WorldWideScience

Sample records for actinium 211

  1. Extraction of actinium with di-(2-ethylhexyl)phosphoric acid from hydrochloric and nitric acid solutions

    The extraction of actinium with HDEHP from Cl- and NO3- systems has been investigated. It was found that extraction of actinium from HCl solutions is much better than from HNO3 solutions. Stability constants of actinium complexes Ac(X-)+2 with Cl- and NO3- ligands were determined. Our results show that the actinium formed less stable complexes with Cl- than with NO3- ligands. 5 refs., 3 figs., 1 tab. (author)

  2. The sorption of polonium, actinium and protactinium onto geological materials

    This paper describes a combined experimental and modeling program of generic sorption studies to increase confidence in the performance assessment for a potential high-level radioactive waste repository in Japan. The sorption of polonium, actinium and protactinium onto geological materials has been investigated. Sorption of these radioelements onto bentonite, tuff and granodiorite from equilibrated de-ionized water was studied under reducing conditions at room temperature. In addition, the sorption of actinium and protactinium was investigated at 60 C. Thermodynamic chemical modeling was carried out to aid interpretation of the results

  3. Discovery of the actinium, thorium, protactinium, and uranium isotopes

    Fry, C; Thoennessen, M

    2012-01-01

    Currently, 31 actinium, 31 thorium, 28 protactinium, and 23 uranium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  4. Separation of Actinium 227 from the uranium minerals

    The purpose of this work was to separate Actinium 227, whose content is 18%, from the mineral carnotite found in Gomez Chihuahua mountain range in Mexico. The mineral before processing is is pre-concentrated and passed, first through anionic exchange resins, later the eluate obtained is passed through cationic resins. The resins were 20-50 MESH QOWEX and 100-200 MESH 50 X 8-20 in some cased 200-400 MESH AG 50W-X8, 1X8 in other cases. The eluates from the ionic exchange were electrodeposited on stainless steel polished disc cathode and platinum electrode as anode; under a current ODF 10mA for 2.5 to 5 hours and of 100mA for .5 of an hour. it was possible to identify the Actinium 227 by means of its descendents, TH-227 and RA-223, through alpha spectroscopy. Due to the radiochemical purity which the electro deposits were obtained the Actinium 227 was low and was not quantitatively determined. A large majority of the members of the natural radioactive series 3 were identified and even alpha energies reported in the literature with very low percentages of non-identified emissions were observed. We conclude that a more precise study is needed concerning ionic exchange and electrodeposit to obtain an Actinium 227 of radiochemical purity. (Author)

  5. Spectroscopic and computational investigation of actinium coordination chemistry.

    Ferrier, Maryline G; Batista, Enrique R; Berg, John M; Birnbaum, Eva R; Cross, Justin N; Engle, Jonathan W; La Pierre, Henry S; Kozimor, Stosh A; Lezama Pacheco, Juan S; Stein, Benjamin W; Stieber, S Chantal E; Wilson, Justin J

    2016-01-01

    Actinium-225 is a promising isotope for targeted-α therapy. Unfortunately, progress in developing chelators for medicinal applications has been hindered by a limited understanding of actinium chemistry. This knowledge gap is primarily associated with handling actinium, as it is highly radioactive and in short supply. Hence, Ac(III) reactivity is often inferred from the lanthanides and minor actinides (that is, Am, Cm), with limited success. Here we overcome these challenges and characterize actinium in HCl solutions using X-ray absorption spectroscopy and molecular dynamics density functional theory. The Ac-Cl and Ac-OH2O distances are measured to be 2.95(3) and 2.59(3) Å, respectively. The X-ray absorption spectroscopy comparisons between Ac(III) and Am(III) in HCl solutions indicate Ac(III) coordinates more inner-sphere Cl(1-) ligands (3.2±1.1) than Am(III) (0.8±0.3). These results imply diverse reactivity for the +3 actinides and highlight the unexpected and unique Ac(III) chemical behaviour. PMID:27531582

  6. Production of high-purity radium-223 from legacy actinium-beryllium neutron sources.

    Soderquist, Chuck Z; McNamara, Bruce K; Fisher, Darrell R

    2012-07-01

    Radium-223 is a short-lived alpha-particle-emitting radionuclide with potential applications in cancer treatment. Research to develop new radiopharmaceuticals employing (223)Ra has been hindered by poor availability due to the small quantities of parent actinium-227 available world-wide. The purpose of this study was to develop innovative and cost-effective methods to obtain high-purity (223)Ra from (227)Ac. We obtained (227)Ac from two surplus actinium-beryllium neutron generators. We retrieved the actinium/beryllium buttons from the sources and dissolved them in a sulfuric-nitric acid solution. A crude actinium solid was recovered from the solution by coprecipitation with thorium fluoride, leaving beryllium in solution. The crude actinium was purified to provide about 40 milligrams of actinium nitrate using anion exchange in methanol-water-nitric acid solution. The purified actinium was then used to generate high-purity (223)Ra. We extracted (223)Ra using anion exchange in a methanol-water-nitric acid solution. After the radium was separated, actinium and thorium were then eluted from the column and dried for interim storage. This single-pass separation produces high purity, carrier-free (223)Ra product, and does not disturb the (227)Ac/(227)Th equilibrium. A high purity, carrier-free (227)Th was also obtained from the actinium using a similar anion exchange in nitric acid. These methods enable efficient production of (223)Ra for research and new alpha-emitter radiopharmaceutical development. PMID:22697483

  7. Astatine-211 Pathway from Radiochemistry to Clinical Investigation

    Particularly in clinical settings where tumour burden is low and cancers are located in close proximity to essential normal tissue structures, α-particle emitting radionuclides can offer significant advantages for targeted radionuclide therapy. One of the first alpha emitters to be evaluated for this purpose is the 7.2-h half-life radiohalogen Astatine-211 (211At). From a commercialization-potential perspective 211At, is less appealing than the longer half-life alpha particle emitters Radium-223, Actinium-225 and Thorium-227, which have become the focus of many laboratories. However, if methods for providing a better supply of 211At could be developed, this alpha emitter would be the radionuclide of choice for many potential therapeutic applications. With regard to the production of 211At, this can be readily be accomplished by bombarding natural bismuth targets with 28−29.5 MeV alpha particles via the 209Bi(α,2n)211At reaction. The goal is to utilize an alpha particle beam energy that provides the required balance for maximizing 211At production while minimizing creation of 210At, which is problematic because of its 138.4-day half life alpha-particle emitting daughter, 210Po. For most intended clinical applications, alpha particle beam energy of about 29 MeV offers the best compromise between maximizing yield and providing 211At with sufficient radionuclidic purity for clinical use. Clinically relevant levels of 211At have been produced at several institutions using both internal and external cyclotron targets

  8. Radium, thorium, and actinium extraction from seawater using an improved manganese-oxide-coated fiber

    Laboratory experiments were conducted to determine the efficiency with which improved manganese-oxide-coated acrylic fibers extract radium, thorium, and actinium from seawater. Tests were made using surface seawater spiked with 227Ac, 227Th and 223Ra. For sample volumes of approximately 30 liters and flow rates up to 0.5 liters per minute, radium and actinium are removed quantitatively. Approximately 80-95% of the thorium is removed under these same conditions. (Auth.)

  9. CJS 211 COURSE TUTORIAL/ snaptutorial

    viswanadh

    2015-01-01

    For more classes visit www.snaptutorial.com CJS 211 Week 1 Individual Assignment Ethical Dilemma Paper CJS 211 Week 1 DQ 1 CJS 211 Week 1 DQ 2 CJS 211 Week 2 Individual Assignment Ethical Dilemma Worksheet Law Enforcement CJS 211 Week 2 DQ 1 CJS 211 Week 2 DQ 2 CJS 211 Week 2 Team Assignment Ethical Decision Making Paper CJS 211 Week 3 Individual Assignment Ethical Dilemma Worksheet Prosecutors CJS 211 Week 3 Team Assignment Ethics Issue Presentation ...

  10. Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232

    Harvey, James T.; Nolen, Jerry; Vandergrift, George; Gomes, Itacil; Kroc, Tom; Horwitz, Phil; McAlister, Dan; Bowers, Del; Sullivan, Vivian; Greene, John

    2011-12-30

    The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces {approx}100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 Ge

  11. Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232

    The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces ∼100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 GeV protons

  12. Neutron-Induced Fission of Actinium-227, Protactinium-231 and Neptunium-237: Mass Distribution

    Results of radiochemical studies on the mass distribution in the neutron-induced fission of actinium-227, protactinium-231 and neptunium-237 have been presented. This work has been carried out as part of a programme to determine the mass distribution in the fission of heavy elements as a function of Z and A. All irradiations have been carried out in the core of the swimming-pool type reactor APSARA with cadmium shielding wherever necessary. Relative yields of several fission product nuclides have been obtained by a method involving a comparison of the fission product activities from the respective targets with those formed from uranium-235 simultaneously irradiated. Thermal-neutron fission yields of uranium-235 have been assumed. These results indicate a predominantly asymmetric mass distribution in all the three cases, and also a distinct though small symmetric peak in the case of actinium-227. (author)

  13. A new method for the determination of low-level actinium-227 in geological samples

    We developed a new method for the determination of 227Ac in geological samples. The method uses extraction chromatographic techniques and alpha-spectrometry and is applicable for a range of natural matrices. Here we report on the procedure and results of the analysis of water (fresh and seawater) and rock samples. Water samples were acidified and rock samples underwent total dissolution via acid leaching. A DGA (N,N,N',N'-tetra-n-octyldiglycolamide) extraction chromatographic column was used for the separation of actinium. The actinium fraction was prepared for alpha spectrometric measurement via cerium fluoride micro-precipitation. Recoveries of actinium in water samples were 80 ± 8 % (number of analyses n = 14) and in rock samples 70 ± 12 % (n = 30). The minimum detectable activities (MDA) were 0.017-0.5 Bq kg-1 for both matrices. Rock sample 227Ac activities ranged from 0.17 to 8.3 Bq kg-1 and water sample activities ranged from below MDA values to 14 Bq kg-1of 227Ac. From the analysis of several standard rock and water samples with the method we found very good agreement between our results and certified values. (author)

  14. Analysis of the gamma spectra of the uranium, actinium, and thorium decay series

    Momeni, M.H.

    1981-09-01

    This report describes the identification of radionuclides in the uranium, actinium, and thorium series by analysis of gamma spectra in the energy range of 40 to 1400 keV. Energies and absolute efficiencies for each gamma line were measured by means of a high-resolution germanium detector and compared with those in the literature. A gamma spectroscopy method, which utilizes an on-line computer for deconvolution of spectra, search and identification of each line, and estimation of activity for each radionuclide, was used to analyze soil and uranium tailings, and ore.

  15. Analysis of the gamma spectra of the uranium, actinium, and thorium decay series

    This report describes the identification of radionuclides in the uranium, actinium, and thorium series by analysis of gamma spectra in the energy range of 40 to 1400 keV. Energies and absolute efficiencies for each gamma line were measured by means of a high-resolution germanium detector and compared with those in the literature. A gamma spectroscopy method, which utilizes an on-line computer for deconvolution of spectra, search and identification of each line, and estimation of activity for each radionuclide, was used to analyze soil and uranium tailings, and ore

  16. CJS 211 Course Tutorial/TutorialRank

    candice

    2015-01-01

    For more course tutorials visit www.tutorialrank.com Tutorial Purchased: 8 Times, Rating: A+   CJS 211 Week 1 Individual Assignment Ethical Dilemma Paper CJS 211 Week 1 DQ 1 CJS 211 Week 1 DQ 2 CJS 211 Week 2 Individual Assignment Ethical Dilemma Worksheet Law Enforcement CJS 211 Week 2 DQ 1 CJS 211 Week 2 DQ 2 CJS 211 Week 2 Team Assignment Ethical Decision Making Paper CJS 211 Week 3 Individual Assignment Ethical Dilemma Worksheet Prosecutors...

  17. In-source laser spectroscopy developments at TRILIS—towards spectroscopy on actinium and scandium

    Resonance Ionization Laser Ion Sources (RILIS) have become a versatile tool for production and study of exotic nuclides at Isotope Separator On-Line (ISOL) facilities such as ISAC at TRIUMF. The recent development and addition of a grating tuned spectroscopy laser to the TRIUMF RILIS solid state laser system allows for wide range spectral scans to investigate atomic structures on short lived isotopes, e.g., those from the element actinium, produced in uranium targets at ISAC. In addition, development of new and improved laser ionization schemes for rare isotope production at ISAC is ongoing. Here spectroscopic studies on bound states, Rydberg states and autoionizing (AI) resonances on scandium using the existing off-line capabilities are reported. These results allowed to identify a suitable ionization scheme for scandium via excitation into an autoionizing state at 58,104 cm − 1 which has subsequently been used for ionization of on-line produced exotic scandium isotopes.

  18. Astatine-211: production and availability.

    Zalutsky, Michael R; Pruszynski, Marek

    2011-07-01

    The 7.2-h half life radiohalogen (211)At offers many potential advantages for targeted α-particle therapy; however, its use for this purpose is constrained by its limited availability. Astatine-211 can be produced in reasonable yield from natural bismuth targets via the (209)Bi(α,2n)(211)At nuclear reaction utilizing straightforward methods. There is some debate as to the best incident α-particle energy for maximizing 211At production while minimizing production of (210)At, which is problematic because of its 138.4-day half life α-particle emitting daughter, (210)Po. The intrinsic cost for producing (211)At is reasonably modest and comparable to that of commercially available (123)I. The major impediment to (211)At availability is attributed to the need for a medium energy α-particle beam for its production. On the other hand, there are about 30 cyclotrons in the world that have the beam characteristics required for (211)At production. PMID:22201707

  19. Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL

    Raeder, S.; Bastin, B.; Block, M.; Creemers, P.; Delahaye, P.; Ferrer, R.; Fléchard, X.; Franchoo, S.; Ghys, L.; Gaffney, L. P.; Granados, C.; Heinke, R.; Hijazi, L.; Huyse, M.; Kron, T.; Kudryavtsev, Yu.; Laatiaoui, M.; Lecesne, N.; Luton, F.; Moore, I. D.; Martinez, Y.; Mogilevskiy, E.; Naubereit, P.; Piot, J.; Rothe, S.; Savajols, H.; Sels, S.; Sonnenschein, V.; Traykov, E.; Van Beveren, C.; Van den Bergh, P.; Van Duppen, P.; Wendt, K.; Zadvornaya, A.

    2016-06-01

    To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.

  20. 21 CFR 211.137 - Expiration dating.

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Expiration dating. 211.137 Section 211.137 Food... § 211.137 Expiration dating. (a) To assure that a drug product meets applicable standards of identity, strength, quality, and purity at the time of use, it shall bear an expiration date determined...

  1. 40 CFR 21.1 - Scope.

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Scope. 21.1 Section 21.1 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL SMALL BUSINESS § 21.1 Scope. This part establishes procedures for the issuance by EPA of the statements, referred to in section 7(g) of the Small Business...

  2. 7 CFR 3565.211 - Interest credit.

    2010-01-01

    ... 7 Agriculture 15 2010-01-01 2010-01-01 false Interest credit. 3565.211 Section 3565.211... AGRICULTURE GUARANTEED RURAL RENTAL HOUSING PROGRAM Loan Requirements § 3565.211 Interest credit. (a... assistance in the form of interest credit, to the extent necessary to reduce the agreed-upon rate of...

  3. 49 CFR 399.211 - Maintenance.

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Maintenance. 399.211 Section 399.211 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL MOTOR CARRIER SAFETY... STANDARDS Step, Handhold, and Deck Requirements for Commercial Motor Vehicles § 399.211 Maintenance....

  4. 12 CFR 211.42 - Definitions.

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Definitions. 211.42 Section 211.42 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM INTERNATIONAL BANKING OPERATIONS (REGULATION K) International Lending Supervision § 211.42 Definitions. For the purposes of...

  5. 1 CFR 21.1 - Drafting.

    2010-01-01

    ... 1 General Provisions 1 2010-01-01 2010-01-01 false Drafting. 21.1 Section 21.1 General Provisions ADMINISTRATIVE COMMITTEE OF THE FEDERAL REGISTER PREPARATION, TRANSMITTAL, AND PROCESSING OF DOCUMENTS PREPARATION OF DOCUMENTS SUBJECT TO CODIFICATION General § 21.1 Drafting. (a) Each agency that prepares...

  6. 8 CFR 211.5 - Alien commuters.

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Alien commuters. 211.5 Section 211.5 Aliens...: IMMIGRANTS; WAIVERS § 211.5 Alien commuters. (a) General. An alien lawfully admitted for permanent residence.... An alien commuter engaged in seasonal work will be presumed to have taken up residence in the...

  7. 25 CFR 211.20 - Leasing procedures.

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Leasing procedures. 211.20 Section 211.20 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR ENERGY AND MINERALS LEASING OF TRIBAL LANDS FOR MINERAL DEVELOPMENT How To Acquire Leases § 211.20 Leasing procedures. (a) Indian mineral owners may, with...

  8. 47 CFR 53.211 - Audit planning.

    2010-10-01

    ... 47 Telecommunication 3 2010-10-01 2010-10-01 false Audit planning. 53.211 Section 53.211 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES (CONTINUED) SPECIAL PROVISIONS CONCERNING BELL OPERATING COMPANIES Separate Affiliate; Safeguards § 53.211 Audit planning....

  9. 14 CFR 417.211 - Debris analysis.

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Debris analysis. 417.211 Section 417.211... TRANSPORTATION LICENSING LAUNCH SAFETY Flight Safety Analysis § 417.211 Debris analysis. (a) General. A flight safety analysis must include a debris analysis. For an orbital or suborbital launch, a debris...

  10. 5 CFR 211.101 - Purpose.

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Purpose. 211.101 Section 211.101 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS VETERAN PREFERENCE § 211.101 Purpose. The purpose of this part is to define veterans' preference and the administration of...

  11. 40 CFR 211.110 - Exemptions.

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Exemptions. 211.110 Section 211.110 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS PRODUCT NOISE LABELING General Provisions § 211.110 Exemptions....

  12. 40 CFR 211.105 - Label format.

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Label format. 211.105 Section 211.105 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS PRODUCT NOISE LABELING General Provisions § 211.105 Label format. (a) Unless specified otherwise in other...

  13. 40 CFR 211.202 - Effective date.

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Effective date. 211.202 Section 211.202 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS PRODUCT NOISE LABELING Hearing Protective Devices § 211.202 Effective date. Manufacturers of...

  14. 40 CFR 211.104 - Label content.

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Label content. 211.104 Section 211.104 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS PRODUCT NOISE... Required by U.S. EPA regulation 40 CFR part 211, subpart ___.” EC01FE92.055...

  15. 40 CFR 211.210 - Requirements.

