. 210Pb and 212Pb radioactivities were determined by the 46.5- and 238.6-keV γ-rays with an LEPS (low energy photon spectrometer) and an HPGe spectrometer, respectively. The ash-fall sample from the eruption Sep. 14, was collected at Kanrakumachi, Gunma Pref., 40 km SE of the volcano, and measurement for the growth curve of 222Rn from the fall started 1 week after the eruption. A well-type HPGe spectrometer was used for determination of the 351.9-keV γ-ray of 222Rn from 214Pb in equilibrium, which was normalized by the 911.1-keV 228Ac γ-ray. 210Pb and 212Pb emitted into the atmosphere were suggested to have been transported 140 km within the time of a few times of the 212Pb half life (10.6 hr) on the northerly wind. 210Pb and 212Pb, and 222Rn were suggested to be a possibly useful tool of monitoring magmatic activities. (S.I.)

  17. Estimation of the Arctic aerosols from local and long-range transport using relationships between 210Pb and 212Pb atmospheric activity concentrations

    In this study, the aerosol activity concentrations of 210Pb at 28 Canadian radiological monitoring stations from 2009 to 2013 were analyzed. The results show that the ratio of 210Pb winter average concentration to summer average concentration increases with increasing latitude. This could be used to evaluate the transport of pollutants to the Arctic region such as the Arctic haze from Eurasia through long-range atmospheric transport during winter. Based on 12 years of monitoring results from the Yellowknife station that includes both 210Pb and 212Pb concentrations, the study confirms that the seasonal distribution of 210Pb to 212Pb activity concentration ratios has a significant peak in winter and a relatively low value in summer, which can be used as an indicator of the air mass flow to the Arctic. The period dominated by long-range aerosol transport and Arctic haze was estimated by fitting a Gaussian distribution function to the peak values of this ratio in winter. A peak width parameter of full width at half maximum (FWHM) allows a year by year estimate of the period of influence by long-range transport of aerosols, and this varied between 67 and 88 days in this study. The fitted Gaussian peak also shows that the season of the continental influenced air mass in Yellowknife usually starts in mid-to-late November and ends in mid-to-late April. Thus, the 210Pb to 212Pb ratio distributions may enable the determination of periods dominated by long-range aerosol transport and the scale of the Arctic haze at different latitudes. - Highlights: • Twelve years 210Pb/212Pb monitoring results from low to high altitude are presented. • The 210Pbwinter/210Pbsummer ratio increases clearly with latitude of monitoring site. • The pollutant transport to the Arctic is estimated by distribution 210Pb/212Pb ratio. • The time scale of long-range transport aerosol bearing 210Pb to Arctic is reported

  18. Involvement of PPAR receptors in the anticonvulsant effects of a cannabinoid agonist, WIN 55,212-2.

    Payandemehr, Borna; Ebrahimi, Ali; Gholizadeh, Ramtin; Rahimian, Reza; Varastehmoradi, Bardia; Gooshe, Maziar; Aghaei, Hossein Nayeb; Mousavizadeh, Kazem; Dehpour, Ahmad Reza

    2015-03-01

    Cannabinoid and PPAR receptors show well established interactions in a set of physiological effects. Regarding the seizure-modulating properties of both classes of receptors, the present study aimed to evaluate the roles of the PPAR-gamma, PPAR-alpha and CB1 receptors on the anticonvulsant effects of WIN 55,212-2 (WIN, a non selective cannabinoid agonist). The clonic seizure thresholds after intravenous administration of pentylenetetrazole (PTZ) were assessed in mice weighing 23-30 g. WIN increased the seizure threshold dose dependently. Pretreatment with pioglitazone, as a PPARγ agonist, potentiated the anticonvulsant effects of WIN, while PPARγ antagonist inhibited these anticonvulsant effects partially. On the other hand PPARα antagonist reduced the anticonvulsant effects of WIN significantly. Finally the combination of CB1 antagonist and PPARα antagonist could completely block the anticonvulsant properties of WIN. Taken together, these results show for the first time that a functional interaction exists between cannabinoid and PPAR receptors in the modulation of seizure susceptibility. PMID:25448777

  19. Discovery of Very High Energy gamma-rays from 1ES1011+496 at z=0.212

    Albert, J; Anderhub, H; Antoranz, P; Armada, A; Baixeras, C; Barrio, J A; Bartko, H; Bastieri, D; Becker, J K; Bednarek, W; Berger, K; Bigongiari, C; Biland, A; Böck, R K; Bordas, P; Bosch-Ramon, V; Bretz, T; Britvitch, I; Camara, M; Carmona, E; Chilingarian, A; Coarasa, J A; Commichau, S; Contreras, J L; Cortina, J; Costado, M T; Curtef, V; Danielyan, V; Dazzi, F; De Angelis, A; Delgado, C; De los Reyes, R; De Lotto, B; Domingo-Santamaria, E; Dorner, D; Doro, M; Errando, M; Fagiolini, M; Ferenc, D; Fernández, E; Firpo, R; Flix, J; Fonseca, M V; Font, L; Fuchs, M; Galante, N; Garcia-Lopez, R J; Garczarczyk, M; Gaug, M; Giller, M; Göbel, F; Hakobyan, D; Hayashida, M; Hengstebeck, T; Herrero, A; Höhne, D; Hose, J; Hsu, C C; Jacon, P; Jogler, T; Kosyra, R; Kranich, D; Kritzer, R; Laille, A; Lindfors, E; Lombardi, S; Longo, F; López, J; López, M; Lorenz, E; Majumdar, P; Maneva, G; Mannheim, K; Mansutti, O; Mariotti, M; Mart, M; Mazin, D; Merck, C; Meucci, M; Meyer, M; Miranda, J M; Mirzoyan, R; Mizobuchi, S; Moralejo, A; Nieto, D; Nilsson, K; Ninkovic, J; Ona-Wilhelmi, E; Otte, N; Oya, I; Paneque, D; Panniello, M; Paoletti, R; Paredes, J M; Pasanen, M; Pascoli, D; Pauss, F; Pegna, R; Perlman, E; Persic, M; Peruzzo, L; Piccioli, A; Prandini, E; Puchades, N; Raymers, A; Rhode, W; Rib, M; Rico, J; Rissi, M; Robert, A; Rugamer, S; Saggion, A; Saitô, T; Sánchez, A; Sartori, P; Scalzotto, V; Scapin, V; Schmitt, R; Schweizer, T; Shayduk, M; Shinozaki, K; Shore, S N; Sidro, N; Sillanpa, A; Sobczynska, D; Stamerra, A; Stark, L S; Takalo, L; Tavecchio, F; Temnikov, P; Tescaro, D; Teshima, M; Torres, D F; Turini, N; Vankov, H; Vitale, V; Wagner, R M; Wibig, T; Wittek, W; Zandanel, F; Zanin, R; Zapatero, J

    2007-01-01

    We report on the discovery of Very High Energy (VHE) gamma-ray emission from the BL Lacertae object 1ES1011+496. The observation was triggered by an optical outburst in March 2007 and the source was observed with the MAGIC telescope from March to May 2007. Observing for 18.7 hours we find an excess of 6.2 sigma with an integrated flux above 200GeV of (1.58$\\pm0.32)\\cdot 10^{-11}$ photons cm$^{-2}$ s$^{-1}$. The VHE gamma-ray flux is >40% higher than in March-April 2006 (reported elsewhere), indicating that the VHE emission state may be related to the optical emission state. We have also determined the redshift of 1ES1011+496 based on an optical spectrum that reveals the absorption lines of the host galaxy. The redshift of z=0.212 makes 1ES1011+496 the most distant source observed to emit VHE gamma-rays up to date.

  20. Measurement of {sup 214} Pb, {sup 212} Pb {sup 210} Pb and {sup 7} Be activities in sizes fractionated aerosols in the lower atmosphere at Sacavem (Lisbon)

    Reis, Mario J.; Brogueira, Alfredo L.; Bettencourt, Antonio O. [Instituto Tecnologico e Nuclear, Sacavem (Portugal). Dept. de Protecao Radiologica e Seguranca Nuclear; Rosa, Rui N. [Universidade de Evora (Portugal). Dept. de Fisica

    2001-07-01

    Aerodynamic size distribution measurements of {sup 214} Pb, {sup 212} Pb {sup 210} Pb and {sup 7} Be were carried out using a five-stage high-volume cascade impactor with effective cut-off diameters of 0.49, 0.95, 1.5, 3.0, and 7.2 {mu}m. The activity of the samples was measured by {gamma}-ray spectrometry using both coaxial and ultra-low background well-type HPGe detectors. The activity size distribution measurements indicate that all radionuclides were associated with submicron aerosol in the accumulation mode, being {sup 210} Pb and {sup 7} Be attached to slightly larger particles, when compared to short-lived radon and thoron daughters. The mass size distributions show a significant contribution from aerosol particles larger than 7.2 {mu}m to the total mass concentration, which indicates the occurrence of resuspension processes. However, since that in most of the samples no {sup 210} Pb and short-lived {sup 214} Pb and {sup 212} Pb were found in association with larger particles, it seems that those nuclides were mostly originated by the decay of atmospheric radon (or thoron in the case of {sup 212} Pb) instead of soil resuspension. On average it was observed that about 80% of the {sup 214} Pb and {sup 212} Pb activity was associated with aerosol particles with aerodynamic diameters smaller than 0.49 {mu}m and about 90% with particles smaller than 0.95 {mu}m. (author)

  1. The cannabinoid agonist WIN55,212-2 increases intracellular calcium via CB1 receptor coupling to Gq/11 G proteins

    Lauckner, Jane E.; Hille, Bertil; Mackie, Ken

    2005-01-01

    Central nervous system responses to cannabis are primarily mediated by CB1 receptors, which couple preferentially to Gi/o G proteins. Here, we used calcium photometry to monitor the effect of CB1 activation on intracellular calcium concentration. Perfusion with 5 μM CB1 aminoalkylindole agonist, WIN55,212-2 (WIN), increased intracellular calcium by several hundred nanomolar in human embryonic kidney 293 cells stably expressing CB1 and in cultured hippocampal neurons. The increase was blocked ...

  2. Preclinical evaluation of NETA-based bifunctional ligand for radioimmunotherapy applications using 212Bi and 213Bi: Radiolabeling, serum stability, and biodistribution and tumor uptake studies

    Introduction: Despite the great potential of targeted α-radioimmunotherapy (RIT) as demonstrated by pre-clinical and clinical trials, limited progress has been made on the improvement of chelation chemistry for 212Bi and 213Bi. A new bifunctional ligand 3p-C-NETA was evaluated for targeted α RIT using 212Bi and 213Bi. Methods: Radiolabeling of 3p-C-NETA with 205/6Bi, a surrogate of 212Bi and 213Bi, was evaluated at pH 5.5 and room temperature. In vitro stability of the 205/6Bi-3p-C-NETA-trastuzumab conjugate was evaluated using human serum (pH 7, 37 °C). Immunoreactivity and specific activity of the 205/6Bi-3p-C-NETA-trastuzumab conjugate were measured. An in vivo biodistribution study was performed to evaluate the in vivo stability and tumor targeting properties of the 205/6Bi-3p-C-NETA-trastuzumab conjugate in athymic mice bearing subcutaneous LS174T tumor xenografts. Result: The 3p-C-NETA-trastuzumab conjugate was extremely rapid in complexing with 205/6Bi, and the corresponding 205/6Bi-3p-C-NETA-trastuzumab was stable in human serum. 205/6Bi-3p-C-NETA-trastuzumab was prepared with a high specific activity and retained immunoreactivity. 205/6Bi-3p-C-NETA-trastuzumab conjugate displayed excellent in vivo stability and targeting as evidenced by low normal organ and high tumor uptake. Conclusion: The results of the in vitro and in vivo studies indicate that 3p-C-NETA is a promising chelator for RIT applications using 212Bi and 213Bi. Further detailed in vivo evaluations of 3p-C-NETA for targeted α RIT are warranted

  3. Selective lack of tolerance to delayed gastric emptying after daily administration of WIN 55,212-2 in the rat.

    Abalo, R; Cabezos, P A; López-Miranda, V; Vera, G; González, C; Castillo, M; Fernández-Pujol, R; Martín, M I

    2009-09-01

    The use of cannabinoids to treat gastrointestinal (GI) motor disorders has considerable potential. However, it is not clear if tolerance to their actions develops peripherally, as it does centrally. The aim of this study was to examine the chronic effects of the cannabinoid agonist WIN 55,212-2 (WIN) on GI motility, as well as those in the central nervous and cardiovascular systems. WIN was administered for 14 days, at either non-psychoactive or psychoactive doses. Cardiovascular parameters were measured in anaesthetized rats, whereas central effects and alterations in GI motor function were assessed in conscious animals using the cannabinoid tetrad and non-invasive radiographic methods, respectively. Tests were performed after first (acute effects) and last (chronic effects) administration of WIN, and 1 week after discontinuing treatment (residual effects). Food intake and body weight were also recorded throughout treatment. Blood pressure and heart rate remained unchanged after acute or chronic administration of WIN. Central activity and GI motility were acutely depressed at psychoactive doses, whereas non-psychoactive doses only slightly reduced intestinal transit. Most effects were reduced after the last administration. However, delayed gastric emptying was not and could, at least partially, account for a concomitant reduction in food intake and body weight gain. The remaining effects of WIN administration in GI motility were blocked by the CB1 antagonist AM 251, which slightly accelerated motility when administered alone. No residual effects were found 1 week after discontinuing cannabinoid treatment. The different systems show differential sensitivity to cannabinoids and tolerance developed at different rates, with delayed gastric emptying being particularly resistant to attenuation upon chronic treatment. PMID:19413685

