WorldWideScience

Sample records for actinium 209

  1. Extraction of actinium with di-(2-ethylhexyl)phosphoric acid from hydrochloric and nitric acid solutions

    The extraction of actinium with HDEHP from Cl- and NO3- systems has been investigated. It was found that extraction of actinium from HCl solutions is much better than from HNO3 solutions. Stability constants of actinium complexes Ac(X-)+2 with Cl- and NO3- ligands were determined. Our results show that the actinium formed less stable complexes with Cl- than with NO3- ligands. 5 refs., 3 figs., 1 tab. (author)

  2. The sorption of polonium, actinium and protactinium onto geological materials

    This paper describes a combined experimental and modeling program of generic sorption studies to increase confidence in the performance assessment for a potential high-level radioactive waste repository in Japan. The sorption of polonium, actinium and protactinium onto geological materials has been investigated. Sorption of these radioelements onto bentonite, tuff and granodiorite from equilibrated de-ionized water was studied under reducing conditions at room temperature. In addition, the sorption of actinium and protactinium was investigated at 60 C. Thermodynamic chemical modeling was carried out to aid interpretation of the results

  3. Separation of Actinium 227 from the uranium minerals

    The purpose of this work was to separate Actinium 227, whose content is 18%, from the mineral carnotite found in Gomez Chihuahua mountain range in Mexico. The mineral before processing is is pre-concentrated and passed, first through anionic exchange resins, later the eluate obtained is passed through cationic resins. The resins were 20-50 MESH QOWEX and 100-200 MESH 50 X 8-20 in some cased 200-400 MESH AG 50W-X8, 1X8 in other cases. The eluates from the ionic exchange were electrodeposited on stainless steel polished disc cathode and platinum electrode as anode; under a current ODF 10mA for 2.5 to 5 hours and of 100mA for .5 of an hour. it was possible to identify the Actinium 227 by means of its descendents, TH-227 and RA-223, through alpha spectroscopy. Due to the radiochemical purity which the electro deposits were obtained the Actinium 227 was low and was not quantitatively determined. A large majority of the members of the natural radioactive series 3 were identified and even alpha energies reported in the literature with very low percentages of non-identified emissions were observed. We conclude that a more precise study is needed concerning ionic exchange and electrodeposit to obtain an Actinium 227 of radiochemical purity. (Author)

  4. Spectroscopic and computational investigation of actinium coordination chemistry.

    Ferrier, Maryline G; Batista, Enrique R; Berg, John M; Birnbaum, Eva R; Cross, Justin N; Engle, Jonathan W; La Pierre, Henry S; Kozimor, Stosh A; Lezama Pacheco, Juan S; Stein, Benjamin W; Stieber, S Chantal E; Wilson, Justin J

    2016-01-01

    Actinium-225 is a promising isotope for targeted-α therapy. Unfortunately, progress in developing chelators for medicinal applications has been hindered by a limited understanding of actinium chemistry. This knowledge gap is primarily associated with handling actinium, as it is highly radioactive and in short supply. Hence, Ac(III) reactivity is often inferred from the lanthanides and minor actinides (that is, Am, Cm), with limited success. Here we overcome these challenges and characterize actinium in HCl solutions using X-ray absorption spectroscopy and molecular dynamics density functional theory. The Ac-Cl and Ac-OH2O distances are measured to be 2.95(3) and 2.59(3) Å, respectively. The X-ray absorption spectroscopy comparisons between Ac(III) and Am(III) in HCl solutions indicate Ac(III) coordinates more inner-sphere Cl(1-) ligands (3.2±1.1) than Am(III) (0.8±0.3). These results imply diverse reactivity for the +3 actinides and highlight the unexpected and unique Ac(III) chemical behaviour. PMID:27531582

  5. Discovery of the actinium, thorium, protactinium, and uranium isotopes

    Fry, C; Thoennessen, M

    2012-01-01

    Currently, 31 actinium, 31 thorium, 28 protactinium, and 23 uranium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  6. Production of high-purity radium-223 from legacy actinium-beryllium neutron sources.

    Soderquist, Chuck Z; McNamara, Bruce K; Fisher, Darrell R

    2012-07-01

    Radium-223 is a short-lived alpha-particle-emitting radionuclide with potential applications in cancer treatment. Research to develop new radiopharmaceuticals employing (223)Ra has been hindered by poor availability due to the small quantities of parent actinium-227 available world-wide. The purpose of this study was to develop innovative and cost-effective methods to obtain high-purity (223)Ra from (227)Ac. We obtained (227)Ac from two surplus actinium-beryllium neutron generators. We retrieved the actinium/beryllium buttons from the sources and dissolved them in a sulfuric-nitric acid solution. A crude actinium solid was recovered from the solution by coprecipitation with thorium fluoride, leaving beryllium in solution. The crude actinium was purified to provide about 40 milligrams of actinium nitrate using anion exchange in methanol-water-nitric acid solution. The purified actinium was then used to generate high-purity (223)Ra. We extracted (223)Ra using anion exchange in a methanol-water-nitric acid solution. After the radium was separated, actinium and thorium were then eluted from the column and dried for interim storage. This single-pass separation produces high purity, carrier-free (223)Ra product, and does not disturb the (227)Ac/(227)Th equilibrium. A high purity, carrier-free (227)Th was also obtained from the actinium using a similar anion exchange in nitric acid. These methods enable efficient production of (223)Ra for research and new alpha-emitter radiopharmaceutical development. PMID:22697483

  7. Radium, thorium, and actinium extraction from seawater using an improved manganese-oxide-coated fiber

    Laboratory experiments were conducted to determine the efficiency with which improved manganese-oxide-coated acrylic fibers extract radium, thorium, and actinium from seawater. Tests were made using surface seawater spiked with 227Ac, 227Th and 223Ra. For sample volumes of approximately 30 liters and flow rates up to 0.5 liters per minute, radium and actinium are removed quantitatively. Approximately 80-95% of the thorium is removed under these same conditions. (Auth.)

  8. At R209

    1977-01-01

    Side view of R209, showing a large muon chamber in front of the Iron toroid magnet. Gunter Feilhauer is looking down from top of the magnet. Ulrich Becker (left), Lars Leistam (right) stand on the floor.

  9. Bi209 alpha activity

    The study for measuring Bi209 alpha activity is presented. Ilford L4 nuclear emulsion pellicles loaded with bismuth citrate to obtain a load of 100 mg/cm3 of dry emulsion, were prepared. Other pellicles were prepared with the same. Ilford L4 gel to estimate the background radiation. To observe 'fading' effect, pellicles loaded with bismuth were submitted to neutrons of high energy, aiming to record recoil proton tracks. The pellicles were confined in nitrogen atmosphere at temperature lower than -100C. The Bi209 experimental half-life was obtained and compared with the estimated theoretical data. (M.C.K.)

  10. Identification of 209Hg

    The new neutron-rich nuclide 209Hg has been identified for the first time. An on-line, gas-thermochromatographic technique was developed for rapidly separating the Hg-element products from 600-MeV 18O+natPb(thick target) reaction system. A special detection arrangement was used in order to detect the weak γ-activities of the neutron-rich Hg isotopes. The half-life of 209Hg was determined to be 35-6+9 s. (orig.)

  11. Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232

    The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces ∼100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 GeV protons

  12. Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232

    Harvey, James T.; Nolen, Jerry; Vandergrift, George; Gomes, Itacil; Kroc, Tom; Horwitz, Phil; McAlister, Dan; Bowers, Del; Sullivan, Vivian; Greene, John

    2011-12-30

    The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces {approx}100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 Ge

  13. Comment: 209 [Taxonomy Icon

    Full Text Available Anopheles stephensi Anopheles stephensi Anopheles_stephensi_L.png 209.png Public Do...main CDC(Centers for Disease Control and Prevention)のimage libraryから(Public Domain) http://phil.cdc.gov/phil/home.asp bando 2010/02/15 14:46:05 2010/02/15 14:49:04 ...

  14. Neutron-Induced Fission of Actinium-227, Protactinium-231 and Neptunium-237: Mass Distribution

    Results of radiochemical studies on the mass distribution in the neutron-induced fission of actinium-227, protactinium-231 and neptunium-237 have been presented. This work has been carried out as part of a programme to determine the mass distribution in the fission of heavy elements as a function of Z and A. All irradiations have been carried out in the core of the swimming-pool type reactor APSARA with cadmium shielding wherever necessary. Relative yields of several fission product nuclides have been obtained by a method involving a comparison of the fission product activities from the respective targets with those formed from uranium-235 simultaneously irradiated. Thermal-neutron fission yields of uranium-235 have been assumed. These results indicate a predominantly asymmetric mass distribution in all the three cases, and also a distinct though small symmetric peak in the case of actinium-227. (author)

  15. A new method for the determination of low-level actinium-227 in geological samples

    We developed a new method for the determination of 227Ac in geological samples. The method uses extraction chromatographic techniques and alpha-spectrometry and is applicable for a range of natural matrices. Here we report on the procedure and results of the analysis of water (fresh and seawater) and rock samples. Water samples were acidified and rock samples underwent total dissolution via acid leaching. A DGA (N,N,N',N'-tetra-n-octyldiglycolamide) extraction chromatographic column was used for the separation of actinium. The actinium fraction was prepared for alpha spectrometric measurement via cerium fluoride micro-precipitation. Recoveries of actinium in water samples were 80 ± 8 % (number of analyses n = 14) and in rock samples 70 ± 12 % (n = 30). The minimum detectable activities (MDA) were 0.017-0.5 Bq kg-1 for both matrices. Rock sample 227Ac activities ranged from 0.17 to 8.3 Bq kg-1 and water sample activities ranged from below MDA values to 14 Bq kg-1of 227Ac. From the analysis of several standard rock and water samples with the method we found very good agreement between our results and certified values. (author)

  16. Analysis of the gamma spectra of the uranium, actinium, and thorium decay series

    Momeni, M.H.

    1981-09-01

    This report describes the identification of radionuclides in the uranium, actinium, and thorium series by analysis of gamma spectra in the energy range of 40 to 1400 keV. Energies and absolute efficiencies for each gamma line were measured by means of a high-resolution germanium detector and compared with those in the literature. A gamma spectroscopy method, which utilizes an on-line computer for deconvolution of spectra, search and identification of each line, and estimation of activity for each radionuclide, was used to analyze soil and uranium tailings, and ore.

  17. Analysis of the gamma spectra of the uranium, actinium, and thorium decay series

    This report describes the identification of radionuclides in the uranium, actinium, and thorium series by analysis of gamma spectra in the energy range of 40 to 1400 keV. Energies and absolute efficiencies for each gamma line were measured by means of a high-resolution germanium detector and compared with those in the literature. A gamma spectroscopy method, which utilizes an on-line computer for deconvolution of spectra, search and identification of each line, and estimation of activity for each radionuclide, was used to analyze soil and uranium tailings, and ore

  18. 48 CFR 209.104 - Standards.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Standards. 209.104 Section 209.104 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF... Standards....

  19. 40 CFR 209.12 - Time.

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Time. 209.12 Section 209.12 Protection... Issued Under Section 11(d) of the Noise Control Act § 209.12 Time. (a) In computing any period of time... period of time begins to run shall not be included, except as otherwise provided. Saturdays, Sundays,...

  20. 40 CFR 240.209-1 - Requirement.

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Requirement. 240.209-1 Section 240.209-1 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES GUIDELINES FOR THE THERMAL PROCESSING OF SOLID WASTES Requirements and Recommended Procedures § 240.209-1...

  1. 49 CFR 209.5 - Service.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Service. 209.5 Section 209.5 Transportation Other... TRANSPORTATION RAILROAD SAFETY ENFORCEMENT PROCEDURES General § 209.5 Service. (a) Each order, notice, or other... mail, except as otherwise provided herein. (b) Service upon a person's duly authorized...

  2. 22 CFR 209.4 - Discrimination prohibited.

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Discrimination prohibited. 209.4 Section 209.4 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT NON-DISCRIMINATION IN FEDERALLY-ASSISTED PROGRAMS... § 209.4 Discrimination prohibited. (a) General. No person in the United States shall, on the grounds...

  3. 7 CFR 20.9 - Records.

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Records. 20.9 Section 20.9 Agriculture Office of the Secretary of Agriculture EXPORT SALES REPORTING REQUIREMENTS § 20.9 Records. Each reporting exporter shall... authorized employees of the United States Department of Agriculture and shall be preserved for three...

  4. 40 CFR 240.209 - Safety.

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Safety. 240.209 Section 240.209 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES GUIDELINES FOR THE THERMAL PROCESSING OF SOLID WASTES Requirements and Recommended Procedures § 240.209 Safety....

  5. 46 CFR 108.209 - Hospital spaces.

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Hospital spaces. 108.209 Section 108.209 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) A-MOBILE OFFSHORE DRILLING UNITS DESIGN AND EQUIPMENT Construction and Arrangement Accommodation Spaces § 108.209 Hospital spaces. (a) Each unit carrying twelve...

  6. 33 CFR 117.209 - Mianus River.

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Mianus River. 117.209 Section 117.209 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Connecticut § 117.209 Mianus River. The draw of the...

  7. 7 CFR 868.209 - Information.

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Information. 868.209 Section 868.209 Agriculture... Application of Standards § 868.209 Information. Requests for the Rice Inspection Handbook, Equipment Handbook, or for information concerning approved devices and procedures, criteria for approved devices,...

  8. 22 CFR 209.6 - Compliance information.

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Compliance information. 209.6 Section 209.6... § 209.6 Compliance information. (a) Cooperation and assistance. The Administrator shall to the fullest... and accurate compliance reports at such times, and in such form and containing such information,...

  9. 40 CFR 20.9 - Cost recovery.

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Cost recovery. 20.9 Section 20.9 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL CERTIFICATION OF FACILITIES § 20.9 Cost... (a)(6) of 26 CFR 1.169-2, the Regional Administrator shall so signify in the notice of...

  10. 42 CFR 59.209 - Civil rights.

    2010-10-01

    ... issued by the Secretary of Health and Human Services with the approval of the President (45 CFR part 80). ... 42 Public Health 1 2010-10-01 2010-10-01 false Civil rights. 59.209 Section 59.209 Public Health... Grants for Family Planning Service Training § 59.209 Civil rights. Attention is called to...

  11. 14 CFR 91.209 - Aircraft lights.

    2010-01-01

    ... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Aircraft lights. 91.209 Section 91.209... Requirements § 91.209 Aircraft lights. No person may: (a) During the period from sunset to sunrise (or, in... or the sun is more than 6 degrees below the horizon)— (1) Operate an aircraft unless it has...

  12. 40 CFR 209.26 - Evidence.

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Evidence. 209.26 Section 209.26... Orders Issued Under Section 11(d) of the Noise Control Act § 209.26 Evidence. (a) The official... record. Evidence may be received at the hearing even though inadmissible under the rules of...

  13. Authorization basis for the 209-E Building

    This Authorization Basis document is one of three documents that constitute the Authorization Basis for the 209-E Building. Per the U.S. Department of Energy, Richland Operations Office (RL) letter 98-WSD-074, this document, the 209-E Building Preliminary Hazards Analysis (WHC-SD-WM-TI-789), and the 209-E Building Safety Evaluation Report (97-WSD-074) constitute the Authorization Basis for the 209-E Building. This Authorization Basis and the associated controls and safety programs will remain in place until safety documentation addressing deactivation of the 209-E Building is developed by the contractor and approved by RL

  14. In-source laser spectroscopy developments at TRILIS—towards spectroscopy on actinium and scandium

    Resonance Ionization Laser Ion Sources (RILIS) have become a versatile tool for production and study of exotic nuclides at Isotope Separator On-Line (ISOL) facilities such as ISAC at TRIUMF. The recent development and addition of a grating tuned spectroscopy laser to the TRIUMF RILIS solid state laser system allows for wide range spectral scans to investigate atomic structures on short lived isotopes, e.g., those from the element actinium, produced in uranium targets at ISAC. In addition, development of new and improved laser ionization schemes for rare isotope production at ISAC is ongoing. Here spectroscopic studies on bound states, Rydberg states and autoionizing (AI) resonances on scandium using the existing off-line capabilities are reported. These results allowed to identify a suitable ionization scheme for scandium via excitation into an autoionizing state at 58,104 cm − 1 which has subsequently been used for ionization of on-line produced exotic scandium isotopes.

  15. 31 CFR 800.209 - Critical technologies.

    2010-07-01

    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Critical technologies. 800.209..., AND TAKEOVERS BY FOREIGN PERSONS Definitions § 800.209 Critical technologies. The term critical technologies means: (a) Defense articles or defense services covered by the United States Munitions List...

  16. 24 CFR 941.209 - Audit.

    2010-04-01

    ... HOUSING DEVELOPMENT PHA Eligibility and Program Requirements § 941.209 Audit. All PHAs that receive funds under this part for the development of low-income housing shall comply with audit requirements in 24 CFR... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Audit. 941.209 Section...

  17. 44 CFR 209.2 - Definitions.

    2010-10-01

    ... project, in accordance with FEMA guidance and using a FEMA-approved methodology. FEMA will review the... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Definitions. 209.2 Section 209.2 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT OF...

  18. Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL

    Raeder, S.; Bastin, B.; Block, M.; Creemers, P.; Delahaye, P.; Ferrer, R.; Fléchard, X.; Franchoo, S.; Ghys, L.; Gaffney, L. P.; Granados, C.; Heinke, R.; Hijazi, L.; Huyse, M.; Kron, T.; Kudryavtsev, Yu.; Laatiaoui, M.; Lecesne, N.; Luton, F.; Moore, I. D.; Martinez, Y.; Mogilevskiy, E.; Naubereit, P.; Piot, J.; Rothe, S.; Savajols, H.; Sels, S.; Sonnenschein, V.; Traykov, E.; Van Beveren, C.; Van den Bergh, P.; Van Duppen, P.; Wendt, K.; Zadvornaya, A.

    2016-06-01

    To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.

  19. 14 CFR 67.209 - Neurologic.

    2010-01-01

    ... Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIRMEN MEDICAL STANDARDS AND CERTIFICATION Second-Class Airman Medical Certificate § 67.209 Neurologic. Neurologic standards for a second-class airman medical certificate are: (a) No established medical history or...

  20. 48 CFR 209.270-4 - Procedures.

    2010-10-01

    ... designation as aviation or ship critical safety items. See additional information at PGI 209.270-4; (2... activity; and (3) Qualify and identify aviation and ship critical safety item suppliers and products. (b... that a prospective contractor or its product meets or can meet the established qualification...

  1. 47 CFR 53.209 - Biennial audit.

    2010-10-01

    ... necessary to ensure compliance with the audit requirements listed in paragraph (b) of this section. If the... independent auditor to take any actions necessary to ensure compliance with the audit requirements in... 47 Telecommunication 3 2010-10-01 2010-10-01 false Biennial audit. 53.209 Section...

  2. 49 CFR 209.133 - Referral for prosecution.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Referral for prosecution. 209.133 Section 209.133... Penalties § 209.133 Referral for prosecution. If an inspector, including a certified state inspector under... case, and if it appears that assessment of a civil penalty would not be an adequate deterrent to...

  3. 46 CFR 153.209 - Bilge pumping systems.

    2010-10-01

    ... 46 Shipping 5 2010-10-01 2010-10-01 false Bilge pumping systems. 153.209 Section 153.209 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) CERTAIN BULK DANGEROUS CARGOES SHIPS CARRYING... Requirements § 153.209 Bilge pumping systems. Bilge pumping systems for cargo pumprooms, slop tanks, and...

  4. 49 CFR 209.131 - Criminal penalties generally.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Criminal penalties generally. 209.131 Section 209... Criminal Penalties § 209.131 Criminal penalties generally. A person who knowingly violates 49 U.S.C. 5104(b... hazardous material transportation law or a regulation, order, special permit, or approval issued...

  5. 46 CFR 69.209 - Calculation of tonnages.

    2010-10-01

    ... 46 Shipping 2 2010-10-01 2010-10-01 false Calculation of tonnages. 69.209 Section 69.209 Shipping... MEASUREMENT OF VESSELS Simplified Measurement System § 69.209 Calculation of tonnages. (a) Gross tonnage. (1... percent of that depth is used for gross tonnage calculations. (b) Net tonnage. (1) For a vessel...

  6. 48 CFR 209.406-2 - Causes for debarment.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Causes for debarment. 209.406-2 Section 209.406-2 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM... 209.406-2 Causes for debarment. (1) Any person shall be considered for debarment if...

  7. 5 CFR 842.209 - Members of Congress.

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Members of Congress. 842.209 Section 842.209 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS (CONTINUED) FEDERAL EMPLOYEES RETIREMENT SYSTEM-BASIC ANNUITY Eligibility § 842.209 Members of Congress....

  8. 33 CFR 209.345 - Water resource policies and authorities.

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Water resource policies and authorities. 209.345 Section 209.345 Navigation and Navigable Waters CORPS OF ENGINEERS, DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE ADMINISTRATIVE PROCEDURE § 209.345 Water resource policies and authorities. Reimbursement for Advance...

  9. 49 CFR 382.209 - Use following an accident.

    2010-10-01

    ... 49 Transportation 5 2010-10-01 2010-10-01 false Use following an accident. 382.209 Section 382.209... ALCOHOL USE AND TESTING Prohibitions § 382.209 Use following an accident. No driver required to take a post-accident alcohol test under § 382.303 shall use alcohol for eight hours following the accident,...

  10. Groundwater seepage from the Ranger uranium mine tailings dam: radioisotopes of radium, thorium and actinium. Supervising Scientist report 106

    Monitoring of bores near the Ranger uranium mine tailings dam has revealed deterioration in water quality in several bores since 1983. In a group of bores to the north of the dam, increases have been observed of up to 500 times for sulphate concentrations and of up to 5 times for 226Ra concentrations. Results are presented here of measurements of members of the uranium, thorium and actinium decay series in borewater samples collected between 1985 and 1993. In particular, measurements of all four naturally-occurring radium isotopes have been used in an investigation of the mechanism of radium concentration changes. For the most seepage-affected bores the major findings of the study include: 228Ra/226Ra 223Ra /226Ra and 224Ra/228Ra ratios all increased over the course of the study; barium concentrations show high seasonal variability, being lower in November than May, but strontium concentrations show a steady increase with time. Calculations show that the groundwater is probably saturated with respect to barite but not with respect to celestite or anglesite; sulphide concentrations are low in comparison with sulphate, and are higher in November than in May; and 227Ac concentrations have increased with time, but do not account for the high 223Ra/226Ra ratios. It is concluded on the basis of these observations that increases in Ra isotope concentrations observed in a number of seepage-affected bores arise from increases in salinity leading to desorption of radium from adsorption sites in the vicinity of the bore rather by direct transport of radium from the tailings. Increased salinity is also causing the observed increases in 227Ac and strontium concentrations, while formation of a barite solid phase in the groundwater is causing the removal of some radium from solution. This is the cause of the increasing radium isotope ratios noted above

  11. Dicty_cDB: VSJ209 [Dicty_cDB

    Full Text Available VS (Link to library) VSJ209 (Link to dictyBase) - - - Contig-U15456-1 VSJ209E (Link to Original ... _1( U60995 |pid:none) Schistosoma mansoni aspartic proteinas ... 172 6e-79 protein update 2009. 3.25 PSORT psg: ...