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Requirements. 211.210 Section 211.210 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS PRODUCT NOISE LABELING Hearing Protective Devices § 211.210 Requirements....

  16. 33 CFR 117.211 - Mystic River.

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Mystic River. 117.211 Section 117.211 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Connecticut § 117.211 Mystic River. (a) The draw of the...

  17. 49 CFR 211.75 - Evidence.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Evidence. 211.75 Section 211.75 Transportation... TRANSPORTATION RULES OF PRACTICE Interim Procedures for the Review of Emergency Orders § 211.75 Evidence. (a) The Federal Rules of Evidence for United States Courts and Magistrates shall be employed as general...

  18. Dicty_cDB: CHQ211 [Dicty_cDB

    Full Text Available CH (Link to library) CHQ211 (Link to dictyBase) - - - - CHQ211P (Link to Original site) CHQ211F ... TFAYNIPLIKQVGVSSGSSILTVRISVDLGYVEQTQPPTQPPTQPPTQPP TPP --- ---FDNHKTGLHDYTNAFGATKGGRDIIVTTGFDYYEAFEGSIRWYN ... TFAYNIPLIKQVGVSSGSSILTVRISVDLGYVEQTQPPTQPPTQPPTQPP TPP --- ---FDNHKTGLHDYTNAFGATKGGRDIIVTTGFDYYEAFEGSIRWYN ...

  19. 14 CFR 91.211 - Supplemental oxygen.

    2010-01-01

    ... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Supplemental oxygen. 91.211 Section 91.211 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIR TRAFFIC...) At flight altitudes above flight level 250 unless at least a 10-minute supply of supplemental...

  20. 21 CFR 211.58 - Maintenance.

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Maintenance. 211.58 Section 211.58 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL... Maintenance. Any building used in the manufacture, processing, packing, or holding of a drug product shall...

  1. 38 CFR 3.211 - Death.

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Death. 3.211 Section 3..., Compensation, and Dependency and Indemnity Compensation Evidence Requirements § 3.211 Death. Death should be... community where death occurred. (2) A copy of a coroner's report of death or a verdict of a coroner's...

  2. 21 CFR 211.173 - Laboratory animals.

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Laboratory animals. 211.173 Section 211.173 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS... Laboratory animals. Animals used in testing components, in-process materials, or drug products for...

  3. 21 CFR 211.176 - Penicillin contamination.

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Penicillin contamination. 211.176 Section 211.176... Penicillin contamination. If a reasonable possibility exists that a non-penicillin drug product has been exposed to cross-contamination with penicillin, the non-penicillin drug product shall be tested for...

  4. 47 CFR 1.211 - Service.

    2010-10-01

    ... 47 Telecommunication 1 2010-10-01 2010-10-01 false Service. 1.211 Section 1.211 Telecommunication... Service. Except as otherwise expressly provided in this chapter, all pleadings filed in a hearing... counsel, then upon such party. All such papers shall be accompanied by proof of service. For...

  5. 27 CFR 24.211 - Formula required.

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Formula required. 24.211... OF THE TREASURY LIQUORS WINE Production of Other Than Standard Wine § 24.211 Formula required. The proprietor who desires to produce wine other than standard wine shall first obtain approval of the formula...

  6. 21 CFR 211.56 - Sanitation.

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Sanitation. 211.56 Section 211.56 Food and Drugs... Sanitation. (a) Any building used in the manufacture, processing, packing, or holding of a drug product shall... assigning responsibility for sanitation and describing in sufficient detail the cleaning schedules,...

  7. 29 CFR 1952.211 - Developmental schedule.

    2010-07-01

    ... 29 Labor 9 2010-07-01 2010-07-01 false Developmental schedule. 1952.211 Section 1952.211 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR... schedule. (a) Occupational health study accepted and implementation begun July, 1973; (b) Compliance...

  8. 12 CFR 741.211 - Advertising.

    2010-01-01

    ... 12 Banks and Banking 6 2010-01-01 2010-01-01 false Advertising. 741.211 Section 741.211 Banks and Banking NATIONAL CREDIT UNION ADMINISTRATION REGULATIONS AFFECTING CREDIT UNIONS REQUIREMENTS FOR INSURANCE Regulations Codified Elsewhere in NCUA's Regulations as Applying to Federal Credit Unions...

  9. 49 CFR 1542.211 - Identification systems.

    2010-10-01

    ... 49 Transportation 9 2010-10-01 2010-10-01 false Identification systems. 1542.211 Section 1542.211... systems. (a) Personnel identification system. The personnel identification system under §§ 1542.201(b)(3... identification media stock and supplies. (iv) Auditing the system at a minimum of once a year or sooner,...

  10. 12 CFR 211.9 - Investment procedures.

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Investment procedures. 211.9 Section 211.9... the case of an Edge corporation not engaged in banking. (5) Investment in a general partnership or... have no existing banking presence. (f) Prior notice. An investment that does not qualify for...

  11. Astatine-211-Labeled Targeted Radiotherapeutics: An Update

    The heavy halogen 211At was first proposed for use in α-particle targeted radiotherapy more than 30 years ago and continues to be one of the most promising radionuclides for this purpose. Although its 7.2-h half life is not ideal for intravenously administered whole antibodies, it is compatible with the pharmacokinetics of antibody fragments, peptides, aptamers and organic molecules. Its diverse chemistry allows its incorporation into a wide array of targeting vehicles, relying on its chemical similarity to iodine to provide a useful point of departure. On the other hand, the relatively low carbon-astatine bond strength is challenging. In common with the other α-emitters being discussed at this symposium, lack of reliable availability is one of the biggest hurdles in the use of 211At for targeted radiotherapy. However, in the case of 211At, it is not a question of production cost or availability of target material, because 211At can be produced in reasonable yield from natural bismuth targets. Rather, the difficulty is the lack of cyclotrons equipped with the medium energy α-particle beams required for its production. If the infrastructure for producing 211At is to be improved to the stage where 211At-labeled radiopharmaceuticals can have a meaningful impact, several developments must occur. First, the ability to produce clinically relevant levels of 211At that can be shipped to remote locations in chemically tractable form must be demonstrated. Approaches under consideration include compensating for radiolysis-mediated effects and the consideration of alternative chemistries. Second, strategies for compensating for heterogeneities in dose deposition must be developed, hopefully in a way that is compatible with approval for human use. And third, it is essential that more clinical trials be performed with 211At-labeled therapeutics, particularly in settings of minimum residual disease where the radiobiological advantages of α-particles can be best exploited. Our

  12. 48 CFR 252.211-7003 - Item identification and valuation.

    2010-10-01

    ... valuation. 252.211-7003 Section 252.211-7003 Federal Acquisition Regulations System DEFENSE ACQUISITION... of Provisions And Clauses 252.211-7003 Item identification and valuation. As prescribed in 211.274-6(a), use the following clause: Item Identification and Valuation (AUG 2008) (a) Definitions. As...

  13. 48 CFR 211.272 - Alternate preservation, packaging, and packing.

    2010-10-01

    ..., packaging, and packing. 211.272 Section 211.272 Federal Acquisition Regulations System DEFENSE ACQUISITION... Requirements Documents 211.272 Alternate preservation, packaging, and packing. Use the provision at 252.211-7004, Alternate Preservation, Packaging, and Packing, in solicitations which include...

  14. New method for large scale production of medically applicable Actinium-225 and Radium-223

    Alpha-emitters (211At, 212Bi, 213Bi, 223Ra, 225Ac) are promising for targeted radiotherapy of cancer. Only two alpha decays near a cell membrane result in 50% death of cancer cell and only a single decay inside the cell is required for this. 225Ac may be used either directly or as a mother radionuclide in 213Bi isotope generator. Production of 225Ac is provided by three main suppliers - Institute for Transuranium Elements in Germany, Oak Ridge National Laboratory in USA and Institute of Physics and Power Engineering in Obninsk, Russia. The current worldwide production of 225Ac is approximately 1.7 Ci per year that corresponds to only 100-200 patients that could be treated annually. The common approach for 225Ac production is separation from mother 229Th or irradiation of 226Ra with protons in a cyclotron. Both the methods have some practical limitations to be applied routinely. 225Ac can be also produced by irradiation of natural thorium with medium energy protons . Cumulative cross sections of 225Ac, 227Ac, 227Th, 228Th formations have been obtained recently. Thorium targets (1-9 g) were irradiated by 114-91 MeV proton beam (1-50 μA) at INR linear accelerator. After dissolution in 8 M HNO3 + 0.004 M HF thorium was removed by double LLX by HDEHP in toluene (1:1). Ac and REE were pre-concentrated and separated from Ra and most fission products by DGA-Resin (Triskem). After washing out by 0.01 M HNO3 Ac was separated from REE by TRU Resin (Triskem) in 3 M HNO3 media. About 6 mCi 225Ac were separated in hot cell with chemical yield 85%. The method may be upscaled for production of Ci amounts of the radionuclide. The main impurity is 227Ac (0.1% at the EOB) but it does not hinder 225Ac from being used for medical 225Ac/213Bi generators. (author)

  15. CYFRA 21-1: AN OVERVIEW

    Soma Susan Varghese; Madhavan Nirmal; Sunil, P. M.; Jithin Jose

    2013-01-01

    Cytokeratins are group of intermediate filament proteins and based on thetissue expression, cytokeratins are classified into simple epithelial cytokeratin andstratified epithelial cytokeratins. CK expression pattern in the malignant cells areusually retained from the cell of origin, and therefore CK are being used in tumortyping. Cyfra 21-1 is a soluble fragment of cytokeratin 19 is an acid type cytokeratin,with a molecular weight of 40,000d. The assumption is that Cyfra 21-1 is released into...

  16. Dosimetrical considerations in astatine-211 radioimmunotherapy

    Several dosimetrical quantities have been suggested for use in alpha-particle dosimetry. To evaluate the expected biological effect when using these quantities, a Monte Carlo program was set to register the single-event distribution of both specific energy and alpha-particle track length to a cell nucleus (r=5.6 μm). Distributions were acquired for both 'bound' (simulating the effect of 211At-labelled antibodies bound to antigens on cell surfaces (r=7.0 μm)) as well as 'non-bound' (simulating 211At-labelled antibodies that have not bound to a cell) astatine-211. From these distributions, various theoretical cell survival curves were established for 3 different dosimetrical quantities, i.e. specific energy, number of alpha-particle hits and total track length. The survival curves for all quantities are presented for the corresponding mean absorbed dose in order to facilitate comparisons of the expected effects of using the 3 different quantities for both distributions of 211At decays. The theoretical survival curves presented here could, combined with experiments using 'bound' and 'non-bound' 211At in a single-cell suspension, reveal which dosimetrical quantity is most suitable for 211 At-radioimmunotherapy. (author)

  17. Groundwater seepage from the Ranger uranium mine tailings dam: radioisotopes of radium, thorium and actinium. Supervising Scientist report 106

    Monitoring of bores near the Ranger uranium mine tailings dam has revealed deterioration in water quality in several bores since 1983. In a group of bores to the north of the dam, increases have been observed of up to 500 times for sulphate concentrations and of up to 5 times for 226Ra concentrations. Results are presented here of measurements of members of the uranium, thorium and actinium decay series in borewater samples collected between 1985 and 1993. In particular, measurements of all four naturally-occurring radium isotopes have been used in an investigation of the mechanism of radium concentration changes. For the most seepage-affected bores the major findings of the study include: 228Ra/226Ra 223Ra /226Ra and 224Ra/228Ra ratios all increased over the course of the study; barium concentrations show high seasonal variability, being lower in November than May, but strontium concentrations show a steady increase with time. Calculations show that the groundwater is probably saturated with respect to barite but not with respect to celestite or anglesite; sulphide concentrations are low in comparison with sulphate, and are higher in November than in May; and 227Ac concentrations have increased with time, but do not account for the high 223Ra/226Ra ratios. It is concluded on the basis of these observations that increases in Ra isotope concentrations observed in a number of seepage-affected bores arise from increases in salinity leading to desorption of radium from adsorption sites in the vicinity of the bore rather by direct transport of radium from the tailings. Increased salinity is also causing the observed increases in 227Ac and strontium concentrations, while formation of a barite solid phase in the groundwater is causing the removal of some radium from solution. This is the cause of the increasing radium isotope ratios noted above

  18. CYFRA 21-1: AN OVERVIEW

    Soma Susan Varghese

    2013-07-01

    Full Text Available Cytokeratins are group of intermediate filament proteins and based on thetissue expression, cytokeratins are classified into simple epithelial cytokeratin andstratified epithelial cytokeratins. CK expression pattern in the malignant cells areusually retained from the cell of origin, and therefore CK are being used in tumortyping. Cyfra 21-1 is a soluble fragment of cytokeratin 19 is an acid type cytokeratin,with a molecular weight of 40,000d. The assumption is that Cyfra 21-1 is released intothe bloodstream during cell death, and therefore its level correlates very well with thetumour mass, or more specifically with the necrosis in the tumour, which is a functionof the tumour mass. The aim of this article is to review on cyfra 21-1 and its role as adiagnostic and prognostic marker.

  19. Extraction of astatine isotopes for development of radiopharmaceuticals using a 211Rn-211At generator

    In order to utilize a 211At isotope, a promising α-emitter for radionuclide therapy, the chemical properties of astatine isotopes are studied. We have examined wet chemistry methods through the distribution ratios of astatine in liquid-liquid extraction. The astatine isotopes have been found to be well extracted into DIPE and MIBK. We observed that the distribution ratio of astatine isotopes increases with concentrations of HCl greater than 3 M, while it decreases with the HCl concentration less than 2 M. The results will be useful for development of the 211Rn-211At generator. (author)

  20. 22 CFR Appendix I to Part 211 - Operational Plan

    2010-04-01

    ... DISASTER RELIEF, ECONOMIC DEVELOPMENT AND OTHER ASSISTANCE Pt. 211, App. I Appendix I to Part 211...) and (b), will be met. 5. Logistics. Provide a logistics plan that demonstrates the adequacy...

  1. 34 CFR 300.211 - Information for SEA.

    2010-07-01

    ... 34 Education 2 2010-07-01 2010-07-01 false Information for SEA. 300.211 Section 300.211 Education... DISABILITIES Local Educational Agency Eligibility § 300.211 Information for SEA. The LEA must provide the SEA with information necessary to enable the SEA to carry out its duties under Part B of the Act,...

  2. 21 CFR 211.103 - Calculation of yield.

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Calculation of yield. 211.103 Section 211.103 Food... § 211.103 Calculation of yield. Actual yields and percentages of theoretical yield shall be determined... the drug product. Such calculations shall either be performed by one person and independently...

  3. 9 CFR 113.211 - Feline Rhinotracheitis Vaccine, Killed Virus.

    2010-01-01

    ... Virus. 113.211 Section 113.211 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.211 Feline Rhinotracheitis Vaccine, Killed Virus....

  4. 48 CFR 211.274 - Item identification and valuation requirements.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Item identification and valuation requirements. 211.274 Section 211.274 Federal Acquisition Regulations System DEFENSE ACQUISITION... Requirements Documents 211.274 Item identification and valuation requirements....

  5. 48 CFR 211.274-3 - Policy for valuation.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Policy for valuation. 211.274-3 Section 211.274-3 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM... Documents 211.274-3 Policy for valuation. (a) It is DoD policy that contractors shall be required...

  6. 36 CFR 211.3 - Cooperation with State officers.

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Cooperation with State officers. 211.3 Section 211.3 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE ADMINISTRATION Cooperation § 211.3 Cooperation with State officers. All forest officers will cooperate with...

  7. 20 CFR 211.13 - Payments made after death.

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Payments made after death. 211.13 Section 211... CREDITABLE RAILROAD COMPENSATION § 211.13 Payments made after death. Payments made by an employer with respect to a deceased employee but paid after the calendar year of the employee's death to the...

  8. 21 CFR 211.52 - Washing and toilet facilities.

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Washing and toilet facilities. 211.52 Section 211.52 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED... § 211.52 Washing and toilet facilities. Adequate washing facilities shall be provided, including hot...

  9. 22 CFR 211.6 - Processing, repackaging, and labeling commodities.

    2010-04-01

    ... commodities. 211.6 Section 211.6 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT TRANSFER OF FOOD COMMODITIES FOR FOOD USE IN DISASTER RELIEF, ECONOMIC DEVELOPMENT AND OTHER ASSISTANCE § 211.6 Processing, repackaging, and labeling commodities. (a) Commercial processing and repackaging. Cooperating sponsors...

  10. 5 CFR 179.211 - Notice of salary offset.

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Notice of salary offset. 179.211 Section 179.211 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS CLAIMS COLLECTION STANDARDS Salary Offset § 179.211 Notice of salary offset. (a) Upon receipt of...

  11. 25 CFR 211.56 - Geological and geophysical permits.

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Geological and geophysical permits. 211.56 Section 211.56... FOR MINERAL DEVELOPMENT Rents, Royalties, Cancellations and Appeals § 211.56 Geological and geophysical permits. Permits to conduct geological and geophysical operations on Indian lands which do...

  12. 40 CFR 211.110-3 - Export exemptions.

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Export exemptions. 211.110-3 Section 211.110-3 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS PRODUCT NOISE LABELING General Provisions § 211.110-3 Export exemptions. (a) A new...

  13. 40 CFR 211.110-1 - Testing exemption.

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Testing exemption. 211.110-1 Section 211.110-1 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS PRODUCT NOISE LABELING General Provisions § 211.110-1 Testing exemption. (a) A new...

  14. 4 CFR 21.1 - Filing a protest.

    2010-01-01

    ... a decision on the protest, in accordance with GAO's rules at 4 CFR part 81. If the protester... 4 Accounts 1 2010-01-01 2010-01-01 false Filing a protest. 21.1 Section 21.1 Accounts GOVERNMENT ACCOUNTABILITY OFFICE GENERAL PROCEDURES BID PROTEST REGULATIONS § 21.1 Filing a protest. (a) An interested...

  15. 40 CFR 211.212 - Compliance audit testing.

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Compliance audit testing. 211.212 Section 211.212 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) NOISE ABATEMENT PROGRAMS PRODUCT NOISE LABELING Hearing Protective Devices § 211.212 Compliance audit testing....

  16. 40 CFR 211.103 - Number and gender.

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Number and gender. 211.103 Section 211... PRODUCT NOISE LABELING General Provisions § 211.103 Number and gender. In this part, words in the singular will be understood to include the plural, and words in the masculine gender will be understood...

  17. 34 CFR 21.1 - Equal Access to Justice Act.

    2010-07-01

    ... 34 Education 1 2010-07-01 2010-07-01 false Equal Access to Justice Act. 21.1 Section 21.1 Education Office of the Secretary, Department of Education EQUAL ACCESS TO JUSTICE General § 21.1 Equal Access to Justice Act. (a) The Equal Access to Justice Act (the Act) provides for the award of fees...