  4. FDG PET/CT imaging in primary osseous and soft tissue sarcomas: a retrospective review of 212 cases

    Charest, Mathieu [Lakeshore General Hospital, Service of Nuclear Medicine, Pointe-Claire (Canada); Hickeson, Marc; Lisbona, Robert; Novales-Diaz, Javier A.; Derbekyan, Vilma [McGill University Health Center, Department of Nuclear Medicine, Montreal (Canada); Turcotte, Robert E. [McGill University Health Center, Department of Orthopedic Surgery, Montreal (Canada)

    2009-12-15

    The aims of this study are to evaluate the sensitivity of FDG PET/CT for detection of soft tissue and osseous sarcomas on the basis of FDG avidity. We retrospectively evaluated 212 consecutive patients with known soft tissue or osseous sarcoma who had undergone a FDG PET/CT study for the initial staging or assessment of recurrence of disease. The maximum standardized uptake value (SUV{sub max}) of each primary and/or most intense metastatic lesion was measured and compared with the histological data provided in the final pathological reports. An SUV{sub max} of 2.5 or greater was considered positive for our analysis. Sufficient histopathological data were available for 160 soft tissue sarcomas and 52 osseous sarcomas. FDG PET/CT detected 93.9% of all sarcomas with a sensitivity of 93.7% for soft tissue sarcomas and 94.6% for osseous sarcomas. The sensitivities of the most common sarcoma histologies were 100% for leiomyosarcomas, 94.7% for osteosarcomas, 100% for Ewing's sarcomas, 88.9% for liposarcomas, 80.0% for synovial sarcomas, 100% for gastrointestinal stromal tumors, 87.5% for malignant peripheral nerve sheath tumors, 100% for fibroblastic and myoblastic sarcomas, and 100% for malignant fibrohistiocytic tumors. The receiver-operating characteristic curve revealed an area under the curve of 94% for the discrimination of low-grade and high-grade sarcomas imaged for initial staging by FDG PET/CT. The combined metabolic and morphological information of FDG PET/CT imaging allows high sensitivity for the detection of various sarcomas and accurate discrimination between newly diagnosed low-grade and high-grade sarcomas. (orig.)

  5. FDG PET/CT imaging in primary osseous and soft tissue sarcomas: a retrospective review of 212 cases

    The aims of this study are to evaluate the sensitivity of FDG PET/CT for detection of soft tissue and osseous sarcomas on the basis of FDG avidity. We retrospectively evaluated 212 consecutive patients with known soft tissue or osseous sarcoma who had undergone a FDG PET/CT study for the initial staging or assessment of recurrence of disease. The maximum standardized uptake value (SUVmax) of each primary and/or most intense metastatic lesion was measured and compared with the histological data provided in the final pathological reports. An SUVmax of 2.5 or greater was considered positive for our analysis. Sufficient histopathological data were available for 160 soft tissue sarcomas and 52 osseous sarcomas. FDG PET/CT detected 93.9% of all sarcomas with a sensitivity of 93.7% for soft tissue sarcomas and 94.6% for osseous sarcomas. The sensitivities of the most common sarcoma histologies were 100% for leiomyosarcomas, 94.7% for osteosarcomas, 100% for Ewing's sarcomas, 88.9% for liposarcomas, 80.0% for synovial sarcomas, 100% for gastrointestinal stromal tumors, 87.5% for malignant peripheral nerve sheath tumors, 100% for fibroblastic and myoblastic sarcomas, and 100% for malignant fibrohistiocytic tumors. The receiver-operating characteristic curve revealed an area under the curve of 94% for the discrimination of low-grade and high-grade sarcomas imaged for initial staging by FDG PET/CT. The combined metabolic and morphological information of FDG PET/CT imaging allows high sensitivity for the detection of various sarcomas and accurate discrimination between newly diagnosed low-grade and high-grade sarcomas. (orig.)

  6. 21.2.Schizophrenia

    1993-01-01

    930403 Family therapy of social psycologic in-tervention and rehabilitation of schizophrenia.KANG Ming(亢明),et al.Dept Psychiatr,3rdPeople’s Hosp,Huaiyin,Jiangsu Prov,223001.Chin J Nerv & Ment Dis 1992;18(5):258—260.Family therapy of social psychologic interven-tion(SPI) was used for the rehabilitation of dis-charged patients with schizophrenia.It was indi-cated that family therapy of SPI had significanteffect on the recovery of social function,im-provement of relation between the patients andmembers of the family,and preventing relapse ofschizophrenia etc.The social function of the

  7. The effect of miR-212 inhibitor on the pain behavior of bone cancer mice%鞘内注射miR-212反义锁核酸对骨癌小鼠痛行为的影响

    侯百灵; 刘玥; 夏天娇; 张羽; 孙蓓; 冷鑫; 周瑜; 倪坤; 顾小萍

    2013-01-01

    目的 研究骨癌痛发展和维持过程中小鼠脊髓水平miR-212表达的变化规律及连续鞘内注射miR-212反义锁核酸LNA-anti-miR-212对骨癌痛小鼠痛行为的影响.方法 本实验分为两个部分:(一)骨癌痛小鼠脊髓水平miR-212表达的变化规律:C3H/HeJ雄性小鼠36只,随机分为假手术组(sham组,n=18)和肿瘤组(T组,n=18).sham组小鼠在右侧股骨远端骨髓腔注射不含肿瘤细胞的α-MEM,T组小鼠在右侧股骨远端骨髓腔注射纤维肉瘤细胞NCTC 2472,建立骨癌痛模型.在术前1d,术后4d、7d、10 d、14 d、21 d,sham组和T组各随机取三只小鼠处死,取脊髓腰膨大标本,用Real-time PCR的方法检测脊髓水平miR-212的表达情况.(二)连续鞘内注射LNA-anti-miR-212对骨癌痛小鼠痛行为的影响:C3H/HeJ雄性小鼠24只,随机分为四组:L组(鞘内注射LNA-anti-miR-212,n=6)、L’组(鞘内注射LNA'-negative control,n=6)、C组(鞘内注射溶媒无核酸酶水,n=6)和S组(假手术处理,n=6).L组、L’组和C组小鼠在右侧股骨远端注射纤维肉瘤细胞NCTC 2472,S组小鼠在右侧股骨远端骨髓腔注射不含肿瘤细胞的α-MEM.所有小鼠于术前1d、术后4d、7d、10 d、14 d测小鼠痛行为指标,包括自发抬足次数和机械缩足阈值(PWMT),术后14 d,L组、L’组、C组小鼠分别鞘内注射LNA-anti-miR-212 12 pmol/5μl、LNA '-negative control 12 pmol/5μl和无核酸酶水5μl,连续鞘内注射7d,1次/d,每天测小鼠痛行为指标,至术后第21天.结果 miR-212的表达变化表现为:与基础值相比,sham组和T组小鼠在术后第4天,脊髓水平miR-212明显升高(P<0.05);与基础值和sham组相比,T组小鼠脊髓水平miR-212在术后7d、10 d、14 d、21 d均明显升高(P<0.05).连续鞘内注射LNA-anti-miR-212改善骨癌痛小鼠痛行为:术后19 d至21 d,与L’组和C组相比,L组小鼠PWMT[19 d(1.07 ±0.16)g,20 d(1.13±0.21)g,21 d(1.27±0.21)g)]明显升高(P<0.05),

  8. Damage thresholds of various materials irradiated by 100-ps pulses of 21.2-nm laser radiation

    Hájková, V.; Chalupský, J.; Wabnitz, H.; Feldhaus, J.; Störmer, M.; Hecquet, Ch.; Mocek, T.; Kozlová, M.; Polan, J.; Homer, P.; Rus, B.; Juha, L.

    2009-05-01

    Irradiation experiments were conducted at Prague Asterix Laser System (PALS) with the Ne-like zinc soft x-ray laser (SXRL) at 21.2 nm (58.5 eV) delivering up to 4 mJ (~4 x 1014 photons), 100-ps pulses in a narrowly collimated beam. The SXRL beam was focused using a 1 inch diameter off-axis parabolic mirror (f = 253 mm at 14 degrees) with a Mo:Si multilayer coating (R = 30% at 21 nm) placed 2825 mm from the SXRL. The diameter of the SXRL beam incident on the mirror was about 11 mm. Ablation experiments with a gradually attenuated beam were performed to determine the single-shot damage threshold of various materials. In this case, the sample was positioned at the tightest focus of the SXRL whose pulse energy was attenuated by aluminum filters of various thickness to adjust the fluence. Both the focal spot area and single-shot damage threshold were determined from the plot of damaged surface areas as a function of a pulse energy logarithm to dete. For PMMA, the focal spot area and the ablation threshold inferred from the data are Sfoc = (1172+/-230) μm2 and Fth = (1.25+/-0.4) J/cm2, respectively. Inorganic materials have thresholds significantly higher than organic polymers, e.g., amorphous and monocrystalline silicon gave values 2.5 J/cm2 and 4.2 J/cm2, respectively. For prospective SASE FEL optical elements, the SiC coating is of great interest. Its damage threshold is of 20 J/cm2, i.e., slightly lower than that of monocrystalline silicon. The thresholds determined with the 100-ps pulses from plasma-based, quasi-steady state SXRL are significantly higher than the thresholds obtained for 20-fs pulses provided by the SXR freeelectron laser in Hamburg. There is a difference in PMMA thresholds of two orders of magnitude for these two sources.

  9. Multi-millijoule, deeply saturated x-ray laser at 21.2 nm for applications in plasma physics

    We report on the development of a multi-millijoule, ultra high-brightness Ne-like soft x-ray laser (XRL) at the wavelength of 21.2 nm, recently undertaken at the PALS Centre. The device has been implemented as a routine radiation source delivering about 4 mJ of energy in pulses with a duration of ∼100 ps, in a narrowly collimated beam exhibiting high spatial quality and possessing high spatial coherence. The peak power of about 40 MW, generated by this device, is the largest value attained by an XRL to date. The same holds true for the peak spectral brightness, amounting to 1027 photons s-1 mm-2 mrad-2 0.1%BW-1. The active medium consists of a 3 cm long plasma column, sequentially generated from a slab target by an energy of ∼500 J delivered by the iodine 1.315 μm driving laser. The population inversion is produced by focusing tightly down to the line ∼500 J of energy into a much wider preplasma column, which makes it possible to create a lasing medium with a reduced lateral density gradient and thereby to minimize the lateral refraction of the x-ray beam. The multi-millijoule output is generated in double-pass amplification regime, achieved by a carefully designed half cavity using a flat multilayer Mo : Si mirror positioned a few millimetres near the plasma end. We describe the measured characteristics of the output beam generated by double-pass amplification, and illustrate its spatial beam coherence obtained using a Fresnel wavefront splitting interferometer. Given the available energy, peak power and brightness in a single pulse, the demonstrated XRL constitutes a tool for novel applications in both solid state and plasma physics. Examples of such applications are the generation of high-energy density, low-temperature plasmas relevant to laboratory astrophysics, x-ray interferometry of plasmas and solids with spatial resolution ranging from a micron to a few nanometres according to the specific experimental arrangement, or study of soft x

  10. Multi-millijoule, deeply saturated x-ray laser at 21.2 nm for applications in plasma physics

    Rus, B [Gas Lasers Department/PALS Centre, Institute of Physics, Academy of Sciences of the Czech Republic, Na Slovance 2, 18221 Prague (Czech Republic); Mocek, T [Gas Lasers Department/PALS Centre, Institute of Physics, Academy of Sciences of the Czech Republic, Na Slovance 2, 18221 Prague (Czech Republic); Praeg, A R [Gas Lasers Department/PALS Centre, Institute of Physics, Academy of Sciences of the Czech Republic, Na Slovance 2, 18221 Prague (Czech Republic); Kozlova, M [Gas Lasers Department/PALS Centre, Institute of Physics, Academy of Sciences of the Czech Republic, Na Slovance 2, 18221 Prague (Czech Republic); Hudecek, M [Gas Lasers Department/PALS Centre, Institute of Physics, Academy of Sciences of the Czech Republic, Na Slovance 2, 18221 Prague (Czech Republic); Jamelot, G [Laboratoire d' interaction du Rayonnement X avec la Matiere, Batiment 350, Universite Paris-Sud, 91405 Orsay (France); Carillon, A [Laboratoire d' interaction du Rayonnement X avec la Matiere, Batiment 350, Universite Paris-Sud, 91405 Orsay (France); Ros, D [Laboratoire d' interaction du Rayonnement X avec la Matiere, Batiment 350, Universite Paris-Sud, 91405 Orsay (France); Lagron, J-C [Laboratoire d' interaction du Rayonnement X avec la Matiere, Batiment 350, Universite Paris-Sud, 91405 Orsay (France); Joyeux, D [Institut d' Optique Theorique et Appliquee, Laboratoire Charles Fabry, Batiment 503, Universite Paris-Sud, 91403 Orsay (France); Phalippou, D [Institut d' Optique Theorique et Appliquee, Laboratoire Charles Fabry, Batiment 503, Universite Paris-Sud, 91403 Orsay (France)