  12. Dicty_cDB: VFA209 [Dicty_cDB

    Full Text Available VF (Link to library) VFA209 (Link to dictyBase) - - - Contig-U15456-1 VFA209P (Link to Original ... 85_1( EF193385 |pid:none) Musca domestica aspartic proteinas ... 171 1e-75 AB078420_1( AB078420 |pid:none) Brugi ...

  13. 50 CFR 226.209 - Critical habitat for hawksbill turtle.

    2010-10-01

    ... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Critical habitat for hawksbill turtle. 226.209 Section 226.209 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND... Critical habitat for hawksbill turtle. (a) Mona and Monito Islands, Puerto Rico—Waters surrounding...

  14. 7 CFR 761.209 - Loan funds for beginning farmers.

    2010-01-01

    ... 7 Agriculture 7 2010-01-01 2010-01-01 false Loan funds for beginning farmers. 761.209 Section 761... Funds to State Offices § 761.209 Loan funds for beginning farmers. Each fiscal year, the Agency reserves a portion of direct and guaranteed FO and OL loan funds for beginning farmers in accordance...

  15. 21 CFR 209.1 - Scope and purpose.

    2010-04-01

    ... dispensing or administering prescription drug products to inpatients in a hospital or health care facility... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Scope and purpose. 209.1 Section 209.1 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS:...

  16. 8 CFR 209.1 - Adjustment of status of refugees.

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Adjustment of status of refugees. 209.1... STATUS OF REFUGEES AND ALIENS GRANTED ASYLUM § 209.1 Adjustment of status of refugees. The provisions of this section shall provide the sole and exclusive procedure for adjustment of status by a...

  17. 14 CFR 1274.209 - Evaluation and selection.

    2010-01-01

    ...) Technical evaluation. The technical evaluation of proposals may include peer reviews. Because the business... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Evaluation and selection. 1274.209 Section... WITH COMMERCIAL FIRMS Pre-Award Requirements § 1274.209 Evaluation and selection. (a)...

  18. Dicty_cDB: VSK209 [Dicty_cDB

    Full Text Available VS (Link to library) VSK209 (Link to dictyBase) - - - Contig-U15669-1 VSK209P (Link to Original ... .2 T31109( T31109 )myosin III - Atlantic horseshoe crab ... 34 6.2 protein update 2009. 3.26 PSORT psg: 0.81 g ...

  19. 27 CFR 46.209 - Articles in vending machines.

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Articles in vending machines. 46.209 Section 46.209 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY (CONTINUED) TOBACCO MISCELLANEOUS REGULATIONS RELATING TO TOBACCO PRODUCTS AND CIGARETTE PAPERS AND TUBES...

  20. 28 CFR 36.209 - Illegal use of drugs.

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Illegal use of drugs. 36.209 Section 36... PUBLIC ACCOMMODATIONS AND IN COMMERCIAL FACILITIES General Requirements § 36.209 Illegal use of drugs. (a... discrimination against an individual based on that individual's current illegal use of drugs. (2) A...

  1. 33 CFR 209.220 - Flood control regulations.

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Flood control regulations. 209..., DEPARTMENT OF DEFENSE ADMINISTRATIVE PROCEDURE § 209.220 Flood control regulations. (a) Local protection... probable date of transfer. (b) Use of storage allocated for flood control or navigation at...

  2. 33 CFR 209.300 - Flood control regulations.

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Flood control regulations. 209..., DEPARTMENT OF DEFENSE ADMINISTRATIVE PROCEDURE § 209.300 Flood control regulations. (a) Regulations for the... authority contained in Section 3 of the Flood Control Act of June 22, 1936, as amended and supplemented,...

  3. 49 CFR 1540.209 - Fees for security threat assessment.

    2010-10-01

    ... 49 Transportation 9 2010-10-01 2010-10-01 false Fees for security threat assessment. 1540.209...: GENERAL RULES Security Threat Assessments § 1540.209 Fees for security threat assessment. This section describes the payment process for completion of the security threat assessments required under subpart....

  4. 49 CFR 209.109 - Payment of penalty; compromise.

    2010-10-01

    ... the Internet at https://www.pay.gov/paygov/. Instructions for online payment are found on the Web site... 49 Transportation 4 2010-10-01 2010-10-01 false Payment of penalty; compromise. 209.109 Section... Civil Penalties § 209.109 Payment of penalty; compromise. (a) Payment of a civil penalty may be made...

  5. 20 CFR 209.16 - Disposal of payroll records.

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Disposal of payroll records. 209.16 Section... RAILROAD EMPLOYERS' REPORTS AND RESPONSIBILITIES § 209.16 Disposal of payroll records. Employers may dispose of payroll records for periods subsequent to 1936, provided that the payroll records are more...

  6. Radiationless transition probabilities in muonic 209Bi

    The probability for non-radiative (n.r.) excitations in muonic 209Bi was determined from a (μ-, γγ)-measurement by comparing the intensities of muonic X-ray transitions in single and coincidence spectra. The values of Pn.r.(3p→1s)=(17.9±2.0)% and Pn.r.(3d→1s)=(3.0±2.2)% were measured for the first time. The strength of the n.r. decay of the 2p-level was found to be (4.2±2.2)%. The n.r. transition probabilities of two subcomplexes of the (2p→1s)-transition leading to different mean excitation energies are (3.2±1.8)% and (5.0±2.0)%, respectively. (orig.)

  7. [Survival after gastrectomy for cancer. 209 cases].

    Le Treut, Y P; Capobianco, C; Botti, G; Christophe, M; Lebreuil, G; Bricot, R

    1992-09-26

    The long-term results of 209 gastrectomies performed for adenocarcinoma, including 117 which were prospectively collected, are presented. Resection was curative in 154 cases (73.6 percent). The TNM distribution of the tumours was: stage I (TxNOMO) 75 cases, stage II (TxN1MO) 46 cases, stage III (TxN2MO) 33 cases and stage IV (TxNxM1) 55 cases. Lymph node involvement was more frequent in the prospective than in the retrospective study. With a more than 5 years' follow-up of 80 percent of the patients operated upon, the actuarial survival rate at 5 years (operative mortality included) was 38 percent for all lesions, 52 percent for curative resection and 2 percent for palliative resection. Following curative resection, the survival rates for tumours of the upper, middle and lower thirds of the stomach were 40, 60 and 55 percent respectively. These rates were 60 percent for stage I tumours, 54 percent for stage II tumours and 25 percent for stage III tumours. The results obtained in this series, where most of the curative gastrectomies included excision of N1 and N2 lymph nodes, show that lymph node involvement has no significant importance for the prognosis when it is proximal (N1) and is not incompatible with prolonged survival when it is pedicular (N2). PMID:1465364

  8. Underground research laboratory room 209 instrument array

    An in situ excavation response test was conducted at the Canadian Underground Research Laboratory (URL) in conjunction with excavation of a tunnel (Room 209) through a near-vertical water-bearing fracture oriented almost perpendicular to the tunnel axis. Encountering a fracture with such desirable characteristics provided a unique opportunity during construction of the URL to try out instrumentation and analytical methods for use in the Excavation Response Experiment (ERE), one of the major URL experiments. This is the first of four reports that cover the excavation response test. This report contains the information provided to the numerical modelling groups before the start of excavation. It includes survey information of the excavations within 30 m of the instrument array; the layout of the instrument array; details of the geology, rock properties, joint characteristics, in situ stresses, and in situ rock temperature distribution; the results of hydrogeological testing and monitoring; the planned excavation sequence; and the format for the modellers to present their results to facilitate easy comparison with the measured responses. Includes 13 excavation charts in back pocket

  9. Dicty_cDB: SSH209 [Dicty_cDB

    Full Text Available g factor A genes, complete cds; and hypothetical translation initiation factor IF-2 gen...AF308672 |AF308672.1 Cowdria ruminantium clone 23hw hypothetical transmembrane protein and hypothetical ribosome-bindin...SS (Link to library) SSH209 (Link to dictyBase) - - - Contig-U05323-1 SSH209F (Link to Original site...ctyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U05323-1 Original site URL http://dict...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSH2-A/SSH209Q.Seq.d/ Representative seq. ID SSH209F (Link to Original site

  10. A biokinetic study of {sup 209}Po in man

    Henricsson, C.F.; Ranebo, Y. [Department of Medical Radiation Physics, Clinical Sciences in Lund, Lund University, Skane University Hospital in Lund (Sweden); Hansson, M. [Medical Radiation Physics, Department of Clinical Sciences in Malmoe, Lund University, Skane University Hospital in Malmoe (Sweden); Raeaef, C.L., E-mail: Christopher.Raaf@med.lu.se [Medical Radiation Physics, Department of Clinical Sciences in Malmoe, Lund University, Skane University Hospital in Malmoe (Sweden); Holm, E. [Norwegian Radiation Protection Authority, Osteras (Norway)

    2012-10-15

    Five adult volunteers participated in a biokinetic study of radioactive polonium. Portions of about 10 Bq of {sup 209}Po were orally administrated to four of the volunteers in a single ingestion. The fifth volunteer ingested a daily amount of 53 mBq of 209Po for 243 d to study the time to achieve equilibrium between intake and excretion for protracted intakes. For the subjects ingesting single intakes of {sup 209}Po complete sampling of urine and feces was subsequently collected the first few days upon the ingestion. The samples were processed with radiochemical extraction and analyzed with alpha spectrometry. In the study, the maximum daily excretion rates in feces were 18-50% of the ingested activity, observed within 3 d after intake. Regarding the urine excretion, the daily excretion peaked, on average, at 0.15-1% of the ingested activity within two days upon intake. These results indicate an average gastro-intestinal uptake fraction of 0.46 {+-} 0.08, which agrees well with earlier biokinetic studies of polonium in man. -- Highlights: Black-Right-Pointing-Pointer Human metabolism of an oral intake of polonium. Black-Right-Pointing-Pointer 4 individuals were administrated about 10 Bq polonium-209. Black-Right-Pointing-Pointer Gastro-intestinal uptake fraction, if orally administrated polonium-209 was investigated. Black-Right-Pointing-Pointer The biological half-time of polonium in human body was studied.

  11. The continuum shell-model neutron states of 209Pb

    Ramendra Nath Majumdar

    2003-12-01

    The neutron strength distributions of the three high-spin 117/2, 2ℎ11/2 and 113/2 states of 209Pb have been obtained within the formalism of the core-polarisation effect where the effect of interaction of the neutron shell-model states of 209Pb with the collective vibrational states (originating also from the giant resonances) have been taken into consideration. The theoretical results have been discussed in the light of works on 117/2, 2ℎ11/2 and 113/2 neutron orbitals of 209Pb. The shell-model energies of the neutron states have been obtained by Skyrme–Hartree–Fock method.

  12. 48 CFR 3052.209-72 - Organizational conflict of interest.

    2010-10-01

    ... CONTRACT CLAUSES Text of Provisions and Clauses 3052.209-72 Organizational conflict of interest. As prescribed in (HSAR) 48 CFR 3009.507-1, insert the following provision: Organizational Conflict of Interest... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Organizational conflict...

  13. 48 CFR 3452.209-70 - Organizational conflict of interest.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Organizational conflict of... Clauses 3452.209-70 Organizational conflict of interest. As prescribed in 3409.570, insert the following provision in all certifications: Organizational Conflict of Interest (OCT 1987) The offeror certifies...

  14. Engineering study for closure of 209E facility

    This document is an engineering study for evaluating alternatives to determine the most cost effective closure plan for the 209E Facility, Critical Mass Laboratory. This laboratory is located in the 200 East Area of the Hanford Site and contains a Critical Assembly Room and a Mix room were criticality experiments were once performed

  15. 40 CFR 209.19 - Informal settlement and consent agreement.

    2010-07-01

    ... ABATEMENT PROGRAMS RULES OF PRACTICE GOVERNING PROCEEDINGS UNDER THE NOISE CONTROL ACT OF 1972 Rules of Practice Governing Hearings for Orders Issued Under Section 11(d) of the Noise Control Act § 209.19...) admits the jurisdictional allegations of the complaint; (2) admits the facts as stipulated in the...

  16. 7 CFR 400.209 - Electronic transmission and receiving system.

    2010-01-01

    ... Contract-Standards for Approval § 400.209 Electronic transmission and receiving system. Any Contractor under the Contract is required to: (a) Adopt a plan for the purpose of transmitting and receiving... 7 Agriculture 6 2010-01-01 2010-01-01 false Electronic transmission and receiving system....

  17. 27 CFR 27.209 - Used liquor bottles.

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Used liquor bottles. 27..., DEPARTMENT OF THE TREASURY LIQUORS IMPORTATION OF DISTILLED SPIRITS, WINES, AND BEER Requirements for Liquor Bottles § 27.209 Used liquor bottles. The appropriate TTB officer may pursuant to letterhead...

  18. 48 CFR 952.209-72 - Organizational conflicts of interest.

    2010-10-01

    ....209-72 Organizational conflicts of interest. As prescribed at 48 CFR 909.507-2, insert the following... (Contracting Officer see 48 CFR 909.507-2 and enter specific term) years after the completion of this contract... facts required to be disclosed or the existence of an actual or potential organizational conflict...

  19. 49 CFR 209.11 - Request for confidential treatment.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Request for confidential treatment. 209.11 Section... confidential treatment. (a) This section governs the procedures for requesting confidential treatment of any... documents required to be submitted by FRA regulations, and all investigative and compliance activities,...

  20. 41 CFR 101-6.209-1 - Cooperation and assistance.

    2010-07-01

    ... 41 Public Contracts and Property Management 2 2010-07-01 2010-07-01 true Cooperation and...-Nondiscrimination in Programs Receiving Federal Financial Assistance § 101-6.209-1 Cooperation and assistance. Each responsible GSA official shall to the fullest extent practicable seek the cooperation of recipients...

  1. 40 CFR 209.2 - Use of number and gender.

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Use of number and gender. 209.2... gender. In these rules of practice, words in the singular number apply to the plural and words in the masculine gender apply to the feminine and vice versa....

  2. 15 CFR 971.209 - Processing outside the United States.

    2010-01-01

    ... 15 Commerce and Foreign Trade 3 2010-01-01 2010-01-01 false Processing outside the United States... Applications Contents § 971.209 Processing outside the United States. (a) Except as provided in this section and § 971.408, the processing of hard minerals recovered pursuant to a permit shall be...

  3. 48 CFR 14.209 - Cancellation of invitations before opening.

    2010-10-01

    ... REGULATION CONTRACTING METHODS AND CONTRACT TYPES SEALED BIDDING Solicitation of Bids 14.209 Cancellation of... invitation is desirable. (b) When an invitation issued other than electronically is cancelled, bids that have... prospective bidders to whom invitations were issued. When an invitation issued electronically is cancelled,...

  4. 9 CFR 113.209 - Rabies Vaccine, Killed Virus.

    2010-01-01

    ... 5 U.S.C. 552(a) and 1 CFR part 51. Copies may be obtained from the World Health Organization... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Rabies Vaccine, Killed Virus. 113.209... AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD...

  5. 12 CFR 209.3 - Cancellation of Reserve Bank stock.

    2010-01-01

    ... Section 209.3 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM... the Federal Reserve System, voluntarily liquidates or ceases business, is merged or consolidated into... by a state member bank, a vote to place a member bank in voluntary liquidation, or the appointment...

  6. 40 CFR 209.23 - Trade secrets and privileged information.

    2010-07-01

    ... administrative law judge shall preserve the confidentiality of trade secrets and other privileged commercial and... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Trade secrets and privileged... Practice Governing Hearings for Orders Issued Under Section 11(d) of the Noise Control Act § 209.23...

  7. 41 CFR 101-27.209 - Utilization and distribution of shelf-life items.

    2010-07-01

    ... distribution of shelf-life items. 101-27.209 Section 101-27.209 Public Contracts and Property Management... PROCUREMENT 27-INVENTORY MANAGEMENT 27.2-Management of Shelf-Life Materials § 101-27.209 Utilization and distribution of shelf-life items. Where it is determined that specified quantities of both Type I and Type...

  8. 41 CFR 101-6.209-3 - Access to sources of information.

    2010-07-01

    ... information. 101-6.209-3 Section 101-6.209-3 Public Contracts and Property Management Federal Property...-Nondiscrimination in Programs Receiving Federal Financial Assistance § 101-6.209-3 Access to sources of information... business hours to such of its books, records, accounts, and other sources of information, and...

  9. 33 CFR 209.230 - Use of reservoir areas for recreation.

    2010-07-01

    ... in 36 CFR parts 311 to 326. Licenses and leases are granted under the law containing conditions and... recreation. 209.230 Section 209.230 Navigation and Navigable Waters CORPS OF ENGINEERS, DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE ADMINISTRATIVE PROCEDURE § 209.230 Use of reservoir areas for...

  10. 8 CFR 209.2 - Adjustment of status of alien granted asylum.

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Adjustment of status of alien granted asylum. 209.2 Section 209.2 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS ADJUSTMENT OF STATUS OF REFUGEES AND ALIENS GRANTED ASYLUM § 209.2 Adjustment of status of...

  11. 24 CFR 570.209 - Guidelines for evaluating and selecting economic development projects.

    2010-04-01

    ... selecting economic development projects. 570.209 Section 570.209 Housing and Urban Development Regulations... DEVELOPMENT BLOCK GRANTS Eligible Activities § 570.209 Guidelines for evaluating and selecting economic... activities to be carried out for economic development purposes. Specifically, these guidelines are...

  12. 48 CFR 1414.209-70 - Examination of records by the Department of the Interior.

    2010-10-01

    ... the Department of the Interior. 1414.209-70 Section 1414.209-70 Federal Acquisition Regulations System DEPARTMENT OF THE INTERIOR CONTRACTING METHODS AND CONTRACT TYPES CONTRACTING BY NEGOTIATION Solicitation and Receipt of Proposals and Information 1414.209-70 Examination of records by the Department of the...

  13. 49 CFR 180.209 - Requirements for requalification of specification cylinders.

    2010-10-01

    ... cylinders. 180.209 Section 180.209 Transportation Other Regulations Relating to Transportation PIPELINE AND... CONTINUING QUALIFICATION AND MAINTENANCE OF PACKAGINGS Qualification, Maintenance and Use of Cylinders § 180.209 Requirements for requalification of specification cylinders. (a) Periodic qualification...

  14. Multinucleon photonuclear reactions on {sup 209}Bi: Experiment and evaluation

    Belyshev, S.S.; Kurilik, A.S. [Lomonosov Moscow State University, Department of Physics, Moscow (Russian Federation); Filipescu, D.M.; Tesileanu, O. [Extreme Light Infrastructure - Nuclear Physics/Horia Hulubei National Institute for R and D in Physics and Nuclear Engineering, Bucharest-Magurele (Romania); Gheoghe, I. [Extreme Light Infrastructure - Nuclear Physics/Horia Hulubei National Institute for R and D in Physics and Nuclear Engineering, Bucharest-Magurele (Romania); University of Bucharest, Faculty of Physics, Bucharest-Magurele (Romania); Ishkhanov, B.S. [Lomonosov Moscow State University, Department of Physics, Moscow (Russian Federation); Skobeltsyn Institute of Nuclear Physics, Lomonosov Moscow State University, Moscow (Russian Federation); Khankin, V.V.; Kuznetsov, A.A.; Orlin, V.N.; Peskov, N.N.; Stopani, K.A.; Varlamov, V.V. [Skobeltsyn Institute of Nuclear Physics, Lomonosov Moscow State University, Moscow (Russian Federation)

    2015-06-15

    Photon activation technique using bremsstrahlug with end-point energy 55.6 MeV is used to induce photonuclear reactions in a {sup 209}Bi target. Absolute yields and integrated cross sections of multiparticle reactions (γ, 2n-6n), (γ, 4n1p), and (γ, 5n1p) are obtained. The results are compared to predictions of statistical models using systematical and microscopic description of photoabsorption and to the result of evaluation of the partial photoneutron reaction cross sections. Based on a comparison with existing experimental photoneutron cross sections and model calculations, we make a conclusion that neutron multiplicity assignment in available photoneutron cross sections on {sup 209}Bi can be corrected and evaluated cross sections of (γ, 1n) and (γ, 2n) are obtained that are in an agreement with the obtained experimental results. (orig.)

  15. 209-E Building -- Response to ventilation failure evaluation

    This document provides an evaluation and recommendations for radiological workplace air monitoring and response to ventilation failure for the Critical Mass Laboratory, 209-E Building. The Critical Mass Laboratory, part of the 209-E Building, was designed to provide a heavily shielded room where plutonium and uranium liquid solutions could be brought into various critical configurations under readily controlled and monitored conditions. The facility is contained within a one-story L-shaped concrete block and reinforced concrete building. One wing houses offices, a control room, shops, and a common area while the other wing includes an equipment room, the change room, work areas, and the two-story Critical Assembly Room (CAR). Three of the rooms contain radiologically contaminated equipment and materials

  16. Breeding of New Maize Cultivar Danyu 209%玉米杂交种丹玉209的选育

    陈晓旭; 岳辉; 王作英; 鲁俊田; 陈丽; 刘日尊; 左青

    2015-01-01

    丹玉209是丹东农业科学院、辽宁丹玉种业科技股份有限公司于2009年选育的中熟玉米品种。以玉米自交系 R88为母本,以自交系 L34为父本杂交组配而成的玉米杂交种,该杂交种具有高产、优质、抗倒伏、抗叶斑病和适应性广等特点。适应在辽宁省春播玉米区种植。种植密度适宜在5.25万株~6万株/ hm2。%Corn hybrid cultivar Danyu 209 was developed by Dan Dong Academy of Agricultural Sciences of Liaoning Province and Liaoning Danyu Seed Science and Technology Co. ,Ltd. Using inbred line R88 as fe-male parent and the L34 as male parent . According to the variety production test ,Danyu 209 has the charac-teristics of high yield,good quality,muli-resistance and wide adaptation. The variety is suitable for direct see-ding in spring in Liaoning province . The density of the variety was up to 52 500 plants / hm 2 ~ 60 000 plants /hm2 .