  18. 24 CFR 881.211 - Audit.

    2010-04-01

    ... requirements in 24 CFR part 44 shall apply. (b) Where a nonprofit organization is the eligible owner of a project, receiving financial assistance under this part, the audit requirements in 24 CFR part 45 shall... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Audit. 881.211 Section...

  19. 24 CFR 880.211 - Audit.

    2010-04-01

    ... administrator under § 880.505 receiving financial assistance under this part, the audit requirements in 24 CFR... financial assistance under this part, the audit requirements in 24 CFR part 45 shall apply. ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Audit. 880.211 Section...

  20. 34 CFR 682.211 - Forbearance.

    2010-07-01

    ... citations affecting § 682.211, see the List of CFR Sections Affected, which appears in the Finding Aids.... (a)(1) The Secretary encourages a lender to grant forbearance for the benefit of a borrower or... documentation, as described in § 682.210(n), from a borrower serving in a medical or dental internship...

  1. 42 CFR 2.11 - Definitions.

    2010-10-01

    ... social well-being of the user. Drug abuse means the use of a psychoactive substance for other than... HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL PROVISIONS CONFIDENTIALITY OF ALCOHOL AND DRUG ABUSE PATIENT RECORDS General Provisions § 2.11 Definitions. For purposes of these...

  2. 14 CFR 67.211 - Cardiovascular.

    2010-01-01

    ... Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIRMEN MEDICAL STANDARDS AND CERTIFICATION Second-Class Airman Medical Certificate § 67.211 Cardiovascular. Cardiovascular standards for a second-class medical certificate are no established medical history or clinical diagnosis...

  3. Building 211 cyclotron characterization survey report

    NONE

    1998-03-30

    The Building 211 Cyclotron Characterization Survey includes an assessment of the radioactive and chemical inventory of materials stored within the facility; an evaluation of the relative distribution of accelerator-produced activation products within various cyclotron components and adjacent structures; measurement of the radiation fields throughout the facility; measurement and assessment of internal and external radioactive surface contamination on various equipment, facility structures, and air-handling systems; and an assessment of lead (Pb) paint and asbestos hazards within the facility.

  4. Residual Interactions and High Spin States in A = 211 Isobars

    The shell model has been particularly successful in describing the structure of states near the doubly magic 208Pb core. In particular semi-empirical calculations are able to reproduce the yrast states in the three valence proton nucleus, 211 At to a high degree of accuracy. Recent spectroscopic measurements using a variety of novel reaction mechanisms have provided information on the related A = 211 nuclei 211At, 211Po, 211Bi and 211Pb allowing a comparison between the data and the results of semi-empirical calculations. While good agreement is observed for the lower spin yrast states, the calculations predict the presence of isomeric states not yet completely characterized in the current experiments. (author)

  5. H2 Velocity Structure in HH 211

    Salas, L.; I. Cruz González; Margarita Rosado

    2003-01-01

    Describimos la estructura en velocidad del chorro molecular HH211 en la línea 2.12 Um del H2. Las observaciones fueron obtenidas con un interferómetro Fabry-Pérot con resolución espectral de 24 km s_1. Se pudo observar que el lóbulo este del chorro está corrido al azul mientras que el del oeste está corrido al rojo. La mayor parte de la radiación se origina en bajas velocidades, en concordancia con la relación flujo-velocidad de Salas & Cruz-González (2002), pero estas bajas ...

  6. 21 CFR 211.188 - Batch production and control records.

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Batch production and control records. 211.188... Reports § 211.188 Batch production and control records. Batch production and control records shall be prepared for each batch of drug product produced and shall include complete information relating to...

  7. 21 CFR 211.192 - Production record review.

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Production record review. 211.192 Section 211.192... Production record review. All drug product production and control records, including those for packaging and... established, approved written procedures before a batch is released or distributed. Any...

  8. 12 CFR 211.11 - Advisory opinions under Regulation K.

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Advisory opinions under Regulation K. 211.11... INTERNATIONAL BANKING OPERATIONS (REGULATION K) International Operations of U.S. Banking Organizations § 211.11 Advisory opinions under Regulation K. (a) Request for advisory opinion. Any person may submit a request...

  9. 40 CFR 211.111 - Testing by the Administrator.

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Testing by the Administrator. 211.111... PROGRAMS PRODUCT NOISE LABELING General Provisions § 211.111 Testing by the Administrator. (a)(1) To determine whether products conform to applicable regulations under this part, the Administrator may...

  10. 49 CFR 211.77 - Appeal to the Administrator.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Appeal to the Administrator. 211.77 Section 211.77... Appeal to the Administrator. (a) Any party aggrieved by the final decision of a presiding officer (other than the Administrator) may appeal to the Administrator. The appeal must be filed within twenty...

  11. 33 CFR 211.22 - Real estate Claims Officers.

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Real estate Claims Officers. 211..., DEPARTMENT OF DEFENSE REAL ESTATE ACTIVITIES OF THE CORPS OF ENGINEERS IN CONNECTION WITH CIVIL WORKS PROJECTS Real Estate Claims § 211.22 Real estate Claims Officers. In each Division Office the...

  12. 33 CFR 211.1 - Real estate defined.

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Real estate defined. 211.1... DEFENSE REAL ESTATE ACTIVITIES OF THE CORPS OF ENGINEERS IN CONNECTION WITH CIVIL WORKS PROJECTS Real Estate; General § 211.1 Real estate defined. The term real estate as used in this part includes...

  13. 48 CFR 333.211 - Contracting Officer's decision.

    2010-10-01

    ... decision. (a)(2) The Contracting Officer shall refer a proposed final decision to OGC-GLD, for advice as to the legal sufficiency and format before sending the final decision to the contractor. The Contracting... decision. 333.211 Section 333.211 Federal Acquisition Regulations System HEALTH AND HUMAN SERVICES...

  14. 12 CFR 211.13 - Supervision and reporting.

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Supervision and reporting. 211.13 Section 211.13 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM... Supervision and reporting. (a) Supervision—(1) Foreign branches and subsidiaries. U.S. banking...

  15. 50 CFR 660.211 - Fixed gear fishery-definitions.

    2010-10-01

    ... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Fixed gear fishery-definitions. 660.211... Groundfish-Limited Entry Fixed Gear Fisheries § 660.211 Fixed gear fishery—definitions. These definitions are... weekly and/or bimonthly trip limits. Limited entry fixed gear fishery means the fishery composed...

  16. 37 CFR 211.5 - Deposit of identifying material.

    2010-07-01

    ... material. 211.5 Section 211.5 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS... Program, Library of Congress, Copyright Office - RPO, 101 Independence Avenue, SE, Washington, DC 20559... the Librarian of Congress to order its destruction or other disposition....

  17. 5 CFR 211.103 - Administration of preference.

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Administration of preference. 211.103... PREFERENCE § 211.103 Administration of preference. Agencies are responsible for making all preference determinations except for preference based on a common law marriage. Such a claim should be referred to...

  18. 17 CFR 256.211 - Miscellaneous paid-in capital.

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Miscellaneous paid-in capital. 256.211 Section 256.211 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION... capital. This account shall include the balance of all other credits for paid-in capital which are...

  19. 14 CFR 145.211 - Quality control system.

    2010-01-01

    ... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Quality control system. 145.211 Section 145...) SCHOOLS AND OTHER CERTIFICATED AGENCIES REPAIR STATIONS Operating Rules § 145.211 Quality control system. (a) A certificated repair station must establish and maintain a quality control system acceptable...

  20. 18 CFR 281.211 - Filing and documentation.

    2010-04-01

    ... user which qualifies it as an essential agricultural user in accordance with 7 CFR 2900.3. (C) Includes the data and calculations used to determine essential agricultural requirements under 7 CFR 2900.4. (D... documentation. 281.211 Section 281.211 Conservation of Power and Water Resources FEDERAL ENERGY...

  1. 22 CFR 211.4 - Availability and shipment of commodities.

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Availability and shipment of commodities. 211.4 Section 211.4 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT TRANSFER OF FOOD COMMODITIES FOR FOOD... commodities. (a) Shipment, distribution and use of commodities. Commodities shall be available for...

  2. 14 CFR 221.211 - Cancellation of suspended matter.

    2010-01-01

    ... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Cancellation of suspended matter. 221.211 Section 221.211 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION... matter. When, pursuant to an order of the Department, the cancellation of rules, fares, charges, or...

  3. 7 CFR 58.211 - Packaging room for bulk products.

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Packaging room for bulk products. 58.211 Section 58... Service 1 Rooms and Compartments § 58.211 Packaging room for bulk products. A separate room or area shall... dust within the packaging room and where needed, a dust collector shall be provided and...

  4. 21 CFR 211.130 - Packaging and labeling operations.

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Packaging and labeling operations. 211.130 Section... (CONTINUED) DRUGS: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR FINISHED PHARMACEUTICALS Packaging and Labeling Control § 211.130 Packaging and labeling operations. There shall be written procedures designed...

  5. 49 CFR 219.211 - Analysis and follow-up.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Analysis and follow-up. 219.211 Section 219.211 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Analysis and follow-up. (a) The laboratory designated in appendix B to this part undertakes prompt...

  6. Development of 211At Chemistry for Labelling Biomolecules

    Our studies have demonstrated that high recovery of 211At can be obtained using a “wet chemistry” approach to isolation from the bismuth target. We have also demonstrated that direct labelling of antibody-B10 conjugates with 211At can be performed in high yields, and that the astatinated antibodies are stable to in vivo deastatination. While these results will allow us to enter clinical studies with 211At-labelled antibodies, the chemistry associated with 211At is not fully understood. Therefore, it is important that many more basic studies to be conducted with 211At, so the optimal labelling reagent for each type of disease-targeting agent becomes apparent

  7. 48 CFR 252.211-7004 - Alternate preservation, packaging, and packing.

    2010-10-01

    ..., packaging, and packing. 252.211-7004 Section 252.211-7004 Federal Acquisition Regulations System DEFENSE... CLAUSES Text of Provisions And Clauses 252.211-7004 Alternate preservation, packaging, and packing. As prescribed in 211.272, use the following provision: Alternate Preservation, Packaging, and Packing (DEC...

  8. Intrahepatic cholangiocarcinoma with increased serum CYFRA 21-1 level.

    Kashihara, T; Ohki, A; Kobayashi, T; Sato, T; Nishizawa, H; Ogawa, K; Tako, H; Kawakami, F; Tsuji, M; Tamaoka, K

    1998-06-01

    CYFRA 21-1 is a fragment of cytokeratin 19 (CK 19). Four patients with large intrahepatic (or peripheral) cholangiocarcinoma (CC) and high serum levels of CYFRA 21-1 (normal, vitamin K absence or antagonist II (PIVKA II) were elevated in all HCC patients (AFP, PIVKA II, respectively; normal range, < or = 10.0 ng/ml and < or = 0.1 AU/ml) CYFRA 21-1 levels were measured twice or three times during the clinical course in 2 CC patients and in 6 HCC patients, and increased gradually with tumor growth in the 2 CC patients and in 3 of the 6 HCC patients. Marked increases in serum CYFRA 21-1 levels in patients with large liver cancers, particularly in those with normal levels of AFP and PIVKA II, would suggest the existence of intrahepatic CC rather than HCC. PMID:9658330

  9. Dicty_cDB: CFI211 [Dicty_cDB

    Full Text Available CF (Link to library) CFI211 (Link to dictyBase) - - - Contig-U15057-1 CFI211P (Link to Original ... *, 1 ordered piece. 38 0.99 7 AF100466 |AF100466.2 Dengue ... virus type 2 strain Mara4 polyprotein gene, comple ... te cds. 46 1.3 1 AF489932 |AF489932.1 Dengue ... Virus Type 2 strain BR64022, complete genome. 46 1 ...

  10. Inactivation of human osteosarcoma cells in vitro by {sup 211}At-TP-3 monoclonal antibody: Comparison with astatine-211 and external-beam X rays

    Larsen, R.H. [Univ. of Oslo (Norway)]|[Institute for Cancer Research, Oslo (Norway); Bruland, O.S. [Institute for Cancer Research, Oslo (Norway); Hoff, P.; Alstad, J. [Univ. of Oslo (Norway); Lindmo, T. [Institute for Cancer Research, Oslo (Norway); Rofstad, E.K. [Norwegian Institute of Technology, Trondheim (Norway)

    1994-08-01

    The potential usefulness of {alpha}-particle radioimmunotherapy in the treatment of osteosarcoma was studied in vitro by using the monoclonal antibody TP-3 and cells of three human osteosarcoma cell lines (OHS, SAOS and KPDX) differing in antigen expression. Cell survival curves were established after treatment with (a) {sup 211}At-TP-3 of different specific activities, (b) {sup 211}At-labeled bovine serum albumin (BSA), (c) free {sup 211}At and (d) external-beam X rays. The three osteosarcoma cell lines showed similar survival curves, whether treated with external-beam X rays, {sup 211}At-BSA or free {sup 211}At. The D{sub o}`s were lower for free {sup 211}At than for {sup 211}At-BSA. The survival curves for {sup 211}At-TP-3 treatment, on the other hand, differed significantly among the cell lines, suggesting that sensitivity to {sup 211}At-TP-3 treatment was governed by cellular properties other than sensitivity to external-beam X rays. The cellular property most important for sensitivity to {sup 211}At-TP-3 treatment was the antigen expression. Cell inactivation after {sup 211}At-TP-3 treatment increased substantially with increasing specific activity of the {sup 211}At-TP-3. At high specific activities, the cytotoxic effect of {sup 211}At-TP-3 was significantly higher than that of {sup 211}At-BSA. In conclusion, {sup 211}At-TP-3 has the potential to give clinically favorable therapeutic ratios in the treatment of osteosarcoma. 39 refs., 5 figs., 2 tabs.

  11. Process for producing astatine-211 for radiopharmaceutical use

    A one-step chemical manipulation is described in combination with a distillation and collection process for producing At-211 comprising; a. providing a target of irradiated Bismuth coated to a predetermined thickness of a backing member, b. providing a vapor-producing still operably connected with a condenser that has a water cooled condensate collector formed of a dry silica gel mesh maintained at a temperature above the freezing point of water, and providing an effluent gas filter that is operably connected to receive effluent gas from the condenser, c. heating the target in the still at a temperature in the range of about 6300-6800C for a time period in the range of 50 to 80 minutes, to evole At-211 vapor from the target, c. providing a dry carrier gas having an oxygen concentration that is sufficient to form Bi/sub 2/O/sub 3/ thereby to essentially preclude vaporization of Bi metal, passing the carrier gas through the still to carry the At-211 vapor to the condenser, and to carry effluent from the condenser to the effluent gas filter, e. eluting At-211 from the condensate collector of the condenser with a controlled volume of eluent containing predetermined solvents that are compatible with a given desired radiopharmaceutical procedure, and f. collecting the At-211 in the controlled volume of eluent for use in the given radiopharmaceutical procedure

  12. Dicty_cDB: AHA211 [Dicty_cDB

    Full Text Available AH (Link to library) AHA211 (Link to dictyBase) - - - Contig-U16427-1 AHA211P (Link to Original ... yfg*ytlyiyiiq*nviffrtdfrkdgfhr*ry*ihgns*sck*irkryf*ngs ... nl*k*ncykiisids*fsk*csrecc*mfrfin*ks*rftsnrny*yiik ... fnfi Homology vs CSM-cDNA Score E Sequences producing s ignificant alignments: (bits) Value VHQ485 (VHQ485 ... 004. 4.27 Homology vs DNA Score E Sequences producing s ignificant alignments: (bits) Value N AC116956 |AC ... 2.22 Homology vs Protein Score E Sequences producing s ignificant alignments: (bits) Value (Q86KD1) RecNa ...

  13. 211 Po alpha decay level scheme

    deformations, so that their shapes in the ground state are represented by spheres. It is very interesting to note, that in the frame of this model, the linked level with 1s1/2 of the alpha particle is predicted to emerge from the orbital 1g9/2 of the spherical 211 Po parent, this level being deeply located in the potential well. Also, it is known that the ground state of the parent is 9/2+ emerging from 2g9/2 and the alpha decay exhibits a fine structure with 98.9% transitions to the ground state of the daughter with spin 1/2- (level 3p1/2), 0.55% transitions to the first single-particle excited state 5/2- (level 2f5/2) and 0.54% transitions to the second single-particle excited state 3/2- (level 3p3/2). In the frame of our formalism the fine structure can be understood by considering transitions between levels with the same quantum numbers in the avoided crossing regions, that means using the Landau-Zener effect. The system having only an axial symmetry, the good quantum number is the projection Ω of the nucleon spin. (author)

  14. 48 CFR 552.211-86 - Maximum weight per shipping container.

    2010-10-01

    ... shipping container. 552.211-86 Section 552.211-86 Federal Acquisition Regulations System GENERAL SERVICES....211-86 Maximum weight per shipping container. As prescribed in 511.204(b)(6), insert the following clause: Maximum Weight per Shipping Container (JAN 2010) In no instance shall the weight of a...

  15. 46 CFR 14.211 - Posting of copy of shipping articles.

    2010-10-01

    ... 46 Shipping 1 2010-10-01 2010-10-01 false Posting of copy of shipping articles. 14.211 Section 14.211 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY MERCHANT MARINE OFFICERS AND SEAMEN SHIPMENT AND DISCHARGE OF MERCHANT MARINERS Shipment of Merchant Mariners § 14.211 Posting of copy of...

  16. 36 CFR 211.4 - Cooperation for fire prevention and control.

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Cooperation for fire prevention and control. 211.4 Section 211.4 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE ADMINISTRATION Cooperation § 211.4 Cooperation for fire prevention and control. The Forest...

  17. 37 CFR 211.6 - Methods of affixation and placement of mask work notice.

    2010-07-01

    ... placement of mask work notice. 211.6 Section 211.6 Patents, Trademarks, and Copyrights COPYRIGHT OFFICE, LIBRARY OF CONGRESS COPYRIGHT OFFICE AND PROCEDURES MASK WORK PROTECTION § 211.6 Methods of affixation and placement of mask work notice. (a) General. (1) This section specifies methods of affixation and...

  18. Evaluation of a Wet Chemistry Method for Isolation of Cyclotron Produced [211At]Astatine

    Shigeki Watanabe

    2013-09-01

    Full Text Available A “wet chemistry” approach for isolation of 211At from an irradiated bismuth target is described. The approach involves five steps: (1 dissolution of bismuth target in conc. HNO3; (2 removal of the HNO3 by distillation; (3 dissolution of residue in 8 M HCl; (4 extraction of 211At from 8 M HCl into DIPE; and (5 extraction of 211At from DIPE into NaOH. Results from 55 “optimized” 211At isolation runs gave recovery yields of approximately 78% after decay and attenuation corrections. An attenuation-corrected average of 26 ± 3 mCi in the target provided isolated (actual yields of 16 ± 3 mCi of 211At. A sixth step, used for purification of 211At from trace metals, was evaluated in seven runs. In those runs, isolated 211At was distilled under reductive conditions to provide an average 71 ± 8% recovery. RadioHPLC analyses of the isolated 211At solutions, both initial and after distillation, were obtained to examine the 211At species present. The primary species of 211At present was astatide, but astatate and unidentified species were also observed. Studies to determine the effect of bismuth attenuation on 211At were conducted to estimate an attenuation factor (~1.33 for adjustment of 211At readings in the bismuth target.