    2002-12-01

    We report on the development of a multi-millijoule, ultra high-brightness Ne-like soft x-ray laser (XRL) at the wavelength of 21.2 nm, recently undertaken at the PALS Centre. The device has been implemented as a routine radiation source delivering about 4 mJ of energy in pulses with a duration of {approx}100 ps, in a narrowly collimated beam exhibiting high spatial quality and possessing high spatial coherence. The peak power of about 40 MW, generated by this device, is the largest value attained by an XRL to date. The same holds true for the peak spectral brightness, amounting to 10{sup 27} photons s{sup -1} mm{sup -2} mrad{sup -2} 0.1%BW{sup -1}. The active medium consists of a 3 cm long plasma column, sequentially generated from a slab target by an energy of {approx}500 J delivered by the iodine 1.315 {mu}m driving laser. The population inversion is produced by focusing tightly down to the line {approx}500 J of energy into a much wider preplasma column, which makes it possible to create a lasing medium with a reduced lateral density gradient and thereby to minimize the lateral refraction of the x-ray beam. The multi-millijoule output is generated in double-pass amplification regime, achieved by a carefully designed half cavity using a flat multilayer Mo : Si mirror positioned a few millimetres near the plasma end. We describe the measured characteristics of the output beam generated by double-pass amplification, and illustrate its spatial beam coherence obtained using a Fresnel wavefront splitting interferometer. Given the available energy, peak power and brightness in a single pulse, the demonstrated XRL constitutes a tool for novel applications in both solid state and plasma physics. Examples of such applications are the generation of high-energy density, low-temperature plasmas relevant to laboratory astrophysics, x-ray interferometry of plasmas and solids with spatial resolution ranging from a micron to a few nanometres according to the specific experimental

  11. Polymorphisms in a Putative Enhancer at the 10q21.2 Breast Cancer Risk Locus Regulate NRBF2 Expression

    Darabi, Hatef; McCue, Karen; Beesley, Jonathan; Michailidou, Kyriaki; Nord, Silje; Kar, Siddhartha; Humphreys, Keith; Thompson, Deborah; Ghoussaini, Maya; Bolla, Manjeet K.; Dennis, Joe; Wang, Qin; Canisius, Sander; Scott, Christopher G.; Apicella, Carmel; Hopper, John L.; Southey, Melissa C.; Stone, Jennifer; Broeks, Annegien; Schmidt, Marjanka K.; Scott, Rodney J.; Lophatananon, Artitaya; Muir, Kenneth; Beckmann, Matthias W.; Ekici, Arif B.; Fasching, Peter A.; Heusinger, Katharina; dos-Santos-Silva, Isabel; Peto, Julian; Tomlinson, Ian; Sawyer, Elinor J.; Burwinkel, Barbara; Marme, Frederik; Guénel, Pascal; Truong, Thérèse; Bojesen, Stig E.; Flyger, Henrik; Benitez, Javier; González-Neira, Anna; Anton-Culver, Hoda; Neuhausen, Susan L.; Arndt, Volker; Brenner, Hermann; Engel, Christoph; Meindl, Alfons; Schmutzler, Rita K.; Arnold, Norbert; Brauch, Hiltrud; Hamann, Ute; Chang-Claude, Jenny; Khan, Sofia; Nevanlinna, Heli; Ito, Hidemi; Matsuo, Keitaro; Bogdanova, Natalia V.; Dörk, Thilo; Lindblom, Annika; Margolin, Sara; Kosma, Veli-Matti; Mannermaa, Arto; Tseng, Chiu-chen; Wu, Anna H.; Floris, Giuseppe; Lambrechts, Diether; Rudolph, Anja; Peterlongo, Paolo; Radice, Paolo; Couch, Fergus J.; Vachon, Celine; Giles, Graham G.; McLean, Catriona; Milne, Roger L.; Dugué, Pierre-Antoine; Haiman, Christopher A.; Maskarinec, Gertraud; Woolcott, Christy; Henderson, Brian E.; Goldberg, Mark S.; Simard, Jacques; Teo, Soo H.; Mariapun, Shivaani; Helland, Åslaug; Haakensen, Vilde; Zheng, Wei; Beeghly-Fadiel, Alicia; Tamimi, Rulla; Jukkola-Vuorinen, Arja; Winqvist, Robert; Andrulis, Irene L.; Knight, Julia A.; Devilee, Peter; Tollenaar, Robert A.E.M.; Figueroa, Jonine; García-Closas, Montserrat; Czene, Kamila; Hooning, Maartje J.; Tilanus-Linthorst, Madeleine; Li, Jingmei; Gao, Yu-Tang; Shu, Xiao-Ou; Cox, Angela; Cross, Simon S.; Luben, Robert; Khaw, Kay-Tee; Choi, Ji-Yeob; Kang, Daehee; Hartman, Mikael; Lim, Wei Yen; Kabisch, Maria; Torres, Diana; Jakubowska, Anna; Lubinski, Jan; McKay, James; Sangrajrang, Suleeporn; Toland, Amanda E.; Yannoukakos, Drakoulis; Shen, Chen-Yang; Yu, Jyh-Cherng; Ziogas, Argyrios; Schoemaker, Minouk J.; Swerdlow, Anthony; Borresen-Dale, Anne-Lise; Kristensen, Vessela; French, Juliet D.; Edwards, Stacey L.; Dunning, Alison M.; Easton, Douglas F.; Hall, Per; Chenevix-Trench, Georgia

    2015-01-01

    Genome-wide association studies have identified SNPs near ZNF365 at 10q21.2 that are associated with both breast cancer risk and mammographic density. To identify the most likely causal SNPs, we fine mapped the association signal by genotyping 428 SNPs across the region in 89,050 European and 12,893 Asian case and control subjects from the Breast Cancer Association Consortium. We identified four independent sets of correlated, highly trait-associated variants (iCHAVs), three of which were located within ZNF365. The most strongly risk-associated SNP, rs10995201 in iCHAV1, showed clear evidence of association with both estrogen receptor (ER)-positive (OR = 0.85 [0.82–0.88]) and ER-negative (OR = 0.87 [0.82–0.91]) disease, and was also the SNP most strongly associated with percent mammographic density. iCHAV2 (lead SNP, chr10: 64,258,684:D) and iCHAV3 (lead SNP, rs7922449) were also associated with ER-positive (OR = 0.93 [0.91–0.95] and OR = 1.06 [1.03–1.09]) and ER-negative (OR = 0.95 [0.91–0.98] and OR = 1.08 [1.04–1.13]) disease. There was weaker evidence for iCHAV4, located 5′ of ADO, associated only with ER-positive breast cancer (OR = 0.93 [0.90–0.96]). We found 12, 17, 18, and 2 candidate causal SNPs for breast cancer in iCHAVs 1–4, respectively. Chromosome conformation capture analysis showed that iCHAV2 interacts with the ZNF365 and NRBF2 (more than 600 kb away) promoters in normal and cancerous breast epithelial cells. Luciferase assays did not identify SNPs that affect transactivation of ZNF365, but identified a protective haplotype in iCHAV2, associated with silencing of the NRBF2 promoter, implicating this gene in the etiology of breast cancer. PMID:26073781

  12. Radioimmunoscintigraphy of colorectal carcinoma using technetium-99m-labeled, totally human monoclonal antibody 88BV59H21-2.

    Gulec, S A; Serafini, A N; Moffat, F L; Vargas-Cuba, R D; Sfakianakis, G N; Franceschi, D; Crichton, V Z; Subramanian, R; Klein, J L; De Jager, R L

    1995-12-01

    Radioimmunoscintigraphy (RIS) using human monoclonal antibodies offers the important clinical advantage of repeated imaging over murine monoclonal antibodies by eliminating the cross-species antibody response. This article reports a Phase I-II clinical trial with Tc-99m-labeled, totally human monoclonal antibody 88BV59H21-2 in patients with colorectal carcinoma. The study population consisted of 34 patients with colorectal cancer (20 men and 14 women; age range, 44-81 years). Patients were administered 5-10 mg antibody labeled with 21-41 mCi Tc-99m by the i.v. route and imaged at 3-10 and 16-24 h after infusion using planar and single-photon emission computed tomographic (CT) techniques. Pathological confirmation was obtained in 25 patients who underwent surgery. Human antihuman antibody (HAHA) titers were checked prior to and 1 and 3 months after the infusion. RIS with Tc-99m-labeled 88BV59H21-2 revealed a better detection rate in the abdomen-pelvis region compared with axial CT. The combined use of both modalities increased the sensitivity in both the liver and abdomen-pelvis regions. Ten patients developed mild adverse reactions (chills and fever). No HAHA response was detected in this series. Tc-99m-labeled human monoclonal antibody 88BV59H21-2 RIS shows promise as a useful diagnostic modality in patients with colorectal cancer. RIS alone or in combination with CT is more sensitive than CT in detecting tumor within the abdomen and pelvis. Repeated RIS studies may be possible, due to the lack of a HAHA response. PMID:7493345

  13. Cell Killing Mechanisms and Impact on Gene Expression by Gemcitabine and 212Pb-Trastuzumab Treatment in a Disseminated i.p. Tumor Model

    Yong, Kwon Joong; Milenic, Diane E.; Baidoo, Kwamena E.; Brechbiel, Martin W.

    2016-01-01

    In pre-clinical studies, combination therapy with gemcitabine and targeted radioimmunotherapy (RIT) using 212Pb-trastuzumab showed tremendous therapeutic potential in the LS-174T tumor xenograft model of disseminated intraperitoneal disease. To better understand the underlying molecular basis for the observed cell killing efficacy, gene expression profiling was performed after a 24 h exposure to 212Pb-trastuzumab upon gemcitabine (Gem) pre-treatment in this model. DNA damage response genes in tumors were quantified using a real time quantitative PCR array (qRT-PCR array) covering 84 genes. The combination of Gem with α-radiation resulted in the differential expression of apoptotic genes (BRCA1, CIDEA, GADD45α, GADD45γ, IP6K3, PCBP4, RAD21, and p73), cell cycle regulatory genes (BRCA1, CHK1, CHK2, FANCG, GADD45α, GTSE1, PCBP4, MAP2K6, NBN, PCBP4, and SESN1), and damaged DNA binding and repair genes (BRCA1, BTG2, DMC1, ERCC1, EXO1, FANCG, FEN1, MSH2, MSH3, NBN, NTHL1, OGG1, PRKDC, RAD18, RAD21, RAD51B, SEMA4G, p73, UNG, XPC, and XRCC2). Of these genes, the expression of CHK1, GTSE1, EXO1, FANCG, RAD18, UNG and XRCC2 were specific to Gem/212Pb-trastuzumab administration. In addition, the present study demonstrates that increased stressful growth arrest conditions induced by Gem/212Pb-trastuzumab could suppress cell proliferation possibly by up-regulating genes involved in apoptosis such as p73, by down-regulating genes involved in cell cycle check point such as CHK1, and in damaged DNA repair such as RAD51 paralogs. These events may be mediated by genes such as BRCA1/MSH2, a member of BARC (BRCA-associated genome surveillance complex). The data suggest that up-regulation of genes involved in apoptosis, perturbation of checkpoint genes, and a failure to correctly perform HR-mediated DSB repair and mismatch-mediated SSB repair may correlate with the previously observed inability to maintain the G2/M arrest, leading to cell death. PMID:27467592

  14. Étude des dommages induits dans l'ADN par irradiation laser X-UV à 21.2 nm

    Cassou, K.; Ros, D.; Kazamias, S.; Klisnick, A.; Jamelot, G.; Guilbaud, O.; Rus, B.; Kozlová, M.; Polan, J.; Präg, A. R.; Stupka, M.; Eot-Houllier, G.; Sage, E.; Begusová, M.; Stísová, V.; Du Penhoat, M.-A. H.; Touati, A.; Chétioui, A.

    2005-06-01

    We report the preliminary result of the application of the collisional Ne-like soft x-ray laser as radiation source to induce DNA damage. The goal of this experiment was a test bed study of the damage yields induced by soft x-ray radiation in dried plasmid DNA sample. The saturated Ne-like soft x-ray laser available at the PALS facility, delivering several millijoules in a single 100 ps pulse at 21.2 nm was used to irradiate two different plasmids: pSP189 and pBS. The study is centered on the dose effect leading to single and double strand break in DNA.

  15. Measuring Progress on the Control of Porcine Reproductive and Respiratory Syndrome (PRRS at a Regional Level: The Minnesota N212 Regional Control Project (Rcp as a Working Example.