  17. Toxic effects of decabromodiphenyl ether (BDE-209 on human embryonic kidney cells

    Min eLi

    2014-05-01

    Full Text Available Polybrominated diphenyl ethers (PBDEs are widely used as flame-retardant additives in consumer and household products and can escape into the environment over time. PBDEs have become a global environmental organic pollutant due to the properties of persistence, toxicity, and bioaccumulation. The well-studied toxic effects of PBDEs mainly include thyroid hormone disruption and neurotoxicity. There is no consistent conclusions on the carcinogenic potential of PBDEs to date. Here, we explored the toxic effects of BDE-209 on human embryonic kidney cells (HEK293T. The comparison of the gene expression profiles of HEK293T cells with BDE-209 treatment and the negative control found that BDE-209 exposure may alter nucleosome organization through significantly changing the expression of histone gene clusters. The remodeled chromatin structure could further disturb systemic lupus erythematosus as one of the toxic effects of BDE-209. Additionally, gene sets of different cancer modules are positively correlated with BDE-209 exposure. This suggests that BDE-209 has carcinogenic potential for a variety of tumors. Collectively, BDE-209 has a broader toxicity not limited to disruption of thyroid hormone-related biological processes. Notably, the toxic effects of BDE-209 dissolved in dimethyl sulfoxide (DMSO is not the simply additive effects of BDE-209 and DMSO alone.

  18. The internal barriers of rotation for the 209 polychlorinated biphenyls.

    Andersson, P L; Haglund, P; Tysklind, M

    1997-01-01

    The internal barrier of rotation (Erot) was calculated for all 209 polychlorinated biphenyls (PCBs) by using a semi-empirical method, viz. the Austin Model 1 (AMI) Hamiltonian. The difference in total energy between a forced planar state and an optimised twisted structure was defined as Erot. The Erot values were in the range of 8.33 to 483 kJ/mol, and were significantly influenced by the number of chlorine atoms in ortho position. An additional structural characteristic of the PCBs influencing Erot of ortho substituted congeners was substitution by chlorine atoms in vicinal meta positions, which is assumed to prevent outward bending of ortho substituents. This so-called buttressing effect contributed with 4 to 31 kJ/mol per added chlorine atom. In conclusion, the internal barrier of rotation, calculated for all 209 PCBs, provides an important structure dependent physico-chemical parameter for multivariate modelling of future quantitative structure-activity and structure-property relationships (QSARs/QSPRs). PMID:19005788

  19. New measurement of neutron capture resonances of 209Bi

    Domingo-Pardo, C; Abbondanno, U; Aerts, G; Alvarez-Pol, H; Alvarez-Velarde, F; Andriamonje, Samuel A; Andrzejewski, J; Assimakopoulos, Panayiotis; Audouin, L; Badurek, G; Baumann, P; Becvar, F; Berthoumieux, E; Calviño, F; Cano-Ott, D; Capote, R; Carrillode Albornoz, A; Cennini, P; Chepel, V; Chiaveri, Enrico; Colonna, N; Cortés, G; Couture, A; Cox, J; Dahlfors, M; David, S; Dillman, I; Dolfini, R; Dridi, W; Durán, I; Eleftheriadis, C; Embid-Segura, M; Ferrant, L; Ferrari, A; Ferreira-Marques, R; Fitzpatrick, L; Frais-Kölbl, H; Fujii, K; Furman, W; Gallino, R; Gonçalves, I; Gonzalez-Romero, E; Goverdovski, A; Gramegna, F; Griesmayer, E; Guerrero, C; Gunsing, F; Haas, B; Haight, R; Heil, M; Herrera-Martínez, A; Igashira, M; Isaev, S; Jericha, E; Kadi, Y; Kappeler, F; Karamanis, D; Karadimos, D; Kerveno, M; Ketlerov, V; Köhler, P; Konovalov, V; Kossionides, E; Krticka, M; Lamboudis, C; Leeb, H; Lindote, A; Lopes, I; Lozano, M; Lukic, S; Marganiec, J; Marques, L; Marrone, S; Mastinu, P; Mengoni, A; Milazzo, P M; Moreau, C; Mosconi, M; Neves, F; Oberhummer, Heinz; Oshima, M; O'Brien, S; Pancin, J; Papachristodoulou, C; Papadopoulos, C; Paradela, C; Patronis, N; Pavlik, A; Pavlopoulos, P; Perrot, L; Plag, R; Plompen, A; Plukis, A; Poch, A; Pretel, C; Quesada, J; Rauscher, T; Reifarth, R; Rosetti, M; Rubbia, Carlo; Rudolf, G; Rullhusen, P; Salgado, J; Sarchiapone, L; Savvidis, I; Stéphan, C; Tagliente, G; Taín, J L; Tassan-Got, L; Tavora, L; Terlizzi, R; Vannini, G; Vaz, P; Ventura, A; Villamarín, D; Vincente, M C; Vlachoudis, V; Vlastou, R; Voss, F; Walter, S; Wendler, H; Wiescher, M; Wisshak, K

    2006-01-01

    The neutron capture cross section of Bi209 has been measured at the CERN n TOF facility by employing the pulse-height-weighting technique. Improvements over previous measurements are mainly because of an optimized detection system, which led to a practically negligible neutron sensitivity. Additional experimental sources of systematic error, such as the electronic threshold in the detectors, summing of gamma-rays, internal electron conversion, and the isomeric state in bismuth, have been taken into account. Gamma-ray absorption effects inside the sample have been corrected by employing a nonpolynomial weighting function. Because Bi209 is the last stable isotope in the reaction path of the stellar s-process, the Maxwellian averaged capture cross section is important for the recycling of the reaction flow by alpha-decays. In the relevant stellar range of thermal energies between kT=5 and 8 keV our new capture rate is about 16% higher than the presently accepted value used for nucleosynthesis calculations. At th...

  20. Galaxy Evolution in the Environment of ABCG 209

    Haines, C P; Merluzzi, P; La Barbera, F; Massarotti, M; Busarello, G; Girardi, M

    2004-01-01

    We examine the environmental effects on the photometric properties of galaxies for the rich galaxy cluster ABCG 209 at z=0.209. We use archive CFHT optical imaging of a 42'x28' field centred on the cluster to produce a galaxy sample complete to B=25.0 and R=24.5. Both the composite and red sequence galaxy luminosity functions are found to be dependent on the local galaxy surface density, their faint-end slopes becoming shallower with increasing density. We explain this as a combination of the morphology-density relation, and dwarf galaxies being cannibalised and/or disrupted by the cD galaxy and the ICM in the cluster core. The B-R colour of the red sequence itself appears 0.02mag redder for the highest-density regions, indicative of their stellar populations being marginally (<5%) older or (<20%) more metal-rich. This may be due to the galaxies themselves forming earliest in the rarest overdensities marked by rich clusters, or their star-formation being suppressed earliest by the ICM.

  1. The Effects of Proposition 209 on California: Higher Education, Public Employment, and Contracting

    Geshekter, Charles L.

    2008-01-01

    In 1996, Californians overwhelmingly approved Proposition 209, which prohibited all state agencies from discriminating on the basis of race, ethnicity, or gender in university admissions, public employment, or competition for a state contract. Opponents of Proposition 209 predicted dire consequences for California's ethnic minorities and women if…

  2. 33 CFR 209.180 - Temporary closure of waterway to navigation.

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Temporary closure of waterway to navigation. 209.180 Section 209.180 Navigation and Navigable Waters CORPS OF ENGINEERS, DEPARTMENT OF THE... navigation. (a) When an application is received for the temporary closure of a waterway for the...

  3. Aerobic degradation of BDE-209 by Enterococcus casseliflavus: Isolation, identification and cell changes during degradation process.

    Tang, Shaoyu; Yin, Hua; Chen, Shuona; Peng, Hui; Chang, Jingjing; Liu, Zehua; Dang, Zhi

    2016-05-01

    Decabromodiphenyl ether (BDE-209) is one of the most commonly used brominated flame retardants that have contaminated the environment worldwide. Microbial bioremediation has been considered as an effective technique to remove these sorts of persistent organic pollutants. Enterococcus casseliflavus, a gram-positive bacterium capable of aerobically transforming BDE-209, was isolated by our team from sediments in Guiyu, an e-waste dismantling area in Guangdong Province, China. To promote microbial bioremediation of BDE-209 and elucidate the mechanism behind its aerobic degradation, the effects of BDE-209 on the cell changes of E. casseliflavus were examined in this study. The experimental results demonstrated that the high cell surface hydrophobicity (CSH) of E. casseliflavus made the bacteria absorb hydrophobic BDE-209 more easily. E. casseliflavus responded to BDE-209 stress, resulting in an increase in cell membrane permeability and accumulation of BDE-209 inside the cell. The differential expression of intracellular protein was analyzed through two-dimensional gel electrophoresis (2-DE). More than 50 differentially expressed protein spots were reproducibly detected, including 25 up, and 25 down regulated after a 4 days exposure. Moreover, the apoptotic-like cell changes were observed during E. casseliflavus mediated degradation of BDE-209 by means of flow cytometry. PMID:26852209

  4. Evaluation and calculation of photonuclear reaction data for 209Bi below 30 MeV

    Based on available experimental data of neutron and photonuclear reaction, both neutron optical potential parameter and giant resonance parameters of gamma for 209Bi were obtained. The photonuclear reaction data for 209Bi were calculated, compared with experimental data and recommended below 30 MeV

  5. 31 CFR 560.209 - Prohibited transactions with respect to the development of Iranian petroleum resources.

    2010-07-01

    ... to the development of Iranian petroleum resources. 560.209 Section 560.209 Money and Finance... respect to the development of Iranian petroleum resources. Except as otherwise authorized, and... development of petroleum resources located in Iran, or (2) A guaranty of another person's performance...

  6. 29 CFR 778.209 - Method of inclusion of bonus in regular rate.

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Method of inclusion of bonus in regular rate. 778.209... LABOR STATEMENTS OF GENERAL POLICY OR INTERPRETATION NOT DIRECTLY RELATED TO REGULATIONS OVERTIME COMPENSATION Payments That May Be Excluded From the âRegular Rateâ Bonuses § 778.209 Method of inclusion...

  7. 33 CFR 209.320 - Policy on release of commercial statistics.

    2010-07-01

    ... statistics. 209.320 Section 209.320 Navigation and Navigable Waters CORPS OF ENGINEERS, DEPARTMENT OF THE... statistics. The collection of commercial statistics pertaining to rivers, harbors, and waterways, and annual... waterway statistics. In case Federal or State agencies or local interests request other than...

  8. 40 CFR 600.209-95 - Calculation of fuel economy values for labeling.

    2010-07-01

    ... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Calculation of fuel economy values for labeling. 600.209-95 Section 600.209-95 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) ENERGY POLICY FUEL ECONOMY AND CARBON-RELATED EXHAUST EMISSIONS OF MOTOR VEHICLES Fuel...

  9. 40 CFR 600.209-85 - Calculation of fuel economy values for labeling.

    2010-07-01

    ... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Calculation of fuel economy values for labeling. 600.209-85 Section 600.209-85 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) ENERGY POLICY FUEL ECONOMY AND CARBON-RELATED EXHAUST EMISSIONS OF MOTOR VEHICLES Fuel...

  10. 48 CFR 252.209-7007 - Prohibited Financial Interests for Lead System Integrators.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Prohibited Financial Interests for Lead System Integrators. 252.209-7007 Section 252.209-7007 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of...

  11. 20 CFR 209.14 - Report of separation allowances subject to tier II taxation.

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Report of separation allowances subject to tier II taxation. 209.14 Section 209.14 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER... separation allowances subject to tier II taxation. For any employee who is paid a separation payment,...

  12. Study of rare processes induced by 209-Gev muons

    Analysis of dimuon final states from 1.4 x 1011 positive and 2.9 x 1010 negative 209-Gev muons in a magnetized iron calorimeter has set a lower limit of 9 Gev/c2 on the mass of a heavy neutral muon (M0), and a 90%-confidence level upper limit of sigma(μN→b anti bX)B(b anti b→μX)-36 cm2 for the production of bottom hadrons by muons. The dimuon mass spectrum from 102,678 trimuon final states places a 90%-confidence level upper limit for the muoproduction of upsilon states: sigma(μN→μ UPSILON X)B(UPSILON→μ+μ-)-39 cm2. In addition, analysis of 71 rare multimuon events, including 4- and 5-muon final states, is presented

  13. Weak Lensing Mass Reconstruction of the Galaxy Cluster Abell 209

    Paulin-Henriksson, S; Haines, C P; Radovich, M; Mercurio, A; Becciani, U

    2007-01-01

    Weak lensing applied to deep optical images of clusters of galaxies provides a powerful tool to reconstruct the distribution of the gravitating mass associated to these structures. We use the shear signal extracted by an analysis of deep exposures of a region centered around the galaxy cluster Abell 209, at redshift z=0.2, to derive both a map of the projected mass distribution and an estimate of the total mass within a characteristic radius. We use a series of deep archival R-band images from CFHT-12k, covering an area of 0.3 deg^2. We determine the shear of background galaxy images using a new implementation of the modified Kaiser-Squires-Broadhurst pipeline for shear determination, which we has been tested against the ``Shear TEsting Program 1 and 2'' simulations. We use mass aperture statistics to produce maps of the 2 dimensional density distribution, and parametric fits using both Navarro-Frenk-White (NFW) and singular-isothermal-sphere profiles to constrain the total mass. The projected mass distributi...

  14. Feasibility study on polonium-209 as radioisotope fuel for space nuclear power

    We have investigated the performance and the production method of alternative isotopes of 238Pu as a radioisotope fuel for use in space radioisotope power generators. Polonium-209 has the possibility to be an alternative material of 238Pu. It has enough half-time of 102 years and the specific power of 490 W/kg. From the simulation, the beam current of 14 A with 40 MeV proton energy provides 1 kg/yr of 209Po annually. (author)

  15. BDE-209: kinetic studies and effect of humic substances on photodegradation in water.

    Leal, J F; Esteves, V I; Santos, E B H

    2013-12-17

    BDE-209 is a brominated flame retardant and a priority contaminant, which has been found in several environmental matrices, namely, in water. To date, there are no quantum yield data for BDE-209 photodegradation by sunlight in water, to allow predicting half-life times in aquatic systems. In this work, the kinetics of BDE-209 photodegradation in water was studied and the influence of different fractions of aquatic humic substances (HS) was evaluated. Aqueous solutions of BDE-209 exposed for different periods of time to simulated sunlight were analyzed by HPLC-UV after being concentrated using dispersive liquid-liquid microextraction (DLLME) or solid-phase extraction (SPE). The photodegradation of BDE-209 in aqueous solution followed pseudo-first-order kinetics. The average quantum yield obtained of 0.010 ± 0.001 (about 20-fold lower than the quantum yield determined in ethanol) allow to predict an outdoor half-life time of 3.5 h. The photodegradation percentage of BDE-209 was not significantly affected by the XAD-4 fraction of HS, but it decreased substantially in the presence of humic and fulvic acids. Light screening by the humic substances could not explain this delay, which is probably the result of the association of the compound with the hydrophobic sites of the humic material. PMID:24245794

  16. Effect of cadmium ion on biodegradation of decabromodiphenyl ether (BDE-209) by Pseudomonas aeruginosa

    Highlights: • BDE-209 degradation by P. aeruginosa in the presence of Cd was investigated. • Degradation was accelerated by the increase of CSH induced by low level of Cd. • Higher membrane permeability caused by low level of Cd promoted degradation. • Depression of cell growth and metabolism by high content Cd inhibited degradation. -- Abstract: The influence of Cd(II) ions on the degradation of decabromodiphenyl ether (BDE-209) by an aerobic degrading strain, Pseudomonas aeruginosa, was investigated. The results demonstrated that the strain P. aeruginosa exhibited a high level of resistance against cadmium toxicity, and Cd(II) ions of different concentrations possessed mixed reactions on BDE-209 bioremoval. The degradation efficiency was stimulated at low concentrations of Cd(II) ions (≤1 mg L−1) but inhibited at higher levels (≥5 mg L−1). Subsequent analyses revealed that the increase of cell hydrophobicity and membrane permeability were two main factors for Cd(II) ions of low concentrations to accelerate BDE-209 degradation. However, inhibition effect by high concentrations of Cd(II) ions was mainly attributed to the negative impact of metals on growth and metabolism of the strain. It was also showed through cellular distribution of BDE-209 that different concentration of Cd(II) ions affected the amount of BDE-209 inside or outside the cell at different incubation time

  17. Effect of cadmium ion on biodegradation of decabromodiphenyl ether (BDE-209) by Pseudomonas aeruginosa

    Shi, Guangyu [State Key Laboratory of Organic Geochemistry, Guangzhou Institute of Geochemistry, Chinese Academy of Science, Guangzhou 510640 (China); Yin, Hua, E-mail: huayin@scut.edu.cn [Key Laboratory of Pollution Control and Ecosystem Restoration in Industry Clusters, Ministry of Education, College of Environment and Energy, South China University of Technology, Guangzhou 510006 (China); Ye, Jinshao [Department of Environmental Engineering, Jinan University, Guangzhou 510632 (China); Peng, Hui [Department of Chemistry, Jinan University, Guangzhou 510632 (China); Li, Jun; Luo, Chunling [State Key Laboratory of Organic Geochemistry, Guangzhou Institute of Geochemistry, Chinese Academy of Science, Guangzhou 510640 (China)

    2013-12-15

    Highlights: • BDE-209 degradation by P. aeruginosa in the presence of Cd was investigated. • Degradation was accelerated by the increase of CSH induced by low level of Cd. • Higher membrane permeability caused by low level of Cd promoted degradation. • Depression of cell growth and metabolism by high content Cd inhibited degradation. -- Abstract: The influence of Cd(II) ions on the degradation of decabromodiphenyl ether (BDE-209) by an aerobic degrading strain, Pseudomonas aeruginosa, was investigated. The results demonstrated that the strain P. aeruginosa exhibited a high level of resistance against cadmium toxicity, and Cd(II) ions of different concentrations possessed mixed reactions on BDE-209 bioremoval. The degradation efficiency was stimulated at low concentrations of Cd(II) ions (≤1 mg L{sup −1}) but inhibited at higher levels (≥5 mg L{sup −1}). Subsequent analyses revealed that the increase of cell hydrophobicity and membrane permeability were two main factors for Cd(II) ions of low concentrations to accelerate BDE-209 degradation. However, inhibition effect by high concentrations of Cd(II) ions was mainly attributed to the negative impact of metals on growth and metabolism of the strain. It was also showed through cellular distribution of BDE-209 that different concentration of Cd(II) ions affected the amount of BDE-209 inside or outside the cell at different incubation time.

  18. Altitudinal distributions of BDE-209 and other polybromodiphenyl ethers in high mountain lakes

    The present study shows the occurrence of 2,2',3,3',4,4',5,5',6,6'-decabromodiphenyl ether (BDE-209) in microbial biofilms of Pyrenean and Tatra high mountain lakes despite its low vapor pressure and high hydrophobicity. Aerosol air transport is therefore a feasible mechanism for BDE-209 accumulation in sites up to 2688 m above sea level. This compound and other PBDEs exhibit altitudinally-dependent distribution involving higher concentrations with increasing mountain lake elevation. However, the apparently very high enthalpies of the concentration gradients observed, including BDE-209, suggest that bacterial anaerobic debromination also plays a significant role in the resulting altitudinal distributions. This microbial mechanism explains the relative abundances of PBDEs and their within lake differences between rocky and sediment microbial biofilms, thereby showing that the altitudinal pattern observed is not purely due to water temperature control on bacterial activity but also to changes in the availability of anaerobic microenvironments which increase with increasing lake productivity at lower altitudes. - Highlights: → BDE-209 is found in high mountain areas despite its low vapor pressure. → Aerosol air transport may transport BDE-209 to high mountain sites. → BDE-209 and PBDEs exhibit altitudinally-dependent distributions. → PBDE bacterial anaerobic debromination is important in mountain areas. → Biodegradation may generate altitudinal and latitudinal concentration gradients. - Decabromodiphenyl ether and the other polybromodiphenyl congeners show vertical distributions in high mountains due to temperature effects and microbial degradation.

  19. Altitudinal distributions of BDE-209 and other polybromodiphenyl ethers in high mountain lakes

    Bartrons, Mireia [Department of Environmental Chemistry, Institute of Environmental Assessment and Water Research (IDAEA-CSIC), Jordi Girona, 18, 08034 Barcelona, Catalonia (Spain); Limnology Unit (CSIC-UB), Centre for Advanced Studies of Blanes (CEAB-CSIC), Acces Cala St. Francesc, 14, 17300 Blanes, Catalonia (Spain); Grimalt, Joan O., E-mail: joan.grimalt@idaea.csic.es [Department of Environmental Chemistry, Institute of Environmental Assessment and Water Research (IDAEA-CSIC), Jordi Girona, 18, 08034 Barcelona, Catalonia (Spain); Catalan, Jordi [Limnology Unit (CSIC-UB), Centre for Advanced Studies of Blanes (CEAB-CSIC), Acces Cala St. Francesc, 14, 17300 Blanes, Catalonia (Spain)

    2011-07-15

    The present study shows the occurrence of 2,2',3,3',4,4',5,5',6,6'-decabromodiphenyl ether (BDE-209) in microbial biofilms of Pyrenean and Tatra high mountain lakes despite its low vapor pressure and high hydrophobicity. Aerosol air transport is therefore a feasible mechanism for BDE-209 accumulation in sites up to 2688 m above sea level. This compound and other PBDEs exhibit altitudinally-dependent distribution involving higher concentrations with increasing mountain lake elevation. However, the apparently very high enthalpies of the concentration gradients observed, including BDE-209, suggest that bacterial anaerobic debromination also plays a significant role in the resulting altitudinal distributions. This microbial mechanism explains the relative abundances of PBDEs and their within lake differences between rocky and sediment microbial biofilms, thereby showing that the altitudinal pattern observed is not purely due to water temperature control on bacterial activity but also to changes in the availability of anaerobic microenvironments which increase with increasing lake productivity at lower altitudes. - Highlights: > BDE-209 is found in high mountain areas despite its low vapor pressure. > Aerosol air transport may transport BDE-209 to high mountain sites. > BDE-209 and PBDEs exhibit altitudinally-dependent distributions. > PBDE bacterial anaerobic debromination is important in mountain areas. > Biodegradation may generate altitudinal and latitudinal concentration gradients. - Decabromodiphenyl ether and the other polybromodiphenyl congeners show vertical distributions in high mountains due to temperature effects and microbial degradation.