  19. 14 CFR 302.211 - Procedures in certificate cases involving initial or continuing fitness.

    2010-01-01

    ... initial or continuing fitness. 302.211 Section 302.211 Aeronautics and Space OFFICE OF THE SECRETARY... Disposition of Applications § 302.211 Procedures in certificate cases involving initial or continuing fitness... applicant's fitness to operate. Where such applications propose the operation of scheduled service...

  20. 22 CFR 1203.735-211 - Activities relating to private organizations and politics.

    2010-04-01

    ... engage in any form of political activity in any foreign country. (h) Activities relating to U.S. politics... politics. 1203.735-211 Section 1203.735-211 Foreign Relations UNITED STATES INTERNATIONAL DEVELOPMENT... Employees § 1203.735-211 Activities relating to private organizations and politics. (a) Definition. For...

  1. 48 CFR 1552.211-80 - Data standards for the transmission of laboratory measurement results.

    2010-10-01

    ... transmission of laboratory measurement results. 1552.211-80 Section 1552.211-80 Federal Acquisition Regulations... Texts of Provisions and Clauses 1552.211-80 Data standards for the transmission of laboratory... Transmission of Laboratory Measurement Results (OCT 2000) This contract requires the transmission...

  2. 40 CFR Appendix A to Part 211 - Compliance Audit Testing Report

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Compliance Audit Testing Report A... ABATEMENT PROGRAMS PRODUCT NOISE LABELING Pt. 211, App. A Appendix A to Part 211—Compliance Audit Testing... conformance with applicable regulations under 40 CFR Part 211, et seq. All the data reported here are true...

  3. 24 CFR 3286. 211 - Expiration and renewal of installation licenses.

    2010-04-01

    ... 24 Housing and Urban Development 5 2010-04-01 2010-04-01 false Expiration and renewal of... Licensing in HUD-Administered States § 3286. 211 Expiration and renewal of installation licenses. (a) Expiration. Each installation license issued or renewed under this subpart C will expire 3 years after...

  4. 211Po - Comments on Evaluation of Decay Data

    This evaluation was completed in August 2009. The literature available by December 31st, 2008 was included. Evaluation Procedures: The Limitation of Relative Statistical Weight (LWM) method was applied for averaging numbers throughout this evaluation; this method was implemented by using the computer code LWEIGHT, ver. 4 (designed for Excel, MS Office). The uncertainty assigned to an average value in this evaluation is never lower than the lowest uncertainty of any of the experimental input values. Decay Scheme; 211Po decays 100% by alpha particle emissions, mainly to the ground state of 207Pb. The most recent evaluations of the 211Po nuclear structure and decay data, published in Nuclear Data Sheets, were done by E. Browne (2004) and M.J. Martin (1993). In the present evaluation, the spin, parity and energy of the levels, together with the multipolarities and mixing ratios of the γ-ray transitions, have been adopted from the A=207 ENSDF mass-chain evaluation 1993Ma73.This data evaluation refers only to the decay of the 211Po ground state, and not to the decay of the 211Po metastable state at 1462 keV (with a half-life of 25.2 s)

  5. 12 CFR 211.8 - Investments and activities abroad.

    2010-01-01

    ... Section 211.8 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM... standards of banking or financial prudence, having due regard for diversification of risks, suitable..., it is the Board's policy to allow activities abroad to be organized and operated as best...

  6. 21 CFR 211.182 - Equipment cleaning and use log.

    2010-04-01

    ... shall be part of the batch record. The persons performing and double-checking the cleaning and... Reports § 211.182 Equipment cleaning and use log. A written record of major equipment cleaning... individual equipment logs that show the date, time, product, and lot number of each batch processed....

  7. 40 CFR 86.211-94 - Exhaust gas analytical system.

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false Exhaust gas analytical system. 86.211... analytical system. The provisions of § 86.111-94 apply to this subpart, except that the NOX analyzer is optional. The exhaust gas analytical system must contain components necessary to determine...

  8. 33 CFR 211.2 - Authority to acquire real estate.

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Authority to acquire real estate..., DEPARTMENT OF DEFENSE REAL ESTATE ACTIVITIES OF THE CORPS OF ENGINEERS IN CONNECTION WITH CIVIL WORKS PROJECTS Real Estate; General § 211.2 Authority to acquire real estate. (a) Congressional...

  9. 48 CFR 852.211-72 - Technical industry standards.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Technical industry....211-72 Technical industry standards. As prescribed in 811.103-70, insert the following provision: Technical Industry Standards (JAN 2008) The supplies or equipment required by this invitation for bid...

  10. 48 CFR 752.211-70 - Language and measurement.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Language and measurement....211-70 Language and measurement. The following clause shall be used in all USAID-direct contracts. Language and Measurement (JUN 1992) (a) The English language shall be used in all written...

  11. 48 CFR 1552.211-76 - Legal analysis.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Legal analysis. 1552.211-76... analysis. As prescribed in 1511.011-76, insert this contract clause when it is determined that the contract involves legal analysis. Legal Analysis (APR 1984) The Contractor shall furnish to the Project Officer...

  12. 48 CFR 1852.211-70 - Packaging, handling, and transportation.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Packaging, handling, and... and Clauses 1852.211-70 Packaging, handling, and transportation. As prescribed in 1811.404-70, insert the following clause: Packaging, Handling, and Transportation (SEPT 2005) (a) The Contractor...

  13. 48 CFR 552.211-75 - Preservation, Packaging and Packing.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Preservation, Packaging....211-75 Preservation, Packaging and Packing. As prescribed in 511.204(b)(2), insert the following clause: Preservation, Packaging, and Packing (FEB 1996) Unless otherwise specified, all items shall...

  14. 48 CFR 871.211 - Information concerning correspondence courses.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Information concerning... PROGRAMS Vocational Rehabilitation and Employment Service 871.211 Information concerning correspondence courses. Specific questions on correspondence courses as to the content of courses, academic credit,...

  15. 48 CFR 52.211-18 - Variation in Estimated Quantity.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Variation in Estimated....211-18 Variation in Estimated Quantity. As prescribed in 11.703(c), insert the following clause in... in the estimated quantity of unit-priced items: Variation in Estimated Quantity (APR 1984) If...

  16. 48 CFR 452.211-70 - Brand Name or Equal.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Brand Name or Equal. 452... FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and Clauses 452.211-70 Brand Name or Equal. As prescribed in 411.171, insert the following provision: Brand Name or Equal (NOV...

  17. 48 CFR 52.211-6 - Brand name or equal.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Brand name or equal. 52....211-6 Brand name or equal. As prescribed in 11.107(a), insert the following provision: Brand Name or Equal (AUG 1999) (a) If an item in this solicitation is identified as “brand name or equal,”...

  18. 27 CFR 26.211 - Warehouse receipts covering distilled spirits.

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Warehouse receipts... and Recordkeeping § 26.211 Warehouse receipts covering distilled spirits. The sale of warehouse..., warehouse receipts for distilled spirits stored in warehouses, or elsewhere, must register and keep...

  19. 27 CFR 25.211 - Beer returned to brewery.

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Beer returned to brewery..., DEPARTMENT OF THE TREASURY LIQUORS BEER Beer Returned to Brewery § 25.211 Beer returned to brewery. (a) General. Beer, produced in the United States, on which the brewer has paid or determined the tax may...

  20. 22 CFR 211.1 - General purpose and scope; legislation.

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false General purpose and scope; legislation. 211.1...; legislation. (a) Legislation. The Agricultural Trade Development and Assistance Act of 1954, as amended (Pub...-624, 104 Stat. 3632-65 (1990). The legislation implemented by the regulation in this part (as of...

  1. 40 CFR 180.211 - Propachlor; tolerances for residues.

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Propachlor; tolerances for residues...) PESTICIDE PROGRAMS TOLERANCES AND EXEMPTIONS FOR PESTICIDE CHEMICAL RESIDUES IN FOOD Specific Tolerances § 180.211 Propachlor; tolerances for residues. (a) General. Tolerances are established for the...

  2. Addressing challenges in preparation of 211At-labeled biomolecules for use in targeted alpha therapy

    There are significant challenges in the development of 211At-labeled biomolecules for application to targeted alpha therapy. Challenges that we have addressed include development of: (1) labeling methods to obtain high in vivo 211At-label stability, (2) approaches to consistently obtain high recovery yields of Na[211At]At from irradiated bismuth targets, (3) methods to optimize biomolecule labeling yields, (4) reagents for use of 211At in pretargeting approach to cancer therapy, and (5) 211At-labeled antibodies in conditioning for hematopoietic cell transplantation. (author)

  3. Micromachined cutting blade formed from {211}-oriented silicon

    Fleming, James G.; Sniegowski, Jeffry J.; Montague, Stephen

    2003-09-09

    A cutting blade is disclosed fabricated of micromachined silicon. The cutting blade utilizes a monocrystalline silicon substrate having a {211} crystalline orientation to form one or more cutting edges that are defined by the intersection of {211} crystalline planes of silicon with {111} crystalline planes of silicon. This results in a cutting blade which has a shallow cutting-edge angle .theta. of 19.5.degree.. The micromachined cutting blade can be formed using an anisotropic wet etching process which substantially terminates etching upon reaching the {111} crystalline planes of silicon. This allows multiple blades to be batch fabricated on a common substrate and separated for packaging and use. The micromachined cutting blade, which can be mounted to a handle in tension and optionally coated for increased wear resistance and biocompatibility, has multiple applications including eye surgery (LASIK procedure).

  4. Micromachined cutting blade formed from {211}-oriented silicon

    Fleming, James G. (Albuquerque, NM); Fleming, legal representative, Carol (Burbank, CA); Sniegowski, Jeffry J. (Tijeras, NM); Montague, Stephen (Albuquerque, NM)

    2011-08-09

    A cutting blade is disclosed fabricated of micromachined silicon. The cutting blade utilizes a monocrystalline silicon substrate having a {211} crystalline orientation to form one or more cutting edges that are defined by the intersection of {211} crystalline planes of silicon with {111} crystalline planes of silicon. This results in a cutting blade which has a shallow cutting-edge angle .theta. of 19.5.degree.. The micromachined cutting blade can be formed using an anisotropic wet etching process which substantially terminates etching upon reaching the {111} crystalline planes of silicon. This allows multiple blades to be batch fabricated on a common substrate and separated for packaging and use. The micromachined cutting blade, which can be mounted to a handle in tension and optionally coated for increased wear resistance and biocompatibility, has multiple applications including eye surgery (LASIK procedure).

  5. Discovery of superthermal hydroxyl (OH) in the HH211 outflow

    Tappe, A; Black, J H; Muench, A A

    2008-01-01

    We present a 5-37 micron infrared spectrum obtained with the Spitzer Space Telescope toward the southeastern lobe of the young protostellar outflow HH211. The spectrum shows an extraordinary sequence of OH emission lines arising in highly excited rotational levels up to an energy E/k~28200K above the ground level. This is, to our knowledge, by far the highest rotational excitation of OH observed outside Earth. The spectrum also contains several pure rotational transitions of H2O (v=0), H2 (v=0) S(0) to S(7), HD (v=0) R(3) to R(6), and atomic fine-structure lines of [Fe II], [Si II], [Ne II], [S I], and [Cl I]. The origin of the highly excited OH emission is most likely the photodissociation of H2O by the UV radiation generated in the terminal outflow shock of HH211.

  6. High spin states and Yrast isomers in 211Rn

    Excited states in 211Rn with spins up to 53/2 have been identified using (HI,xn) reactions and γ-ray techniques. A shell model calculation can reproduce the ordering of the yrast sequence up to spin 41/2-. Several yrast isomers have been identified. Enhanced E3 transitions are observed and their systematic occurrence in this region discussed. The influence of the neutron hole, and possible core excitations on the effective moment of inertia are also pointed out

  7. 75 FR 33738 - Airworthiness Directives; Rolls-Royce plc (RR) RB211-524 Series and RB211 Trent 500, 700, and 800...

    2010-06-15

    ... complete Privacy Act Statement in the Federal Register published on April 11, 2000 (65 FR 19477-78... 12866; 2. Is not a ``significant rule'' under the DOT Regulatory Policies and Procedures (44 FR 11034... plc (RR) RB211-524 Series and RB211 Trent 500, 700, and 800 Series Turbofan Engines AGENCY:...

  8. Final Report for grant entitled "Production of Astatine-211 for U.S. Investigators"

    Wilbur, Daniel Scott

    2012-12-12

    Alpha-particle emitting radionuclides hold great promise in the therapy of cancer, but few alpha-emitters are available to investigators to evaluate. Of the alpha-emitters that have properties amenable for use in humans, 211At is of particular interest as it does not have alpha-emitting daughter radionuclides. Thus, there is a high interest in having a source of 211At for sale to investigators in the US. Production of 211At is accomplished on a cyclotron using an alpha-particle beam irradiation of bismuth metal. Unfortunately, there are few cyclotrons available that can produce an alpha particle beam for that production. The University of Washington has a cyclotron, one of three in the U.S., that is currently producing 211At. In the proposed studies, the things necessary for production and shipment of 211At to other investigators will be put into place at UW. Of major importance is the efficient production and isolation of 211At in a form that can be readily used by other investigators. In the studies, production of 211At on the UW cyclotron will be optimized by determining the best beam energy and the highest beam current to maximize 211At production. As it would be very difficult for most investigators to isolate the 211At from the irradiated target, the 211At-isolation process will be optimized and automated to more safely and efficiently obtain the 211At for shipment. Additional tasks to make the 211At available for distribution include obtaining appropriate shipping vials and containers, putting into place the requisite standard operating procedures for Radiation Safety compliance at the levels of 211At activity to be produced / shipped, and working with the Department of Energy, Isotope Development and Production for Research and Applications Program, to take orders, make shipments and be reimbursed for costs of production and shipment.

  9. Comparison of (211)At-PRIT and (211)At-RIT of Ovarian Microtumors in a Nude Mouse Model

    Frost, Sofia H L; Bäck, Tom; Chouin, Nicolas;

    2013-01-01

    Abstract Purpose: Pretargeted radioimmunotherapy (PRIT) against intraperitoneal (i.p.) ovarian microtumors using avidin-conjugated monoclonal antibody MX35 (avidin-MX35) and (211)At-labeled, biotinylated, succinylated poly-l-lysine ((211)At-B-PL(suc)) was compared with conventional radioimmunothe....... Despite advanced disease in many animals at the time of treatment, PRIT demonstrated good potential to treat disseminated ovarian cancer....... radioimmunotherapy (RIT) using (211)At-labeled MX35 in a nude mouse model. Methods: Mice were inoculated i.p. with 1×10(7) NIH:OVCAR-3 cells. After 3 weeks, they received PRIT (1.0 or 1.5 MBq), RIT (0.9 MBq), or no treatment. Concurrently, 10 additional animals were sacrificed and examined to determine disease......), and 0.45 (RIT). The 1.5-MBq PRIT group exhibited lower incidence of ascites and fewer tumors >1 mm than RIT-treated animals. Conclusions: PRIT was as effective as RIT with regard to TFF; however, the size distribution of tumors and presence of ascites indicated that 1.5-MBq PRIT was more efficient...

  10. Measurement of the (211)Pb half-life using recoil atoms from (219)Rn decay.

    Aitken-Smith, P M; Collins, S M

    2016-04-01

    The radioactive half-life of (211)Pb was measured, by α-particle counting of samples of radiochemically pure (211)Pb in equilibrium with its α-emitting progeny, (211)Bi and (211)Po. The samples were prepared by the collection of (215)Po recoil atoms from the decay of the (219)Rn decay progeny produced from a (223)Ra sample onto stainless steel discs. The radioactive decay of the (211)Pb was measured utilising a 2π proportional counter operating on the α plateau. A half-life of 36.164 (13)min was determined, which is in agreement with currently available literature. A full uncertainty budget is presented. A recommended half-life of T1/2((211)Pb)=36.161 (17)min has been evaluated from the current literature values. PMID:26773817

  11. Gene expression signature in mouse thyroid tissue after 131I and 211At exposure

    Rudqvist, Nils; Spetz, Johan; Schüler, Emil; Langen, Britta; Parris, Toshima Z.; Helou, Khalil; Forssell-Aronsson, Eva

    2015-01-01

    Background 131I and 211At are used in nuclear medicine and accumulate in the thyroid gland and may impact normal thyroid function. The aim of this study was to determine transcriptional profile variations, assess the impact on cellular activity, and identify genes with biomarker properties in thyroid tissue after 131I and 211At administration in mice. Methods To further investigate thyroid tissue transcriptional responses to 131I and 211At administration, we generated a new transcriptional da...

  12. Clinical significance of serum CYFRA 21-1 in gastric cancer.

    Nakata, B.; Chung, Y. S.; Kato, Y.; Ogawa, M; Ogawa, Y; Inui, A.; Maeda, K; Sawada, T; Sowa, M.

    1996-01-01

    We studied the clinical significance of the soluble cytokeratin 19 fragment detected with monoclonal antibody CYFRA 21-1 in the sera of patients with histologically proven gastric cancer. Sera of 110 patients with gastric cancer were analysed for CYFRA 21-1 levels by a two-step sandwich enzyme immunoassay. There were no significant differences between CYFRA 21-1 levels and the histotype, depth of invasion or vessel invasion. However, CYFRA 21-1 was significantly higher in the presence of peri...

  13. New tumor markers for breast carcinoma is serum CYFRA 21-1%乳腺癌新的肿瘤标志物-CYFRA21-1

    刘志勇; 欧阳忠; 邹小明

    2010-01-01

    目的 探讨CYFRA21-1在乳腺癌中的表达情况及其临床意义.方法 分别检测86例原发性乳腺癌,14例复发性乳腺癌,22例良性乳腺肿瘤,25例正常人群中血清CYFRA21-1、CEA、CA153的表达情况,并检测血清CYFRA21-1含量与临床病理特征、预后及无病生存时间的关系.结果 乳腺良性肿瘤人群与正常人群中CYFRA21-1的差别无统计学意义.CYFRA21-1在Ⅳ期乳腺癌及复发性乳腺癌中的阳性率分别为60%和64.2%,其阳性率高于CA153和CEA.在血运性复发性乳腺癌病例中,其灵敏度较高,为89%.随着TNM分期的增加CYFRA21-1的水平逐渐升高.CYFRA21-1与CEA无统计学关联,与CA153有轻度统计学关联,单因素及多因素分析均显示:CYFRA21-1可作为判断乳腺癌预后的一个独立指标.结论 检测CYFRA21-1水平对检测乳腺癌复发及评估治疗效果有非常大的价值.