    Pablo Valdes-Donoso

    Full Text Available Due to the highly transmissible nature of porcine reproductive and respiratory syndrome (PRRS, implementation of regional programs to control the disease may be critical. Because PRRS is not reported in the US, numerous voluntary regional control projects (RCPs have been established. However, the effect of RCPs on PRRS control has not been assessed yet. This study aims to quantify the extent to which RCPs contribute to PRRS control by proposing a methodological framework to evaluate the progress of RCPs. Information collected between July 2012 and June 2015 from the Minnesota Voluntary Regional PRRS Elimination Project (RCP-N212 was used. Demography of premises (e.g. composition of farms with sows = SS and without sows = NSS was assessed by a repeated analysis of variance. By using general linear mixed-effects models, active participation of farms enrolled in the RCP-N212, defined as the decision to share (or not to share PRRS status, was evaluated and used as a predictor, along with other variables, to assess the PRRS trend over time. Additionally, spatial and temporal patterns of farmers' participation and the disease dynamics were investigated. The number of farms enrolled in RCP-N212 and its geographical coverage increased, but the proportion of SS and NSS did not vary significantly over time. A significant increasing (p<0.001 trend in farmers' decision to share PRRS status was observed, but with NSS producers less willing to report and a large variability between counties. The incidence of PRRS significantly (p<0.001 decreased, showing a negative correlation between degree of participation and occurrence of PRRS (p<0.001 and a positive correlation with farm density at the county level (p = 0.02. Despite a noted decrease in PRRS, significant spatio-temporal patterns of incidence of the disease over 3-weeks and 3-kms during the entire study period were identified. This study established a systematic approach to quantify the effect of RCPs on

  16. 3种微创手术治疗复杂性输尿管上段结石212例比较%A comparison of three surgical procedures of complicated upper ureteral calculi for 212 cases

    李旭明; 程洪林; 郭闯; 程宗勇; 李锋; 张力; 李元仲

    2011-01-01

    Objective To compare the efficacy of three procedures, ureteroscopic litripsy(URL), minimally invasive percutaneous nephrolithotomy(MPCNL) ,and retroperitoneal laparoscopic ureterolithomy(RLU), for the treatment of complicated upper ureteral calculi. Methods Two hundred and thirteen cases of complicated upper ureteral calculi were treated in this hospital from February 2002 to February 2010,including fifty-two cases of URL, one hundred and seven cases of MPCNL, and fifty-four cases of RLU. Results The stone free rate seven days after operation:URL was 36.5%(19/52),MPCNL was 75.7%(81/107),RLU was 90.6% (48/53); the stone free rate one months after operation: URL was 71. 1% (38/52), MPCNL was 95. 3% (102/107), RLU was 96.2%(51/53); the stone-free rate three months after operation:URL was 82.7%(43/52),MPCNL was 98. 1%(105/107),RLU was 98.1%(52/53). There was significantly difference between URL and MPCNL(P<0.05) ,URL and RLU (P<0.05). There was also significantly difference between MPCNL and RLU in the near future(P<0. 05) ,but had no difference in long term. Conclusion High stone free rate can be obtained with RLU and MPCNL for impacted upper ureteral calculi. The stone-free rate is less satisfactory with URL.%目的 比较输尿管镜碎石(URL)、微创经皮肾镜取石(MPCNL)、后腹腔镜下输尿管切开取石(RLU)治疗复杂性输尿管上段结石的疗效.方法 回顾分析2002年2月至2010年2月复杂性输尿管上段结石212例,其中URL治疗52例,MPCNL治疗107例,RLU治疗54例.比较分析3种手术的治疗效果.结果 术后7 d结石清除率:URL组36.5%(19/52),MPCNL组75.7%(81/107),RLU组90.6%(48/53).术后1个月结石清除率:URL组73.1%(38/52),MPCNL组95.3%(102/107),RLU组96.2%(51/53).术后3个月结石清除率:URL组82.7%(43/52),MPCNL组98.1%(105/107),RLU组98.1%(52/53).URL组分别与MPCNL组、RLU组比较差异有统计学意义(P<0.05),MPCNL、RLU组之间比较近期差异有统计学意义(P<0.05),

  17. Loci on 7p12.2, 10q21.2 and 14q11.2 are associated with risk of childhood acute lymphoblastic leukemia

    Papaemmanuil, Elli; Hosking, Fay J; Vijayakrishnan, Jayaram; Price, Amy; Olver, Bianca; Sheridan, Eammon; Kinsey, Sally E; Lightfoot, Tracy; Roman, Eve; Irving, Julie A E; Allan, James M.; Tomlinson, Ian P; Taylor, Malcolm; Greaves, Mel; Houlston, Richard S

    2016-01-01

    To identify risk variants for childhood acute lymphoblastic leukemia (ALL) we conducted a genome-wide association study of 2 case-control series, analyzing the genotypes of 291,423 tagging SNP genotypes in a total of 907 ALL cases and 2,398 controls. We identified risk loci for ALL at 7p12.2 (IKZF1, rs4132601; OR = 1.69, P = 1.20 x 10-19), 10q21.2 (ARIDB5, rs7089424; OR = 1.65, P = 6.69 x 10-19) and 14q11.2 (CEBPE, rs2239633; OR = 1.34, P = 2.88 x 10-7). The 10q21.2 (ARIDB5) risk association appears to be selective for the subset of B-cell precursor ALL with hyperdiploidy. These data show that common low-penetrance susceptibility alleles contribute to the risk of developing childhood ALL and provide novel insight into disease causation of this hematological cancer; notably all 3 risk variants map to genes involved in transcriptional regulation and differentiation of B-cell progenitors. PMID:19684604

  18. 13CO2/12CO2 ratio analysis in exhaled air by lead-salt tunable diode lasers for noninvasive diagnostics in gastroenterology

    Stepanov, Eugene V.; Zyrianov, Pavel V.; Miliaev, Valerii A.; Selivanov, Yurii G.; Chizhevskii, Eugene G.; Os'kina, Svetlana; Ivashkin, Vladimir T.; Nikitina, Elena I.

    1999-07-01

    An analyzer of 13CO2/12CO2 ratio in exhaled air based on lead-salt tunable diode lasers is presented. High accuracy of the carbon isotope ratio detection in exhaled carbon dioxide was achieved with help of very simple optical schematics. It was based on the use of MBE laser diodes operating in pulse mode and on recording the resonance CO2 absorption at 4.2 micrometers . Special fast acquisition electronics and software were applied for spectral data collection and processing. Developed laser system was tested in a clinical train aimed to assessment eradication efficiency in therapy of gastritis associated with Helicobacter pylori infection. Data on the 13C-urea breath test used for P.pylori detection and obtained with tunable diode lasers in the course of the trail was compared with the results of Mass-Spectroscopy analysis and histology observations. The analyzer can be used also for 13CO2/12CO2 ratio detection in exhalation to perform gastroenterology breath test based on using other compounds labeled with stable isotopes.

  19. Inherited Tandem Duplication of the X Chromosome: Dup(X(q13.2-q21.2 in a Family.

    Jia-Woei Hou

    2004-09-01

    Full Text Available A 2-year-old boy who was failing to thrive and who had multiple anomalies was found tohave a maternally derived tandem duplication of the long arm of the X chromosome:dup(X(q13.2-q21.2. The karyotyping interpretation was further confirmed by fluorescencein situ hybridization studies in which a double gene dosage of the X-inactivation-specifictranscript (gene locus on Xq13.2 and a whole chromosome X painting on the abnormal Xwere noted. He suffered from hypotonia, gastroesophageal reflux, laryngomalacia, recurrentinfections, immunodeficiency (IgG4 deficiency, dysgenesis of the corpus callosum, proximalrenal tubular acidosis, and nephrolithiasis. His mother and elder sister also had the samerearrangement, the dup(X, on one of their X chromosomes. However, the mother was ingood health, but the sister suffered from nephrolithiasis. The clinical variability in this familywith the Xq duplication is reported and discussed.

  20. Differential effects of repeated low dose treatment with the cannabinoid agonist WIN 55,212-2 in experimental models of bone cancer pain and neuropathic pain

    Hald, Andreas; Ding, Ming; Egerod, Kristoffer Lihme;

    2008-01-01

    Pain due to bone malignancies is one of the most difficult types of cancer pain to fully control and may further decrease the patients' quality of life. Animal models of chronic pain conditions resulting from peripheral inflammatory reactions or nerve injuries are responsive to treatment with....... Furthermore, this treatment strategy was not found to induce measurable CNS related side effects or tolerance. Cancer cell viability assays and bone volume fraction assessed by micro computed tomography (microCT) demonstrated that these effects were not due to changes in cancer progression. The difference in...... cannabinoid agonists. However, the use of cannabinoid agonists in humans may be hampered by CNS related side effects and development of tolerance. In the present study, we investigated the effect of repeated low dose administration of the synthetic cannabinoid agonist WIN 55,212-2 on bone cancer pain and...

  1. Treatment of Advanced Non Small Cell Lung Cancer in Routine Care: A Retrospective Analysis of 212 Consecutive Patients Treated in a Community Based Oncology Group Practice

    Hubert Koeppler

    2009-01-01

    Full Text Available Treatment outcome data generated in prospective trials are intrinsically biased due to necessary selection criteria. Therefore the results obtained may not reflect the actual impact of current treatment options for an unselected general population. We analysed the treatment modalities and the outcome in 212 consecutive patients with non small cell lung cancer stages IIIB and IV who were seen in a community based oncology group practice between 6/1995 and 6/2006. 93 presented with stage IIIB and 119 with stage IV. Chemotherapy was given to 194/212 patients (92%, 114 patients (54% received palliative radiation at one point during treatment. Treatment consisted of chemotherapy only in 86 patients (40% and radiation only in 6 patients. 12 patients received best supportive care only. Patients with stage IIIB have survival rates at 12, 24 and 36 months of 64%, 27% and 21% respectively and for patients with stage IV the survival rates at 12, 24 and 36 months are 40%, 19% and 11% respectively. The median survival for stages IIIB and IV is 16 and 11 months respectively. In a multivariate analysis incorporating the factors stage (IIIB vs. IV, age (70 vs. 70 years and performance status (WHO 0/1 vs. 2/3 only stage and performance status were independent factors for survival. These retrospective data concerning analysis of survival , response rates and toxicity in a community setting confirm published results of phase II-III studies and indicate that results generated in prospective trials can be transferred into routine care.

  2. A Deep X-ray look at a very massive star: HETGS spectroscopy of the blue hypergiant Cyg OB2-12 (HIP 101364)

    Huenemoerder, David; Oskinova, Lidia; Ignace, Richard; Hamann, Wolf-Rainer; Schulz, Norbert S.; neilson, hilding; Shenar, Tomer

    2016-04-01

    We have obtained a Chandra/HETGS spectrum of one of the most massive and luminous stars in the Galaxy: the blue hypergiant Cyg OB2-12 (HIP 101364, spectral type B3 Ia+). This is the first measurement at high resolution of X-ray spectral lines in a blue hypergiant and allows comparison of X-ray properties between massive stars at different but related evolutionary stages: O-type supergiants, luminous blue variables, Wolf-Rayet stars, and blue hypergiants stars. The new data provide a look at how the most massive stars shed mass during their pre-supernova evolution. We find that In Cyg OB2-12 the resolved Si and Mg lines are broadened by about 1000 km/s (FWHM). The lines, however, do not show appreciable centroid shifts (<100 km/s), which would be much larger for canonical moderately thick winds (~500 km/s). The He-like Mg XI lines show evidence of photo-excitation, implying a wind origin close to the UV-bright photosphere. The spectrum also indicates relatively high temperature plasma, up to 22 MK (1.9 keV), showing significant continuum and emission lines below 5A (above 2.5 keV). Hence, at first glance, the spectrum resembles neither an O-star thick wind, nor a magnetically confined (narrow-line) plasma. We will present more detailed wind models using both X-ray and UV spectra to constrain fundamental physical parameters of this star.

  3. The jet and the disk of the HH 212 low-mass protostar imaged by ALMA: SO and SO2 emission

    Podio, L.; Codella, C.; Gueth, F.; Cabrit, S.; Bachiller, R.; Gusdorf, A.; Lee, C.-F.; Lefloch, B.; Leurini, S.; Nisini, B.; Tafalla, M.