  20. CLASH-VLT: Environment-driven evolution of galaxies in the z=0.209 cluster Abell 209

    Annunziatella, M; Biviano, A; Girardi, M; Nonino, M; Balestra, I; Rosati, P; Caminha, G Bartosch; Brescia, M; Gobat, R; Grillo, C; Lombardi, M; Sartoris, B; De Lucia, G; Demarco, R; Frye, B; Fritz, A; Moustakas, J; Scodeggio, M; Kuchner, U; Maier, C; Ziegler, B

    2016-01-01

    The analysis of galaxy properties and the relations among them and the environment, can be used to investigate the physical processes driving galaxy evolution. We study the cluster A209 by using the CLASH-VLT spectroscopic data combined with Subaru photometry, yielding to 1916 cluster members down to a stellar mass of 10^{8.6} Msun. We determine: i) the stellar mass function of star-forming and passive galaxies; ii) the intra-cluster light and its properties; iii) the orbits of low- and high-mass passive galaxies; and iv) the mass-size relation of ETGs. The stellar mass function of the star-forming galaxies does not depend on the environment, while the slope found for passive galaxies becomes flatter in the densest region. The color distribution of the intra-cluster light is consistent with the color of passive members. The analysis of the dynamical orbits shows that low-mass passive galaxies have tangential orbits, avoiding small pericenters around the BCG. The mass-size relation of low-mass passive ETGs is ...

  1. Behavior of decabromodiphenyl ether (BDE-209) in soil: Effects of rhizosphere and mycorrhizal colonization of ryegrass roots

    A rhizobox experiment was conducted to investigate degradation of decabromodiphenyl ether (BDE-209) in the rhizosphere of ryegrass and the influence of root colonization with an arbuscular mycorrhizal (AM) fungus. BDE-209 dissipation in soil varied with its proximity to the roots and was enhanced by AM inoculation. A negative correlation (P 2 = 0.66) was found between the residual BDE-209 concentration in soil and soil microbial biomass estimated as the total phospholipid fatty acids, suggesting a contribution of microbial degradation to BDE-209 dissipation. Twelve and twenty-four lower brominated PBDEs were detected in soil and plant samples, respectively, with a higher proportion of di- through hepta-BDE congeners in the plant tissues than in the soils, indicating the occurrence of BDE-209 debromination in the soil-plant system. AM inoculation increased the levels of lower brominated PBDEs in ryegrass. These results provide important information about the behavior of BDE-209 in the soil-plant system. - Research highlights: → BDE-209 dissipation in soil was affected by the proximity to the roots. → Microbial degradation contributes greatly to BDE-209 dissipation in the soil. → Twelve and twenty-four lower brominated PBDEs were detected in soil and plant samples. → AM inoculation increased root uptake and accumulation of BDE-209. - BDE-209 dissipation and degradation in soil were affected by both its proximity to ryegrass roots and inoculation with an AM fungus.

  2. Behavior of decabromodiphenyl ether (BDE-209) in soil: Effects of rhizosphere and mycorrhizal colonization of ryegrass roots

    Wang Sen [State Key Laboratory of Environmental Chemistry and Ecotoxicology, Research Center for Eco-Environmental Sciences, Chinese Academy of Sciences, P.O. Box 2871, Beijing 100085 (China); Zhang Shuzhen, E-mail: szzhang@rcees.ac.cn [State Key Laboratory of Environmental Chemistry and Ecotoxicology, Research Center for Eco-Environmental Sciences, Chinese Academy of Sciences, P.O. Box 2871, Beijing 100085 (China); Huang, Honglin [State Key Laboratory of Environmental Chemistry and Ecotoxicology, Research Center for Eco-Environmental Sciences, Chinese Academy of Sciences, P.O. Box 2871, Beijing 100085 (China); Christie, Peter [Agri-Environment Branch, Agri-Food and Biosciences Institute, Newforge Lane, Belfast BT9 5PX (United Kingdom)

    2011-03-15

    A rhizobox experiment was conducted to investigate degradation of decabromodiphenyl ether (BDE-209) in the rhizosphere of ryegrass and the influence of root colonization with an arbuscular mycorrhizal (AM) fungus. BDE-209 dissipation in soil varied with its proximity to the roots and was enhanced by AM inoculation. A negative correlation (P < 0.001, R{sup 2} = 0.66) was found between the residual BDE-209 concentration in soil and soil microbial biomass estimated as the total phospholipid fatty acids, suggesting a contribution of microbial degradation to BDE-209 dissipation. Twelve and twenty-four lower brominated PBDEs were detected in soil and plant samples, respectively, with a higher proportion of di- through hepta-BDE congeners in the plant tissues than in the soils, indicating the occurrence of BDE-209 debromination in the soil-plant system. AM inoculation increased the levels of lower brominated PBDEs in ryegrass. These results provide important information about the behavior of BDE-209 in the soil-plant system. - Research highlights: > BDE-209 dissipation in soil was affected by the proximity to the roots. > Microbial degradation contributes greatly to BDE-209 dissipation in the soil. > Twelve and twenty-four lower brominated PBDEs were detected in soil and plant samples. > AM inoculation increased root uptake and accumulation of BDE-209. - BDE-209 dissipation and degradation in soil were affected by both its proximity to ryegrass roots and inoculation with an AM fungus.

  3. Low level exposure to the flame retardant BDE-209 reduces thyroid hormone levels and disrupts thyroid signaling in fathead minnows

    Noyes, Pamela D.; Lema, Sean C.; Macaulay, Laura J.; Douglas, Nora K.; Stapleton, Heather M.

    2013-01-01

    Polybrominated diphenyl ether (PBDE) flame retardants have been shown to disrupt thyroid hormone regulation, neurodevelopment, and reproduction in some animals. However, effects of the most heavily used PBDE, decabromodiphenyl ether (BDE-209), on thyroid functioning remain unclear. This study examined low-dose effects of BDE-209 on thyroid hormone levels and signaling in fathead minnows. Adult males received dietary exposures of BDE-209 at a low dose (~3 ng/g bw-day) and high dose (~300 ng/g ...

  4. Designing of Anti Dengue Drug Molecule against Insilico Modeled Target DC-Sign (CD-209

    Prashantha C.N

    2013-09-01

    Full Text Available The C-type lectin DC-SIGN (CD209 plays a major role in receptor on human dendritic cells, it binds to several glycoproteins of viruses that facilitate disease progression. In dengue fever, the disease targets of arbovirus infection, show dendritic and reticuloendothelial cells that may affect immune system. The phytochemical extracts of Bosenbergia rotunda (BR have been effectively used as potential small molecular inhibitors to inhibit DC-SIGN (CD209 function. Using rational drug designing the training sets include Panduratin-A and 4-hydroxypanduratin is designed from BR derivatives could be an effective inhibitor of a DC-SIGN (CD209 binding towards the drug discovery/ therapy against dengue fever.

  5. High-energy neutron-induced fission cross sections of natural lead and bismuth-209

    Calviño Tavares, Francisco; Cortés Rossell, Guillem Pere; Poch Parés, Agustí; Pretel Sánchez, Carme

    2011-01-01

    The CERN Neutron Time-Of-Flight (n TOF) facility is well suited to measure small neutron- induced ssion cross sections, as those of subactinides. The cross section ratios of natPb and 209Bi relative to 235U and 238U were measured using PPAC detectors. The fragment coincidence method allows to unambiguously identify the ssion events. The present experiment provides the rst results for neutron-induced ssion up to 1 GeV for natPb and 209Bi. A good agreement with previous exper...

  6. CLASH-VLT: Environment-driven evolution of galaxies in the z = 0.209 cluster Abell 209

    Annunziatella, M.; Mercurio, A.; Biviano, A.; Girardi, M.; Nonino, M.; Balestra, I.; Rosati, P.; Bartosch Caminha, G.; Brescia, M.; Gobat, R.; Grillo, C.; Lombardi, M.; Sartoris, B.; De Lucia, G.; Demarco, R.; Frye, B.; Fritz, A.; Moustakas, J.; Scodeggio, M.; Kuchner, U.; Maier, C.; Ziegler, B.

    2016-01-01

    Context. The analysis of galaxy properties, such as stellar masses, colors, sizes and morphologies, and the relations among them and the environment, in which the galaxies reside, can be used to investigate the physical processes driving galaxy evolution. Aims: We conduct a thorough study of the cluster A209 with a new large spectro-photometric dataset to investigate possible environmental effects on galaxy properties that can provide information on galaxy evolution in cluster hostile environments. Methods: We use the dataset obtained as part of the CLASH-VLT spectroscopic survey, supplemented with Subaru/SuprimeCam high-quality imaging in BVRIz-bands, which yields 1916 cluster members (50% of them spectroscopically confirmed) down to a stellar mass M⋆ = 108.6 M⊙. We determine the stellar mass function of these galaxies in different regions of the cluster, by separating the sample into star-forming and passive cluster members. We then determine the intra-cluster light and its properties. We also derive the orbits of low- (M⋆ ≤ 1010.0 M⊙) and high-mass (M⋆ > 1010.0 M⊙) passive galaxies and study the effect of the environment on the mass-size relation of early-type galaxies, selected according to their Sérsic index; the effects are studied separately for the galaxies in each mass range. Finally, we compare the cluster stellar mass density profile with the number density and total-mass density profiles. Results: The stellar mass function of the star-forming cluster galaxies does not depend on the environment. The slope found for passive galaxies becomes flatter in the densest cluster region, which implies that the low-mass component starts to dominate when moving away from the cluster center. The color distribution of the intra-cluster light is consistent with the color of passive cluster members. The analysis of the dynamical orbits of passive galaxies shows that low-mass galaxies have tangential orbits, avoiding small pericenters around the BCG. The

  7. 43 CFR 17.209 - Effect of State or local law or other requirements and effect of employment opportunities.

    2010-10-01

    ... requirements and effect of employment opportunities. 17.209 Section 17.209 Public Lands: Interior Office of the... employment opportunities. (a) The obligation to comply with this subpart is not obviated or alleviated by the... alleviated because employment opportunities in any occupation or profession are or may be more limited...

  8. 40 CFR 600.209-08 - Calculation of vehicle-specific 5-cycle fuel economy values for a model type.

    2010-07-01

    ...-cycle fuel economy values for a model type. 600.209-08 Section 600.209-08 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) ENERGY POLICY FUEL ECONOMY AND CARBON-RELATED EXHAUST EMISSIONS OF MOTOR VEHICLES Fuel Economy Regulations for 1977 and Later Model Year Automobiles-Procedures...

  9. Impact of co-exposure with lead and decabromodiphenyl ether (BDE-209) on thyroid function in zebrafish larvae

    Highlights: • PBDEs and metals are the main contaminants at e-waste recycling sites. • Combined effects of Pb/BDE-209 on thyroid function in zebrafish larvae were studied. • Co-exposure of Pb and BDE-209 elicited synergistic effects on T3 and T4 levels. • BDE-209 enhanced Pb uptake, and Pb decreased bioconcentration/metabolism of BDE-209. • Mixtures of Pb and BDE-209 probably result in an increase in toxicological effects. - Abstract: Polybrominated diphenyl ethers (PBDEs) and metals are the main contaminants at waste electrical and electronic equipment (“e-waste”) recycling sites. However, the potential environmental health effects of mixtures of PBDEs and metals are not known. We investigated co-exposure of lead (Pb) with decabromodiphenyl ether (BDE-209) on thyroid function in zebrafish larvae. Seven groups of embryos/larvae of zebrafish were treated with Pb (0, 2, 5, 10, 15, 20, and 30 μg/L), six groups were exposed to BDE-209 (0, 50, 100, 200, 400, and 800 μg/L), and nine groups of zebrafish larvae were treated with Pb and BDE-209 (5, 10, and 20 μg/L Pb; 50, 100, and 200 μg/L BDE-209). Embryos/larvae were exposed from 2 h post-fertilization (hpf) until 144 hpf, and thyroid hormone (TH) content measured. Pb exposure significantly decreased whole-body TH contents (triiodothyroxine (T3) and thyroxine (T4)) but BDE-209 exposure significantly increased T3 and T4 levels. Pb or BDE-209 treatment alone caused a predicted downregulation of TH transport (i.e., expression of the mRNA or proteins of transthyretin). Chemical analyses showed Pb uptake to be increased by BDE-209, but BDE-209 bioconcentration was decreased and the ability to metabolize BDE-209 was reduced in the presence of Pb. We also found that a mixture of the two chemicals had a synergistic effect on TH levels in zebrafish

  10. Impact of co-exposure with lead and decabromodiphenyl ether (BDE-209) on thyroid function in zebrafish larvae

    Zhu, Biran; Wang, Qiangwei; Wang, Xianfeng [State Key Laboratory of Freshwater Ecology and Biotechnology, Institute of Hydrobiology, Chinese Academy of Sciences, Wuhan 430072 (China); University of Chinese Academy of Sciences, Beijing 100049 (China); Zhou, Bingsheng, E-mail: bszhou@ihb.ac.cn [State Key Laboratory of Freshwater Ecology and Biotechnology, Institute of Hydrobiology, Chinese Academy of Sciences, Wuhan 430072 (China)

    2014-12-15

    Highlights: • PBDEs and metals are the main contaminants at e-waste recycling sites. • Combined effects of Pb/BDE-209 on thyroid function in zebrafish larvae were studied. • Co-exposure of Pb and BDE-209 elicited synergistic effects on T{sub 3} and T{sub 4} levels. • BDE-209 enhanced Pb uptake, and Pb decreased bioconcentration/metabolism of BDE-209. • Mixtures of Pb and BDE-209 probably result in an increase in toxicological effects. - Abstract: Polybrominated diphenyl ethers (PBDEs) and metals are the main contaminants at waste electrical and electronic equipment (“e-waste”) recycling sites. However, the potential environmental health effects of mixtures of PBDEs and metals are not known. We investigated co-exposure of lead (Pb) with decabromodiphenyl ether (BDE-209) on thyroid function in zebrafish larvae. Seven groups of embryos/larvae of zebrafish were treated with Pb (0, 2, 5, 10, 15, 20, and 30 μg/L), six groups were exposed to BDE-209 (0, 50, 100, 200, 400, and 800 μg/L), and nine groups of zebrafish larvae were treated with Pb and BDE-209 (5, 10, and 20 μg/L Pb; 50, 100, and 200 μg/L BDE-209). Embryos/larvae were exposed from 2 h post-fertilization (hpf) until 144 hpf, and thyroid hormone (TH) content measured. Pb exposure significantly decreased whole-body TH contents (triiodothyroxine (T{sub 3}) and thyroxine (T{sub 4})) but BDE-209 exposure significantly increased T{sub 3} and T{sub 4} levels. Pb or BDE-209 treatment alone caused a predicted downregulation of TH transport (i.e., expression of the mRNA or proteins of transthyretin). Chemical analyses showed Pb uptake to be increased by BDE-209, but BDE-209 bioconcentration was decreased and the ability to metabolize BDE-209 was reduced in the presence of Pb. We also found that a mixture of the two chemicals had a synergistic effect on TH levels in zebrafish.

  11. 48 CFR 2452.209-70 - Potential organizational conflicts of interest.

    2010-10-01

    ... competitive advantage. The offeror may also provide relevant facts that show how its organizational structure... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Potential organizational... Provisions and Clauses 2452.209-70 Potential organizational conflicts of interest. As prescribed in...

  12. 23 CFR 633.209 - Notices to prospective Federal-aid construction contractors.

    2010-04-01

    ... 23 Highways 1 2010-04-01 2010-04-01 false Notices to prospective Federal-aid construction...) § 633.209 Notices to prospective Federal-aid construction contractors. The State highway department... Development System and Appalachian local access roads construction contracts....

  13. 22 CFR 209.12 - Effect on other regulations; supervision and coordination.

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Effect on other regulations; supervision and... OF THE CIVIL RIGHTS ACT OF 1964 § 209.12 Effect on other regulations; supervision and coordination... other ground. (b) Supervision and coordination. The Administrator may from time to time assign...

  14. Equal Opportunity in Higher Education: The Past and Future of California's Proposition 209

    Grodsky, Eric, Ed.; Kurlaender, Michal, Ed.

    2010-01-01

    This timely book examines issues pertaining to equal opportunity--affirmative action, challenges to it, and alternatives for improving opportunities for underrepresented groups--in higher education today. Its starting point is California's Proposition 209, which ended race-based affirmative action in public education and the workplace in 1996. The…

  15. 48 CFR 1552.209-70 - Organizational conflict of interest notification.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Organizational conflict of... Clauses 1552.209-70 Organizational conflict of interest notification. As prescribed in 1509.507-1(b) insert the following solicitation provision in all solicitations. Organizational Conflict of...

  16. 48 CFR 1352.209-70 - Potential organizational conflict of interest.

    2010-10-01

    ....209-70 Potential organizational conflict of interest. As prescribed in 48 CFR 1309.507-1(a), insert the following provision, modified appropriately: Potential Organizational Conflict of Interest (APR 2010) (a) There is a potential organizational conflict of interest (see FAR Subpart 9.5,...

  17. 48 CFR 952.209-8 - Organizational conflicts of interest-disclosure.

    2010-10-01

    ... Services (JUN 1997) (a) Organizational conflict of interest means that because of other activities or... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Organizational conflicts... Clauses 952.209-8 Organizational conflicts of interest-disclosure. As prescribed in 909.507-1(e),...

  18. 48 CFR 1552.209-72 - Organizational conflict of interest certification.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Organizational conflict of... Provisions and Clauses 1552.209-72 Organizational conflict of interest certification. As prescribed in 1509... existence of any potential organizational conflict of interest. If the offeror is aware of...

  19. Pion-Induced Fission of 209Bi and 119Sn:. Measurements, Calculations, Analyses and Comparison

    Rana, Mukhtar Ahmed; Sher, Gul; Manzoor, Shahid; Shehzad, M. I.

    Cross-sections for the π--induced fission of 209Bi and 119Sn have been measured using the most sensitive CR-39 solid-state nuclear track detector. In experiments, target-detector stacks were exposed to negative pions of energy 500, 672, 1068, and 1665 MeV at the Brookhaven National Laboratory, USA. An important aspect of the present paper is the comparison of pion-induced fission fragment spectra of above mentioned nuclei with the spontaneous fission fragment spectra of 252Cf. This comparison is made in terms of fission fragment track lengths in the CR-39 detectors. Measurement results are compared with calculations of Monte Carlo and statistical weight functions methods using the computer code CEM95. Agreement between measurements and calculations is fairly good for 209Bi target nuclei whereas it is indigent for the case of 119Sn. The possibilities of the trustworthy calculations, using the computer code CEM95, comparable with measurements of pion-induced fission in intermediate and heavy nuclei are explored by employing various systematics available in the code. Energy dependence of pion-induced fission in 119Sn and 209Bi is analyzed employing a newly defined parameter geometric-size-normalized fission cross-section (χfg). It is found that the collective nuclear excitations, which may lead to fission, become more probable for both 209Bi and 119Sn nuclei with increasing energy of negative pions from 500 to 1665 MeV.

  20. 48 CFR 52.209-4 - First Article Approval-Government Testing.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false First Article Approval... Clauses 52.209-4 First Article Approval—Government Testing. As prescribed in 9.308-2 (a) and (b), insert the following clause: First Article Approval—Government Testing (SEP 1989) (a) The Contractor...

  1. 48 CFR 52.209-3 - First Article Approval-Contractor Testing.

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false First Article Approval... Clauses 52.209-3 First Article Approval—Contractor Testing. As prescribed in 9.308-1 (a) and (b), insert the following clause: First Article Approval—Contractor Testing (SEP 1989) (a) The Contractor...

  2. 48 CFR 2152.209-70 - Certification regarding debarment, suspension, proposed debarment and other responsibility...

    2010-10-01

    ... the contract resulting from this certification for default. (Name of Company) By: (Signature) (Name... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Certification regarding... CONTRACT CLAUSES Text of Provisions and Clauses 2152.209-70 Certification regarding debarment,...

  3. Confirmation of 20% error in the 209Po half-life

    First results of a half-life measurement of 209Po show 20% discrepancy with the formerly recommended value of 102 (5) years, which was based on a single experiment performed in 1956. After one year of measurement, a statistical uncertainty on T1/2 of 3.5% has been reached and effects of long-term instability are assumed to be less than 5%. The preliminary half-life value obtained in this work, 120 (6) years, supports the newly determined value of 125.2 (33) years by Collé et al. (2014). The 20% error in the half-life has an impact on numerous measurements in which aged 209Po solutions were used as a tracer. - Highlights: • Measured half-life of 209Po is 120 (6) a. • The formerly recommended value was in error by 20%. • Measurement results using 209Po as a tracer are affected. • The error persisted for half a century

  4. 18 CFR 1304.209 - Land-based structures/alterations.

    2010-04-01

    ... 18 Conservation of Power and Water Resources 2 2010-04-01 2010-04-01 false Land-based structures... APPROVAL OF CONSTRUCTION IN THE TENNESSEE RIVER SYSTEM AND REGULATION OF STRUCTURES AND OTHER ALTERATIONS TVA-Owned Residential Access Shoreland § 1304.209 Land-based structures/alterations. (a) Except...

  5. 77 FR 16319 - Amtrak's Petition for Determination of PRIIA Section 209 Cost Methodology

    2012-03-20

    ... From the Federal Register Online via the Government Publishing Office SURFACE TRANSPORTATION BOARD Amtrak's Petition for Determination of PRIIA Section 209 Cost Methodology AGENCY: Surface Transportation... environment or the conservation of energy resources. Decided: March 13, 2012. By the Board, Chairman...

  6. 49 CFR 238.209 - Forward end structure of locomotives, including cab cars and MU locomotives.

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Forward end structure of locomotives, including... SAFETY STANDARDS Specific Requirements for Tier I Passenger Equipment § 238.209 Forward end structure of locomotives, including cab cars and MU locomotives. (a)(1) The skin covering the forward-facing end of...

  7. The LEP 2 machine : pushing to the limits 209 GeV! Exhibition LEPFest 2000

    2000-01-01

    By installing 288 new superconducting accelerating cavities after 1995,and thanks to the excellent work of the CERN teams,energies up to 209 GeV -well beyond LEP 's original design energy -have been achieved.Significant experi- mental data have been collected at energies in excess of 206 GeV.