  14. 12 CFR 211.7 - Voluntary liquidation of Edge and agreement corporations.

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Voluntary liquidation of Edge and agreement corporations. 211.7 Section 211.7 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM INTERNATIONAL BANKING OPERATIONS (REGULATION K) International Operations of U.S....

  15. 49 CFR 240.211 - Procedures for making the determination on performance skills.

    2010-10-01

    ... performance skills. 240.211 Section 240.211 Transportation Other Regulations Relating to Transportation... determination on performance skills. (a) Each railroad, prior to initially certifying or recertifying any person... demonstrated, in accordance with the requirements of § 240.127 of this part, the skills to safely...

  16. On convergence (2,1,...,1-periodic branched continued fraction of the special form

    D. I. Bodnar

    2016-01-01

    Full Text Available (2,1,...,1-periodic branched continued fraction of the special form is defined. Conditions of convergence are established for 2-periodic continued fraction and (2,1,...,1-periodic branched continued fraction of the special form. Truncation error bounds are estimated for these fractions under additional conditions.

  17. 48 CFR 552.211-92 - Radio Frequency Identification (RFID) using passive tags.

    2010-10-01

    ... with 48 CFR clause 252.211-7006. Shipments to GSA Distribution Centers with final destinations to DLA and DoD shall be in compliance to 48 CFR 252.211-7006. Copies may be obtained from http://www.access.gpo.gov/nara/cfr/cfr-table-search.html. (End of clause)...

  18. Alpha-Decay of $^{211}Po$ on the 1633 keV $^{207}Pb$ level

    Chumin, V G; Malikov, Sh R; Norseev, Yu V; Samatov, Z K; Fominykh, V I; Cherevatenko, A P; Yurkova, L V

    2000-01-01

    In investigations of gamma-spectrum of ^{211}At and daughter ^{211}Po and ^{207}Bi isotopes a new branch of the alpha-decay on the ^{207}Pb 1633 keV level is discovered. Its intensity is 8.1 cdot 10^{-4} %.

  19. 33 CFR 211.111 - Certification terminating rights of former owners.

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Certification terminating rights of former owners. 211.111 Section 211.111 Navigation and Navigable Waters CORPS OF ENGINEERS, DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE REAL ESTATE ACTIVITIES OF THE CORPS OF ENGINEERS IN...

  20. 45 CFR 400.211 - Methodology to be used to determine time-eligibility of refugees.

    2010-10-01

    ...-eligibility of refugees. 400.211 Section 400.211 Public Welfare Regulations Relating to Public Welfare OFFICE OF REFUGEE RESETTLEMENT, ADMINISTRATION FOR CHILDREN AND FAMILIES, DEPARTMENT OF HEALTH AND HUMAN SERVICES REFUGEE RESETTLEMENT PROGRAM Federal Funding Federal Funding for Expenditures for...

  1. 12 CFR 211.22 - Interstate banking operations of foreign banking organizations.

    2010-01-01

    ... production office in accordance with the provisions in § 208.7 of Regulation H (12 CFR 208.7). ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Interstate banking operations of foreign banking organizations. 211.22 Section 211.22 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF...

  2. 12 CFR 211.23 - Nonbanking activities of foreign banking organizations.

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Nonbanking activities of foreign banking organizations. 211.23 Section 211.23 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM INTERNATIONAL BANKING OPERATIONS (REGULATION K) Foreign Banking Organizations §...

  3. 12 CFR 211.3 - Foreign branches of U.S. banking organizations.

    2010-01-01

    ... CFR part 204). (e) Conditional approval; access to information. The Board may impose such conditions... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Foreign branches of U.S. banking organizations. 211.3 Section 211.3 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL...

  4. 40 CFR 600.211-08 - Sample calculation of fuel economy values for labeling.

    2010-07-01

    ... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Sample calculation of fuel economy values for labeling. 600.211-08 Section 600.211-08 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) ENERGY POLICY FUEL ECONOMY AND CARBON-RELATED EXHAUST EMISSIONS OF MOTOR VEHICLES...

  5. 5 CFR 842.211 - Senior Executive Service, Defense Intelligence Senior Executive Service, and Senior Cryptologic...

    2010-01-01

    ... Intelligence Senior Executive Service, and Senior Cryptologic Executive Service. 842.211 Section 842.211... Intelligence Senior Executive Service, and Senior Cryptologic Executive Service. (a) A member of the Senior Executive Service, the Defense Intelligence Senior Executive Service, or the Senior Cryptologic...

  6. 49 CFR 375.211 - Must I have an arbitration program?

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Must I have an arbitration program? 375.211... Services to My Customers General Responsibilities § 375.211 Must I have an arbitration program? (a) You must have an arbitration program for individual shippers to resolve disputes about property loss...

  7. Separation of 211At from irradiated bismuth target and labelling of a model protein

    Astatine-211 is a promising radionuclide for therapeutic use in nuclear medicine. An efficient method (70%) for radiochemical separation from the irradiated Bi-target has been described. The level of Bi contamination in the purified 2'11At-solution was estimated. Finally labelling of a model protein has been tried. (author). 14 refs

  8. Influence of preparation conditions on 211 particle refinement in YBCO bulk superconductors with Ce addition

    Diko, Pavel, E-mail: dikos@saske.sk; Volochová, Daniela; Radušovská, Monika; Zmorayová, Katarína; Šefčiková, Martina; Antal, Vitalij; Jurek, Karel; Jirsa, Miloš; Kováč, Jozef

    2013-11-15

    Highlights: •CeO{sub 2} causes coarsening of Y211 particles in nominal composition Y{sub 1.5}Ba{sub 2}Cu{sub 3}O{sub x}. •Y211 particles grow during sintering at 940 °C. •High local density of Y211 particles hinders their growth at sintering stage. •Addition of BaCeO{sub 3} leads to smaller Y211 particles. •Skeleton of Y211 particles prevents pollution of grown samples. -- Abstract: The influence of CeO{sub 2} and BaCeO{sub 3} addition and the influence of processing conditions on Y{sub 2}BaCuO{sub 5} (Y211) particle size and particle distribution in melt-processed YBa{sub 2}Cu{sub 3}O{sub 7}/Y{sub 2}BaCuO{sub 5} (Y123/Y211) bulk superconductors with nominal composition Y{sub 1.5}Ba{sub 2}Cu{sub 3}O{sub x} was investigated. Ce dissolved in the peritectic melt can actively hinder the Y211 particle growth by the Ostwald ripening process at melting stage. At sintering of intensively milled samples, Y211 particles in the charge free of CeO{sub 2} are smaller than Y211 particles formed in the charge with CeO{sub 2} addition and this behaviour can be related to the melt formation around added CeO{sub 2}. The Y211 particle refinement in the mildly milled samples with large Y123 particles in the pressed green bodies is caused by very dense Y211 skeleton resistant to melt formation at the sintering stage. This skeleton is a barrier for pollution of the sample from the substrate and from the seed. BaCeO{sub 3} added instead CeO{sub 2} causes significant Y211 particle refinement also in the samples with homogenously distributed Y211 particles.

  9. Prevalence of the prion protein gene E211K variant in U.S. cattle

    Chase Chad C

    2008-07-01

    Full Text Available Abstract Background In 2006, an atypical U.S. case of bovine spongiform encephalopathy (BSE was discovered in Alabama and later reported to be polymorphic for glutamate (E and lysine (K codons at position 211 in the bovine prion protein gene (Prnp coding sequence. A bovine E211K mutation is important because it is analogous to the most common pathogenic mutation in humans (E200K which causes hereditary Creutzfeldt – Jakob disease, an autosomal dominant form of prion disease. The present report describes a high-throughput matrix-associated laser desorption/ionization-time-of-flight mass spectrometry assay for scoring the Prnp E211K variant and its use to determine an upper limit for the K211 allele frequency in U.S. cattle. Results The K211 allele was not detected in 6062 cattle, including those from five commercial beef processing plants (3892 carcasses and 2170 registered cattle from 42 breeds. Multiple nearby polymorphisms in Prnp coding sequence of 1456 diverse purebred cattle (42 breeds did not interfere with scoring E211 or K211 alleles. Based on these results, the upper bounds for prevalence of the E211K variant was estimated to be extremely low, less than 1 in 2000 cattle (Bayesian analysis based on 95% quantile of the posterior distribution with a uniform prior. Conclusion No groups or breeds of U.S. cattle are presently known to harbor the Prnp K211 allele. Because a carrier was not detected, the number of additional atypical BSE cases with K211 will also be vanishingly low.

  10. 5 CFR 875.211 - What happens if my eligibility status changes after I submit my application?

    2010-01-01

    ... provisions of 5 U.S.C. 8412(g), or retire after you submit an application for coverage, but before your... changes after I submit my application? 875.211 Section 875.211 Administrative Personnel OFFICE OF... PROGRAM Eligibility § 875.211 What happens if my eligibility status changes after I submit my...

  11. Evaluation of meta-[211At]astatobenzylguanidine in an athymic mouse human neuroblastoma xenograft model

    A paired-label biodistribution was performed in athymic mice bearing SK-N-SH human neuroblastoma xenografts to compare the tissue uptake of meta-[211At]astatobenzylguanidine ([211At]MABG) and [131I]MIBG. Significantly higher (p 211At]MABG was seen in tumor (3.8 ± 0.8% ID/g vs. 3.1 ± 0.7% ID/g at 8 h) compared to [131I]MIBG. Desipramine reduced tumor uptake of [211At] MABG by 43%, suggesting that its accumulation was related to the specific uptake-1 mechanism. Higher uptake of [211At]MABG was also seen in normal tissue targets such as heart (6.0 ± 0.9% ID/g vs. 4.5 ± 0.8% ID/g at 8 h; p 211At]MABG by 1.5-fold while reducing uptake in heart and several other normal tissues. The vesicular uptake inhibitor tetrabenazine reduced heart uptake by 30% without reducing the tumor uptake. These results suggest such strategies might be useful for improving [211At]MABG tumor-to-normal tissue ratios

  12. Preparation and preclinical evaluation of {sup 211}At-labelled compounds for {alpha}-particle radiotherapy

    Larsen, R.H.

    1994-12-31

    The interest for {alpha}-particle emitters in internal radiotherapy is increasing due to improved conjugation chemistry. Experimental work has concentrated on {sup 211}At and {sup 212}Bi since these to nuclides have radiochemical and physical properties suitable for medical application. In this report it is demonstrated that biologically active {sup 211}At-labelled compounds can be prepared within a relatively short time allowing utilization of this 7.2 h {alpha}-particle. It is further shown that {sup 211}At-TP-3 treatment of human osteosarcoma in vitro gives promising therapeutic ratios. 76 refs., 5 figs., 3 tabs.

  13. Preparation and preclinical evaluation of 211At-labelled compounds for α-particle radiotherapy

    The interest for α-particle emitters in internal radiotherapy is increasing due to improved conjugation chemistry. Experimental work has concentrated on 211At and 212Bi since these to nuclides have radiochemical and physical properties suitable for medical application. In this report it is demonstrated that biologically active 211At-labelled compounds can be prepared within a relatively short time allowing utilization of this 7.2 h α-particle. It is further shown that 211At-TP-3 treatment of human osteosarcoma in vitro gives promising therapeutic ratios. 76 refs., 5 figs., 3 tabs

  14. CYFRA 21-1 serum levels in women with adnexal masses and inflammatory diseases.

    Tempfer, C; Hefler, L; Heinzl, H; Loesch, A.; Gitsch, G; Rumpold, H.; Kainz, C.

    1998-01-01

    The aim of the present study was to evaluate the clinical usefulness of the cytokeratin marker CYFRA 21-1 as a screening marker for ovarian cancer, as a predictive marker in patients with adnexal masses and as a prognostic marker in women suffering from ovarian cancer. In order to determine the specificity of the CYFRA 21-1 test, we have investigated CYFRA 21-1 serum levels in several benign conditions. This retrospective study comprises 37 patients suffering from ovarian cancer FIGO stages I...

  15. The growth and characterization of (211) and (133) Oriented (Hg,Cd)Te epilayers (211)B GaAs by organometallic vapor phase epitaxy

    Gouws, G. J.; Muller, R. J.

    1995-09-01

    The growth of CdTe buffer layers on (211)B GaAs substrates by organometallic vapor phase epitaxy (OMVPE) was studied, and it was found that, depending on the growth conditions, either the (211) or (133) epitaxial orientation could be formed. In some cases, an epilayer showing a mixed (211) and (133) orientation was also observed. The influence of several growth parameters on the orientation of the CdTe layer was investigated, and it was found that the Te/Cd ratio, together with the growth temperature, have the most significant effect in determining the epilayer orientation. From these results, it was then possible to select nominally optimized growth conditions for CdTe buffer layers of both orientations. (Hg,Cd)Te layers of the same orientations could then be grown and characterized. Although double crystal x-ray diffraction measurements indicated a somewhat better crystalline perfection in the (133) (Hg,Cd)Te layers, these layers showed a poor surface morphology compared to the (211) orientation. Measurement of etch pit densities also indicated defect densities to be typically half an order of magnitude higher in the (133) orientation. Diodes were formed by ion implantation in both orientations and significantly better results were obtained on the (211) (Hg,Cd)Te layers.

  16. ASTATINE-211 RADIOCHEMISTRY: THE DEVELOPMENT OF METHODOLOGIES FOR HIGH ACTIVITY LEVEL RADIOSYNTHESIS

    MICHAEL R. ZALUTSKY

    2012-08-08

    Targeted radionuclide therapy is emerging as a viable approach for cancer treatment because of its potential for delivering curative doses of radiation to malignant cell populations while sparing normal tissues. Alpha particles such as those emitted by 211At are particularly attractive for this purpose because of their short path length in tissue and high energy, making them highly effective in killing cancer cells. The current impact of targeted radiotherapy in the clinical domain remains limited despite the fact that in many cases, potentially useful molecular targets and labeled compounds have already been identified. Unfortunately, putting these concepts into practice has been impeded by limitations in radiochemistry methodologies. A critical problem is that the synthesis of therapeutic radiopharmaceuticals provides additional challenges in comparison to diagnostic reagents because of the need to perform radio-synthesis at high levels of radioactivity. This is particularly important for {alpha}-particle emitters such as 211At because they deposit large amounts of energy in a highly focal manner. The overall objective of this project is to develop convenient and reproducible radiochemical methodologies for the radiohalogenation of molecules with the {alpha}-particle emitter 211At at the radioactivity levels needed for clinical studies. Our goal is to address two problems in astatine radiochemistry: First, a well known characteristic of 211At chemistry is that yields for electrophilic astatination reactions decline as the time interval after radionuclide isolation from the cyclotron target increases. This is a critical problem that must be addressed if cyclotrons are to be able to efficiently supply 211At to remote users. And second, when the preparation of high levels of 211At-labeled compounds is attempted, the radiochemical yields can be considerably lower than those encountered at tracer dose. For these reasons, clinical evaluation of promising 211At

  17. Morphological stability of Sm123 superconductor during peritectic solidification from Sm211 + L mixture

    The interface stability of the Sm 123 superconductor was analyzed in accordance with the constitutional undercooling criterion. As the single-crystal growth of the 123 phase is largely dependent on the growth-interface stability, a quantitative analysis was very much required. From this analysis, it was clarified that the constitutional undercooling must exist in the liquid when the 123 growth interface comes close to a 211 particle during the peritectic solidification. It was also predicted that the larger 211 particle radius, smaller volume fraction of the 211 particles, larger growth rate, or smaller imposed temperature gradient would cause easy occurrence of the constitutional undercooling ahead of the 123 growth interface. Taking into account the nucleation at the L/211 interface just ahead of the 123 growth front due to the constitutional undercooling, the transition of 123 growth from a planar-interface morphology to an equiaxed blocky morphology was investigated quantitatively and qualitatively

  18. 33 CFR 211.8 - Limitations on rights which may be granted.

    2010-07-01

    ... ARMY, DEPARTMENT OF DEFENSE REAL ESTATE ACTIVITIES OF THE CORPS OF ENGINEERS IN CONNECTION WITH CIVIL WORKS PROJECTS Temporary Use by Others of Civil Works Real Estate § 211.8 Limitations on rights...

  19. Preparation and in vivo evaluation of linkers for 211At labeling of humanized anti-Tac

    The syntheses, radiolabeling, antibody conjugation, and in vivo evaluation of new linkers for 211At labeling of humanized anti-Tac (Hu-anti-Tac), an antibody to the α-chain of the IL-2 receptor (IL-2Rα) shown to be a useful target for radioimmunotherapy are described. Synthesis of the organometallic linker precursors is accomplished by reaction of the corresponding bromo- or iodoaryl esters with bis(tributyltin) in the presence of a palladium catalyst. Subsequent conversion to the corresponding N-succinimidyl ester and labeling with 211At of two new linkers, N-succinimidyl 4-[211At]astato-3-methylbenzoate and N-succinimidyl N-(4-[211At]astatophenethyl)succinamate (SAPS), together with the previously reported N-succinimidyl 4-[211At]astatobenzoate and N-succinimidyl 3-[211At]astato-4-methylbenzoate, are each conjugated to Hu-anti-Tac. The plasma survival times of these conjugates are compared to those of directly iodinated (125I) Hu-anti-Tac. The N-succinimidyl N-(4-[211At]astatophenethyl)succinamate compound (SAPS) emerged from this assay as the most viable candidate for 211At-labeling of Hu-anti-Tac. SAPS, along with the directly analogous radio-iodinated reagent, N-succinimidyl N-(4-[125I]astatophenethyl)succinamate (SIPS), are evaluated in a biodistribution study along with directly iodinated (125I) Hu-anti-Tac. Blood clearance and biological accretion results indicate that SAPS is a viable candidate for further evaluation for radioimmunotherapy of cancer

  20. System Engineering Management and Implementation Plan for Project W-211, ''Initial Tank Retrieval Systems'' (ITRS)

    This systems Engineering Management and Implementation Plan (SEMIP) describes the Project W-211 implementation of the Tank Farm Contractor Systems Engineering Management Plan (TFC SEMP). The SEMIP defines the systems engineering products and processes used by the project to comply with the TFC SEMP, and provides the basis for tailoring systems engineering processes by applying a graded approach to identify appropriate systems engineering requirements for W-211

  1. Increases in Serum CYFRA21-1 Concentration during Successful Treatment with Crizotinib

    Kanaji, Nobuhiro; Tadokoro, Akira; Watanabe, Naoki; Inoue, Takuya; Ishii, Tomoya; Dobashi, Hiroaki; Bandoh, Shuji

    2014-01-01

    Case series Patient: — Final Diagnosis: — Symptoms: — Medication: — Clinical Procedure: — Specialty: — Objective: Unexpected drug reaction Background: Increases in tumor marker concentrations usually suggest disease progression. Cases Report: We here describe on 3 patients with non-small cell lung cancer whose serum concentrations of CYFRA21-1 increased in spite of successful treatment with crizotinib. Discontinuation of crizotinib resulted in a rapid decrease in serum CYFRA21-1 concentration...