    2015-09-01

    Context. The investigation of the disk formation and jet launching mechanism in protostars is crucial to understanding the earliest stages of star and planet formation. Aims: We aim to constrain the physical and dynamical properties of the molecular jet and disk of the HH 212 protostellar system at unprecedented angular scales, exploiting the capabilities of the Atacama Large Millimeter Array (ALMA). Methods: The ALMA observations of HH 212 in emission lines from sulfur-bearing molecules, SO 98-87, SO 1011-1010, SO282,6-71,7, are compared with simultaneous CO 3-2, SiO 8-7 data. The molecules column density and abundance are estimated using simple radiative transfer models. Results: SO 98-87 and SO282,6-71,7 show broad velocity profiles. At systemic velocity, they probe the circumstellar gas and the cavity walls. Going from low to high blue- and red-shifted velocities the emission traces the wide-angle outflow and the fast (~100-200 km s-1), collimated (~90 AU) molecular jet revealing the inner knots with timescales ≤50 yr. The jet transports a mass-loss rate ≥ 0.2-2 × 10-6 M⊙ yr-1, implying high ejection efficiency (≥ 0.03-0.3). The SO and SO2 abundances in the jet are ~ 10-7-10-6. SO 1011-1010 emission is compact and shows small-scale velocity gradients, indicating that it originates partly from the rotating disk previously seen in HCO+ and C17O, and partly from the base of the jet. The disk mass is ≥ 0.002-0.013 M⊙ and the SO abundance in the disk is ~ 10-8-10-7. Conclusions: SO and SO2 are effective tracers of the molecular jet in the inner few hundreds AU from the protostar. Their abundances indicate that 1-40% of sulfur is in SO and SO2 due to shocks in the jet/outflow and/or to ambipolar diffusion at the wind base. The SO abundance in the disk is 3-4 orders of magnitude larger than in evolved protoplanetary disks. This may be due to an SO enhancement in the accretion shock at the envelope-disk interface or in spiral shocks if the disk is partly

  4. A specific Ce oxidation process during sorption of rare earth elements on biogenic Mn oxide produced by Acremonium sp. strain KR21-2

    Tanaka, Kazuya; Tani, Yukinori; Takahashi, Yoshio; Tanimizu, Masaharu; Suzuki, Yoshinori; Kozai, Naofumi; Ohnuki, Toshihiko

    2010-10-01

    Sorption of rare earth elements (REEs) and Ce oxidation on natural and synthetic Mn oxides have been investigated by many researchers. Although Mn(II)-oxidizing microorganisms are thought to play an important role in the formation of Mn oxides in most natural environments, Ce oxidation by biogenic Mn oxide and the relevance of microorganisms to the Ce oxidation process have not been well understood. Therefore, in this study, we conducted sorption experiments of REEs on biogenic Mn oxide produced by Acremonium sp. strain KR21-2. The distribution coefficients, Kd(REE), between biogenic Mn oxide (plus hyphae) and 10 mmol/L NaCl solution showed a large positive Ce anomaly and convex tetrad effect variations at pH 3.8, which was consistent with previous works using synthetic Mn oxide. The positive Ce anomaly was caused by oxidation of Ce(III) to Ce(IV) by the biogenic Mn oxide, which was confirmed by analysis of the Ce L III-edge XANES spectra. With increasing pH, the positive Ce anomaly and convex tetrad effects became less pronounced. Furthermore, negative Ce anomalies were observed at a pH of more than 6.5, suggesting that Ce(IV) was stabilized in the solution (HPLC-ICP-MS showed that some fractions of REEs in the filtrates (<0.2 μm) after sorption experiments were bound to organic molecules (40 and <670 kDa fractions), which were possibly released from hyphae. A line of our data indicates that the negative Ce anomalies under circumneutral pH conditions arose from Ce(III) oxidation on the biogenic Mn oxide and subsequent complexation of Ce(IV) with organic ligands. The suppression of tetrad effects is also explained by the complexation of REEs with organic ligands. The results of this study demonstrate that the coexistence of the biogenic Mn oxide and hyphae of strain KR21-2 produces a specific redox chemistry which cannot be explained by inorganic species.

  5. Family paracentric inversion of the short arm of chromosome X (Xp21.2p11.23 and connection with autism spectrum disorders

    Pejović-Milovančević Milica

    2012-01-01

    Full Text Available Introduction. Autism spectrum disorders (ASDs are a group of complex pervasive developmental disorders characterized by impairments in communication, social interaction and behavior. In most cases autism is caused by a combination of genetic factors and environmental risk factors. In 10% to 20% of cases it has been shown that the cause of ASD is genetic. Case Outline. We are describing a 2-year-old boy who was referred to genetic counseling because of speech delay and certain autism-like behavior. By cytogenetic analysis the karyotype 46, inv(X,Y was obtained. The boy was a carrier of a paracentric inversion of the short arm of the chromosome X. After cytogenetic analysis of parental blood, it was detected that mother was a carrier of identical aberration, but had no clinical signs. The method of fluorescent in situ hybridization (FISH yielded the precise breakpoint in the region (p21.2p11.23. Mother and son were carriers of identical X chromosome. Conclusion. Breakpoints are located in the regions that have already been linked to autism, which indicates that the positional effect of the gene could have been a possible cause of the patient’s genotype. In addition to positional effects, in order to better understand the etiology of autism other genetic and environmental factors should be always taken into consideration. [Projekat Ministarstva nauke Republike Srbije, br. ON175013

  6. Oxidation behaviour of ferritic stainless steel grade Crofer 22 APU at 700 °C in flowing Ar-75%CO2-12%H2O

    Shariff, Nurul Atikah; Othman, Norinsan Kamil; Jalar, Azman

    2013-11-01

    The oxidation of Ferritic Stainless Steel (FSS) grade Crofer 22 APU has been investigated. FSS alloys were exposed to isothermal conditions in a horizontal tube furnace at a 700 °C in flowing Ar-75%CO2-12%H2O at a pressure of approximately 1 atm. The results showed that the growth of non protective Fe2O3 and spinel was observed after 50 h exposure in the presence of 12% H2O. The weight was increased significantly with time of exposure. The formation of different oxides is presented on the interface of the specimen such as MnCr2O4, Fe3O4 and Fe2O3 were revealed by X-ray diffraction and supported by EDAX analysis. FSS did not form a protective Cr2O3 layer due to water vapour accelerates the kinetics oxidation. Data of microstructure observation is presented and discussed in this paper in term of water vapour effects.

  7. The enhancement of 21.2%-power conversion efficiency in polymer photovoltaic cells by using mixed Au nanoparticles with a wide absorption spectrum of 400 nm-1000 nm

    郝敬昱; 徐颖; 张玉佩; 陈淑芬; 李兴鳌; 汪联辉; 黄维

    2015-01-01

    Au nanoparticles (NPs) mixed with a majority of bone-like, rod, and cube shapes and a minority of irregu-lar spheres, which can generate a wide absorption spectrum of 400 nm–1000 nm and three localized surface plas-mon resonance peaks, respectively, at 525, 575, and 775 nm, are introduced into the hole extraction layer poly(3,4-ethylenedioxythiophene):poly(4-styrenesulfonate) (PEDOT:PSS) to improve optical-to-electrical conversion performances in polymer photovoltaic cells. With the doping concentration of Au NPs optimized, the cell performance is significantly improved: the short-circuit current density and power conversion efficiency of the poly(3-hexylthiophene): [6,6]-phenyl-C60-butyric acid methyl ester cell are increased by 20.54%and 21.2%, reaching 11.15 mA·cm−2 and 4.23%. The variations of optical, electrical, and morphology with the incorporation of Au NPs in the cells are analyzed in detail, and our results demonstrate that the cell performance improvement can be attributed to a synergistic reaction, including:1) both the local-ized surface plasmon resonance-and scattering-induced absorption enhancement of the active layer, 2) Au doping-induced hole transport/extraction ability enhancement, and 3) large interface roughness-induced efficient exciton dissociation and hole collection.

  8. Comprehensive study on the structure of the BSA from extended-to aged form in wide (2-12) pH range.

    Varga, N; Hornok, V; Sebők, D; Dékány, I

    2016-07-01

    In this work we studied the structure of the bovine serum albumin (BSA) and the protein-ligand interactions since researchers prefer to use them as carriers in drug delivery systems. Systematic study (between pH 2-12, in double distilled water and physiological salt solution) was carried out to determine the changes in the secondary and the tertiary structures of the BSA, the apparent molecular weight (Mw), the size (dLS) and the electrokinetic potential (ζ). At pH 7, the BSA has higher stability in the absence (ζ=-69mV, dLS=2.2nm, A2=1.4×10(-3)mlmol/g(2)) than in the presence of salt solution (ζ=-2.4mV, dLS=5.3nm, A2=-3.2×10(-4)mlmol/g(2)). The Mw strongly depends on the pH and the ionic strength (at pH 3 in the absence of salt, the Mw is 54.6kDa while in the presence of salt is 114kDa) which determines the geometry of the protein. The protein-ligand interactions were characterized by fluorescence (FL) and isothermal microcalorimetry (ITC) methods; these independent techniques provided similar thermodynamic parameters such as the binding constant (K) and the Gibbs free energy (ΔG). PMID:26995614

  9. Charge-state dependence of M-shell x-ray production in 67Ho by 2--12-MeV carbon ions

    Charge-state dependence of M-shell x-ray production cross sections of 67Ho bombarded by 2--12-MeV carbon ions, with and without K-shell vacancies, were measured using a windowless Si(Li) x-ray detector with a full-width-at-half-maximum resolution of 135 eV at 5.9 keV. Carbon ions of different charge states were produced using a postacceleration, nitrogen gas stripping cell. The carbon ions were then magnetically analyzed to select the desired charge state and energy before entering the target chamber. The total M-shell and Mζ, Mα,β, and Mγ x-ray cross sections were measured. The electron-capture (EC) contributions as well as the direct-ionization (DI) contributions can be determined by making a comprehensive study of the projectile-charge-state dependence of the target x-ray production cross sections for targets in which the single-collision realm is maintained. In this paper, both EC and DI contributions and the total M-shell x-ray production cross sections are compared to both the first Born theory and to the perturbed-stationary-state theory with energy-loss, Coulomb-deflection, and relativistic corrections

  10. The jet and the disk of the HH 212 low-mass protostar imaged by ALMA: SO and SO2 emission

    Podio, L; Gueth, F; Cabrit, S; Bachiller, R; Gusdorf, A; Lee, C -F; Lefloch, B; Leurini, S; Nisini, B; Tafalla, M

    2015-01-01

    To investigate the disk formation and jet launch in protostars is crucial to comprehend the earliest stages of star and planet formation. We aim to constrain the properties of the molecular jet and the disk of the HH 212 protostellar system at unprecedented angular scales through ALMA observations of sulfur-bearing molecules, SO 9(8)-8(7), SO 10(11)-10(10), SO2 8(2,6)-7(1,7). SO 9(8)-8(7) and SO2 8(2,6)-7(1,7) show broad velocity profiles. At systemic velocity they probe the circumstellar gas and the cavity walls. Going from low to high blue-/red-shifted velocities the emission traces the wide-angle outflow and the fast (~100-200 km/s) and collimated (~90 AU) molecular jet revealing the inner knots with timescales 0.2-2e-6 Msun/yr, implying high ejection efficiency (>0.03-0.3). The SO and SO2 abundances in the jet are ~1e-7-1e-6. SO 10(11)-10(10) emission is compact and shows small-scale velocity gradients indicating that it originates partly from the rotating disk previously seen in HCO+ and C17O, and partly...

  11. Decontamination and decommissioning of 61 plutonium gloveboxes in D-Wing, Building 212 Argonne National Laboratory-East: Final project report

    Argonne National Laboratory-East (ANL-E) is a government-owned, contractor operated, multipurpose research facility located 25 miles southwest of downtown Chicago on 689 hectares (1,700 acres) in DuPage County, Illinois, as shown in Figure 1.1. Building 212 is located in the central area of ANL-E, as shown in Figure 1.2. The purpose of this project was to eliminate the risk of radioactive material release from the contaminated glovebox systems and to make the laboratories available for unrestricted use. The following work objectives were established: (1) Identify and remove radioactive materials for return to ANL-E Special Materials control. (2) Remove and package the radioactively contaminated materials and equipment from the gloveboxes. (3) Decontaminate the gloveboxes to nontransuranic (non-TRU) levels. (4) Size-reduce and package the gloveboxes and support systems. (5) Document and dispose of the radioactive and mixed waste. (6) Decontaminate, survey, and release the nine laboratories and corridor areas for unrestricted use

  12. Ruling out unresolved binaries in five transitional disks VLT/NACO: deep 2.12 and 1.75 {\\mu}m narrow-band imaging

    Vicente, Silvia; Hartung, Markus; Bouy, Herve; Huelamo, Nuria; Artigau, Etienne; Augereau, Jean-Charles; van Dishoeck, Ewine; Olofsson, Johan; Oliveira, Isa; Prusti, Timo

    2011-01-01

    Aims. We aim at detecting the presence of companions inside the inner hole/gap region of a sample of five well known transitional disks using spatially-resolved imaging in the near-IR with the VLT/NACO/S13 camera, which probes projected distances from the primary of typically 0.1 to 7 arcsec. The sample includes the stars DoAr 21, HD 135344B (SAO 206462), HR 4796A, T Cha, and TW Hya, spanning ages of less than 1 to 10 Myr, spectral types of A0 to K7, and hole/gap outer radii of 4 to 100 AU. Methods. In order to enhance the contrast and to avoid saturation at the core of the point-spread function (PSF), we use narrow-band filters at 1.75 and 2.12 {\\mu}m. The "locally optimized combination of images" (LOCI) algorithm is applied for an optimal speckle noise removal and PSF subtraction, providing an increase of 0.5-1.5 mag in contrast over the classic method. Results. With the proviso that we could have missed companions owing to unfavorable projections, the VLT/NACO observations rule out the presence of unresolv...

  13. Systemic radioimmunotherapy using a monoclonal antibody, anti-Tac directed toward the alpha subunit of the IL-2 receptor armed with the {alpha}-emitting radionuclides {sup 212}Bi or {sup 211}At

    Wesley, Jon N.; McGee, Edwin C.; Garmestani, Kayhan; Brechbiel, Martin W.; Yordanov, Alexander T.; Wu Chuanchu; Gansow, Otto A.; Eckelman, William C.; Bacher, John D.; Flynn, Michael; Goldman, Carolyn K.; MacLin, Melvin; Schwartz, Uwe P.; Jackson-White, Terri; Phillip, Celeste M.; Decker, Jean; Waldmann, Thomas A. E-mail: tawald@helix.nih.gov

    2004-04-01

    To exploit the fact that IL-2 receptors are expressed by T-cells responding to foreign antigens but not by resting T-cells, humanized anti-Tac (HAT) armed with alpha-emitting radionuclides {sup 212}Bi and {sup 211}At was evaluated in a cynomolgus cardiac allograft model. Control graft survival was 8.2{+-} 0.5 days compared with 14.0{+-}1.3 days (p<0.01) survival for monkeys treated with {sup 212}Bi labeled HAT and 26.7{+-}2.4 days survival (p<0.001 versus controls) with {sup 211}At labeled HAT. Thus, {sup 211}At labeled HAT may have application in organ transplantation and in treatment of IL-2 receptor expressing T-cell leukemia.