  8. 20 CFR 209.17 - Use of payroll records as returns of compensation.

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Use of payroll records as returns of... RAILROAD RETIREMENT ACT RAILROAD EMPLOYERS' REPORTS AND RESPONSIBILITIES § 209.17 Use of payroll records as returns of compensation. Payroll records of employers which have permanently ceased operations may...

  9. CD209L (L-SIGN) is a receptor for severe acute respiratory syndrome coronavirus

    Jeffers, Scott A.; Tusell, Sonia M.; Gillim-Ross, Laura; Hemmila, Erin M.; Achenbach, Jenna E.; Babcock, Gregory J.; Thomas, William D.; Thackray, Larissa B.; Young, Mark D.; Mason, Robert J.; Ambrosino, Donna M.; Wentworth, David E.; DeMartini, James C.; Holmes, Kathryn V.

    2004-01-01

    Angiotensin-converting enzyme 2 (ACE2) is a receptor for SARS-CoV, the novel coronavirus that causes severe acute respiratory syndrome [Li, W. Moore, M. J., Vasilieva, N., Sui, J., Wong, S. K., Berne, M. A., Somasundaran, M., Sullivan, J. L., Luzuriaga, K., Greenough, T. C., et al. (2003) Nature 426, 450–454]. We have identified a different human cellular glycoprotein that can serve as an alternative receptor for SARS-CoV. A human lung cDNA library in vesicular stomatitis virus G pseudotyped retrovirus was transduced into Chinese hamster ovary cells, and the cells were sorted for binding of soluble SARS-CoV spike (S) glycoproteins, S590 and S1180. Clones of transduced cells that bound SARS-CoV S glycoprotein were inoculated with SARS-CoV, and increases in subgenomic viral RNA from 1–16 h or more were detected by multiplex RT-PCR in four cloned cell lines. Sequencing of the human lung cDNA inserts showed that each of the cloned cell lines contained cDNA that encoded human CD209L, a C-type lectin (also called L-SIGN). When the cDNA encoding CD209L from clone 2.27 was cloned and transfected into Chinese hamster ovary cells, the cells expressed human CD209L glycoprotein and became susceptible to infection with SARS-CoV. Immunohistochemistry showed that CD209L is expressed in human lung in type II alveolar cells and endothelial cells, both potential targets for SARS-CoV. Several other enveloped viruses including Ebola and Sindbis also use CD209L as a portal of entry, and HIV and hepatitis C virus can bind to CD209L on cell membranes but do not use it to mediate virus entry. Our data suggest that the large S glycoprotein of SARS-CoV may use both ACE2 and CD209L in virus infection and pathogenesis. PMID:15496474

  10. 25 CFR 20.209 - Can a tribe operating under a tribal redesign plan go back to operating under this part?

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Can a tribe operating under a tribal redesign plan go back to operating under this part? 20.209 Section 20.209 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT....209 Can a tribe operating under a tribal redesign plan go back to operating under this part? Yes,...

  11. Characterizing the optimal operation of photocatalytic degradation of BDE-209 by nano-sized TiO2.

    Chow, Ka Lai; Man, Yu Bon; Zheng, Jin Shu; Liang, Yan; Tam, Nora Fung Yee; Wong, Ming Hung

    2012-01-01

    Brominated flame retardants have been widely used in industry. There is a rapid growing public concern for their availabilities in the environment. Advanced oxidation process (AOP) is a promising and efficient technology which may be used to remove emerging chemicals such as brominated flame retardants. This study aims at investigating optimal operational conditions for the removal of BDE-209 using nano-scaled titanium(IV) oxide. The residual PBDE congeners after photocatalytical degradation of BDE-209 by TiO2 were analysed by gas chromatography-mass spectrometry (GC-MS). It was found that the degradability of BDE-209 by TiO2 was attributed to its photocatalytic activity but not the small size of the particles. The half-life of removing BDE-209 by TiO2 was 3.05 days under visible light. Tetra- and penta-BDEs were the major degraded products of BDE-209. Optimum conditions for photocatalytical degradation of BDE-209 was found to be at pH 12 (93% +/- 1%), 5, 10, 20 mg/L (93.0% +/- 1.70%, 91.6% +/- 3.21%, 91.9% +/- 0.952%, respectively), respectively of humic acid and in the form of anatase/rutile TiO2 (82% +/- 3%). Hence, the efficiency of removing BDE-209 can be maximized while being cost effective at the said operating conditions. PMID:23520876

  12. A route for polonium 210 production from alpha-particle irradiated bismuth-209 target

    A method is proposed for production of polonium-210 via the 209Bi(α,3n)210 At nuclear reaction. Bombardment of a bismuth-209 target was performed with a 37 MeV alpha-particle beam that leads to the production of astatine-210 (T1/2 = 8.1 h), which decays to polonium-210. It is purified from the bismuth target matrix by employing liquid-liquid extraction using tributyl phosphate (TBP) in para-xylene from 7 M hydrochloric acid. Back extraction of polonium-210 was performed by 9 M nitric acid. This method allows to purify a tracer amount of Po-210 (2.6 x 10-13 mol) from macroscopic amount of Bi (2.8 x 10-2 mol).

  13. High-energy Neutron-induced Fission Cross Sections of Natural Lead and Bismuth-209

    Tarrio, D; Carrapico, C; Eleftheriadis, C; Leeb, H; Calvino, F; Herrera-Martinez, A; Savvidis, I; Vlachoudis, V; Haas, B; Koehler, P; Vannini, G; Oshima, M; Le Naour, C; Gramegna, F; Wiescher, M; Pigni, M T; Audouin, L; Mengoni, A; Quesada, J; Becvar, F; Plag, R; Cennini, P; Mosconi, M; Rauscher, T; Couture, A; Capote, R; Sarchiapone, L; Vlastou, R; Domingo-Pardo, C; Dillmann, I; Pavlopoulos, P; Karamanis, D; Krticka, M; Jericha, E; Ferrari, A; Martinez, T; Trubert, D; Oberhummer, H; Karadimos, D; Plompen, A; Isaev, S; Terlizzi, R; Cortes, G; Cox, J; Cano-Ott, D; Pretel, C; Colonna, N; Berthoumieux, E; Vaz, P; Heil, M; Lopes, I; Lampoudis, C; Walter, S; Calviani, M; Gonzalez-Romero, E; Embid-Segura, M; Stephan, C; Igashira, M; Papachristodoulou, C; Aerts, G; Tavora, L; Berthier, B; Rudolf, G; Andrzejewski, J; Villamarin, D; Ferreira-Marques, R; Tain, J L; O'Brien, S; Reifarth, R; Kadi, Y; Neves, F; Poch, A; Kerveno, M; Rubbia, C; Lazano, M; Dahlfors, M; Wisshak, K; Salgado, J; Dridi, W; Ventura, A; Andriamonje, S; Assimakopoulos, P; Santos, C; Voss, F; Ferrant, L; Patronis, N; Chiaveri, E; Guerrero, C; Perrot, L; Vicente, M C; Lindote, A; Praena, J; Baumann, P; Kappeler, F; Rullhusen, P; Furman, W; David, S; Marrone, S; Tassan-Got, L; Gunsig, F; Alvarez-Velarde, F; Massimi, C; Mastinu, P; Pancin, J; Papadopoulos, C; Tagliente, G; Haight, R; Chepel, V; Kossionides, E; Badurek, G; Marganiec, J; Lukic, S; Pavlik, A; Goncalves, I; Duran, I; Alvarez, H; Abbondanno, U; Fujii, K; Milazzo, P M; Moreau, C

    2011-01-01

    The CERN Neutron Time-Of-Flight (n\\_TOF) facility is well suited to measure small neutron-induced fission cross sections, as those of subactinides. The cross section ratios of (nat)Pb and (209)Bi relative to (235)U and (238)U were measured using PPAC detectors. The fragment coincidence method allows to unambiguously identify the fission events. The present experiment provides the first results for neutron-induced fission up to 1 GeV for (nat)Pb and (209)Bi. A good agreement with previous experimental data below 200 MeV is shown. The comparison with proton-induced fission indicates that the limiting regime where neutron-induced and proton-induced fission reach equal cross section is close to 1 GeV.

  14. Information on antiprotonic atoms and the nuclear periphery from the PS209 experiment

    Trzcinska, A.; Jastrzebski, J.; Czosnyka, T.; von Egidy, T.; Gulda, K.; Hartmann, F. J.; Iwanicki, J.; Ketzer, B.; Kisielinski, M.; Klos, B.; Kurcewicz, W.; Lubinski, P.; Napiorkowski, P. J.; Pienkowski, L.; Schmidt, R.

    2001-01-01

    In the PS209 experiments at CERN two kinds of measurements were performed: the in-beam measurement of X-rays from antiprotonic atoms and the radiochemical, off-line determination of the yield of annihilation products with mass number A_t -1 (less by 1 than the target mass). Both methods give observables which allows to study the peripheral matter density composition and distribution.

  15. Metabolic and Pharmacokinetic Differentiation of STX209 and Racemic Baclofen in Humans

    Raymundo Sanchez-Ponce; Li-Quan Wang; Wei Lu; Jana von Hehn; Maryann Cherubini; Roger Rush

    2012-01-01

    STX209 is an exploratory drug comprising the single, active R-enantiomer of baclofen which is in later stage clinical trials for the treatment of fragile x syndrome (FXS) and autism spectrum disorders (ASD). New clinical data in this article on the metabolism and pharmacokinetics of the R- and S-enantiomers of baclofen presents scientific evidence for stereoselective metabolism of only S-baclofen to an abundant oxidative deamination metabolite that is sterically resolved as the S-enantiomeric...

  16. High-energy neutron transport file for the 209Bi isotope

    The simulation of the nuclear processes, occurring in media irradiated with high-energy particles, promote the elaboration of high-energy transport files. These files being used in versatile computer codes, such as MCNP, allow to simulate with high accuracy particle transport. High-energy transport files are very important for the investigation of accelerator-driven systems. The detailed description of the methods and codes used for the elaboration of the file for 209Bi is presented in this paper. (orig.)

  17. STX209 (Arbaclofen) for Autism Spectrum Disorders: An 8-Week Open-Label Study

    Erickson, Craig A.; Veenstra-Vanderweele, Jeremy M.; Melmed, Raun D.; McCracken, James T.; Ginsberg, Lawrence D.; Sikich, Linmarie; Scahill, Lawrence; Cherubini, Maryann; Zarevics, Peter; Walton-Bowen, Karen; Carpenter, Randall L.; Wang, Paul P.; King, Bryan H.; Bear, Mark

    2013-01-01

    STX209 (arbaclofen), a selective GABA-B agonist, is hypothesized to modulate the balance of excitatory to inhibitory neurotransmission, and has shown preliminary evidence of benefit in fragile X syndrome. We evaluated its safety, tolerability, and efficacy in non-syndromic autism spectrum disorders, in an 8-week open-label trial enrolling 32 children and adolescents with either Autistic Disorder or Pervasive Developmental Disorder—Not Otherwise Specified, and a score ≥17 on the Aberrant Behav...

  18. Molecular CO(1-0) gas in the z~2 radio galaxy MRC 0152-209

    Emonts, B H C; Mao, M Y; Norris, R P; Miley, G; Ekers, R D; Villar-Martin, M; Rottgering, H J A; Sadler, E M; Rees, G; Morganti, R; Saikia, D J; Oosterloo, T A; Stevens, J B; Tadhunter, C N

    2011-01-01

    We report the detection of molecular CO(1-0) gas in the high-z radio galaxy MRC 0152-209 (z = 1.92) with the Australia Telescope Compact Array Broadband Backend (ATCA/CABB). This is the third known detection of CO(1-0) in a high-z radio galaxy to date. CO(1-0) is the most robust tracer of the overall molecular gas content (including the wide-spread, low-density and subthermally excited component), hence observations of CO(1-0) are crucial for studying galaxy evolution in the Early Universe. We derive L'(CO) = (6.6 +- 2.0) x 10^10 K km/s pc^2 for MRC 0152-209, which is comparable to that derived from CO(1-0) observations of several high-z submillimetre and starforming BzK galaxies. The CO(1-0) traces a total molecular hydrogen mass of M(H2) = 5 x 10^10 (alpha_x/0.8) Msun. MRC 0152-209 is an infra-red bright radio galaxy, in which a large reservoir of cold molecular gas has not (yet) been depleted by star formation or radio source feedback. Its compact radio source is reliably detected at 40 GHz and has a steep...

  19. Far Infrared Mapping of Three Galactic Star Forming Regions: W3(OH), S209 & S187

    S. K. Ghosh; B. Mookerjea; T. N. Rengarajan; S. N. Tandon; R. P. Verma

    2001-06-01

    Three Galactic star forming regions associated with W3(OH), S209 and S187 have been simultaneously mapped in two trans-IRAS far infrared (FIR) bands centered at ∼ 140 and 200m using the TIFR 100 cm balloon borne FIR telescope. These maps showextended FIR emission with structures. The HIRES processed IRAS maps of these regions at 12, 25, 60 & 100 m have also been presented for comparison. Point-like sources have been extracted from the longest waveband TIFR maps and searched for associations in the other five bands. The diffuse emission from these regions have been quantified, which turns out to be a significant fraction of the total emission. The spatial distribution of cold dust (T < 30 K) for two of these sources (W3(OH) & S209), has been determined reliably from the maps in TIFR bands. The dust temperature and optical depth maps show complex morphology. In general the dust around S209 has been found to be warmer than that in W3(OH) region.

  20. Metabolic and Pharmacokinetic Differentiation of STX209 and Racemic Baclofen in Humans

    Raymundo Sanchez-Ponce

    2012-09-01

    Full Text Available STX209 is an exploratory drug comprising the single, active R-enantiomer of baclofen which is in later stage clinical trials for the treatment of fragile x syndrome (FXS and autism spectrum disorders (ASD. New clinical data in this article on the metabolism and pharmacokinetics of the R- and S-enantiomers of baclofen presents scientific evidence for stereoselective metabolism of only S-baclofen to an abundant oxidative deamination metabolite that is sterically resolved as the S-enantiomeric configuration. This metabolite undergoes some further metabolism by glucuronide conjugation. Consequences of this metabolic difference are a lower Cmax and lower early plasma exposure of S-baclofen compared to R-baclofen and marginally lower urinary excretion of S-baclofen after racemic baclofen administration. These differences introduce compound-related exposure variances in humans in which subjects dosed with racemic baclofen are exposed to a prominent metabolite of baclofen whilst subjects dosed with STX209 are not. For potential clinical use, our findings suggest that STX209 has the advantage of being a biologically defined and active enantiomer.

  1. A functional variant in the CD209 promoter is associated with DQ2-negative celiac disease in the Spanish population

    C Nú(n)ez; E Urcelay; J Martín; B Rueda; A Martínez; C Maluenda; I Polanco; MA López-Nevot; E Ortega; E Sierra; E Gómez de la Concha

    2006-01-01

    AIM: To address the role of CD209 in celiac disease (CD)patients. Non-human leukocyte antigen (HLA) genetic factors in CD predisposition are poorly understood, and environmental factors like infectious pathogens may play a role. CD209 is a dendritic and macrophage surface molecule involved in pathogen recognition and immune activation. Recently, a functional variant in the promoter of the CD209 gene (-336A/G) has been shown to affect the transcriptional CD209 activity in vitro and it has been associated with a higher susceptibility to/or severity of infection.METHODS: The study population was composed of two case-control cohorts of 103 and 386 CD patients and 312 y 419 healthy controls as well as a panel of 257 celiac families. Genotyping for the -336A/G CD209promoter polymorphism was performed using a TaqMan 5' allelic discrimination assay. HLA-DQ was determined by hybridization with allele specific probes.RESULTS: Initially, the case-control and familial studies did not find any association of the -336 A/G CD209 genetic variant with CD susceptibility. However,the stratification by HLA-DQ2 did reveal a significant association of CD209 promoter polymorphism in the HLA-DQ2 (-) group (carrier Avs GG in DQ2 (-) vs DQ2 (+)patients (P = 0.026, OR = 3.71).CONCLUSION: The -336G CD209 allele seems to be involved in CD susceptibility in HLA-DQ2 (-) patients. Our results might suggest a possible role of pathogens in the onset of a minor group of CD patients.

  2. Characterizing the optimal operation of photocatalytic degradation of BDE-209 by nano-sized TiO2

    Ka Lai Chow; Yu Bon Man; Jin Shu Zheng; Yan Liang; Nora Fung Yee Tam; Ming Hung Wong

    2012-01-01

    Brominated flame retardants have been widely used in industry.There is a rapid growing public concern for their availabilities in the environment.Advanced oxidation process (AOP) is a promising and efficient technology which may be used to remove emerging chemicals such as brominated flame retardants.This study aims at investigating optimal operational conditions for the removal of BDE-209 using nano-scaled titanium(IV) oxide.The residual PBDE congeners after photocatalytical degradation of BDE-209 by TiO2 were analysed by gas chromatography-mass spectrometry (GC-MS).It was found that the degradability of BDE-209 by TiO2 was attributed to its photocatalytic activity but not the small size of the particles.The half-life of removing BDE-209 by TiO2 was 3.05 days under visible light.Tetra- and penta-BDEs were the major degraded products of BDE-209.Optimum conditions for photocatalytical degradation of BDE-209 was found to be at pH 12 (93% ± 1%),5,10,20 mg/L (93.0% ± 1.70%,91.6% ± 3.21%,91.9% ± 0.952%,respectively),respectively of humic acid and in the form of anatase/mtile YiO2 (82% ± 3%).Hence,the efficiency of removing BDE-209 can be maximized while being cost effective at the said operating conditions.

  3. Effect of decabromodiphenyl ether (BDE-209) on a soil-biota system: Role of earthworms and ryegrass.

    Feng, Mingbao; He, Qun; Shi, Jiaqi; Qin, Li; Zhang, Xuesheng; Sun, Ping; Wang, Zunyao

    2016-06-01

    In the present study, the toxic effect of decabromodiphenyl ether (BDE-209), an important brominated fire retardant, on soil was evaluated by amending with different concentrations (0 mg/kg, 1 mg/kg, 10 mg/kg, and 500 mg/kg dry wt) for 40 d. The activities of 3 soil enzymes (urease, catalase, and alkaline phosphatase) were measured as the principal assessment endpoints. Meanwhile, the effects of natural environmental factors, such as light conditions and soil biota, on BDE-209 intoxication were studied. For the latter, 30 earthworms (Metaphire guillelmi) with fully matured clitella or ryegrass (Lolium perenne) with fully matured leaves were exposed in soil amended with BDE-209. The activities of the soil enzymes were adversely affected by BDE-209, especially for the high-concentration treatments, with greater adverse effects in the dark than in the light. The presence of earthworms reduced toxicity to BDE-209, whereas ryegrass did not. The calculated integrated biomarker response index, which provides a general indicator of the health status of test species by combining different biomarker signals, further validated these findings. Moreover, the antioxidant status (oxidant-antioxidant balance) of these 2 biota was assessed. Results indicated that BDE-209 significantly affected the activities of antioxidant enzymes (superoxide dismutase and catalase) and enhanced the levels of malondialdehyde in both species. The present study may facilitate a better understanding of the toxicity of BDE-209 toward the soil environment. Environ Toxicol Chem 2016;35:1349-1357. © 2015 SETAC. PMID:26448514

  4. Interethnic diversity of the CD209 (rs4804803 gene promoter polymorphism in African but not American sickle cell disease

    Jenelle A. Noble

    2015-02-01

    Full Text Available Elucidating the genomic diversity of CD209 gene promoter polymorphism could assist in clarifying disease pathophysiology as well as contribution to co-morbidities. CD209 gene promoter polymorphism has been shown to be associated with susceptibility to infection. We hypothesize that CD209 mutant variants occur at a higher frequency among Africans and in sickle cell disease. We analyzed the frequency of the CD209 gene (rs4804803 in healthy control and sickle cell disease (SCD populations and determined association with disease. Genomic DNA was extracted from blood samples collected from 145 SCD and 231 control Africans (from Mali, 331 SCD and 379 control African Americans and 159 Caucasians. Comparative analysis among and between groups was carried out by polymerase chain reaction-restriction fragment length polymorphism (PCR-RFLP. Per ethnic diversification, we found significant disparity in genotypic (23.4% versus 16.9% versus 3.2% and allelic frequencies (48.7% versus 42.1% versus 19.8% of the homozygote mutant variant of the CD209 (snp 309A/G gene promoter between Africans, African Americans and Caucasians respectively. Comparative evaluation between disease and control groups reveal a significant difference in genotypic (10.4% versus 23.4%; p = 0.002 and allelic frequencies (39.7% versus 48.7%; p = 0.02 of the homozygote mutant variant in African SCD and healthy controls respectively, an observation that is completely absent among Americans. Comparing disease groups, we found no difference in the genotypic (p = 0.19 or allelic (p = 0.72 frequencies of CD209 homozygote mutant variant between Africans and Americans with sickle cell disease. The higher frequency of CD209 homozygote mutant variants in the African control group reveals a potential impairment of the capacity to mount an immune response to infectious diseases, and possibly delineate susceptibility to or severity of infectious co-morbidities within and between groups.

  5. Neutron density distributions from antiprotonic 208Pb and 209Bi atoms

    Klos, B.; Trzcinska, A.; Jastrzebski, J.; Czosnyka, T.; Kisielinski, M.; Lubinski, P.; Napiorkowski, P.; Pienkowski, L.; Hartmann, F. J.; Ketzer, B.; Ring, P.; Schmidt, R.; von Egidy, T.; Smolanczuk, R.; S. Wycech

    2007-01-01

    The X-ray cascade from antiprotonic atoms was studied for 208Pb and 209Bi. Widths and shifts of the levels due to the strong interaction were determined. Using modern antiproton-nucleus optical potentials the neutron densities in the nuclear periphery were deduced. Assuming two parameter Fermi distributions (2pF) describing the proton and neutron densities the neutron rms radii were deduced for both nuclei. The difference of neutron and proton rms radii /\\r_np equal to 0.16 +-(0.02)_{stat} +-...