  2. Silver impregnated nanoparticles of titanium dioxide as carriers for {sup 211}At

    Cedrowska, Edyta; Lyczko, Monika; Piotrowska, Agata; Bilewicz, Aleksander [Institute of Nuclear Chemistry and Technology, Warsaw (Poland); Stolarz, Anna; Trcinska, Agnieszka [Warsaw Univ. (Poland). Heavy Ion Lab.; Szkliniarz, Katarzyna [Silesia Univ. Katowice (Poland). Inst. of Physics; Was, Bogdan [Polish Academy of Science, Cracow (Poland). Inst. of Nuclear Physics

    2016-08-01

    The {sup 211}At radioisotope exhibits very attractive nuclear properties for application in radionuclide therapy. Unfortunately use of {sup 211}At is limited, because astatine as the heaviest halogen forms weak bond with carbon atoms in the biomolecules which makes {sup 211}At bioconjugates unstable in physiological conditions. In our work we propose a new solution for binding of {sup 211}At which consists of using nanoparticles of titanium dioxide modified with silver atoms as carriers for {sup 211}At. Ag{sup +} cations have been absorbed on the nanometer-sized TiO{sub 2} particles (15 and 32 nm) through ion exchange process and were reduced in Tollens' reaction. The obtained TiO{sub 2}-Ag nanoparticles were labeled with {sup 211}At. It was found that labeling yields were almost quantitative under reducing conditions, while under oxidizing conditions they dropped to about 80%. The labeled nanoparticles exhibited very high stability in physiological salt, PBS buffer, solutions of peptides (0.001 M cysteine, 0.001 M glutathione) and in human blood serum. To make TiO{sub 2}/Ag nanoparticles well dispersed in water and biocompatible their surface was modified with a silane coupling agent containing poly(ethyleneglycol) molecules. The developed functionalization approach will allow us to attach biomolecules to the TiO{sub 2}/Ag surface.

  3. Preoperative CYFRA 21-1 level as a prognostic indicator in resected primary squamous cell lung cancer.

    Niklinski, J.; Furman, M; Burzykowski, T.; Chyczewski, L.; Laudanski, J.; Chyczewska, E; Rapellino, M.

    1996-01-01

    The CYFRA 21-1 assay is a test that has been developed recently for detection of a cytokeratin 19 fragment in serum. A diagnostic role for CYFRA 21-1 has already been proposed. The question of whether this marker is prognostically significant is important in clarifying the role of CYFRA 21-1 in clinical practice. The aim of this study was to evaluate the prognostic significance of elevated preoperative CYFRA 21-1 levels in patients with resected primary squamous-cell lung cancer (SqCC). Serum...

  4. Serum squamous cell carcinoma antigen and CYFRA 21-1 in cervical cancer treatment

    Purpose: To analyze whether serum squamous cell carcinoma (SCC) antigen and cytokeratin-19 fragments (CYFRA) levels can assist in selecting patients with locally advanced cervical cancer who will benefit from combined treatment or additive surgery. Methods and Materials: Of 114 patients with cervical cancer Stage IB-IV, the first 39 patients received radiotherapy, the following 75 patients received identical radiotherapy plus concomitant chemotherapy (3 cycles of carboplatin and 5-fluorouracil). SCC antigen and CYFRA 21-1 serum levels were measured before treatment, after therapy, and during follow-up. Baseline tumor markers were related to tumor stage and size and clinical outcome. Results: Before treatment, SCC antigen was elevated (>1.9 μg/L) in 60% and CYFRA 21-1 (>2.2 μg/L) in 46% of patients. For all patients, disease-free survival (DFS) was better after combined treatment (67% vs. 43%, p<0.0005). For patients with elevated baseline SCC antigen, DFS was better after combination therapy (67% vs. 27%, p=0.001) which resulted more frequently in a normal SCC antigen (93% vs. 65%, p=0.004). In contrast, in those with a normal baseline CYFRA 21-1, combined therapy resulted in a better DFS (p=0.04). Patients who achieved a normal SCC antigen or CYFRA 21-1 after treatment had a better DFS (respectively 63 vs. 17% and 64 vs. 30%). Elevated SCC antigen posttreatment indicated residual tumor in 11/12 patients (92%), elevated CYFRA 21-1 in 7/10 patients (70%). Forty-seven patients had a tumor recurrence. At recurrence, SCC antigen was raised in 70% and CYFRA 21-1 in 69%. Conclusions: In patients with an elevated pretreatment SCC antigen, SCC antigen normalized more frequently with combined treatment and those patients had a better DFS. Elevated SCC antigen or CYFRA 21-1 levels after treatment completion indicated residual tumor in respectively 92% and 70%. The presence of elevated posttreatment levels of SCC antigen or CYFRA 21-1 indicates the need for additional

  5. CYFRA 21-1 in urine: a diagnostic marker for endometriosis?

    Gjavotchanoff R

    2015-02-01

    Full Text Available Risto Gjavotchanoff1,2 1Department of Laboratory Medicine, Bodenseelabor, Hörbranz, Austria; 2Institute of Anatomy II, University of Jena, Jena University Hospital, Jena, Germany Abstract: Diagnostic workup of endometriosis usually involves laparoscopic inspection and histological examination of biopsies. Unequivocal laboratory parameters for this ailment have not been available in routine diagnostic evaluations thus far. In this study, we examined urine concentrations of cytokeratin 19 (CYFRA 21-1, a structural protein specific for epithelia. We performed immunoassays for CYFRA 21-1 in urine samples from women afflicted with endometriosis throughout their menstrual cycle. We observed a significant increase in CYFRA 21-1 concentrations, corrected by creatinine levels, in the late follicular phase as compared with the level in healthy controls. We conclude that cyclically increased CYFRA 21-1 concentrations in urine could serve as a valuable noninvasive diagnostic parameter in the workup of clinically manifesting endometriosis. Keywords: biomarkers, menstrual cycle, CYFRA 21-1, immunoassay, noninvasive diagnosis

  6. Hurdles for a Broader Use of 211At and for the Synthesis of 211At-Labelled Radiopharmaceuticals at High Activities for Clinical Use

    One of the key impediments to the use of 211At is the very well known deleterious effect of high radiation fields caused by its alpha particles on the synthesis of 211At-labelled radiopharmaceuticals. This is problematic because radiolysis-mediated effects can produce diminishing efficiency of electrophilic astatination reactions due to increasing deposition of radiation dose with increasing activities and with the passage of the time. Astatine-211 has chemical properties that permit complex labelling strategies and a longer half-life than 213Bi that makes it more suitable when the targeting molecule does not gain immediate access to the tumour cells. The first clinical evaluation was published in 2001 [2] in patients with brain tumour. Although this study circumvents many of the challenges to entering clinical studies with 211At and many obstacles had to be surmounted before clinical studies could be initiated, several problems were encountered in maintaining efficient labelling with escalating radiation dose of α-particle even with fresh 211At elution [3]. Astatine-211 also has an additional hurdle to overcome before to its clinical application in labelled radiopharmaceuticals related with its production and distribution. Among the potential group of promising α- emitter it is the only one produced by cyclotrons, but due to the scarcity of cyclotrons equipped with 25−30 MeV α-particle beams, it will of necessity be utilized in distant locations from the site of production. It presents a major chemical challenge because the diminishing efficiency of electrophilic astatination reactions with the passage of the time is well known, a problem likely related to the radiolysis produced by the high LET (linear energy transfer) meaning that large amounts of energy are deposited in a highly localized manner. This problem has been most comprehensively investigated to understand and evaluate the role of the radiolysis effects of astatine alpha particles in the synthesis

  7. Astatine-211: production, injection into monoclonal antibodies radiological effect, possible application to cancer treatment

    Methods developed in the Laboratory of Nuclear Problems, JINR, for producing astatine-211 and injecting it into monoclonal antibodies are described. The use of its diethylene triamine penta-acetic acid complex is shown to be the most effective method of injecting astatine into a biomolecules. The biological effect of the α-particles emitted from the astatine-211 is investigated using Chinese hamster fibroblasts and Ehrlich carcinoma cells. It is established that the mitotic activity depression, number of degenerating cells, number of cells with chromosome aberrations, and cellular surviving fraction depend on the concentration of the radionuclide in the medium 'in vitro'. The RBE of α-particles in comparison with 60Co γ-rays is 3. Injection of astatine-211 absorbed on tellurium particles into mice with ascitic tumors resulted in prolongation of their life or elimination of the tumors. (author). 39 refs, 7 figs

  8. Preparation and preclinical evaluation of 211At-labelled compounds for α-particle radiotherapy

    The present work demonstrate that significant therapeutic gain can be achieved with 211At-labelled MoAbs on single tumour cells and microscopic disease. Β-emitters are less effective on microscopic disease because of radiation dispersion, while longer halflives (e.g., 90Y and 131I) allow favourable therapeutic ratios to be reached in larger tumors. 211At-labelled MoAbs may therefore possibly be used in combination with β-emitting RIC in systemically delivered radioimunnotherapy. Larger tumor nodules are then irradiated effectively due to cross-fire of the longer ranged β-particles while the fraction of tumour cells distributed as single cells and micrometastases may be more effectively radiated with 211At-RIC. 76 refs

  9. Appraising nuclear octupole moment contributions to the hyperfine structures in $^{211}$Fr

    Sahoo, B K

    2015-01-01

    Hyperfine structures of $^{211}$Fr due to the interactions of magnetic dipole ($\\mu$), electric quadrupole ($Q$) and magnetic octupole ($\\Omega$) moments with the electrons are investigated using the relativistic coupled-cluster (RCC) theory with an approximation of singles, doubles and important valence triples excitations in the perturbative approach. Validity of our calculations are substantiated by comparing the results with their available experimental values. Its $Q$ value has also been elevated by combining the measured hyperfine structure constant of the $7p \\ ^2P_{3/2}$ state with our improved calculation. Considering the preliminary value of $\\Omega$ from the nuclear shell-model, its contributions to the hyperfine structures up to the $7d \\ ^2D_{5/2}$ low-lying states in $^{211}$Fr are estimated. Energy splittings of the hyperfine transitions in many states have been assessed to find out suitability to carry out their precise measurements so that $\\Omega$ of $^{211}$Fr can be inferred from them unam...

  10. Selective growth of CdTe on patterned CdTe/Si(211)

    Seldrum, T.; Bommena, R.; Samain, Louise; Sivananthan, S.; Sporken, R.; Dumont, J.

    2008-01-01

    The authors have studied selective growth of cadmium telluride on Si(211) by molecular beam epitaxy (MBE). Patterned substrates were produced by optical lithography of MBE-grown CdTe/As/Si(211). Photoemission microscopy was used as the main tool to study selective growth. This is very powerful because Si or SiO2 can be very easily distinguished from areas covered with even small amounts of CdTe due to contrast from work function differences. It was found that CdTe grows on CdTe without sticki...

  11. 8 CFR 211.3 - Expiration of immigrant visas, reentry permits, refugee travel documents, and Form I-551.

    2010-01-01

    ... permits, refugee travel documents, and Form I-551. 211.3 Section 211.3 Aliens and Nationality DEPARTMENT... Expiration of immigrant visas, reentry permits, refugee travel documents, and Form I-551. An immigrant visa, reentry permit, refugee travel document, or Form I-551 shall be regarded as unexpired if the...

  12. 12 CFR 211.601 - Status of certain offices for purposes of the International Banking Act restrictions on...

    2010-01-01

    ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Status of certain offices for purposes of the International Banking Act restrictions on interstate banking operations. 211.601 Section 211.601 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM INTERNATIONAL...

  13. 21 CFR 211.84 - Testing and approval or rejection of components, drug product containers, and closures.

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Testing and approval or rejection of components, drug product containers, and closures. 211.84 Section 211.84 Food and Drugs FOOD AND DRUG... with filth, insect infestation, or other extraneous adulterant shall be examined against...

  14. 23 CFR 633.211 - Implementation of the Clean Air Act and the Federal Water Pollution Control Act.

    2010-04-01

    ... Pollution Control Act. Pursuant to regulations of the Environmental Protection Agency (40 CFR part 15) implementing requirements with respect to the Clean Air Act and the Federal Water Pollution Control Act are... Water Pollution Control Act. 633.211 Section 633.211 Highways FEDERAL HIGHWAY ADMINISTRATION,...

  15. 25 CFR 211.42 - Annual rentals and expenditures for development on leases other than oil and gas, and geothermal...

    2010-04-01

    ... other than oil and gas, and geothermal resources. 211.42 Section 211.42 Indians BUREAU OF INDIAN AFFAIRS... other than oil and gas, and geothermal resources. (a) Unless otherwise authorized by the Secretary, a lease for minerals other than oil, gas and geothermal resources shall provide for a yearly...

  16. 40 CFR 33.211 - What is the process for appealing or challenging an EPA MBE or WBE certification determination?

    2010-07-01

    ... challenging an EPA MBE or WBE certification determination? 33.211 Section 33.211 Protection of Environment... process for appealing or challenging an EPA MBE or WBE certification determination? (a) An entity which has been denied MBE or WBE certification by EPA OSDBU under § 33.205 or § 33.209 may appeal...

  17. Heteroepitaxy of CdTe on Ge(211)Substrates by Molecular Beam Epitaxy%Ge(211)衬底上分子束外延CdTe薄膜

    李艳辉; 杨春章; 苏栓; 谭英; 高丽华; 赵俊

    2011-01-01

    采用分子束外延在3英寸Ge(211)衬底上生长了10 μm厚的CdTe(211)B薄膜.CdTe表面镜面光亮,3英寸范围厚度平均值9.72 μm,偏差0.3 μm;薄膜晶体质量通过X射线双晶迴摆曲线进行评价,FWHM平均值80.23 arcsec,偏差3.03 arcsec; EPD平均值为4.5×106cm-2.通过研究CdTe薄膜厚度与FWHM和EPD的关系,得到CdTe的理想厚度为8~9 μm.%The 10μm thick CdTe(211)B has been grown by molecular beam epitaxy(MBE) on Ge(211) substrate. The surface morphology of CdTe layers with a diameter of three inches is smooth and mirror-like. The average of thick is 9.72 μm, deviation 0.3 μm; The crystalline quality was measured by an X-ray double-crystal rocking curve, the average is 80.23 arcsec, deviation 3.03 arcsec; The EPD is 4.5 × 106cm -2. We has studied the effects of the thickness onFWHM and EPD for CdTe layer, the optimum thickness of CdTe layer is 8~9 μm.

  18. Preparation of 211At-labeled humanized anti-Tac using 211At produced in disposable internal and external bismuth targets

    These studies describe the production and purification of 211At as well as the procedure for labeling humanized anti-Tac, the antibody to the α-chain of the IL-2 receptor (IL-2Rα), which has been shown to be a useful target for immunotherapy. The optimized protocol combines the advantages of the two-stage dry distillation procedure with the astatination of trialkylstannyl substances as labeling compounds for proteins. The 211At was produced by bombarding either an external or a recently developed disposable internal bismuth target with α-particles from a Cyclotron Corporation CS-30 cyclotron. The 211At was found to contain less than 0.01% 210At. The production rate for the external target was 0.15 mCi ± 0.056 μA-1 h-1 (n = 9) (5.55 MBq μA-1 h-1). The production rate for the internal target was 0.44 ± 0.14 mCi μA-1 h-1 (n = 16) (16.28 MBq μA-1 h-1)

  19. Cytokeratin 19 fragment antigen 21-1 as an independent predictor for definitive chemoradiotherapy sensitivity in esophageal squamous cell carcinoma

    YAN Hong-jiang; WANG Ren-ben; ZHU Kun-li; JIANG Shu-mei; ZHAO Wei; XU Xiao-qing; FENG Rui

    2012-01-01

    Background Patients with esophageal squamous cell carcinoma (ESCC) undergoing definitive chemoradiotherapy (CRT) seem to have a disparity in therapeutic response.The identification of CRT sensitivity-related clinicopathological factors would be helpful for selecting patients most likely to benefit from CRT.Cytokeratin 19 fragment antigen 21-1 (CYFRA21-1) and carcinoembryonic antigen (CEA) have been reported as useful tumor markers for esophageal cancer.The aim of this study was to examine the predictive value of CYFRA21-1 in comparison with CEA and other clinicopathological factors in patients with ESCC treated with definitive CRT.Methods Pretreatment serum CYFRA21-1 and CEA levels were measured by immunoradiometric assays.The relationships between pretreatment clinicopathological factors and the efficacy of CRT were analyzed.Overall survival (OS) was estimated by univariate and multivariate analysis.Results The results from a univariate analysis indicated that the efficacy of CRT was significantly associated with the serum levels of CYFRA21-1 and CEA before treatment (P=0.001 and P=0.023,respectively).It also indicated that the efficacy of CRT was significantly associated with the pretreatment tumor location (P=0.041).By Logistic regression analysis,the independent predictive factor associated with efficacy of CRT was CYFRA21-1 (P=0.002).The OS of the patients with high CYFRA 21-1 levels was worse than that of those with low CYFRA21-1 levels (P=0.001).In multivariate analysis,a low level of CYFRA21-1 was the most significant independent predictor of good OS (P=0.007).Conclusions CEA and tumor location may be useful in predicting the sensitivity of ESCC to CRT.CYFRA21-1 may be an independent predictor for definitive CRT sensitivity in ESCC.

  20. Diagnosis Value of the Detection of CYFRA21-1 in Non-small Cell Lung Cancer

    Jundong GU

    2010-12-01

    Full Text Available Background and objective Cytokeratin-19 fragment (CYFRA21-1 is a soluble protein in serum, and may be a useful circulating tumor marker. The aim of this study is to investigate the diagnostic value of the peripheral blood CYFRA21-1 in non-small cell lung cancer (NSCLC. Methods The levels of peripheral blood CYFRA21-1 were detected in 107 patients with NSCLC and 51 patients with benign pulmonary diseases by enzyme linked immunosorbent assay, and ROC curve was used to analyse the results. Results Singificant difference of peripheral blood CYFRA21-1 levels was detected between the NSCLC group and benign pulmonary disease group (χ2=47.343, P < 0.001. At the threshold of 3.3 ng/mL, sensitivity and specificity of CYFRA21-1 as a serologic marker were 74.77% and 76.47%, respectively for any cancer. ROC curve showed that the under-curve area (AUC of CYFRA21-1 was 0.813 9. There was no significant difference of CYFRA21-1 between subtypes of NSCLC (χ2=0.450, P=0.799. The peripheral blood CYFRA21-1 level was elevated significantly in the patients with extensive disease (IIIb, IV compared with patients with limited disase (I, II, IIIb (χ2=7.057, P=0.008. Conclusion As a tumor marker CYFRA21-1 has relative high sensitivity and specificity for the diagnosis of NSCLC. Elevated peripheral blood CYFRA 21-1 levels were usually indicated extensive disease of NSCLC.