  14. Remaining Sites Verification Package for the 100-B-21:2 Subsite (100-B/C Discovery Pipeline DS-100BC-002). Attachment Waste Site Reclassification Form 2008-003

    The 100-B-21:2 waste site consists of the immediate area of the DS-100BC-02 pipeline. In accordance with this evaluation, the confirmatory and verification sampling results support a reclassification of this site to Interim Closed Out. The results of verification sampling show that residual contaminant concentrations do not preclude any future uses and allow for unrestricted use of shallow zone soils. The results also demonstrate that residual contaminant concentrations are protective of groundwater and the Columbia River

  15. Remaining Sites Verification Package for the 100-B-21:2 Subsite (100-B/C Discovery Pipeline DS-100BC-002), Waste Site Reclassification Form 2008-003

    J. M. Capron

    2008-06-16

    The 100-B-21:2 waste site consists of the immediate area of the DS-100BC-02 pipeline. In accordance with this evaluation, the confirmatory and verification sampling results support a reclassification of this site to Interim Closed Out. The results of verification sampling show that residual contaminant concentrations do not preclude any future uses and allow for unrestricted use of shallow zone soils. The results also demonstrate that residual contaminant concentrations are protective of groundwater and the Columbia River.

  16. Enhanced self-administration of the CB1 receptor agonist WIN55,212-2 in olfactory bulbectomized rats: evaluation of possible serotonergic and dopaminergic underlying mechanisms

    Petra eAmchova

    2014-03-01

    Full Text Available Depression has been associated with drug consumption, including heavy or problematic cannabis use. According to an animal model of depression and substance use disorder comorbidity, we combined the olfactory bulbectomy model of depression with intravenous drug self-administration procedure to verify whether depressive-like rats displayed higher voluntary intake of the CB1 receptor agonist WIN55,212-2 (WIN, 12.5 µg/kg/infusion. To this aim, olfactory-bulbectomized (OBX and sham-operated (SHAM Lister Hooded rats were allowed to self-administer WIN by lever-pressing under a continuous (FR-1 schedule of reinforcement in 2h daily sessions. Data showed that both OBX and SHAM rats developed stable WIN intake; yet, responses in OBX were constantly higher than in SHAM rats soon after the first week of training. In addition, OBX rats took significantly longer to extinguish the drug-seeking behaviour after vehicle substitution. Acute pre-treatment with serotonin 5HT1B receptor agonist, CGS-12066B (2.5-10 mg/kg, did not significantly modify WIN intake in OBX and SHAM Lister Hooded rats. Furthermore, acute pre-treatment with CGS-12066B (10 and 15 mg/kg did not alter responses in parallel groups of OBX and SHAM Sprague Dawley rats self-administering methamphetamine under higher (FR-2 reinforcement schedule with nose-poking as operandum. Finally, dopamine levels in the nucleus accumbens of OBX rats did not increase in response to a WIN challenge, as in SHAM rats, indicating a dopaminergic dysfunction in bulbectomized rats. Altogether, our findings suggest that a depressive state may alter cannabinoid CB1 receptor agonist-induced brain reward function and that a dopaminergic rather than a 5-HT1B mechanism is likely to underlie enhanced WIN self-administration in OBX rats.

  17. Involvement of TRPV1 channels in the activity of the cannabinoid WIN 55,212-2 in an acute rat model of temporal lobe epilepsy.

    Carletti, Fabio; Gambino, Giuditta; Rizzo, Valerio; Ferraro, Giuseppe; Sardo, Pierangelo

    2016-05-01

    The exogenous cannabinoid agonist WIN 55,212-2, (R)-(+)-[2,3-dihydro-5-methyl-3-(4-morpholinylmethyl) pyrrolo[1,2,3-de]-1,4-benzoxazin-6-Yl]-1-naphthalenylmethanone (WIN), has revealed to play a role on modulating the hyperexcitability phenomena in the hippocampus. Cannabinoid-mediated mechanisms of neuroprotection have recently been found to imply the modulation of transient receptor potential vanilloid 1 (TRPV1), a cationic channel subfamily that regulate synaptic excitation. In our study, we assessed the influence of pharmacological manipulation of TRPV1 function, alone and on WIN antiepileptic activity, in the Maximal Dentate Activation (MDA) acute model of temporal lobe epilepsy. Our results showed that the TRPV1 agonist, capsaicin, increased epileptic outcomes; whilst antagonizing TRPV1 with capsazepine exerts a protective role on paroxysmal discharge. When capsaicin is co-administered with WIN effective dose of 10mg/kg is able to reduce its antiepileptic strength, especially on the triggering of MDA response. Accordingly, capsazepine at the protective dose of 2mg/kg managed to potentiate WIN antiepileptic effects, when co-treated. Moreover, WIN subeffective dose of 5mg/kg was turned into effective when capsazepine comes into play. This evidence suggests that systemic administration of TRPV1-active drugs influences electrically induced epilepsy, with a noticeable protective activity for capsazepine. Furthermore, results from the pharmacological interaction with WIN support an interplay between cannabinoid and TRPV1 signaling that could represent a promising approach for a future pharmacological strategy to challenge hyperexcitability-based diseases. PMID:26970948

  18. Health and exercise-related medical issues among 1,212 ultramarathon runners: baseline findings from the Ultrarunners Longitudinal TRAcking (ULTRA) Study.

    Hoffman, Martin D; Krishnan, Eswar

    2014-01-01

    Regular exercise is associated with substantial health benefits; however, little is known about the health impact of extreme levels of exercise. This study examined the prevalence of chronic diseases, health-care utilization, and risk factors for exercise-related injuries among ultramarathon runners. Retrospective, self-reported enrollment data from an ongoing longitudinal observational study of 1,212 active ultramarathon runners were analyzed. The most prevalent chronic medical conditions were allergies/hay fever (25.1%) and exercise-induced asthma (13.0%), but there was a low prevalence of serious medical issues including cancers (4.5%), coronary artery disease (0.7%), seizure disorders (0.7%), diabetes (0.7%), and human immunodeficiency virus (HIV) infection (0.2%). In the year preceding enrollment, most (64.6%) reported an exercise-related injury that resulted in lost training days (median of 14 days), but little nonattendance of work or school due to illness, injury, or exercise-related medical conditions (medians of 0 days for each). The knee was the most common area of exercise-related injury. Prior year incidence of stress fractures was 5.5% with most (44.5%) involving the foot. Ultramarathon runners who sustained exercise-related injuries were younger (pasthma and allergies than the general population, and the prevalence of serious medical issues was nontrivial and should be recognized by those providing medical care to these individuals. Ultramarathon runners, compared with shorter distance runners, have a similar annual incidence of exercise-related injuries but higher proportion of stress fractures involving the foot, and it is the younger and less experienced ultramarathoners who appear most at risk for injury. PMID:24416176

  19. Paracentric inversion of chromosome 7 (46,XX,inv(7)(q21.2q22)) in a newborn with hypoplastic left heart syndrome

    Kuforjii, T.A.; Pillers, D.M.; Silberbach, M. [Oregon Health Sciences Univ., Portland, OR (United States)] [and others

    1994-09-01

    Hypoplastic left heart syndrome (HLHS) is a severe congenital heart disease that is uniformly fatal without surgical intervention. Fetal echocardiography allows prenatal diagnosis, but this condition may not become apparent until after the mid-second trimester. We report a term baby with severe HLHS who had an 18 week fetal ultrasound that reportedly demonstrated a normal heart. There was no family history of congenital heart disease. She was phenotypically female with no dysmorphic features. Physical examination was otherwise normal. She expired at 48 hours of age. The autopsy was noncontributory. The karyotype was 46,XX, but there was an apparently balanced paracentric inversion of the long arm of chromosome 7 (46,XX,inv(7)(q21.2q22)). The mother`s chromosome study was normal without any inversion, and the father was not available for study. Hypoplastic left heart syndrome has been associated with extracardiac anomalies and chromosomal abnormalities including 45,XO,11q-, and trisomy 18. It has also been reported in 5 members spanning 3 generations of a family with a spectrum of left heart defects suggesting an autosomal dominant pattern with high penetrance. First-degree relatives of infants with HLHS have a thirteen percent incidence of related cardiovascular malformations, a frequency higher than predicted by a multifactorial model of inheritance, suggesting that at least a portion of HLHS have a genetic basis. Karyotype analysis, including high resolution banding, may help define the etiology of this condition. Chromosome 7 has not been implicated in HLHS. This case emphasizes the need for genetic analysis, including a pedigree, of affected families. It also underscores the importance of screening by karyotype analysis to determine whether defects of the long arm of chromosome 7 are important in the pathogenesis of hypoplastic left heart syndrome.

  20. ALMA results of the pseudodisk, rotating disk, and jet in the continuum and HCO{sup +} in the protostellar system HH 212

    Lee, Chin-Fei; Hirano, Naomi; Shang, Hsien; Ho, Paul T. P.; Krasnopolsky, Ruben [Academia Sinica Institute of Astronomy and Astrophysics, P.O. Box 23-141, Taipei 106, Taiwan (China); Zhang, Qizhou, E-mail: cflee@asiaa.sinica.edu.tw [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States)

    2014-05-10

    HH 212 is a nearby (400 pc) Class 0 protostellar system showing several components that can be compared with theoretical models of core collapse. We have mapped it in the 350 GHz continuum and HCO{sup +} J = 4-3 emission with ALMA at up to ∼0.''4 resolution. A flattened envelope and a compact disk are seen in the continuum around the central source, as seen before. The HCO{sup +} kinematics shows that the flattened envelope is infalling with small rotation (i.e., spiraling) into the central source, and thus can be identified as a pseudodisk in the models of magnetized core collapse. Also, the HCO{sup +} kinematics shows that the disk is rotating and can be rotationally supported. In addition, to account for the missing HCO{sup +} emission at low-redshifted velocity, an extended infalling envelope is required, with its material flowing roughly parallel to the jet axis toward the pseudodisk. This is expected if it is magnetized with an hourglass B-field morphology. We have modeled the continuum and HCO{sup +} emission of the flattened envelope and disk simultaneously. We find that a jump in density is required across the interface between the pseudodisk and the disk. A jet is seen in HCO{sup +} extending out to ∼500 AU away from the central source, with the peaks upstream of those seen before in SiO. The broad velocity range and high HCO{sup +} abundance indicate that the HCO{sup +} emission traces internal shocks in the jet.

  1. The enhancement of 21.2%-power conversion efficiency in polymer photovoltaic cells by using mixed Au nanoparticles with a wide absorption spectrum of 400 nm-1000 nm

    Hao, Jing-Yu; Xu, Ying; Zhang, Yu-Pei; Chen, Shu-Fen; Li, Xing-Ao; Wang, Lian-Hui; Huang, Wei

    2015-04-01

    Au nanoparticles (NPs) mixed with a majority of bone-like, rod, and cube shapes and a minority of irregular spheres, which can generate a wide absorption spectrum of 400 nm-1000 nm and three localized surface plasmon resonance peaks, respectively, at 525, 575, and 775 nm, are introduced into the hole extraction layer poly(3,4-ethylenedioxythiophene):poly(4-styrenesulfonate) (PEDOT:PSS) to improve optical-to-electrical conversion performances in polymer photovoltaic cells. With the doping concentration of Au NPs optimized, the cell performance is significantly improved: the short-circuit current density and power conversion efficiency of the poly(3-hexylthiophene): [6,6]-phenyl-C60-butyric acid methyl ester cell are increased by 20.54% and 21.2%, reaching 11.15 mA·cm-2 and 4.23%. The variations of optical, electrical, and morphology with the incorporation of Au NPs in the cells are analyzed in detail, and our results demonstrate that the cell performance improvement can be attributed to a synergistic reaction, including: 1) both the localized surface plasmon resonance- and scattering-induced absorption enhancement of the active layer, 2) Au doping-induced hole transport/extraction ability enhancement, and 3) large interface roughness-induced efficient exciton dissociation and hole collection. Project supported by the National Basic Research Program of China (Grant Nos. 2015CB932202 and 2012CB933301), the National Natural Science Foundation of China (Grant Nos. 61274065, 51173081, 61136003, BZ2010043, 51372119, and 51172110), the Science Fund from the Ministry of Education of China (Grant No. IRT1148), the Specialized Research Fund for the Doctoral Program of Higher Education of China (Grant No. 20113223110005), the Priority Academic Program Development of Jiangsu Provincial Higher Education Institutions (Grant No. YX03001), and the National Synergistic Innovation Center for Advanced Materials and the Synergetic Innovation Center for Organic Electronics and

  2. Isotopic generator for 212Pb and 212Bi

    A large potential exists for the use of short lived alpha emitting isotopes for therapeutic purposes. Most prior research has been performed with isotopes such as 211At which require a cyclotron for production. It obviously would be more convenient to use a long lived isotopic generator system. For this reason, we have undertaken a study of the properties of several such generators, one of which, 228Th, is described here