  6. On the 209Po half-life error and its confirmation. A critique

    A recent report on 209Po claimed to have made a determination of the 125-a half-life from measurements made over 0.8 % of one half-life. A careful reanalysis of the original data with a more complete and rigorous consideration of the underlying uncertainties demonstrates that this claim cannot withstand critical scrutiny. More importantly, this critique examines the larger issue as to what constitutes a valid half-life determination, and highlights that a careful and realistic analysis beyond the mere fitting of decay data to an exponential function is required for the measurement and reporting of half-life values. (author)

  7. Far infrared mapping of three Galactic star forming regions : W3(OH), S 209 & S 187

    Ghosh, SK; B. Mookerjea; Rengarajan, TN; Tandon, SN; Verma, RP

    2001-01-01

    Three Galactic star forming regions associated with W3(OH), S209 and S187 have been simultaneously mapped in two trans-IRAS far infrared (FIR) bands centered at ~ 140 and 200 micron using the TIFR 100 cm balloon borne FIR telescope. These maps show extended FIR emission with structures. The HIRES processed IRAS maps of these regions at 12, 25, 60 & 100 micron have also been presented for comparison. Point-like sources have been extracted from the longest waveband TIFR maps and searched for as...

  8. Lightest Isotope of Bh Produced via the 209Bi(52Cr,n)260Bh Reaction

    The lightest isotope of Bh was produced in the new 209Bi(52Cr,n)260Bh reaction at the Lawrence Berkeley National Laboratory's 88-Inch Cyclotron. Positive identification was made by observation of eight correlated alpha particle decay chains in the focal plane detector of the Berkeley Gas-Filled Separator. 260Bh decays with a 35-9+19 ms half-life by alpha particle emission mainly by a group at 10.16 MeV. The measured cross section of 59-20+29 pb is compared to model predictions. The influence of the N=152 and Z=108 shells on alpha decay properties is discussed

  9. Precision laser spectroscopy of the ground state hyperfine splitting of hydrogenlike ^209 Bi^82+

    Klaft, Ingo; Borneis, Stefan; Engel, Thomas; Fricke, Burkhard; Grieser, Ralf; HUBER, GERHARD; Kühl, Thomas; Marx, Dieter; Neumann, Reinhard; Schröder, Sönke; Seelig, Peter; Völker, Lothar

    1994-01-01

    The first direct observation of a hyperfine splitting in the optical regime is reported. The wavelength of the M1 transition between the F = 4 and F = 5 hyperfine levels of the ground state of hydrogenlike ^209 Bi^82+ was measured to be \\lamda_0 = 243.87(4) nm by detection of laser induced fluorescence at the heavy-ion storage ring ESR at GSI. In addition, the lifetime of the laser excited F = 5 sublevel was determined to be \\tau_0 = 0.351(16) ms. The method can be applied to a number of othe...

  10. Constraints on the Radial Variation of Grain Growth in the AS 209 Circumstellar Disk

    Pérez, Laura M; Chandler, Claire J; Isella, Andrea; Andrews, Sean M; Ricci, Luca; Calvet, Nuria; Corder, Stuartt A; Deller, Adam T; Dullemond, Cornelis P; Greaves, Jane S; Harris, Robert J; Henning, Thomas; Kwon, Woojin; Lazio, Joseph; Linz, Hendrik; Mundy, Lee G; Sargent, Anneila I; Storm, Shaye; Testi, Leonardo; Wilner, David J

    2012-01-01

    We present dust continuum observations of the protoplanetary disk surrounding the pre-main sequence star AS 209, spanning more than an order of magnitude in wavelength from 0.88 to 9.8 mm. The disk was observed with sub-arcsecond angular resolution (0.2"-0.5") to investigate radial variations in its dust properties. At longer wavelengths, the disk emission structure is notably more compact, providing model-independent evidence for changes in the grain properties across the disk. We find that physical models which reproduce the disk emission require a radial dependence of the dust opacity \\kappa_{\

  11. Effects of decabromodiphenyl ether (BDE-209 on inter-specific competition between two species of marine bloom-forming microalgae.

    Xinxin Zhang

    Full Text Available Decabromodiphenyl ether (BDE-209, a new kind of persistent organic pollutants, was selected to investigate its influence on population growth and inter-specific competition between two species of marine bloom-forming microalgae, Heterosigma akashiwo and Karenia mikimotoi. (1BDE-209 showed acute toxic effects on both microalgae and H. akashiwo was more sensitive from view of 96 h-EC50 and the ultrastructure variation. (2The microalgal population growth patterns in mono-culture were density-dependent and the growth of both species in the normal co-culture was significantly depressed by competition (P<0.05 with different initial biomass ratios. BDE-209 exposure significantly changed the growth. (3 Lotka-Volterra competition model was used to simulate the interaction between the microalgae. BDE-209 exposure broke the competitive balance to make competition gradually shift in favor of H. akashiwo. Results suggested BDE-209 did have toxic effects on either microalgal growth or the inter-specific competition, which was quite different from previous reports. Further exploration of the mechanism is needed.

  12. CDRI-08 Attenuates REST/NRSF-Mediated Expression of NMDAR1 Gene in PBDE-209-Exposed Mice Brain

    Priya Verma

    2015-01-01

    Full Text Available CDRI-08 is a standardized bacoside enriched ethanolic extract of Bacopa monnieri, a nootropic plant. We reported that CDRI-08 attenuated oxidative stress and memory impairment in mice, induced by a flame retardant, PBDE-209. In order to explore the mechanism, present study was designed to examine the role of CDRI-08 on the expression of NMDAR1 (NR1 and the binding of REST/NRSF to NR1 promoter against postnatal exposure of PBDE-209. Male mice pups were orally supplemented with CDRI-08 at the doses of 40, 80, or 120 mg/kg along with PBDE-209 (20 mg/kg during PND 3–10 and frontal cortex and hippocampus were collected at PND 11 and 60 to study the expression and regulation of NR1 by RT-PCR and electrophoretic mobility shift assay, respectively. The findings showed upregulated expression of NR1 and decreased binding of REST/NRSF to NR1 promoter after postnatal exposure of PBDE-209. Interestingly, supplementation with CDRI-08 significantly restored the expression of NR1 and binding of REST/NRSF to NR1 promoter near to the control value at the dose of 120 mg/kg. In conclusion, the results suggest that CDRI-08 possibly acts on glutamatergic system through expression and regulation of NR1 and may restore memory, impaired by PBDE-209 as reported in our previous study.

  13. CT in ureterolithiasis with a radiation dose equal to intravenous urography: results in 209 patients; CT der Ureterolithiasis mit der Strahlendosis einer Ausscheidungsurographie: Ergebnisse bei 209 Patienten

    Knoepfle, E.; Bohndorf, K. [Klinikum Augsburg (Germany). Klinik fuer Diagnostische Radiologie und Neuroradiologie; Hamm, M.; Wartenberg, S. [Klinikum Augsburg (Germany). Klinik fuer Urologie

    2003-12-01

    Purpose: To evaluate a low-dose, nonenhanced helical CT protocol for the diagnosis of renal colic using an effective dose equivalent of radiation not higher than that of intravenous urography. Materials and Methods: A new low-dose helical-CT protocol (120 kV; 70 mA; rotation time 0.75 s; collimation 5 mm, pitch=2) was used to examine 209 consecutive patients with symptoms of renal colic. The initial CT reports were compared with retrograde ureterography, ureteral endoscopy, stone retrieval, surgical or clinical findings. The effective radiation dose was calculated by the method published by Nagel. The prevalence of ureterolithiasis was 70%. Results: Sensitivity and specificity of the low-dose-helical CT in detecting ureteral calculi were 97.7% and 96.8%, respectively. The positive predictive value was 99.3% and negative predictive value 92.4%. The mean effective radiation dose equivalent was 0.97 mSv in male and 1.35 mSv in female patients. Conclusions: the diagnostic value of the reported CT protocol does no differ from previously published protocols. However, the effective radiation dose equivalent is at least 50% lower than stated in the published protocols. We recommend the low-dose helical CT protocol as the method of choice. (orig.) [German] Fragestellung: Pruefung der diagnostischen Aussagekraft eines nativen Spiral-CT-Protokolls mit einer niedrigen, einer Ausscheidungsurographie aequivalenten Strahlendosis bei der Abklaerung einer Harnleiterkolik. Methode: 209 konsekutive Patienten mit der klinischen Verdachtsdiagnose einer Harnleiterkolik wurden mit einem neuen CT-Protokoll untersucht (120 kV; 70 mA; Rotationszeit 0,75 s; Kollimation 5 mm; Pitch=2). Die prospektiv erhobenen CT-Befunde wurden mittels retrograder Ureterdarstellung, Ureterendoskopie, Steinasservierung, operativ oder im klinischen Verlauf validiert. Die effektive Dosis der CT-Untersuchung wurde nach Nagel berechnet. Die Praevalenz der Ureterolithiasis betrug 70%. Ergebnisse: Die Niedrig

  14. Will Comet 209P/LINEAR Generate the Next Meteor Storm?

    Ye, Quanzhi

    2013-01-01

    Previous studies have suggested that Comet 209P/LINEAR may produce strong me- teor activity on Earth on 2014 May 24; however, exact timing and activity level is difficult to estimate due to the limited physical observations of the comet. Here we reanalyze the optical observations of 209P/LINEAR obtained during its 2009 appari- tion. We find that the comet is relatively depleted in dust production, with Af {\\rho} at 1 cm level within eight months around its perihelion. This feature suggested that this comet may be currently transitioning from typical comet to a dormant comet. Syn- dyne simulation shows that the optical cometary tail is dominated by larger particles with {\\beta} ~ 0.003. Numerical simulations of the cometary dust trails confirm the arrival of particles on 2014 May 24 from some of the 1798-1979 trails. The nominal radiant is at RA 122 +/- 1 deg, Dec 79 +/- 1 deg (J2000) in the constellation of Camelopardalis. Given that the comet is found to be depleted in dust production, we concluded that a me...

  15. The Extremely Low Activity Comet 209P/LINEAR During Its Extraordinary Close Approach in 2014

    Schleicher, David G

    2016-01-01

    We present results from our observing campaign of Comet 209P/LINEAR during its exceptionally close approach to Earth during May of 2014, the third smallest perigee of any comet in two centuries. These circumstances permitted us to pursue several studies of this intrinsically faint object, including measurements of gas and dust production rates, searching for coma morphology, and direct detection of the nucleus to measure its properties. Indeed, we successfully measured the lowest water production rates of an intact comet in over 35 years and a corresponding smallest active area, ~0.007 km^2. When combined with the nucleus size found from radar (Howell et al. 2014), this also yields the smallest active fraction for any comet, ~0.024%. In all, this strongly suggests that 209P/LINEAR is on its way to becoming an inert object. The nucleus was detected but could not easily be disentangled from the inner coma due to seeing variations and changing spatial scales. Even so, we were able to measure a double-peaked ligh...

  16. Three - dimensional conformal radiotherapy (3DCRT) for 209 patients with esophageal carcinoma

    Objective: To analyze the outcomes and prognostic factors of esophageal carcinoma treated with three-dimensional conformal radiotherapy (3DCRT). Methods: From January 2001 to August 2007, 209 patients with esophageal carcinoma treated with 3DCRT were retrospectively analyzed. The local control rotes, the survival rates and the related prognostic factors were evaluated with SPSS 11.5 software. Results: The follow-up rate was 98. 1% by December 2008. The number of patients followed up for 1,3, 4 and 5 years was 209,131,95 and 56, respectively. The 1-, 3- and 4-year local control rates were 74. 9%, 50. 4% and 45. 8%, respectively. The 1-, 3-and 4-year overall survival rates were 64. 6%, 30. 8% and 23.6%, respectively, with a median survival time of 18 months. Univariate analysis showed that the significant prognostic factors included the degree of dysphagia, tumor site, lesion length in barium esophagogram and CT image, the largest diameter of lesion in CT image, T stage, N stage, clinical TNM stage, short term effect, and degree of acute esophagitis. Multivariate analysis revealed that the degree of dysphagia, primary tumor site, clinical stage, and radiotherapy technique (3DCRT or late half course 3DCRT) were independent prognostic factors. Conclusions: Three-dimensional conformal radiotherapy is effective and feasible in the treatment of esophageal cancer. The degree of dysphagia, primary tumor site, and clinical stage are independent prognostic factors for survival of patients treated with 3DCRT. (authors)

  17. Reductive debromination of decabromodiphenyl ether (BDE 209) by anaerobic sediment microorganisms

    Parsons, J.; Zegers, B.; Skoczynska, E.; Voogt, P. de [IBED-Environmental Chemistry, Univ. of Amsterdam (Netherlands)

    2004-09-15

    The environmental fate and effects of brominated flame retardants have been receiving increasing interest. Because of their high hydrophobicity, polybrominated diphenyl ether (PBDE) flame retardants in the aquatic environment are mainly present in sediments and biota. The long-term fate of these compounds will to a large extent depend on the potential for microbial degradation in sediments. Dehalogenation in anaerobic sediments has been found for many chlorinated aromatic compounds such as PCBs and PCDDs. Although there is little information available on the microbial degradation of PBDEs, there are reports showing that polybrominated biphenyls are readily debrominated in anaerobic sediments. Complete debromination of PBDEs in marine sediments may be an important route by which these compounds are removed from the marine environment. On the other hand, incomplete debromination may lead to the accumulation of PBDE congeners that are more bioavailable and more readily taken up by marine organisms. Recent reports indicate that BDE 209 is debrominated in the gut of carp. In this study we investigated the potential for reductive debromination of BDE 209 in anaerobic sediment suspensions.

  18. Final Demolition and Disposition of 209-E Critical Mass Laboratory - 12267

    The 209-E Critical Mass Laboratory was constructed in 1960 to provide a heavy shielded reactor room where quantities of plutonium or uranium in solution could be brought to near-critical configurations under carefully controlled and monitored conditions. In the late 1980's, the responsible contractor, Pacific Northwest National Laboratory (PNNL), was directed by the Department of Energy (DOE) to prepare the facility for unoccupied status. The facility was demolished under a Removal Action Work Plan pursuant to the Comprehensive Environmental Response, Compensation, and Liability Act of 1980 (CERCLA). The funding for this project was provided by the American Recovery and Reinvestment Act (ARRA). The primary rooms of concern with regards to contamination in 209-E facility, which is over 9,000 square feet, are the criticality assembly room (CAR), the mix room, and the change room. The CAR contained two reactor hoods (HO-140 and HO-170), which each had a high efficiency particulate air (HEPA) filter system. The CAR contained 13 tanks ranging from 38 L (10 gal) to 401 L (106 gal). Tanks TK-109 and TK-110 are below grade, and were removed as part of this demolition and disposition remedy. Nonradiological and radiological hazardous substances were removed, decontaminated, or fixed in place, prior to demolition. Except for the removal of below grade tanks TK-109 and TK-110, the facility was demolished to slab-on-grade. PNNL performed stabilization and deactivation activities that included removal of bulk fissile material and chemicals, flushing tanks, stabilizing contamination within gloveboxes and hoods, and packaging and removing waste. The removal of the contaminated plutonium equipment and materials from the 209E facility presented a number of challenges similar in nature to those associated with the inventory reduction and cleanup activities at the Plutonium Finishing Plant. Although there were no bulk fissile materials or chemicals within the facility, there were

  19. 45 CFR 400.209 - Claims involving family units which include refugees who have been in the United States more than...

    2010-10-01

    ... refugees who have been in the United States more than 36 months. 400.209 Section 400.209 Public Welfare Regulations Relating to Public Welfare OFFICE OF REFUGEE RESETTLEMENT, ADMINISTRATION FOR CHILDREN AND FAMILIES, DEPARTMENT OF HEALTH AND HUMAN SERVICES REFUGEE RESETTLEMENT PROGRAM Federal Funding...

  20. 49 CFR 40.209 - What procedural problems do not result in the cancellation of a test and do not require correction?

    2010-10-01

    ... 49 Transportation 1 2010-10-01 2010-10-01 false What procedural problems do not result in the cancellation of a test and do not require correction? 40.209 Section 40.209 Transportation Office of the Secretary of Transportation PROCEDURES FOR TRANSPORTATION WORKPLACE DRUG AND ALCOHOL TESTING...

  1. Measurements of high-energy neutron-induced fission ofnatPb and 209Bi

    Couture A.

    2010-10-01

    Full Text Available The CERN Neutron Time-Of-Flight (n_TOF facility is well suited to measure low cross sections as those of neutron-induced fission in subactinides. The cross section ratios of natPb and 209Bi relative to 235U and 238U were measured using PPAC detectors and a fragment coincidence method that allows us to identify the fission events. The present experiment provides first results for neutron-induced fission up to 1 GeV. Good agreement is found with previous experimental data below 200 MeV. The comparison with proton-induced fission indicates that the limiting regime where neutron-induced and proton-induced fission reach equal cross sections is close to 1 GeV.

  2. Prediction of Aqueous Solubility for 209 Polychlorinated Diphenyl Ethers from Molecular Structural Parameters by DFT Method

    XIE Ya-Jie; LIU Hong-Xia; WANG Zun-Yao; ZHU Li-Dan

    2008-01-01

    Optimized calculations of 209 polychlorinated diphenyl ethers (PCDEs) and diphenyl ethers were carried out at the B3LYP/6-31G* level with the Gaussian 98 program. Based on the theoretical linear solvation energy relationship (TLSER) model, the obtained structural parameters were taken as theoretical descriptors to establish the novel QSPR model for predicting aqueous solubility (-lgSw) of PCDEs. The model obtained in this work contains two variables: mean molecular polarizability (α) and the most positive partial charge on a hydrogen atom (qH+), of which R2 = 0.9606 and SD = 0.32. And the results of cross-validation test also show that the model exhibits optimum stability and better predictive power. Moreover, the predictive power of the new model is better than that of MCIs method.

  3. Study of rare processes induced by 209-GeV muons

    Analysis of dimuon final states from 1.4 x 1011 positive and 2.9 x 1010 negative 209-GeV muons in a magnetized iron calorimeter has set a lower limit of 9 GeV/c2 on the mass of a heavy neutral muon (M0), and a 90%-confidence-level upper limit of sigma(μN→bb-barX)B(bb-bar→μX) -36 cm2 for the production of bottom hadrons by muons. The dimuon mass spectrum from 102 678 trimuon final states places a 90%-confidence-level upper limit for the muoproduction of UPSILON states: sigma(μN→μUPSILONX) B(UPSILON→μ+μ-) -39 cm2. In addition, analysis of 71 rare multimuon events, including four- and five-muon final states, is presented

  4. 10 CFR 1707.209 - Procedure when a decision is not made prior to the time a response is required.

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false Procedure when a decision is not made prior to the time a... DNFSB EMPLOYEES AND PRODUCTION OF OFFICIAL RECORDS IN LEGAL PROCEEDINGS Requests for Testimony and Production of Documents § 1707.209 Procedure when a decision is not made prior to the time a response...

  5. 209周期宫腔内人工授精的临床分析%Clinical analysis on intrauterine insemination (IUI) in 209 cycles

    凌秀凤; 顾林; 陈静琴; 王培; 张军强; 翁莉; 赵静

    2006-01-01

    目的:比较不同治疗方案对宫腔内人工授精(IUI)结局的影响,探讨较好的治疗方案以提高IUI的成功率.方法:回顾性分析了162例病人209个IUI治疗周期的治疗方案,根据病人用药情况分为3组:自然周期/IUI组、尿促卵泡素(hMG/IUI)组、克罗米芬(CC)+补佳乐/IUI组,比较各组病人在注射hCG日的子宫内膜厚度、卵泡发育情况、及妊娠结局等.结果:在162例病人中,有20例获得临床妊娠,临床妊娠率为12.34%,周期妊娠率为9.56%;3组病人的年龄、不孕年限,体重指数(BMI)及基础FSH、血清黄体生成素(LH)值、E2无差异;促排卵后,CC+补佳乐/IUI、hMG/IUI组病人的卵泡数高于自然周期组,子宫内膜厚度在自然周期组和hMG/IUI组明显高于CC+补佳乐/IUI组,有极显著性差异,P<0.01;妊娠结局3组分别为9、5、6.结论:IUI是治疗非输卵管因素不孕的一种有效方法,并且自然周期情况下,病人体内激素环境更接近于生理状况,能获得较好的妊娠结局.

  6. Simultaneous description of CF, ICF and TF data of 6,7Li + 209Bi reaction using new ICF mode

    The systematic behavior of the fusion suppression factors and ICF probability as a function of target mass is not well understood, despite the CF experimental data being available for a number of projectile-target systems. In our recent paper, a new method was proposed to calculate the ICF probability which is based on absorption cross sections obtained from the CDCC calculations. In continuation of this work, we have also carried out similar calculations for 6,7Li + 209Bi where the experimental data of CF and ICF is available. In the recent paper by Marta et al., the semi-classical model calculations were attempted to understand CF and ICF data for 6,7Li + 209Bi, which was not explaining the data quite well. Here, we have demonstrated the use of quantum mechanical treatment for simultaneous explanation of CF, ICF and TF over a large energy range

  7. Analysis of 209 Bi and 238 U photofission cross section in the quasi-deuteron region of photonuclear absorption

    An analysis of the photofission reactions in the quasi-deuteron energy range of photonuclear absorption (∼ 30-140 MeV) has been performed for 209 Bi and 238 U nuclei. Experimental cross section data available in the literature have been compared with calculated values obtained from a model in which the incoming photon is assumed to be absorbed by a neutron-proton pair (Levinger's quasi-deuteron photoabsorption), followed by a mechanism of evaporation-fission competition for the excited residual nuclei. The model has been shown to reproduce the main experimental features of 209 Bi and 238 U photofission cross section, although unexplained differences still remain in the case of 238 U-fission by 30-50 MeV incident photons. (author). 49 refs, 10 figs, 2 tabs

  8. Underground Research Laboratory room 209 instrument array. Vol. 1,2

    An in situ excavation response test was conducted at the 240 Level of the Underground Research Laboratory (URL). The test was carried out in conjunction with the drill-and-blast excavation of a near-circular tunnel (Room 209), about 3.5 m in diameter. The tunnel was excavated through a tunnel axis. Three modelling groups made predictions of the response of the rock mass and hydraulic behaviour of the water-bearing fracture to excavation. The tunnel was excavated in two stages, a pilot tunnel followed by a slash, providing two complete sets of response measurements. Careful excavation was carried out to ensure the excavation shape after each blast round agreed closely with the planned shape incorporated in the numerical models. Instrumentation installed before the tunnel was extended monitored the complete strain tensor at eight locations around the tunnel, radial displacements and piezometric pressures at nine locations in the fracture. As well, tunnel convergence, water flows from the fracture, and hydraulic conductivity of the fracture at nine locations, were measured after each excavation step. The final tunnel profiles were accurately surveyed, and the geology was mapped in detail. The results are presented in this report for comparison with the modellers' predictions (reported in AECL--9566-2). Some preliminary conclusions and recommendations regarding the field testing are presented

  9. Evidence for a CO desorption front in the outer AS 209 disk

    Huang, Jane; Andrews, Sean M

    2016-01-01

    Millimeter observations of CO isotopologues are often used to make inferences about protoplanetary disk gas density and temperature structures. The accuracy of these estimates depends on our understanding of CO freezeout and desorption from dust grains. Most models of these processes indicate that CO column density decreases monotonically with distance from the central star due to a decrease in gas density and freezeout beyond the CO snowline. We present ALMA Cycle 2 observations of $^{12}$CO, $^{13}$CO, and C$^{18}$O $J=2-1$ emission that instead suggest CO enhancement in the outer disk of T Tauri star AS 209. Most notably, the C$^{18}$O emission consists of a central peak and a ring at a radius of $\\sim1''$ (120 AU), well outside the expected CO snowline. We propose that the ring arises from the onset of CO desorption near the edge of the millimeter dust disk. CO desorption exterior to a CO snowline may occur via non-thermal processes involving cosmic rays or high-energy photons, or via a radial thermal inv...