  1. 42 CFR 137.211 - How does a Self-Governance Tribe learn whether self-governance activities have resulted in...

    2010-10-01

    ... 42 Public Health 1 2010-10-01 2010-10-01 false How does a Self-Governance Tribe learn whether self-governance activities have resulted in savings as described in § 137.210. 137.211 Section 137.211 Public... OF HEALTH AND HUMAN SERVICES TRIBAL SELF-GOVERNANCE Operational Provisions Savings § 137.211 How...

  2. A new internal target system for production of 211At on the cyclotron U-120M

    Lebeda, Ondřej; Jiran, Rudolf; Ráliš, Jan; Štursa, Jan

    2005-01-01

    Roč. 63, - (2005), s. 49-53. ISSN 0969-8043 R&D Projects: GA AV ČR KJB4048302 Institutional research plan: CEZ:AV0Z10480505 Keywords : radionuclides production * 211At * cyclotron Subject RIV: CH - Nuclear ; Quantum Chemistry Impact factor: 0.757, year: 2005

  3. Whole genome analysis of Klebsiella pneumoniae T2-1-1 from human oral cavity

    Kok-Gan Chan

    2016-03-01

    Full Text Available Klebsiella pneumoniae T2-1-1 was isolated from the human tongue debris and subjected to whole genome sequencing on HiSeq platform and annotated on RAST. The nucleotide sequence of this genome was deposited into DDBJ/EMBL/GenBank under the accession JAQL00000000.

  4. A study of the wiggle morphology of HH 211 through numerical simulations

    Moraghan, Anthony; Lee, Chin-Fei; Huang, Po-Sheng; Vaidya, Bhargav

    2016-08-01

    Recent high-resolution, high-sensitivity observations of protostellar jets have shown many to possess deviations to their trajectories. HH 211 is one such example where sub-mm observations with the Submillimeter Array (SMA) have revealed a clear reflection-symmetric wiggle. The most likely explanation is that the HH 211 jet source could be moving as part of a protobinary system. Here, we test this assumption by simulating HH 211 through 3D hydrodynamic jet propagation simulations using the PLUTO code with a molecular chemistry and cooling module, and initial conditions based on an analytical model derived from SMA observations. Our results show the reflection-symmetric wiggle can be recreated through the assumption of a jet source perturbed by binary motion at its base, and that a regular sinusoidal velocity variation in the jet beam can be close to matching the observed knot pattern. However, a more complex model with either additional heating from the protostar, or a shorter period velocity pulsation may be required to account for enhanced emission near the source, and weaker knot emission downstream. Position-velocity diagrams along the pulsed jet beam show a complex structure with detectable signatures of knots and show caution must be exercised when interpreting radial velocity profiles through observations. Finally, we make predictions for future HH 211 observations with Atacama Large Millimeter Array.

  5. Astatination of nanoparticles containing silver as possible carriers of 211At

    Lebeda, Ondřej; Kučka, Jan; Hrubý, Martin; Koňák, Čestmír; Kozempel, Ján

    2006-01-01

    Roč. 64, - (2006), s. 201-206. ISSN 0969-8043 R&D Projects: GA AV ČR KJB4048302; GA AV ČR KJB4050408 Institutional research plan: CEZ:AV0Z1048901 Keywords : nanoparticles * 211AT * Atalpha particle therapy Subject RIV: CH - Nuclear ; Quantum Chemistry Impact factor: 0.924, year: 2006

  6. 30 CFR 77.211-1 - Continuous methane monitoring device; installation and operation; automatic deenergization of...

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Continuous methane monitoring device... Installations § 77.211-1 Continuous methane monitoring device; installation and operation; automatic deenergization of electric equipment. Continuous methane monitoring devices shall be set to...

  7. Whole genome analysis of Klebsiella pneumoniae T2-1-1 from human oral cavity

    Kok-Gan Chan; Wai-Fong Yin; Xin-Yue Chan

    2015-01-01

    Klebsiella pneumoniae T2-1-1 was isolated from the human tongue debris and subjected to whole genome sequencing on HiSeq platform and annotated on RAST. The nucleotide sequence of this genome was deposited into DDBJ/EMBL/GenBank under the accession JAQL00000000.

  8. Whole genome analysis of Klebsiella pneumoniae T2-1-1 from human oral cavity.

    Chan, Kok-Gan; Yin, Wai-Fong; Chan, Xin-Yue

    2016-03-01

    Klebsiella pneumoniae T2-1-1 was isolated from the human tongue debris and subjected to whole genome sequencing on HiSeq platform and annotated on RAST. The nucleotide sequence of this genome was deposited into DDBJ/EMBL/GenBank under the accession JAQL00000000. PMID:26981378

  9. 33 CFR 211.9 - Applications for leases, easements, licenses, and permits.

    2010-07-01

    ... WITH CIVIL WORKS PROJECTS Temporary Use by Others of Civil Works Real Estate § 211.9 Applications for leases, easements, licenses, and permits. Applications for use of Civil Works property should be made to the District Engineer of the district within the boundaries of which the real estate is located....

  10. 25 CFR 211.46 - Inspection of premises, books and accounts.

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Inspection of premises, books and accounts. 211.46... premises, books and accounts. Lessees shall allow the Indian mineral owner, the Indian mineral owner's... and submit all related reports required by the lease and applicable regulations. Books and...

  11. Ground state charmed meson spectra for N_f=2+1+1

    Rae, T D

    2015-01-01

    We present a preliminary study of the charmed meson spectra using the electrically neutral subset of the new Budapest-Marseille-Wuppertal N_f=2+1+1 gauge configurations that utilise the 3-HEX smeared clover action. The analysis is performed with a focus on the hyperfine splitting.

  12. 7 CFR 330.211 - Labeling of plant pests for movement under permits.

    2010-01-01

    ... 7 Agriculture 5 2010-01-01 2010-01-01 false Labeling of plant pests for movement under permits... AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE FEDERAL PLANT PEST REGULATIONS; GENERAL; PLANT PESTS; SOIL, STONE, AND QUARRY PRODUCTS; GARBAGE Movement of Plant Pests § 330.211 Labeling...

  13. 76 FR 2605 - Airworthiness Directives; Rolls-Royce plc RB211-Trent 800 Series Turbofan Engines

    2011-01-14

    ... Register published on April 11, 2000 (65 FR 19477-78). Discussion The European Aviation Safety Agency (EASA... Order 12866; 2. Is not a ``significant rule'' under the DOT Regulatory Policies and Procedures (44 FR... Directives; Rolls-Royce plc RB211-Trent 800 Series Turbofan Engines AGENCY: Federal Aviation...

  14. 75 FR 15321 - Airworthiness Directives; Rolls-Royce plc RB211-Trent 800 Series Turbofan Engines

    2010-03-29

    ... Register on January 5, 2010 (75 FR 264). That NPRM proposed to correct an unsafe condition for the... Regulatory Policies and Procedures (44 FR 11034, February 26, 1979); and 3. Will not have a significant...; AD 2010-06-14] RIN 2120-AA64 Airworthiness Directives; Rolls-Royce plc RB211-Trent 800...

  15. 41 CFR 302-3.211 - What is an allowance for overseas tour renewal travel?

    2010-07-01

    ... TYPE Types of Transfers Overseas Tour Renewal Agreement § 302-3.211 What is an allowance for overseas tour renewal travel? An allowance for overseas tour renewal travel is a reimbursement for you and your... 41 Public Contracts and Property Management 4 2010-07-01 2010-07-01 false What is an allowance...

  16. 33 CFR 211.7 - Rights which may be granted by Division and District Engineers.

    2010-07-01

    ..., DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE REAL ESTATE ACTIVITIES OF THE CORPS OF ENGINEERS IN CONNECTION WITH CIVIL WORKS PROJECTS Temporary Use by Others of Civil Works Real Estate § 211.7 Rights which may... to which real estate functions have been or may be assigned are authorized to lease, in the name...

  17. 22 CFR 211.8 - Disposition of commodities unfit for authorized use.

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Disposition of commodities unfit for authorized... COMMODITIES FOR FOOD USE IN DISASTER RELIEF, ECONOMIC DEVELOPMENT AND OTHER ASSISTANCE § 211.8 Disposition of commodities unfit for authorized use. (a) Prior to delivery to cooperating sponsor at discharge port or...

  18. 20 CFR 211.12 - Compensation credited for title VII benefits.

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Compensation credited for title VII benefits... RETIREMENT ACT CREDITABLE RAILROAD COMPENSATION § 211.12 Compensation credited for title VII benefits. Payments made to an employee under title VII of the Regional Rail Reorganization Act of 1973 are...

  19. The clinical utility of a new tumor marker for lung cancer Cyfra 21-1

    Cytokeratins expressed in epithelial cells from respiratory epithelium are also expressed in situ by lung cancers. The Cyfra 21-1 assay is a newly developed test which measures in serum fragments of cytokeratin 19. The aim of our study was to asses the clinical utility of the protein as a marker for lung cancer. We evaluated this marker in 196 patients with lung cancer , 33 patients with being lung diseases and 60 healthy individuals. Significantly higher levels were observed in patients with lung cancer but there was not difference between histological types of lung cancer. Concentration of Cyfra 21-1 significantly correlated with the stage of disease and the highest levels were found in patients with metastases. Consequently the marker was significantly lower in patients who were operated upon when compared with unresectable ones p,0.0001. In addition we observed a correlation between Cyfra 21-1 concentration and survival time. Cyfra 21-1 as a tumor marker is clinically useful especially for NSCLC. (author)

  20. Cyfra 21-1 als Follow-up-Tumormarker bei Patienten mit Plattenepithelkarzinom des Oropharynx

    Alkotyfa, Khaled

    2009-01-01

    Zusammenfassend kann festgestellt werden, dass die Erhebung der Cyfra 21-1- Konzentration im Serum wertvolle Hinweise vor allem hinsichtlich des Vorlegens von Fernmetastasen und Kontrolle des Therapieerfolges sowie des individuellen Krankheitsverlaufes geben kann. Die Resultate der vorliegenden Untersuchung zeigen, dass zum Zeitpunkt der Diagnosestellung keine eindeutige Korrelation zwischen dem Ausmaß der cervikalen Lymphknotenme...

  1. 12 CFR 211.45 - Accounting for fees on international loans.

    2010-01-01

    ... accordance with generally accepted accounting principles. Interpretations ... 12 Banks and Banking 2 2010-01-01 2010-01-01 false Accounting for fees on international loans. 211... Accounting for fees on international loans. (a) Restrictions on fees for restructured international loans....

  2. 5 CFR 847.211 - Death of employee during election opportunity period.

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Death of employee during election... Qualifying Move § 847.211 Death of employee during election opportunity period. (a) When an employee eligible... employee is deemed to have made the election and to be covered, at time of death, by the retirement...

  3. A study of the wiggle morphology of HH 211 through numerical simulations

    Moraghan, Anthony; Lee, Chin-Fei; Huang, Po-Sheng; Vaidya, Bhargav

    2016-05-01

    Recent high-resolution high-sensitivity observations of protostellar jets have shown many to possess deviations to their trajectories. HH 211 is one such example where sub-mm observations with the SMA have revealed a clear reflection-symmetric wiggle. The most likely explanation is that the HH 211 jet source could be moving as part of a protobinary system. Here we test this assumption by simulating HH 211 through 3D hydrodynamic jet propagation simulations using the PLUTO code with a molecular chemistry and cooling module, and initial conditions based on an analytical model derived from SMA observations. Our results show the reflection-symmetric wiggle can be recreated through the assumption of a jet source perturbed by binary motion at its base, and that a regular sinusoidal velocity variation in the jet beam can be close to matching the observed knot pattern. However, a more complex model with either additional heating from the protostar, or a shorter period velocity pulsation may be required to account for enhanced emission near the source, and weaker knot emission downstream. Position velocity diagrams along the pulsed jet beam show a complex structure with detectable signatures of knots and show caution must be exercised when interpreting radial velocity profiles through observations. Finally, we make predictions for future HH 211 observations with ALMA.

  4. 18 CFR 367.2110 - Account 211, Miscellaneous paid-in capital.

    2010-04-01

    ... NATURAL GAS ACT Balance Sheet Chart of Accounts Proprietary Capital § 367.2110 Account 211, Miscellaneous..., Miscellaneous paid-in capital. 367.2110 Section 367.2110 Conservation of Power and Water Resources FEDERAL... ACT OF 2005, FEDERAL POWER ACT AND NATURAL GAS ACT UNIFORM SYSTEM OF ACCOUNTS FOR CENTRALIZED...

  5. 48 CFR 2852.211-70 - Brand-name or equal.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Brand-name or equal. 2852... Forms SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 2852.211-70 Brand-name or equal. As prescribed in 2811.104-70, insert the following clause: Brand-Name or Equal (JAN...

  6. Improving Student Success in Principles of Accounting 211 with the Integration of Situational Leadership Methods.

    Ewell, Paul L.

    2001-01-01

    Looks at the failure rate of students in Accounting 211 in the Virginia Community College System. States that rote teaching styles that do not incorporate interdisciplinary and other diverse methods, do not take into account developing learning skills, and do not encourage active learning are doomed to fail. Makes recommendations for new…

  7. 21 CFR 211.46 - Ventilation, air filtration, air heating and cooling.

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Ventilation, air filtration, air heating and... Buildings and Facilities § 211.46 Ventilation, air filtration, air heating and cooling. (a) Adequate... holding of a drug product. (c) Air filtration systems, including prefilters and particulate matter...

  8. 21 CFR 211.184 - Component, drug product container, closure, and labeling records.

    2010-04-01

    ....84(d), or § 211.122(a)) and the conclusions derived therefrom. (c) An individual inventory record of each component, drug product container, and closure and, for each component, a reconciliation of the use of each lot of such component. The inventory record shall contain sufficient information to...

  9. Whole genome analysis of Klebsiella pneumoniae T2-1-1 from human oral cavity

    Kok-Gan Chan; Wai-Fong Yin; Xin-Yue Chan

    2016-01-01

    Klebsiella pneumoniae T2-1-1 was isolated from the human tongue debris and subjected to whole genome sequencing on HiSeq platform and annotated on RAST. The nucleotide sequence of this genome was deposited into DDBJ/EMBL/GenBank under the accession JAQL00000000.

  10. 211At-Rh(16-S4-diol) complex as a precursor for astatine radiopharmaceuticals

    211At is one of the most promising radionuclides in α-radioimmunotherapy (α-RIT). Unfortunately, biomolecules labeled by direct electrophilic astatination are unstable due to the rapid loss of 211At under both in vitro and in vivo conditions. The present paper describes the results of our studies on attaching At- to the rhodium(III) complex with thioether ligand: 1,5,9,13-etrathiacyclohexadecane-3,11-diol (16-S4-diol). Rh3+ was chosen as a moderately soft metal cation which should form very strong bonds with soft At- anions, but first of all because of the kinetic inertness of low spin rhodium(III) d6 complexes. The 16-S4-diol ligand was selected due to formation of stable complexes with Rh3+. The experiments related to optimization of the reaction conditions were performed with the 131I, basing on a chemical similarity of I- to At-. The experiments with 211At were then carried out under the conditions found optimal for I-. The preliminary results are promising, and indicate a possibility for astatination of biomolecules by using the 211At-Rh(16-S4-diol) complex

  11. Clinical Usefulness of Serum CYFRA 21-1 in Patients with Colorectal Cancer

    Among diverse tumor markers, pretreatment evaluation and follow-up detection of recurrence in colorectal cancer are generally evaluated by serum carcinoembryonic antigen (CEA) levels. However, there have been some reports about the low accuracy and high false-positive results of CEA in colorectal cancer. We investigated the clinical utilities of CYFRA 21-1 by comparing CEA and cancer antigen 19-9 (CA 19-9) in pretreatment and recurrent colorectal cancer. Using a solid-phase immunoradiometric assay, serum levels of CYFRA 21-1, CEA and CA 19-9 were analyzed in 132 patients with primary colorectal cancer, 124 healthy controls, 104 patients with benign colorectal disease and 19 patients with recurrent colorectal cancer. We determined three different cutoff values to evaluate the sensitivity of diagnostic performance in pretreatment and recurrent colorectal cancer. CYFRA 21-1 (≥ 1.13 ng/ml) had a sensitivity of 47 %, compared with 37 % for CEA (≥ 3.05 ng/ml) and 32.6 % for CA 19-9 (≥ 23.1 ng/ml) in the initial staging of primary colorectal cancer. Using different cutoff values, CYFRA 21-1 showed higher sensitivity for pretreatment colorectal cancer than CEA and CA 19-9 in adenocarcinoma and adenosquamous carcinoma of this study. A mildly significant correlative relationship was noted between Dukes' stages and three tumor markers (p<0.01). The areas under the receiver operating characteristic curves of CYFRA 21-1, CEA and CA 19-9 were 0.81±0.03, 0.74±0.03 and 0.62 0.04, respectively, for discriminating colorectal cancer patients from patients with benign colorectal disease. In addition, CYFRA 21-1 was determined as the most sensitive tumor marker for evaluating recurrent colorectal cancer for all cutoff values. This study showed that CYFRA 21-1 could be a useful and dependable tumor marker for pretreatment and recurrent colorectal cancer. Further prospective studies on its usefulness with respect to the prognosis and utility of combined tumor markers are needed

  12. Production of Astatine-211 at the Duke University Medical Center for its regional distribution

    Zalutsky, Michael [Duke University Medical Center, Durham, NC (United States)

    2016-01-01

    Systemic targeted radiation therapy and radioimmunotherapy continue to be important tools in the treatment of certain cancers. Because of their high energy and short path length, alpha particle emitters such as 211At are more effective than either external beam x- ray or in vivo beta radiation in delivering potentially curative doses of radiation. The limited clinical trials that have been conducted to date have yielded encouraging responses in some patients, e.g., malignant brain tumors. In order to escalate the additional necessary research and development in radiochemistry, radiobiology and efficacy evaluation of alpha particle radiotherapeutics, it is universally agreed that access to an affordable, reliable supply of 211At is warranted. In conjunction with the Department of Energy's intent to enhance stable and radioactive isotope availability for research applications, it is the primary objective of this project to improve 211At production and purification capabilities at Duke so that this radionuclide can be supplied to researchers at other institutions throughout the US.The most widely used 211At production method involves the α,2n reaction on Bismuth using a cyclotron with beams ≤ 28 MeV. Yields can be enhanced with use of an internal target that allows for a higher alpha fluence plus efficient heat dissipation in the target. Both of these items are in place at Duke; however, in order to support production for multi-institutional use, irradiation campaigns in excess of 50 µAp and four hours duration will be needed. Further, post-irradiation processing equipment is lacking that will enable the distribution process. Financial support is sought for i) a shielded, ventilated processing/containment hood; ii) development of a post-irradiation target retrieval system; iii) fabrication of a 211At distillation and recovery module and iv) a performance review and, where needed, an enhancement of seven

  13. Hexavalent chromium removal and bioelectricity generation by Ochrobactrum sp. YC211 under different oxygen conditions.