  3. Local Tumor Control, Visual Acuity, and Survival After Hypofractionated Stereotactic Photon Radiotherapy of Choroidal Melanoma in 212 Patients Treated Between 1997 and 2007

    Purpose: To evaluate long-term local tumor control, visual acuity, and survival after hypofractionated linear accelerator-based stereotactic photon radiotherapy in patients with choroidal melanoma. Methods and Materials: Between 1997 and 2007, 212 patients with choroidal melanoma unsuitable for ruthenium-106 brachytherapy or local resection were treated stereotactically at a linear accelerator with 6-MV photon beams at the Medical University of Vienna in five fractions over 7 days. Twenty-four patients received a total dose of 70 Gy (five fractions of 14 Gy), 158 a total dose of 60 Gy (five fractions of 12 Gy) and 30 patients a total dose of 50 Gy (five fractions of 10 Gy) applied on the 80% isodose. Ophthalmologic examinations were performed at baseline and every 3 months in the first 2 years, every 6 months until 5 years, and once a year thereafter until 10 years after radiotherapy. Assessment of visual acuity, routine ophthalmologic examinations, and measurement of tumor base dimension and height using standardized A-scan and B-scan echography were done at each visit. Funduscopy and fluorescein angiography were done when necessary to document tumor response. Results: Median tumor height and volume decreased from 4.8 mm and 270.7 mm3 at baseline to 2.6 mm and 86.6 mm3 at the last individual follow-up, respectively (p < 0.001, p < 0.001). Median visual acuity decreased from 0.55 at baseline to hand motion at the last individual follow-up (p < 0.001). Local tumor control was 95.9% after 5 years and 92.6% after 10 years. Thirty-two patients developed metastatic disease, and 22 of these patients died during the follow-up period. Conclusion: Hypofractionated stereotactic photon radiotherapy with 70 to 50 Gy delivered in five fractions in 7 days is sufficient to achieve excellent local tumor control in patients with malignant melanoma of the choroid. Disease outcome and vision are comparable to those achieved with proton beam radiotherapy. Decreasing the total dose

  4. Health and exercise-related medical issues among 1,212 ultramarathon runners: baseline findings from the Ultrarunners Longitudinal TRAcking (ULTRA Study.

    Martin D Hoffman

    Full Text Available Regular exercise is associated with substantial health benefits; however, little is known about the health impact of extreme levels of exercise. This study examined the prevalence of chronic diseases, health-care utilization, and risk factors for exercise-related injuries among ultramarathon runners. Retrospective, self-reported enrollment data from an ongoing longitudinal observational study of 1,212 active ultramarathon runners were analyzed. The most prevalent chronic medical conditions were allergies/hay fever (25.1% and exercise-induced asthma (13.0%, but there was a low prevalence of serious medical issues including cancers (4.5%, coronary artery disease (0.7%, seizure disorders (0.7%, diabetes (0.7%, and human immunodeficiency virus (HIV infection (0.2%. In the year preceding enrollment, most (64.6% reported an exercise-related injury that resulted in lost training days (median of 14 days, but little nonattendance of work or school due to illness, injury, or exercise-related medical conditions (medians of 0 days for each. The knee was the most common area of exercise-related injury. Prior year incidence of stress fractures was 5.5% with most (44.5% involving the foot. Ultramarathon runners who sustained exercise-related injuries were younger (p<0.001 and less experienced (p<0.01 than those without injury. Stress fractures were more common (p<0.01 among women than men. We conclude that, compared with the general population, ultramarathon runners appear healthier and report fewer missed work or school days due to illness or injury. Ultramarathon runners have a higher prevalence of asthma and allergies than the general population, and the prevalence of serious medical issues was nontrivial and should be recognized by those providing medical care to these individuals. Ultramarathon runners, compared with shorter distance runners, have a similar annual incidence of exercise-related injuries but higher proportion of stress fractures involving

  5. The identification of soil radionuclides in the area of Puspiptek and surrounding

    The area of PUSPIPTEK and the surrounding are potentially exposed by radionuclides, because the operation of the nuclear research plant. The PPTN Serpong was operated long than 10 years, therefore soil radioactivity need to evaluate. The determination of radioactivity in the soil samples which be taken from research location using gamma spectrometry on June-August. The result of the research identified natural radionuclides K-40; Thorium decay series Ac-228, Bi-212, Pb-212, Tl-208, Ra-224 and Rn-220; Uranium decay series Bi-214, Pa-234, Pb-214 and Actinium decay series Bi-211, Po-211. There are no identification radionuclides produce from the activation of PPTN Serpong

  6. 3′-hydroxy-3,4,5,4′-tetramethoxystilbene, the metabolite of resveratrol analogue DMU-212, inhibits ovarian cancer cell growth in vitro and in a mice xenograft model

    Piotrowska-Kempisty, Hanna; Ruciński, Marcin; Borys, Sylwia; Kucińska, Małgorzata; Kaczmarek, Mariusz; Zawierucha, Piotr; Wierzchowski, Marcin; Łażewski, Dawid; Murias, Marek; Jodynis-Liebert, Jadwiga

    2016-01-01

    In screening studies, the cytotoxic activity of four metabolites of resveratrol analogue 3,4,5,4′-tetramethoxystilbene (DMU-212) against A-2780 and SKOV-3 ovarian cancer cells was investigated. The most active metabolite, 3′-hydroxy-3,4,5,4′-tetramethoxystilbene (DMU-214), was chosen for further studies. The cytotoxicity of DMU-214 was shown to be higher than that of the parent compound, DMU-212, in both cell lines tested. Since DMU-212 was supposed to undergo metabolic activation through its conversion to DMU-214, an attempt was made to elucidate the mechanism of its anti-proliferative activity. We found that in SKOV-3 cells lacking p53, DMU-214 induced receptor-mediated apoptosis. In A-2780 cell line with expression of wild-type p53, DMU-214 modulated the expression pattern of p53-target genes driving intrinsic and extrinsic apoptosis pathways, as well as DNA repair and damage prevention. Regardless of the up-regulation of p48, p53R2, sestrins and Gaad45 genes involved in cancer cell DNA repair, we demonstrated the stronger anti-proliferative and pro-apoptotic effects of DMU-214 in A-2780 cells when compared to those in SKOV-3. Hence we verified DMU-214 activity in the xenograft model using SCID mice injected with A-2780 cells. The strong anti-proliferative activity of DMU-214 in the in vivo model allowed to suggest the tested compound as a potential therapeutic in ovarian cancer treatment. PMID:27585955

  7. Effects of WIN 55,212-2 (a non-selective cannabinoid CB1 and CB2 receptor agonist) on the protective action of various classical antiepileptic drugs in the mouse 6 Hz psychomotor seizure model

    Florek-Luszczki, Magdalena; Wlaz, Aleksandra; Kondrat-Wrobel, Maria W.; Tutka, Piotr; Jarogniew J Luszczki

    2014-01-01

    The aim of this study was to characterize the influence of WIN 55,212-2 (WIN—a non-selective cannabinoid CB1 and CB2 receptor agonist) on the anticonvulsant effects of various classical antiepileptic drugs (clobazam, clonazepam, phenobarbital and valproate) in the mouse 6 Hz-induced psychomotor seizure model. Limbic (psychomotor) seizure activity was evoked in albino Swiss mice by a current (32 mA, 6 Hz, 3 s stimulus duration) delivered via ocular electrodes. Drug-related adverse effects were...

  8. A randomized, multicentre study of directed daylight exposure times of 11/2 vs. 21/2 h in daylight-mediated photodynamic therapy with methyl aminolaevulinate in patients with multiple thin actinic keratoses of the face and scalp

    Wiegell, S.R.; Fabricius, S.; Philipsen, P.A.;

    2011-01-01

    Background: Actinic keratoses (AKs) are common dysplastic skin lesions that may differentiate into invasive squamous cell carcinomas. Although a superior cosmetic outcome of photodynamic therapy (PDT) is advantageous compared with equally effective treatments such as cryotherapy and curettage, the...... entire treatment area. Immediately after, patients left the clinic and exposed themselves to daylight according to the randomization. Daylight exposure was monitored with a wristwatch dosimeter and patients scored their pain sensation during treatment. Results: The mean lesion response rate at 3 months...... was 77% in the 11/2-h group and 75% in the 21/2-h group (P = 0·57). The mean duration of daylight exposure was 131 and 187 min in the two groups. The mean overall effective light dose was 9·4 J cm (range 0·2-28·3). Response rate was not associated with effective daylight dose, exposure duration...

  9. Radium-228 analysis of natural waters by Cherenkov counting of Actinium-228

    The activities of 228Ra in natural waters were determined by the Cherenkov counting of the daughter nuclide 228Ac. The radium was pre-concentrated on MnO2 and the radium purified via ion exchange and, after a 2-day period of incubation to allow for secular equilibrium between the parent-daughter 228Ra(228Ac), the daughter nuclide 228Ac was isolated by ion exchange according to the method of Nour et al. [2004. Radium-228 determination of natural waters via concentration on manganese dioxide and separation using Diphonix ion exchange resin. Appl. Radiat. Isot. 61, 1173-1178]. The Cherenkov photons produced by 228Ac were counted directly without the addition of any scintillation reagents. The optimum Cherenkov counting window, sample volume, and vial type were determined experimentally to achieve optimum Cherenkov photon detection efficiency and lowest background count rates. An optimum detection efficiency of 10.9±0.1% was measured for 228Ac by Cherenkov counting with a very low Cherenkov photon background of 0.317±0.013 cpm. The addition of sodium salicylate into the sample counting vial at a concentration of 0.1 g/mL yielded a more than 3-fold increase in the Cherenkov detection efficiency of 228Ac to 38%. Tests of the Cherenkov counting technique were conducted with several water standards of known activity and the results obtained compared closely with a conventional liquid scintillation counting technique. The advantages and disadvantages of Cherenkov counting compared to liquid scintillation counting methods are discussed. Advantages include much lower Cherenkov background count rates and consequently lower minimal detectable activities for 228Ra and no need for expensive environmentally unfriendly liquid scintillation cocktails. The disadvantages of the Cherenkov counting method include the need to measure 228Ac Cherenkov photon detection efficiency and optimum Cherenkov counting volume, which are not at all required when liquid scintillation analysis is used

  10. Linear free energy relationship applied to trivalent cations with lanthanum and actinium oxide and hydroxide structure

    Linear free energy relationships for trivalent cations with crystalline M2O3 and, M(OH)3 phases of lanthanides and actinides were developed from known thermodynamic properties of the aqueous trivalent cations, modifying the Sverjensky and Molling equation. The linear free energy relationship for trivalent cations is as ΔGf,MvX0=aMvXΔGn,M3+0+bMvX+βMvXrM3+, where the coefficients aMvX, bMvX, and βMvX characterize a particular structural family of MvX, rM3+ is the ionic radius of M3+ cation, ΔGf,MvX0 is the standard Gibbs free energy of formation of MvX and ΔGn,M3+0 is the standard non-solvation free energy of the cation. The coefficients for the oxide family are: aMvX=0.2705, bMvX=-1984.75 (kJ/mol), and βMvX=197.24 (kJ/molnm). The coefficients for the hydroxide family are: aMvX=0.1587, bMvX=-1474.09 (kJ/mol), and βMvX=791.70 (kJ/molnm).

  11. Actinium: A RESTful Runtime Container for Scriptable Internet of Things Applications

    Kovatsch, Matthias; Lanter, Martin; Duquennoy, Simon

    2012-01-01

    Programming Internet of Things (IoT) applications is challenging because developers have to be knowledgeable in various technical domains, from low-power networking, over embedded operating systems, to distributed algorithms. Hence, it will be challenging to find enough experts to provide software for the vast number of expected devices, which must also be scalable and particularly safe due to the connection to the physical world. To remedy this situation, we propose an architecture that pr...

  12. Reflection asymmetry in odd-A and odd-odd actinium nuclei

    Theoretical calculations and measurements indicate that octupole correlations are at a maximum in the ground states of the odd-proton nuclei Ac and Pa. It has been expected that odd-odd nuclei should have even larger amount of octupole-octupole correlations. We have recently made measurements on the structure of 224Ac. Although spin and parity assignments could not be made, two bands starting at 354.1 and 360.0 keV have properties characteristic of reflection asymmetric shape. These two bands have very similar rotational constants and also similar alpha decay rates, which suggest similarity between the wavefunctions of these bands. These signatures provide evidence for octupole correlations in these nuclides

  13. Bestimmung der Ionisationsenergie von Actinium und Ultraspurenanalyse von Plutonium mit resonanter Ionisationsmassenspektrometrie (RIMS)

    Waldek, Achim Marcus

    2001-01-01

    ZusammenfassungDie Resonanzionisationsmassenspektrometrie (RIMS) verbindet hohe Elementselektivität mit guter Nachweiseffizienz. Aufgrund dieser Eigenschaften ist die Methode für Ultraspurenanalyse und Untersuchungen an seltenen oder schwer handhabbaren Elementen gut geeignet. Für RIMS werden neutrale Atome mit monochromatischem Laserlicht ein- oder mehrfach resonant auf energetisch hoch liegende Niveaus angeregt und anschließend durch einen weiteren Laserstrahl oder durch ein elektrisches Fe...