  10. Life time of the HFS transition in Li-like {sup 209}Bi{sup 80+}

    Geppert, C.; Noertershaeuser, W. [Institut fuer Kernchemie, Uni Mainz (Germany); GSI, Darmstadt (Germany); Hannen, V.; Joehren, R.; Ortjohann, H.W.; Vollbrecht, J.; Weinheimer, C. [Institut fuer Kernphysik, Uni Muenster (Germany); Kuehl, T. [Institut fuer Kernchemie, Uni Mainz (Germany); GSI, Darmstadt (Germany); Helmholtz Institut Jena (Germany); S' anchez, R.; Winters, D. [GSI, Darmstadt (Germany); Stoehlker, T. [Institut fuer Kernchemie, Uni Mainz (Germany); GSI, Darmstadt (Germany); Helmholtz Institut Jena (Germany); Uni Jena (Germany)

    2014-07-01

    Measuring the hyperfine splitting of heavy, highly charged ions enables tests of QED in strong fields. HFS calculations have a relative uncertainty of more than 10{sup -3} due to the distribution of the magnetic moment (Bohr-Weisskopf-Effekt). With an appropriate comparison of H- and Li-like ions this nuclear structure contribution can be suppressed. Bismuth is a suitable element for these studies, as the HFS splitting for both configurations are in a wavelength range suitable for laser spectroscopy. For this purpose the two ion species were stored in the Experimental Storage Ring at GSI at a velocity of β = 0.71. To efficiently collect the forward emitted photons a specially developed movable detector system was used. Thereby the HFS of Li-like {sup 209}Bi{sup 80+} was successfully measured for the first time. Besides the determination of the transition energy it was possible to extract the lifetime of the transition out of the collected data. The corresponding analysis and the results are presented on this poster.

  11. Comet 209P/LINEAR and the associated Camelopardalids meteor shower

    Ye, Q.; Hui, M.; Wiegert, P.; Campbell-Brown, M.; Brown, P.; Weryk, R.

    2014-07-01

    Previous studies have suggested that comet 209P/LINEAR may produce strong meteor activity on the Earth on 2014 May 24. Here we present our observations and simulations prior to the event. We reanalyze the optical observations of P/LINEAR obtained during its 2009 apparition to model the corresponding meteor stream. We find that the comet is relatively depleted in dust production, with Afρ at 1-cm level within eight months around its perihelion. A syndyne simulation shows that the optical cometary tail is dominated by larger particles with β˜0.003. Numerical simulation of the cometary dust trails confirms the arrival of particles on 2014 May 24 from some of the 1798--1979 trails, with nominal radiant in the constellation of Camelopardalis. Given that the comet is found to be depleted in dust production, we concluded that a meteor storm may be unlikely. However, our simulation also shows that the size distribution of the arrived particles is skewed strongly towards larger particles, which, coupling with the result of the syndyne simulation, suggested that the event (if detectable) may be dominated by bright meteors. Preliminary results from the observations of P/LINEAR during its 2014 apparition as well as the Camelopardalids meteor shower will also be presented.

  12. Life time of the HFS transition in Li-like 209Bi80+

    Measuring the hyperfine splitting of heavy, highly charged ions enables tests of QED in strong fields. HFS calculations have a relative uncertainty of more than 10-3 due to the distribution of the magnetic moment (Bohr-Weisskopf-Effekt). With an appropriate comparison of H- and Li-like ions this nuclear structure contribution can be suppressed. Bismuth is a suitable element for these studies, as the HFS splitting for both configurations are in a wavelength range suitable for laser spectroscopy. For this purpose the two ion species were stored in the Experimental Storage Ring at GSI at a velocity of β = 0.71. To efficiently collect the forward emitted photons a specially developed movable detector system was used. Thereby the HFS of Li-like 209Bi80+ was successfully measured for the first time. Besides the determination of the transition energy it was possible to extract the lifetime of the transition out of the collected data. The corresponding analysis and the results are presented on this poster.

  13. Evidence for a CO Desorption Front in the Outer AS 209 Disk

    Huang, Jane; Öberg, Karin I.; Andrews, Sean M.

    2016-05-01

    Millimeter observations of CO isotopologues are often used to make inferences about protoplanetary disk gas density and temperature structures. The accuracy of these estimates depends on our understanding of CO freezeout and desorption from dust grains. Most models of these processes indicate that CO column density decreases monotonically with distance from the central star due to a decrease in gas density and freezeout beyond the CO snowline. We present ALMA Cycle 2 observations of 12CO, 13CO, and C18O J=2-1 emission that instead suggest CO enhancement in the outer disk of T Tauri star AS 209. Most notably, the C18O emission consists of a central peak and a ring at a radius of ∼ 1\\prime \\prime (120 au), well outside the expected CO snowline. We propose that the ring arises from the onset of CO desorption near the edge of the millimeter dust disk. CO desorption exterior to a CO snowline may occur via non-thermal processes involving cosmic rays or high-energy photons, or via a radial thermal inversion arising from dust migration.

  14. Optical and Near-Infrared Polarimetry for a Highly Dormant Comet 209P/LINEAR

    Kuroda, Daisuke; Watanabe, Makoto; Akitaya, Hiroshi; Takahashi, Jun; Hasegawa, Sunao; Ui, Takahiro; Kanda, Yuka; Takaki, Katsutoshi; Itoh, Ryosuke; Moritani, Yuki; Imai, Masataka; Goda, Shuhei; Takagi, Yuhei; Morihana, Kumiko; Honda, Satoshi; Arai, Akira; Hanayama, Hidekazu; Nagayama, Takahiro; Nogami, Daisaku; Sarugaku, Yuki; Murata, Katsuhiro; Morokuma, Tomoki; Saito, Yoshihiko; Oasa, Yumiko; Sekiguchi, Kazuhiro; Watanabe, Jun-ichi

    2015-01-01

    We conducted an optical and near-infrared polarimetric observation of the highly dormant Jupiter-Family Comet, 209P/LINEAR. Because of its low activity, we were able to determine the linear polarization degrees of the coma dust particles and nucleus independently, that is $P_n$=30.3$^{+1.3}_{-0.9}$% at $\\alpha$=92.2$^\\circ$ and $P_n$=31.0$^{+1.0}_{-0.7}$% at $\\alpha$=99.5$^\\circ$ for the nucleus, and $P_c$=28.8$^{+0.4}_{-0.4}$% at $\\alpha$=92.2$^\\circ$ and 29.6$^{+0.3}_{-0.3}$% at $\\alpha$=99.5$^\\circ$ for the coma. We detected no significant variation in $P$ at the phase angle coverage of 92.2$^\\circ$-99.5$^\\circ$, which may imply that the obtained polarization degrees are nearly at maximum in the phase-polarization curves. By fitting with an empirical function, we obtained the maximum values of linear polarization degrees $P_\\mathrm{max}$=30.8% for the nucleus and $P_\\mathrm{max}$=29.6% for the dust coma. The $P_\\mathrm{max}$ of the dust coma is consistent with those of dust-rich comets. The low geometric a...

  15. Fission fragment angular distributions in proton-induced fission of 209 Bi(p,t) and 197 Au(p,f)

    De, S S; N H; M. L.

    2001-01-01

      The fission fragment angular distributions have been measured for proton-induced fission of 209Bi and 197Au nuclei using surface barrier detectors at several energies between 25 MeV and 30 MeV. The experimental anisotropies are found to be in agreement with the predictions of the Standard Saddle-Point Statistical Model (SSPSM). The fission cross sections of 209Bi 197Au nuclei were also measured and compared with the previous works.

  16. 40 CFR 33.209 - Can EPA re-evaluate the MBE or WBE status of an entity after EPA certifies it to be an MBE or WBE?

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Can EPA re-evaluate the MBE or WBE status of an entity after EPA certifies it to be an MBE or WBE? 33.209 Section 33.209 Protection of... EPA re-evaluate the MBE or WBE status of an entity after EPA certifies it to be an MBE or WBE? (a)...

  17. Fission fragment angular distributions in proton-induced fission of 209 Bi(p,t and 197 Au(p,f

    S. S.

    2001-12-01

    Full Text Available   The fission fragment angular distributions have been measured for proton-induced fission of 209Bi and 197Au nuclei using surface barrier detectors at several energies between 25 MeV and 30 MeV. The experimental anisotropies are found to be in agreement with the predictions of the Standard Saddle-Point Statistical Model (SSPSM. The fission cross sections of 209Bi 197Au nuclei were also measured and compared with the previous works.

  18. Preclinical evaluation of [18F]PK-209, a new PET ligand for imaging the ion-channel site of NMDA receptors

    Introduction: The present study was designed to assess whether [18F]PK-209 (3-(2-chloro-5-(methylthio)phenyl)-1-(3-([18F]fluoromethoxy) phenyl)-1-methylguanidine) is a suitable ligand for imaging the ion-channel site of N-methyl-D-aspartate receptors (NMDArs) using positron emission tomography (PET). Methods: Dynamic PET scans were acquired from male rhesus monkeys over 120 min, at baseline and after the acute administration of dizocilpine (MK-801, 0.3 mg/kg; n = 3/condition). Continuous and discrete arterial blood samples were manually obtained, to generate metabolite-corrected input functions. Parametric volume-of-distribution (VT) images were obtained using Logan analysis. The selectivity profile of PK-209 was assessed in vitro, on a broad screen of 79 targets. Results: PK-209 was at least 50-fold more selective for NMDArs over all other targets examined. At baseline, prolonged retention of radioactivity was observed in NMDAr-rich cortical regions relative to the cerebellum. Pretreatment with MK-801 reduced the VT of [18F]PK-209 compared with baseline in two of three subjects. The rate of radioligand metabolism was high, both at baseline and after MK-801 administration. Conclusions: PK-209 targets the intrachannel site with high selectivity. Imaging of the NMDAr is feasible with [18F]PK-209, despite its fast metabolism. Further in vivo evaluation in humans is warranted

  19. A multi-biomarker risk assessment of the impact of brominated flame retardant-decabromodiphenyl ether (BDE209) on the antioxidant system of earthworm Eisenia fetida.

    Zhang, Wei; Liu, Kou; Chen, Lin; Chen, Lei; Lin, Kuangfei; Fu, Rongbing

    2014-07-01

    Decabromodiphenyl ether (BDE209) is the major contaminant at e-waste recycling sites (EWRSs), and its potential toxicological effects on terrestrial organisms have received extensive attention. However, the impacts of BDE209 on the antioxidant defense system in terrestrial organisms remain vague. Therefore, indoor incubation tests were performed systematically on control and contaminated soil samples to determine the effects of BDE209 on the antioxidant system of earthworm Eisenia fetida. The results showed that compared to the controls, superoxide dismutase (SOD) activities in all treated groups were elevated significantly after 21 and 28 days exposure; catalase (CAT) activities were much higher in all tests during the entire exposure period; peroxidase (POD) and glutathione-s-transferase (GST) activities generally decreased and indicated contrary response trend; the total antioxidant capacity (T-AOC) after exposure to low level of BDE209 (1 mg kg(-1)) was induced, whereas at 10 and 100 mg kg(-1) concentrations it showed suppression status; electron paramagnetic resonance (EPR) spectra suggested that hydroxyl radicals (OH) in earthworms were significantly induced by BDE209; the changes in malondialdehyde (MDA) contents suggested that reactive oxygen species (ROS) might lead to cellular lipid peroxidation in earthworms. The results of these observations suggested that severe oxidative stress occurred in E. fetida, and it may play an important role in inducing the BDE209 toxicity to earthworms. PMID:25016100

  20. Uptake and depuration kinetics of lead (Pb) and biomarker responses in the earthworm Eisenia fetida after simultaneous exposure to decabromodiphenyl ether (BDE209).

    Zhang, Wei; Liu, Kou; Li, Jing; Chen, Lin; Lin, Kuangfei

    2015-03-01

    Lead (Pb) and BDE209 (decabromodiphenyl ether) are the main contaminants at e-waste recycling sites, and their potential toxicological effects on terrestrial organisms have received extensive attention. However, the impact on earthworms of exposure to the two chemicals remains almost unknown. Therefore, indoor incubation tests were performed on control and contaminated soil samples to determine the uptake and toxicity of Pb in the presence of BDE209 to the earthworm Eisenia fetida. The results have demonstrated that the presence of BDE209 facilitated the release of Pb into soil porewater. Compared with exposure to Pb alone, simultaneous exposure to BDE209 significantly enhanced the Pb uptake rate at the level of pGST)] and total antioxidant capacity (T-AOC). The decline trend in antioxidant enzymatic activities and T-AOC might explain an increase in lipid peroxidation reflected by the observed augment in malondialdehyde (MDA) level. Moreover, a biomarker of the lysosomal membrane stability, measured by neutral red retention time (NRRT), was also investigated. The NRRT obviously declined in the joint presence of BDE209, indicating a distinct time-response relationship. The results of these observations have provided a basic understanding of the potential eco-toxicological effects of joint heavy metal and BDE209 exposure on terrestrial invertebrates in a multi-contamination context of ecosystems. PMID:25483371

  1. Synthesis of element 113 in the reaction 209Bi(70Zn, n)278113

    The convincing candidate event of the isotope of the 113th element, were observed, for the first time, in the 209Bi+70Zn reaction at a beam energy of 349.0 MeV with a total dose of 1.7 x 1019. Alpha decay energies and decay times of the candidates, 278113, 274111, and 270Mt, were (11.68±0.04 MeV, 0.344 ms), (11.15±0.07 MeV, 9.26 ms), and (10.03±0.07 MeV, 7.16 ms), respectively. The production cross section of the isotope was deduced to be 55-45+150 fb(10-39 cm2). The experiment was performed at RIIKEN (The Institute of Physical and Chemical Research) Linear Accelerator (RILAC) Facility. The evaporation residues produced by the reaction with a 70Zn beam provided by the RILAC and the bismuth targets, were separated by a gas-filled recoil separator (GARIS) from the beam particles and the target recoils, and collected at the focus of GARIS. We observed an event of implantation of an evaporation residue in the position-sensitive semiconductor detector followed by four consecutive alpha decays terminated by a spontaneous fission decay. Assignment of the event was based on genetic correlation of sequential alpha decays to the already known nuclides 266Bh and 262Db. The fourth alpha decay and the following spontaneous fission decay were assigned to be the decays of 266Bh and 262Db, respectively because of agreements of decay energies and decay times with the reported values. As a consequence, the preceding three alpha decays were assigned to be ones of 278113, 274111, and 270Mt.

  2. Experimental Cross Sections for Reactions of Heavy Ions and 208Pb, 209Bi, 238U, and 248Cm Targets

    The study of the reactions between heavy ions and 208Pb, 209Bi, 238U, and 248 Cm targets was performed to look at the differences between the cross sections of hot and cold fusion reactions. Experimental cross sections were compared with predictions from statistical computer codes to evaluate the effectiveness of the computer code in predicting production cross sections. Hot fusion reactions were studied with the MG system, catcher foil techniques and the Berkeley Gas-filled Separator (BGS). 3n- and 4n-exit channel production cross sections were obtained for the 238U(18O,xn)256-xFm, 238U(22Ne,xn)260-xNo, and 248Cm(15N,xn)263-xLr reactions and are similar to previous experimental results. The experimental cross sections were accurately modeled by the predictions of the HIVAP code using the Reisdorf and Schaedel parameters and are consistent with the existing systematics of 4n exit channel reaction products. Cold fusion reactions were examined using the BGS. The 208Pb(48Ca,xn)256-xNo, 208Pb(50Ti,xn)258-xRf, 208Pb(51V,xn)259-xDb, 209Bi(50Ti,xn)259-xDb, and 209Bi(51V,xn)260-xSg reactions were studied. The experimental production cross sections are in agreement with the results observed in previous experiments. It was necessary to slightly alter the Reisdorf and Schaedel parameters for use in the HIVAP code in order to more accurately model the experimental data. The cold fusion experimental results are in agreement with current 1n- and 2n-exit channel systematics

  3. Experimental Cross Sections for Reactions of Heavy Ions and 208Pb, 209Bi, 238U, and 248Cm Targets

    Patin, Joshua B.

    2002-05-24

    The study of the reactions between heavy ions and {sup 208}Pb, {sup 209}Bi, {sup 238}U, and {sup 248} Cm targets was performed to look at the differences between the cross sections of hot and cold fusion reactions. Experimental cross sections were compared with predictions from statistical computer codes to evaluate the effectiveness of the computer code in predicting production cross sections. Hot fusion reactions were studied with the MG system, catcher foil techniques and the Berkeley Gas-filled Separator (BGS). 3n- and 4n-exit channel production cross sections were obtained for the {sup 238}U({sup 18}O,xn){sup 256-x}Fm, {sup 238}U({sup 22}Ne,xn){sup 260-x}No, and {sup 248}Cm({sup 15}N,xn){sup 263-x}Lr reactions and are similar to previous experimental results. The experimental cross sections were accurately modeled by the predictions of the HIVAP code using the Reisdorf and Schaedel parameters and are consistent with the existing systematics of 4n exit channel reaction products. Cold fusion reactions were examined using the BGS. The {sup 208}Pb({sup 48}Ca,xn){sup 256-x}No, {sup 208}Pb({sup 50}Ti,xn){sup 258-x}Rf, {sup 208}Pb({sup 51}V,xn){sup 259-x}Db, {sup 209}Bi({sup 50}Ti,xn){sup 259-x}Db, and {sup 209}Bi({sup 51}V,xn){sup 260-x}Sg reactions were studied. The experimental production cross sections are in agreement with the results observed in previous experiments. It was necessary to slightly alter the Reisdorf and Schaedel parameters for use in the HIVAP code in order to more accurately model the experimental data. The cold fusion experimental results are in agreement with current 1n- and 2n-exit channel systematics.

  4. Polymorphisms in the feline TNFA and CD209 genes are associated with the outcome of feline coronavirus infection.

    Wang, Ying-Ting; Hsieh, Li-En; Dai, Yu-Rou; Chueh, Ling-Ling

    2014-01-01

    Feline infectious peritonitis (FIP), caused by feline coronavirus (FCoV) infection, is a highly lethal disease without effective therapy and prevention. With an immune-mediated disease entity, host genetic variant was suggested to influence the occurrence of FIP. This study aimed at evaluating cytokine-associated single nucleotide polymorphisms (SNPs), i.e., tumor necrosis factor alpha (TNF-α), receptor-associated SNPs, i.e., C-type lectin DC-SIGN (CD209), and the five FIP-associated SNPs identified from Birman cats of USA and Denmark origins and their associations with the outcome of FCoV infection in 71 FIP cats and 93 FCoV infected non-FIP cats in a genetically more diverse cat populations. A promoter variant, fTNFA - 421 T, was found to be a disease-resistance allele. One SNP was identified in the extracellular domain (ECD) of fCD209 at position +1900, a G to A substitution, and the A allele was associated with FIP susceptibility. Three SNPs located in the introns of fCD209, at positions +2276, +2392, and +2713, were identified to be associated with the outcome of FCoV infection, with statistical relevance. In contrast, among the five Birman FIP cat-associated SNPs, no genotype or allele showed significant differences between our FIP and non-FIP groups. As disease resistance is multifactorial and several other host genes could involve in the development of FIP, the five genetic traits identified in this study should facilitate in the future breeding of the disease-resistant animal to reduce the occurrence of cats succumbing to FIP. PMID:25512064

  5. Evaluation of enhancement patterns using three-dimensional dynamic contrast-enhanced MR imaging in 209 cases of breast cancer

    The purpose of this study was to evaluate contrast-enhanced patterns using three-dimensional (3D) dynamic MR imaging in 209 cases of breast cancer. Three-dimensional dynamic imaging of the breast (1.5-T scanner) was performed in 755 cases. Of 227 breast carcinomas, 209 cases that were histologically confirmed were enrolled in this study. The histological diagnoses included ductal carcinoma in situ (DCIS) (n=12), invasive ductal carcinoma (n=176), mucinous carcinoma (n=10), meduliary carcinoma (n=4), invasive lobular carcinoma (n=6), and other (n=1). Tumor size was a mean 24.6 mm in diameter (range, 7-110 mm), including 110 cases of small breast carcinomas (≤2 cm). The contrast-enhancement pattern was analyzed from the early phase of 3D-MRI and the post-contrast T1-weighted spin echo (SE) image acquired before the delayed phase of 3D-MRI. The type of peripheral enhancement (PE) was evaluated on the early and delayed phases of 3D-MRI. These enhancement patterns were also compared with the histological findings of small breast carcinomas. The sensitivity of the 209 cases of breast carcinoma was 99% (207/209) on 3D dynamic MRI. Two hundred six cases (98.6%), including all DCIS, showed strong enhancement on the early phase of 3D MRI. An increased washout pattern showing signal intensity lower than that of fat on post-contrast T1-weighted imaging was noted in 201 cases (96.1%), of which 179 cases (85.6%) showed washout patterns. PE was identified in 63 cases (30.4%) and in 35 of 110 cases of small breast carcinoma (31.8%). Delayed PE following central washout was noted in 65% of 63 cases and 71.4% of 35 cases of small breast carcinoma. Delayed PE was well correlated with marginal fibrosis. Three-dimensional dynamic MRI of the breast was highly sensitive for breast carcinoma. Delayed PE following central washout was considered a specific finding of breast carcinoma. It is important to understand the enhancement patterns of 3D dynamic MRI for excellent specificity of