    Chen, Chih-Yu; Cheng, Chiu-Yu; Chen, Ching-Kuo; Hsieh, Min-Chi; Lin, Ssu-Ting; Ho, Kuo-Ying; Li, Jo-Wei; Lin, Chia-Pei; Chung, Ying-Chien

    2016-01-01

    Bioremediation is an environmentally friendly method of reducing heavy metal concentration and toxicity. A chromium-reducing bacterial strain, isolated from the vicinity of an electroplate factory, was identified as Ochrobactrum sp. YC211. The efficiency and capacity per time of Ochrobactrum sp. YC211 for hexavalent chromium (Cr(VI)) removal under anaerobic conditions were superior to those under aerobic conditions. An acceptable removal efficiency (96.5 ± 0.6%) corresponding to 30.2 ± 0.8 mg-Cr (g-dry cell weight-h)(-1) was achieved by Ochrobactrum sp. YC211 at 300 mg L(-1) Cr(VI). A temperature of 30°C and pH 7 were the optimal parameters for Cr(VI) removal. By examining reactivated cells, permeabilized cells, and cell-free extract, we determined that Cr(VI) removal by Ochrobactrum sp. YC211 under anaerobic conditions mainly occurred in the soluble fraction of the cell and can be regarded as an enzymatic reaction. The results also indicated that an Ochrobactrum sp. YC211 microbial fuel cell (MFC) with an anaerobic anode was considerably superior to that with an aerobic anode in bioelectricity generation and Cr(VI) removal. The maximum power density and Cr(VI) removal efficiency of the MFC were 445 ± 3.2 mW m(-2) and 97.2 ± 0.3%, respectively. Additionally, the effects of coexisting ions (Cu(2+), Zn(2+), Ni(2+), SO4(2-), and Cl(-)) in the anolyte on the MFC performance and Cr(VI) removal were nonsignificant (P > 0.05). To our knowledge, this is the first report to compare Cr(VI) removal by different cells and MFC types under aerobic and anaerobic conditions. PMID:26889692

  14. Preparation and in vivo evaluation of a novel stabilized linker for 211At labeling of protein

    Significant improvement of in vivo stability of 211At-labeled radioimmunoconjugates achieved upon employment of a recently reported new linker, succinimidyl N-2-(4-[211At]astatophenethyl)succinamate (SAPS), prompted additional studies of its chemistry. The 211At radiolabeling of succinimidyl N-2-(4-tributylstannylphenethyl)succinamate (1) was noted to decline after storage at -15oC for greater than 6 months. Compound 1 was found to degrade via a ring closure reaction with the formation of N-2-(4-tributylstannylphenethyl)succinimide (3), and a modified procedure for the preparation of 1 was developed. The N-methyl structural analog of 1, succinimidyl N-2-(4-tributylstannylphenethyl)-N-methyl succinamate (SPEMS), was synthesized to investigate the possibility of improving the stability of reagent-protein linkage chemistry. Radiolabeling of SPEMS with 211At generates succinimidyl N-2-(4-[211At]astatophenethyl)-N-methyl succinamate (Methyl-SAPS), with yields being consistent for greater than 1 year. Radiolabelings of 1 and SPEMS with 125I generated succinimidyl N-2-(4-[125I]iodophenethyl)succinamate (SIPS) and succinimidyl N-2-(4-[125I]iodophenethyl)-N-methyl succinamate (Methyl-SIPS), respectively, and showed no decline in yields. Methyl-SAPS, SAPS, Methyl-SIPS and SIPS were conjugated to Herceptin for a comparative assessment in LS-174T xenograft-bearing mice. The conjugates of Herceptin with Methyl-SAPS or Methyl-SIPS demonstrated immunoreactivity equivalent to if not superior to the SAPS and SIPS paired analogs. The in vivo studies also revealed that the N-methyl modification resulted in a superior statinated product

  15. Keratin 19-positive cutaneous squamous cell carcinoma with elevated serum cytokeratin 19 fragment 21-1 level: A case report

    UEDA, MISATO; YASUDA, MICHINORI; SHIBAOKA, YOSHIE; KUROKAWA, ICHIRO; KAKUNO, AYAKO; TSUBURA, AIRO

    2016-01-01

    cytokeratin 19 fragment 21-1 (CYFRA21-1) is a marker of lung cancer useful for evaluating clinical diagnosis and prognosis. To the best of our knowledge, there have been no reports of cutaneous squamous cell carcinoma (SCC) with high levels of CYFRA21-1 to date. We herein report a case of a 79-year-old man with a large subcutaneous tumor of the left shoulder, which was diagnosed as primary cutaneous poorly differentiated SCC. The tumor nests were composed of poorly differentiated atypical squamous cells exhibiting high-grade malignancy and mitotic figures; multinuclear cells were also identified inside lymph vessels. Keratin 19 (K19) was intensely expressed in tumor cells. A significantly elevated level of CYFRA21-1 (33 ng/ml) was observed preoperatively. After surgery, the level of CYFRA21-1 was significantly decreased (from 33 to 5.0 ng/ml). Our case demonstrated that K19-positive primary cutaneous undifferentiated SCC induced high levels of CYFRA21-1 in the serum. Thus, CYFRA 21-1 may be a marker indicative of poorly differentiated cutaneous SCC exhibiting K19 expression.

  16. Fine-Needle Aspirate CYFRA 21-1, an Innovative New Marker for Diagnosis of Axillary Lymph Node Metastasis in Breast Cancer Patients

    Choi, Ji Soo; Han, Kyung Hwa; Kim, Eun-Kyung; Moon, Hee Jung; Yoon, Jung Hyun; Kim, Min Jung

    2015-01-01

    Abstract To compare the value of cytokeratin fragment 21-1 (CYFRA 21-1) concentration in the fine-needle biopsy aspirates (fine needle aspirate [FNA] CYFRA 21-1) with cytopathology of fine-needle aspiration biopsy (FNA cytology) and to assess whether CYFRA 21-1 concentrations from ultrasound-guided fine-needle aspiration biopsy (US-FNAB) specimens (FNA CYFRA 21-1) is not inferior to FNA cytology in the diagnosis of axillary lymph node (ALN) metastasis of breast cancer patients. This study rec...

  17. Diagnosis Value of the Detection of CYFRA21-1 in Non-small Cell Lung Cancer

    Gu, Jundong; Wang, Xinzhuo; Zhao, Hui; Zhu, Siwei; Yanjun WEN; Hongrui XU; LI Li; Jun CHEN; Zhou, Qinghua

    2010-01-01

    Background and objective Cytokeratin-19 fragment (CYFRA21-1) is a soluble protein in serum, and may be a useful circulating tumor marker. The aim of this study is to investigate the diagnostic value of the peripheral blood CYFRA21-1 in non-small cell lung cancer (NSCLC). Methods The levels of peripheral blood CYFRA21-1 were detected in 107 patients with NSCLC and 51 patients with benign pulmonary diseases by enzyme linked immunosorbent assay, and ROC curve was used to analyse the results. Res...

  18. Keratin 19-positive cutaneous squamous cell carcinoma with elevated serum cytokeratin 19 fragment 21-1 level: A case report

    UEDA, MISATO; YASUDA, MICHINORI; SHIBAOKA, YOSHIE; Kurokawa, Ichiro; Kakuno, Ayako; TSUBURA, AIRO

    2016-01-01

    cytokeratin 19 fragment 21-1 (CYFRA21-1) is a marker of lung cancer useful for evaluating clinical diagnosis and prognosis. To the best of our knowledge, there have been no reports of cutaneous squamous cell carcinoma (SCC) with high levels of CYFRA21-1 to date. We herein report a case of a 79-year-old man with a large subcutaneous tumor of the left shoulder, which was diagnosed as primary cutaneous poorly differentiated SCC. The tumor nests were composed of poorly differentiated atypical squ...

  19. ELECTRONIC PROPERTIES OF InSb(211)A,B SURFACES%InSb(211)A,B表面电子结构特性

    贾瑜; 陈国剑; 马丙现; 胡行; 顾华伟; 李新建

    2000-01-01

    采用散射理论的格林函数方法计算了InSb(211)A,B两类表面的电子结构,分别给出了两类表面的表面投影能带结构,分析了各表面态的轨道特性和色散特性;并在此基础上讨论了两类表面的稳定性;计算结果和实验结果定性的相符合.

  20. Cyfra211DT、CEADT结合影像学早期诊断肺癌复发与转移%Cyfra211, Serum CEA Doubling Time and Early Diagnosis of Recurrence and Metastasis of Lung Cancer Imaging Dynamics

    田荣华; 查云飞

    2013-01-01

    Objective To evaluate serum Cyfra211 ,CEA and their doubling time and imaging on recurrence and metastasis of lung cancer early diagnosis. Methods 152 cases of lung cancer patients,two years into three groups according to the condition, stable group 79 examples,recurrence in 31 cases of group, transfer group 42 cases. All objects half year 2-5 times serum Cy-fra211 determination,CEA,at the same time,CEADT Cyfra211DT calculation. The ROC Curve process ROC curves multivariable analysis,and with the single variable ROC curves for comparison,the track two years imaging findings,assessment Cyfra211 ,CEA and doubling time alone detection and four index united detection and imaging diagnosis lung cancer in dynamic changes the value of recurrence and metastasis. Results Cyfra211DT,CEADT in relapse and metastasis were the best for 136 days,the critical value of 153 days, 143 days, 132 days. Relapse and metastasis group Cyfra211,CEA and serum doubling time and stable group sensitivity and specificity were in significant differences. Conclusion Cyfra211DT and CEADT were better than Cyfra211 and serum CEA,four joint detection with imaging dynamic observation was helpful for early diagnosis of recurrence and metastasis.%目的 评价血清Cyfra211、CEA及其倍增时间与影像学动态变化对肺癌复发与转移的早期诊断价值.方法 152例肺癌患者,2年内按病情分为3组,稳定组79例,复发组31例,转移组42例.所有对象半年内2~5次测定血清Cyfra211、CEA,同时计算Cyfra211 DT、CEADT.采用ROC Curve过程进行多变量ROC曲线分析,并且与各单变量ROC曲线做比较,追踪两年内影像学表现,评价应用Cyfra211、CEA及其倍增时间单独检测和四指标联合检测以及影像学动态变化在诊断肺癌复发与转移中的价值.结果 Cyfra211 DT、CEADT在复发和转移中最佳临界值分别为136 d、153 d,143 d,132 d.复发和转移组血清Cyfra211、CEA及其倍增时间与稳定组中灵敏性和特异

  1. Sodium-iodide symporter (NIS)-mediated accumulation of [211At]astatide in NIS-transfected human cancer cells

    The cellular expression of the sodium iodide symporter (NIS) has been shown to confer iodide-concentrating capacity in non-thyroid cell types. We examined the role of NIS in the uptake of the alpha-particle emitting radiohalide [211At]astatide in the UVW human glioma cell line transfected to express NIS. [211At]Astatide uptake is shown to be NIS-dependent, with characteristics similar to [131I]iodide uptake. These studies suggest [211At]astatide as a possible alternative radionuclide to [131I]iodide for NIS-based endoradiotherapy, and provide a model for the study of [211At]astatide behavior at a cellular level

  2. Electron transport and cyclotron resonance in (211)-oriented HgTe--CdTe superlattices

    Hoffman, C.A.; Meyer, J.R.; Wagner, R.J.; Bartoli, F.J. (Naval Research Laboratory, Washington, D. C. 20375 (USA)); Chu, X.; Faurie, J.P. (University of Illinois at Chicago, Chicago, Illinois 60680 (USA)); Ram-Mohan, L.R.; Xie, H. (Worcester Polytechnic Institute, Worcester, Massachusetts 01609 (USA))

    1990-03-01

    We discuss a magnetotransport and magneto-optical investigation of (211)-oriented HgTe--CdTe superlattices. Measurements were performed on seven {ital n}-type samples with well widths in the range 41--125 A and energy gaps between 0 and 128 meV. Both magnetotransport and magneto-optical results give evidence for an additional electron species besides the superlattice electrons and holes usually observed. We show that although these have quasi-two-dimensional character, their mobilities are quite sensitive to the superlattice well thickness. These findings are interpreted in terms of band bending and charge transfer from the CdTe substrate into the superlattice. We also discuss the first theoretical calculations of the band structure for (211)-oriented HgTe--CdTe heterostructures.

  3. Quantitation of 211At in small volumes for evaluation of targeted radiotherapy in animal models

    We have evaluated SPECT and two planar imaging methods, geometric mean (GM) and buildup factor (BF), for their potential to quantitate in vivo 211At distributions in rat spinal subarachnoid spaces using phantom studies. The use of medium-energy collimators and the small diameter (3 mm) of the subarachnoid space complicate quantitation. Net activities from distributions in various backgrounds were obtained using a large region of interest with background subtraction. Results showed quantitation accuracy within 10% for SPECT and BF in low backgrounds increasing to 25% at higher background levels while GM errors ranged from 20 to 45%. We have also obtained images of [211At]astatide distributions, administered intrathecally, in rats

  4. Synthesis of (2-[11C]Methoxy)rotenone, a marker of mitochondrial complex I activity

    Recent studies suggest that defects in the function of the complexes of the electron transport chain might be involved in the pathology of neurological diseases such as mitochondrial encephalopathies, Parkinson's Huntington's and Alzheimer's disease. Rotenone is a potent reversible competitive inhibitor of complex I (NADH-CoQ reductase). To study the possible involvement of complex I in such diseases, we synthesized (2-[11C]methoxy)rotenone by [11C]alkylation of 2-O-desmethyl rotenone methyl enol ether followed by hydrolysis of the enol ether to the ketone using aqueous trifluoroacetic acid. (2-[11C]Methoxy)rotenone was purified by high pressure liquid chromatography (silica gel) and was obtained in 7-10% yields decay corrected to end of bombardment in synthesis times typically shorter than 48 min. Radiochemical purities were over 95% and specific activities averaged 1000 Ci/mmol at end of synthesis

  5. Effect of 211At treating pollen and stigma on generative cells and seed setting of rice

    JinJian-Nan; ChenFang; 等

    1998-01-01

    Low specific radioactivity (7.4kBq/ml) 211At treating pollen and stigma can obviously affect morphological structures and physiological functions of pollen,stigma and ovule or embryo sac cells,and cause injury.Results showed that because of the radiation effects the seed setting rate of rice was decreased,and the development of some embryos were affected and others became abnormal.

  6. Differentialdiagnose beim Lungenkarzinom durch CEA, CYFRA 21-1, NSE und ProGRP

    Gruber, Christine

    2008-01-01

    Es handelt sich um eine bizentrische, retrospektive Studie am Institut für Klinische Chemie am Klinikum Großhadern, München und an der Asklepioslungenfachklinik Gauting. Anhand von insgesamt 2749 Patienten wurde univariat und multivariat analysiert, inwieweit die Tumormarker CEA, CYFRA 21-1, NSE und ProGRP und zusätzlich die Routinelaborparameter eine Hilfestellung sowohl in der Diagnostik und Differentialdiagnostik eines Lungenrundherdes (benigne Lungenerkrankung, primäres Lungenkarzinom, Lu...

  7. An improved synthesis of an 125I and 211At labelled benzamide for melanoma imaging

    Recent studies have indicated that benzamides can exhibit affinity for malignant melanoma and may be exploited diagnostically in the treatment of this cancer. Radioiodinated N-(2-diethylaminoethyl)-3-[123I/131I]iodo-4-methoxybenzamide (*I-IMBA) is a benzamide with promising diagnostic properties. A new synthesis procedure was developed to obtain 125I-IMBA suitable for use in vivo. The assets of the procedure include the use of less toxic reagents and better reproducible results when radiolabelling the precursor. The procedure also facilitates the synthesis of the astatinated N-(2-diethylaminoethyl)-3-[211At]astatine-4-methoxybenzamide (211At-AMBA), a new benzamide with a therapeutic potential. The regiospecific no-carrier-added 125I- and 211At-labeling of the benzamide is performed by demetalation of an organotin precursor. Using tributylstannyl as a leaving group, the radiochemical yield obtained after 15 minutes of reaction was 70 %-90 % for both 125I-IMBA and 211At-AMBA. The labelling was performed in a solution of MeOH:AcOH with NCS as the oxidising agent. The organotin precursor N-(2-diethylaminoethyl)-3-(tri-n-butylstannyl)-4-methoxy-benzamide was synthesized from 3-bromo-4-methoxybenzoic acid, with n-BuLi (2 eq) and Bu3SnCl (1 eq) in THF, giving 3-(tri-n-butylstannyl)-4-methoxybenzoic acid. The amide function was introduced by converting the acid group into an active N-succinimidyl-ester, a good leaving group in the reaction with 2-(diethylamino)ethylamine. The overall yield of the organotin precursor was 65 %

  8. Status of ETMC simulations with Nf=2+1+1 twisted mass fermions

    We present the status of runs performed in the twisted mass formalism with Nf=2+1+1 flavours of dynamical fermions: a degenerate light doublet and a mass split heavy doublet. The procedure for tuning to maximal twist is described as well as the current status of the runs using both thin and stout links. Preliminary results for a few observables obtained on ensembles at maximal twist are given. Finally, a reweighting procedure to tune to maximal twist is described. (orig.)

  9. η,η' mesons in 2+1+1 twisted mass lattice QCD

    The twisted mass formulation of lattice QCD is a framework for simulations with an even number of dynamical quarks which benefits from automatic O(a) improvement. Analysing suitable correlation functions, we focus on the mass splitting between the η and η' meson and related quantities in a setup with 2+1+1 dynamical quarks. In addition to the unitary setup, a different regularization of valence and sea quarks (Osterwalder-Seiler approach) is employed to study the strange quark mass dependence.

  10. Nucleon matrix elements with Nf=2+1+1 maximally twisted fermions

    We present a lattice calculation of nucleon matrix elements using four dynamical flavors using the Nf=2+1+1 maximally twisted mass formulation. The renormalization is performed non-perturbatively in the RI'-MOM scheme. We give results for the vector and axial vector operators with up to one-derivative and put particular emphasis on systematic effects in the calculation of the matrix elements.