  14. Synthesis of chelating agents for actinium 225 complexation and its application in radioimmunotherapy

    Immunotherapy with radiolabeled antibodies should allow fairly specific targeting of certain cancers. However, iodine 131 may not be the best isotope for tumor therapy because of its limited specific activity, low beta-energy, relatively long half life and strong gamma emission. Another approach to improve therapeutic efficacy is the use of replacement isotopes with better physical properties. Chelator that can hold radio-metals with high stability under physiological conditions are essential to avoid excessive damage to non-target cells; Moreover, the development of new bifunctional chelating agents is essential for this purpose. Accordingly, our efforts have been directed, for several years, to the synthesis of original chelating agents likely to form stable complexes in vivo with the numerous potential candidates for such applications. Therefore, we have developed a new simple and efficient synthesis pathway of 2-(4-iso-thio-cyanate-benzyl)-1,4,7,10,13,16- hexa-aza-cyclo-hexadecane- 1,4,7,10,13,16-hexa-acetic acid, though functionalized on the cycle by a termination allowed coupling to an antibody or any other biological substance such as a hapten. (author)

  15. Purification of selenium from thorium, uranium, radium, actinium and potassium impurities for low background measurements

    A technique of selenium purification from 232Th, 238U, 226,228Ra, 227Ac and 40K was developed. This technique is simple to perform and employs a minimum number of highly pure reagents (bidistilled water, nitric acid). Operations carried out during purification (elution, evaporation) practically exclude losses of the target product (chemical yields of Se > 99%). A test purification of 100 g of selenium was carried out using this technique. The efficiency of this technique was confirmed by low background gamma spectrometry of the purified selenium sample. Distribution coefficients of Th, U, Ra and Ac on DOWEX 50W- x 8 cation-exchange resin at different concentrations of selenium and nitric acid were experimentally determinated. Instrumental neutron activation analysis of bidistilled water, deionized water and nitric acid was performed. (orig.)

  16. Purification of selenium from thorium, uranium, radium, actinium and potassium impurities for low background measurements

    Rakhimov, A.V. [Joint Institute for Nuclear Research (JINR), Dubna (Russian Federation); Uzbek Academy of Sciences, Tashkent (Uzbekistan). Inst. of Nuclear Physics (INP AS RUz); Warot, G. [CEA-CNRS, Modane (France). Laboratoire Souterrain de Modane (LSM); Karaivanov, D.V. [Joint Institute for Nuclear Research (JINR), Dubna (Russian Federation); Institute for Nuclear Research and Nuclear Energy (INRNE), Sofia (Bulgaria); Kochetov, O.I.; Lebedev, N.A.; Filosofov, D.V. [Joint Institute for Nuclear Research (JINR), Dubna (Russian Federation); Mukhamedshina, N.M.; Sadikov, I.I. [Uzbek Academy of Sciences, Tashkent (Uzbekistan). Inst. of Nuclear Physics (INP AS RUz)

    2013-07-01

    A technique of selenium purification from {sup 232}Th, {sup 238}U, {sup 226,228}Ra, {sup 227}Ac and {sup 40}K was developed. This technique is simple to perform and employs a minimum number of highly pure reagents (bidistilled water, nitric acid). Operations carried out during purification (elution, evaporation) practically exclude losses of the target product (chemical yields of Se > 99%). A test purification of 100 g of selenium was carried out using this technique. The efficiency of this technique was confirmed by low background gamma spectrometry of the purified selenium sample. Distribution coefficients of Th, U, Ra and Ac on DOWEX 50W- x 8 cation-exchange resin at different concentrations of selenium and nitric acid were experimentally determinated. Instrumental neutron activation analysis of bidistilled water, deionized water and nitric acid was performed. (orig.)

  17. Chronic co-administration of the cannabinoid receptor agonist WIN55,212-2 during puberty or adulthood reverses 3,4 methylenedioxymetamphetamine (MDMA)-induced deficits in recognition memory but not in effort-based decision making.

    Schulz, Sybille; Becker, Thorsten; Nagel, Ulrich; von Ameln-Mayerhofer, Andreas; Koch, Michael

    2013-05-01

    Cannabis and 3,4 methylenedioxymetamphetamine (MDMA, "ecstasy") are the most frequently combined illegal drugs among young adults in western societies. This study examined the effects of chronic co-administration of the cannabinoid receptor agonist WIN55,212-2 (WIN) and MDMA on working memory and effort-based decision making in rats. Treatment consisted of MDMA (7.5 mg/kg), WIN (1.2 mg/kg), a combination of these substances (MDMA+WIN) or vehicle over a period of 25 days during puberty (PD40-65) or adulthood (PD80-105). Ten days after the last treatment, WIN reversed MDMA-induced working memory deficits in the object recognition test in animals treated during adulthood or puberty, but had no influence on impairment of adult rats in the effort-based T-maze task. No differences were observed between groups of pubertally treated rats in the decision making task. During a subsequent acute drug challenge MDMA and MDMA+WIN decreased high reward choices in both age groups, indicating MDMA-induced cost-aversive choice. Differential long-term interactions on the neuronal level in the hippocampus and MDMA-induced disturbances in cortico-limbic connections are suggested. PMID:23541493

  18. Measurement of the 115In(n,γ)116 m In reaction cross-section at the neutron energies of 1.12, 2.12, 3.12 and 4.12 MeV

    Lawriniang, Bioletty Mary; Badwar, Sylvia; Ghosh, Reetuparna; Jyrwa, Betylda; Vansola, Vibha; Naik, Haladhara; Goswami, Ashok; Naik, Yeshwant; Datrik, Chandra Shekhar; Gupta, Amit Kumar; Singh, Vijay Pal; Pol, Sudir Shibaji; Subramanyam, Nagaraju Balabenkata; Agarwal, Arun; Singh, Pitambar

    2015-08-01

    The 115In(n,γ)116 m In reaction cross section at neutron energies of 1.12, 2.12, 3.12 and 4.12 MeV was determined by using an activation and off-line γ-ray spectrometric technique. The monoenergetic neutron energies of 1.12 - 4.12 MeV were generated from the 7Li(p,n) reaction by using proton beam with energies of 3 and 4 MeV from the folded tandem ion beam accelerator (FOTIA) at Bhabha Atomic Research Centre (BARC) and with energies of 5 and 6 MeV from the Pelletron facility at Tata Institute of Fundamental Research (TIFR), Mumbai. The 197Au(n,γ)198Au reaction cross-section was used as the neutron flux monitor.The 115In(n,γ)116 m In reaction cross section at neutron energies of 1.12, 2.12, 3.12 and 4.12 MeV was determined by using an activation and off-line γ-ray spectrometric technique. The monoenergetic neutron energies of 1.12 - 4.12 MeV were generated from the 7Li(p,n) reaction by using proton beam with energies of 3 and 4 MeV from the folded tandem ion beam accelerator (FOTIA) at Bhabha Atomic Research Centre (BARC) and with energies of 5 and 6 MeV from the Pelletron facility at Tata Institute of Fundamental Research (TIFR), Mumbai. The 197Au(n,γ)198 Au reaction cross-section was used as the neutron flux monitor. The 115In(n,γ)116 m In reaction cross-sections at neutron energies of 1.12 - 4.12 MeV were compared with the literature data and were found to be in good agreement with one set of data, but not with others. The 115In(n,γ)116 m In cross-section was also calculated theoretically by using the computer code TALYS 1.6 and was found to be slightly lower than the experimental data from the present work and the literature.)198Au reaction cross-section was used as the neutron flux monitor. The 115In(n,γ)116 m In reaction cross-sections at neutron energies of 1.12 - 4.12 MeV were compared with the literature data and were found to be in good agreement with one set of data, but not with others. The 115In(n,γ)116 m In cross-section was also calculated

  19. 32 CFR 212.6 - Procedures.

    2010-07-01

    .... (i) No person because of race, color, creed, sex, age, disability, or national origin shall be... and salaries as employees of the non-Federal entity or as award recognition for services rendered to... be self-sustaining, primarily through dues, contributions, service charges, fees, or...

  20. 40 CFR 21.2 - Definitions.

    2010-07-01

    ....S.C. 1151, et seq. (f) Pollutant means dredged spoil, solid waste, incinerator residue, sewage..., wrecked or discarded equipment, rock, sand, cellar dirt and industrial, municipal, and agricultural waste... CFR part 121, and regulations of the Small Business Administration promulgated thereunder. (b)...

  1. ACCT 212 Course Tutorial/TutorialRank

    loovi

    2015-01-01

    For more course tutorials visit www.tutorialrank.com Tutorial Purchased: 3 Times, Rating: A (TCO 1) The Accounting Equation is used to develop the organizations financial reports. (1) Describe what owners' equity values would be if Assets are $100,000 and Liabilities are $27,000 by showing the Accounting Equation (10 points) and (2) provide an explanation of what accounts could be found in owners' equity. (10 points)  (TCO 1) The financial statements present a compan...

  2. 43 CFR 17.212 - Employment criteria.

    2010-10-01

    ..., manual, or speaking skills the test results accurately reflect the applicant's or employee's job skills... shown to be job-related for the position in question, and (2) alternative job-related tests or criteria... test purports to measure). (c) All job qualifications must be shown to be directly related to the...

  3. 42 CFR 59.212 - Grantee accountability.

    2010-10-01

    ... due pursuant to subparts F, M, and O of 45 CFR part 74. Such total sum shall constitute a debt owed by... Intergovernmental Cooperation Act of 1968 (42 U.S.C. 4213), a State will not be held accountable for interest earned... the Intergovernmental Cooperation Act, means any one of the several States, the District of...

  4. 5 CFR 842.212 - Deferred retirement.

    2010-01-01

    ... this section, an employee or Member who has not attained the minimum retirement age, and who, after... following the date on which the individual attains the minimum retirement age or, if later, (ii) A date the... retirement age, and is reemployed before filing an application for retirement based on that separation,...

  5. PSYCHIATRIC DISORDER21.2.Schizophrenia

    1995-01-01

    950421 A study on therapeutic efficacy,side effectsand correlation between plasma concentration andtherapeutic effect of haloperridol decanoate on treat-ment of schizophrenia.ZHANG Hongyan(张鸿燕),etal.Ment Health Instit,Beijing Med Univ,Beijing,100083.Chin J Neurol & Psychiat 1994;27(5):283-285.Haloperidol decanoate (HD) was conducted in treat-ing 83 schizophrenics in nine hospitals for 24 weeks,meanwhile plasma drug concentration was measured.The results show that therapeutic effectiveness of HDis saticfactory in more than 50%;the static plasmaconcentration in recovery and obviously improved pa-

  6. 21.PSYCHIATRIC DISORDER 21.2.Schizophrenia

    1992-01-01

    920198 Kinetic observation of serum thyr-onormone level in schizophrenics.WANGXueyi (王学义),et al.Psychiatr Hosp,KailuanCoal Mining Administration,Tangshan,063001.Chin J Neurol & Psychiat 1991; 24 (5): 268-271.Measurements of serum T3,T4,RUR and FT4I

  7. 31 CFR 538.212 - Exempt transactions.

    2010-07-01

    ... authorize transactions incident to the exportation of software subject to the Export Administration Regulations, 15 CFR parts 730-774, or to the exportation of goods, technology or software for use in the... agricultural commodities listed in appendix A to this part 538), medicine, and medical devices. Note to §...

  8. 42 CFR 2.12 - Applicability.

    2010-10-01

    ... abuse and neglect. The restrictions on disclosure and use in these regulations do not apply to the reporting under State law of incidents of suspected child abuse and neglect to the appropriate State or... proceedings which may arise out of the report of suspected child abuse and neglect. (d) Applicability...

  9. Calidad de Imagen del Telescopio UNAM212

    Cobos, F. J.; Teiada de Vargas, C.

    1987-05-01

    El telescopio UNAM2l2, del Observatorio Astronómico Nacional, situado en la Sierra de San Pedro Mártir (Baja California, México), cumplira en un futuro muy cercano siete años de uso para fines de investigación astronómica. Aunque en este tiempo no se ha efectuado un estudio sistemático acerca de su comportamiento óptico y de los factores que influyen en la calidad de las imágenes, se han realizado pruebas diversas, estudios parciales y reuniones especificas, cuyos resultados no siempre se han difundido ampliamente y generalmente no se han presentado por escrito. Es por ello que hemos creido necesario intentar una recopilación de la información existente para poder con ella establecer un diagnóstjco que, aunque no sea definitivo, sirva de base para futuros trabajos tendientes a optimizar el comportamiento óptico del telescopio. Es evidente que un buen número de las conclusiones que se presentan son resultado del trabajo de muchas personas ó de esfuerzos colectivos. Asimismo, hemos tratado de localizar información bibliográfica que pueda ser de utilidad. Nuestro objetivo primordial ha consistido en centrarnos en la óptica del telescopio y su calidad, pero también se han considerado otros aspectos que puedan afectar las imágenes obtenidas tales como: celda del primario, `seeing' local y externo, flexiones posibles en la estructura mecánica del telescopio, etc.

  10. 19 CFR 10.212 - Definitions.

    2010-04-01

    ... free of duty and free of any quantitative limitations as provided in 19 U.S.C. 3721. Wholly assembled... machines. “Wholly formed on seamless knitting machines,” when used to describe apparel articles, has... machine to result in that article. When taken from the knitting machine, an apparel article created...