  6. Inclusive Jet Production in Photon-Photon Collisions at $\\sqrt{s_{ee}}$ from 189 to 209 GeV

    Abbiendi, G; Åkesson, P F; Alexander, G; Anagnostou, G; Anderson, K J; Asai, S; Axen, D; Bailey, I; Barberio, E; Barillari, T; Barlow, R J; Batley, R J; Bechtle, P; Behnke, T; Bell, K W; Bell, P J; Bella, G; Bellerive, A; Benelli, G; Bethke, S; Biebel, O; Boeriu, O; Bock, P; Boutemeur, M; Braibant, S; Brown, R M; Burckhart, H J; Campana, S; Capiluppi, P; Carnegie, R K; Carter, A A; Carter, J R; Chang, C Y; Charlton, D G; Ciocca, C; Csilling, A; Cuffiani, M; Dado, S; Dallavalle, G M; de Roeck, A; De Wolf, E A; Desch, K; Dienes, B; Dubbert, J; Duchovni, E; Duckeck, G; Duerdoth, I P; Etzion, E; Fabbri, F; Ferrari, P; Fiedler, F; Fleck, I; Ford, M; Frey, A; Gagnon, P; Gary, J W; Geich-Gimbel, C; Giacomelli, G; Giacomelli, P; Giunta, M; Goldberg, J; Gross, E; Grunhaus, J; Gruwé, M; Sen-Gupta, A; Hajdu, C; Hamann, M; Hanson, G G; Harel, A; Hauschild, M; Hawkes, C M; Hawkings, R; Herten, G; Heuer, R D; Hill, J C; Horváth, D; Igo-Kemenes, P; Ishii, K; Jeremie, H; Jovanovic, P; Junk, T R; Kanzaki, J; Karlen, D; Kawagoe, K; Kawamoto, T; Keeler, R K; Kellogg, R G; Kennedy, B W; Kluth, S; Kobayashi, T; Kobel, M; Komamiya, S; Kramer, T; Krasznahorkay, A; Krieger, P; Von Krogh, J; Kühl, T; Kupper, M; Lafferty, G D; Landsman, H; Lanske, D; Lellouch, D; Letts, J; Levinson, L; Lillich, J; Lloyd, S L; Loebinger, F K; Lü, J; Ludwig, A; Ludwig, J; Mader, W; Marcellini, S; Martin, A J; Mashimo, T; Mättig, P; McKenna, J; McPherson, R A; Meijers, F; Menges, W; Merritt, F S; Mes, H; Meyer, N; Michelini, A; Mihara, S; Mikenberg, G; Miller, D J; Mohr, W; Mori, T; Mutter, A; Nagai, K; Nakamura, I; Nanjo, H; Neal, H A; Nisius, R; O'Neale, S W; Oh, A; Oreglia, M J; Orito, S; Pahl, C; Pásztor, G; Pater, J R; Pilcher, J E; Pinfold, J L; Plane, D E; Pooth, O; Przybycien, M; Quadt, A; Rabbertz, K; Rembser, C; Renkel, P; Roney, J M; Rossi, A M; Rozen, Y; Runge, K; Sachs, K; Saeki, T; Sarkisyan-Grinbaum, E; Schaile, A D; Schaile, O; Scharff-Hansen, P; Schiecks, J; Schörner-Sadenius, T; Schröder, M; Schumacher, M; Seuster, R; Shears, T G; Shen, B C; Sherwood, P; Skuja, A; Smith, A M; Sobie, R J; Söldner-Rembold, S; Spanó, F; Stahl, A; Strom, D; Ströhmer, R; Tarem, S; Tasevsky, M; Teuscher, R; Thomson, M A; Torrence, E; Toya, D; Tran, P; Trigger, I; Trócsányi, Z L; Tsur, E; Turner-Watson, M F; Ueda, I; Ujvári, B; Vollmer, C F; Vannerem, P; Vertesi, R; Verzocchi, M; Voss, H; Vossebeld, J; Ward, C P; Ward, D R; Watkins, P M; Watson, A T; Watson, N K; Wells, P S; Wengler, T; Wermes, N; Wilson, G W; Wilson, J A; Wolf, G; Wyatt, T R; Yamashita, S; Zer-Zion, D; Zivkovic, L

    2008-01-01

    Inclusive jet production (e+e- -> e+e- +jet+X) is studied in collisions of quasi-real photons radiated by the LEP beams at e+e- centre-of-mass energies sqrt see from 189 to 209 GeV. Jets are reconstructed using the kp jet algorithm. The inclusive differential cross-section is measured as a function of the jet transverse momentum, ptjet, in the range 5

  7. Determination of the {sup 209}Bi(n,{gamma}){sup 210}Bi and {sup 209}Bi(n,{gamma}){sup 210m,g}Bi reaction cross sections in a cold neutron beam

    Borella, A. [European Commission, Joint Research Centre, Institute for Reference Materials and Measurements, B-2440 Geel (Belgium); SCK-CEN, Boeretang 200, B-2400 Mol (Belgium); Belgya, T. [Institute of Isotope, Hungarian Academy of Sciences, POB 77, H-1525 Budapest (Hungary); Kopecky, S. [European Commission, Joint Research Centre, Institute for Reference Materials and Measurements, B-2440 Geel (Belgium); Gunsing, F. [CEA/Saclay, DSM/Irfu, F-91191 Gif-sur-Yvette (France); Moxon, M. [Hyde Copse 3, Marcham (United Kingdom); Rejmund, M. [GANIL, F-14076 Caen (France); Schillebeeckx, P., E-mail: peter.schillebeeckx@ec.europa.e [European Commission, Joint Research Centre, Institute for Reference Materials and Measurements, B-2440 Geel (Belgium); Szentmiklosi, L. [Institute of Isotope, Hungarian Academy of Sciences, POB 77, H-1525 Budapest (Hungary)

    2011-01-15

    Gamma-ray transitions following neutron capture in {sup 209}Bi have been studied at the cold neutron beam facility of the Budapest Neutron Centre. Measurements have been performed using a coaxial HPGe detector with Compton suppression. Partial capture cross sections at a velocity of 2200 m/s (or a neutron energy of 25.3 meV) have been deduced relatively to the one for the 4055 keV transition after thermal neutron capture in {sup 209}Bi. This partial cross section of (8.07 {+-} 0.14) mb has in turn been obtained from measurements with a bismuth nitrate target relatively to the cross section for the 1884 keV transition after thermal neutron capture in {sup 14}N. Shell model calculations have been performed to deduce the half-life of the 3rd excited state at 320 keV and to assign the M1 multipolarity of the 320 keV transition to the ground state. Lower limits of (21.4 {+-} 0.8) mb and (18.2 {+-} 0.7) mb for the cross sections to the ground state and to the isomeric state, respectively, have been deduced from the data for the gamma rays feeding these states. The results obtained in this work are in good agreement with experimental data reported in the literature. The thermal total capture cross section has been compared with the contribution due to observed s-wave resonances.

  8. Dermal-type macrophages expressing CD209/DC-SIGN show inherent resistance to dengue virus growth.

    Wing-Hong Kwan

    Full Text Available BACKGROUND: An important question in dengue pathogenesis is the identity of immune cells involved in the control of dengue virus infection at the site of the mosquito bite. There is evidence that infection of immature myeloid dendritic cells plays a crucial role in dengue pathogenesis and that the interaction of the viral envelope E glycoprotein with CD209/DC-SIGN is a key element for their productive infection. Dermal macrophages express CD209, yet little is known about their role in dengue virus infection. METHODS AND FINDINGS: Here, we showed that dermal macrophages bound recombinant envelope E glycoprotein fused to green fluorescent protein. Because dermal macrophages stain for IL-10 in situ, we generated dermal-type macrophages from monocytes in the presence of IL-10 to study their infection by dengue virus. The macrophages were able to internalize the virus, but progeny virus production was undetectable in the infected cells. In addition, no IFN-alpha was produced in response to the virus. The inability of dengue virus to grow in the macrophages was attributable to accumulation of internalized virus particles into poorly-acidified phagosomes. CONCLUSIONS: Aborting infection by viral sequestration in early phagosomes would present a novel means to curb infection of enveloped virus and may constitute a prime defense system to prevent dengue virus spread shortly after the bite of the infected mosquito.

  9. When Comets Get Old: A Synthesis of Comet and Meteor Observations of the Low Activity Comet 209P/LINEAR

    Ye, Quan-Zhi; Brown, Peter G; Campbell-Brown, Margaret D; Pokorný, Petr; Wiegert, Paul A; Gao, Xing

    2015-01-01

    It is speculated that some weakly active comets may be transitional objects between active and dormant comets. These objects are at a unique stage of the evolution of cometary nuclei, as they are still identifiable as active comets, in contrast to inactive comets that are observationally indistinguishable from low albedo asteroids. In this paper, we present a synthesis of comet and meteor observations of Jupiter-family comet 209P/LINEAR, one of the most weakly active comets recorded to-date. Images taken by the Xingming 0.35-m telescope and the Gemini Flamingo-2 camera are modeled by a Monte Carlo dust model, which yields a low dust ejection speed ($1/10$ of that of moderately active comets), dominance of large dust grains, and a low dust production of $0.4~\\mathrm{kg \\cdot s^{-1}}$ at 19~d after the 2014 perihelion passage. We also find a reddish nucleus of 209P/LINEAR that is similar to D-type asteroids and most Trojan asteroids. Meteor observations with the Canadian Meteor Orbit Radar (CMOR), coupled with ...

  10. Interaction between FOXO1A-209 Genotype and Tea Drinking is Significantly Associated with Reduced Mortality at Advanced Ages

    Zeng, Yi; Chen, Huashuai; Ni, Ting;

    2016-01-01

    Based on the genotypic/phenotypic data from Chinese Longitudinal Healthy Longevity Survey (CLHLS) and Cox proportional hazard model, the present study demonstrates that interactions between carrying FOXO1A-209 genotypes and tea drinking are significantly associated with lower risk of mortality at...... interventions, including tea drinking, may, in part, depend upon individual genetic profiles, and the research on the effects of nutrigenomics interactions could potentially be useful for rejuvenation therapies in the clinic or associated healthy aging intervention programs.......Based on the genotypic/phenotypic data from Chinese Longitudinal Healthy Longevity Survey (CLHLS) and Cox proportional hazard model, the present study demonstrates that interactions between carrying FOXO1A-209 genotypes and tea drinking are significantly associated with lower risk of mortality at...... advanced ages. Such significant association is replicated in two independent Han Chinese CLHLS cohorts (p =0.028-0.048 in the discovery and replication cohorts, and p =0.003-0.016 in the combined dataset). We found the associations between tea drinking and reduced mortality are much stronger among carriers...

  11. Measurement of cross sections of the 210Po production reaction by keV-neutron capture of 209Bi

    The cross sections of the 209Bi(n, γ)210gBi reaction were measured in the keV-neutron region, using an activation method with the detection of α rays from 210Po. Pulsed keV neutrons were generated from the 7Li(p, n)7Be reaction by a 1.5-ns bunched proton beam from the 3-MV Pelletron accelerator of the Research Laboratory for Nuclear Reactors at the Tokyo Institute of Technology. The 209Bi samples were metallic bismuth evaporated on a gold backing. After sample irradiation, the 412-keV γrays from the gold backing were measured with on HPGe detector, and then the α rays from 210Po nuclei in the bismuth sample were measured with a Si surface barrier detector. The derived cross sections were 1.9±0.4 mb and 0.62±0.14 mb at the average neutron energies of 30 keV and 534 keV, respectively. The present value at 30 keV is in agreement with the previous measurement at 24 keV of Booth et al., but about a quarter of the evaluation of JENDL Activation cross section File. The present result at 534 keV is the first experimental one around 500 keV, and is about a half of the evaluation of JENDL Activation cross section File. (author)

  12. Antioxidant and gene expression responses of Eisenia fetida following repeated exposure to BDE209 and Pb in a soil-earthworm system.

    Hu, Shuangqing; Zhang, Wei; Li, Jing; Lin, Kuangfei; Ji, Rong

    2016-06-15

    This study first adopted repeated treatment model to investigate stress responses in earthworms (Eisenia fetida) following exposure to decabromodiphenyl ether (BDE209) and lead (Pb), which are the mainly co-existed contaminants at e-waste recycling sites. We evaluated the impacts of BDE209-Pb on antioxidative enzyme (superoxide dismutase, SOD; catalase, CAT) activities, malondialdehyde (MDA) contents and transcriptional levels of three target genes (SOD, CAT and Hsp70), and further explored the relationships among these biomarkers. Results demonstrated that almost all the parameters were generally induced and the responses followed certain dose-effect relationships. Compared to the controls, a significant (P0.64). The observations could provide important information of ecotoxicological effects of BDE209-Pb in a soil-earthworm system as well as the mechanism of antioxidant defense. PMID:26971217

  13. Evaluation of MS-209, a novel multidrug-resistance-reversing agent, in tumour-bearing mice by technetium-99m-MIBI imaging

    MS-209 is a newly synthesised multidrug-resistance (MDR)-reversing agent with few side-effects. In this study, we evaluated the effect of MS-209 on P-glycoprotein (Pgp)-positive tumours in mice by means of technetium-99m methoxyisobutylisonitrile (MIBI) imaging. Mice received Pgp-negative KB-3-1 or Pgp-positive KB-C1 cell xenografts. KB-3-1-bearing mice were administered 0 or 100 mg/kg of MS-209 (groups S0 and S100, respectively), and KB-C1-bearing mice 0, 50, 100 or 200 mg/kg (groups R0, R50, R100 and R200, respectively), 30 min before imaging studies. Dynamic 99mTc-MIBI images were acquired for 30 min, followed by biodistribution studies. Washout of 99mTc-MIBI from the tumours was faster in group R0 than in group S0 on visual analysis, and the washout half-time estimated by region of interest analysis was shorter in group R0 than in group S0. Biodistribution studies revealed that 99mTc-MIBI accumulation in tumours (expressed as %ID/g) was also lower in group R0 than in group S0. MS-209 delayed the 99mTc-MIBI washout from KB-C1 tumours. Washout half-time was longer in groups R50, R100 and R200 than in group R0. A higher %ID/g was observed in groups R100 and R200 than in group R0. In KB-3-1 tumours, MS-209 had no effect on the washout half-time or the %ID/g. This study demonstrated that MS-209 increases the 99mTc-MIBI accumulation in Pgp-positive tumours. The MDR-reversing effect of MS-209 could be effectively evaluated with 99mTc-MIBI visually and non-invasively in vivo. 99mTc-MIBI imaging with MS-209 prior to chemotherapy should contribute significantly to the treatment strategy in patients with multidrug-resistant tumours. (orig.)

  14. Evaluation of MS-209, a novel multidrug-resistance-reversing agent, in tumour-bearing mice by technetium-99m-MIBI imaging

    Tatsumi, Mitsuaki; Nishimura, Tsunehiko [Division of Tracer Kinetics, Osaka University Graduate School of Medicine (Japan); Tsuruo, Takashi [Department of Chemical Biology, Institute of Molecular and Cellular Biosciences, University of Tokyo (Japan)

    2002-03-01

    MS-209 is a newly synthesised multidrug-resistance (MDR)-reversing agent with few side-effects. In this study, we evaluated the effect of MS-209 on P-glycoprotein (Pgp)-positive tumours in mice by means of technetium-99m methoxyisobutylisonitrile (MIBI) imaging. Mice received Pgp-negative KB-3-1 or Pgp-positive KB-C1 cell xenografts. KB-3-1-bearing mice were administered 0 or 100 mg/kg of MS-209 (groups S0 and S100, respectively), and KB-C1-bearing mice 0, 50, 100 or 200 mg/kg (groups R0, R50, R100 and R200, respectively), 30 min before imaging studies. Dynamic {sup 99m}Tc-MIBI images were acquired for 30 min, followed by biodistribution studies. Washout of {sup 99m}Tc-MIBI from the tumours was faster in group R0 than in group S0 on visual analysis, and the washout half-time estimated by region of interest analysis was shorter in group R0 than in group S0. Biodistribution studies revealed that {sup 99m}Tc-MIBI accumulation in tumours (expressed as %ID/g) was also lower in group R0 than in group S0. MS-209 delayed the {sup 99m}Tc-MIBI washout from KB-C1 tumours. Washout half-time was longer in groups R50, R100 and R200 than in group R0. A higher %ID/g was observed in groups R100 and R200 than in group R0. In KB-3-1 tumours, MS-209 had no effect on the washout half-time or the %ID/g. This study demonstrated that MS-209 increases the {sup 99m}Tc-MIBI accumulation in Pgp-positive tumours. The MDR-reversing effect of MS-209 could be effectively evaluated with {sup 99m}Tc-MIBI visually and non-invasively in vivo. {sup 99m}Tc-MIBI imaging with MS-209 prior to chemotherapy should contribute significantly to the treatment strategy in patients with multidrug-resistant tumours. (orig.)

  15. Measurement of the production yield for negative Bi-209 ions and compounds

    In order to perform high sensitivity Accelerator Mass Spectrometry (AMS) measurements of the ratio 210 Bi/209 Bi an important constraint is the use of a high ion current produced by the ion sputtering source. Until now, the information regarding the production of negative Bi ions by sputtering with Cs+ is rather sparse. The electron affinity (EA) is in some extend proportional to the yield of produced negative ions and can be used as a first approximation in this evaluation. For Bi the EA is 0.95 eV. To obtain reliable information about the production yield of negative ions produced by the sputter process of Cs+ ions on Bi (as metallic and other chemical forms) we used the AMS injector deck and performed an experiment in which all negative ion species produced were magnetically analysed. To determine the optimal sputtering yield of negative Bi ions the targets were prepared as Bi2O3, Bi(NO3)3 and metallic Bi. The target material was mixed with Ag and pressed into the source sample holder made of silver. Different fractions of Bi/Ag mixing have been tested to determine the best mechanical resistance and a good electric conductivity. The measurements were performed using the AMS Injector. The negative ions produced in the sputter source are extracted and accelerated up to 15 keV. Then, the negative ions pass through the 90 angle analyzing magnet where the selection of the desired ion species is performed and are measured in the second Faraday cup situated at the exit of the analyzer. In the experiment, the negative ion current was measured in both Faraday cups placed at the entrance and at the exit of the magnetic analyzer. In the first cup, at the entrance of the analyzer, we measure the overall ion current accompanied by electrons. The electron current is depending on the ion source operation conditions and in our source this represents about 20% from the total negative current. This fraction can be determined by removing the electrons from the total beam using the

  16. Photon Events with Missing Energy in $e^{+}e^{-}$ Collisions at $\\sqrt{s}$ = 130 to 209 GeV

    Abdallah, J; Adam, W; Adzic, P; Albrecht, T; Alderweireld, T; Alemany-Fernandez, R; Allmendinger, T; Allport, P P; Amaldi, Ugo; Amapane, N; Amato, S; Anashkin, E; Andreazza, A; Andringa, S; Anjos, N; Antilogus, P; Apel, W D; Arnoud, Y; Ask, S; Åsman, B; Augustin, J E; Augustinus, A; Baillon, Paul; Ballestrero, A; Bambade, P; Barbier, R; Bardin, Dimitri Yuri; Barker, G J; Baroncelli, A; Battaglia, Marco; Baubillier, M; Becks, K H; Begalli, M; Behrmann, A; Ben-Haim, E; Benekos, N C; Benvenuti, Alberto C; Bérat, C; Berggren, M; Berntzon, L; Bertrand, D; Besançon, M; Besson, N; Bloch, D; Blom, M; Bluj, M; Bonesini, M; Boonekamp, M; Booth, P S L; Borisov, G; Botner, O; Bouquet, B; Bowcock, T J V; Boyko, I; Bracko, M; Brenner, R; Brodet, E; Brückman, P; Brunet, J M; Bugge, L; Buschmann, P; Calvi, M; Camporesi, T; Canale, V; Carena, F; Castro, N; Cavallo, F R; Chapkin, M M; Charpentier, P; Checchia, P; Chierici, R; Shlyapnikov, P; Chudoba, J; Chung, S U; Cieslik, K; Collins, P; Contri, R; Cosme, G; Cossutti, F; Costa, M J; Crennell, D J; Cuevas-Maestro, J; D'Hondt, J; Dalmau, J; Da Silva, T; Da Silva, W; Della Ricca, G; De Angelis, A; de Boer, Wim; De Clercq, C; De Lotto, B; De Maria, N; De Min, A; De Paula, L S; Di Ciaccio, L; Di Simone, A; Doroba, K; Drees, J; Dris, M; Eigen, G; Ekelöf, T J C; Ellert, M; Elsing, M; Espirito-Santo, M C; Fanourakis, G K; Fassouliotis, D; Feindt, M; Fernández, J; Ferrer, A; Ferro, F; Flagmeyer, U; Föth, H; Fokitis, E; Fulda-Quenzer, F; Fuster, J A; Gandelman, M; García, C; Gavillet, P; Gazis, E N; Gokieli, R; Golob, B; Gómez-Ceballos, G; Gonçalves, P; Graziani, E; Grosdidier, G; Grzelak, K; Guy, J; Haag, C; Hallgren, A; Hamacher, K; Hamilton, K; Haug, S; Hauler, F; Hedberg, V; Hennecke, M; Herr, H; Hoffman, J; Holmgren, S O; Holt, P J; Houlden, M A; Hultqvist, K; Jackson, J N; Jarlskog, G; Jarry, P; Jeans, D; Johansson, E K; Johansson, P D; Jonsson, P; Joram, C; Jungermann, L; Kapusta, F; Katsanevas, S; Katsoufis, E C; Kernel, G; Kersevan, B P; Kerzel, U; Kiiskinen, A P; King, B T; Kjaer, N J; Kluit, P; Kokkinias, P; Kourkoumelis, C; Kuznetsov, O; Krumshtein, Z; Kucharczyk, M; Lamsa, J; Leder, G; Ledroit, F; Leinonen, L; Leitner, R; Lemonne, J; Lepeltier, V; Lesiak, T; Liebig, W; Liko, D; Lipniacka, A; Lopes, J H; López, J M; Loukas, D; Lutz, P; Lyons, L; MacNaughton, J; Malek, A; Maltezos, S; Mandl, F; Marco, J; Marco, R; Maréchal, B; Margoni, M; Marin, J C; Mariotti, C; Markou, A; Martínez-Rivero, C; Masik, J; Mastroyiannopoulos, N; Matorras, F; Matteuzzi, C; Mazzucato, F; Mazzucato, M; McNulty, R; Meroni, C; Migliore, E; Mitaroff, W A; Mjörnmark, U; Moa, T; Moch, M; Mönig, K; Monge, R; Montenegro, J; Moraes, D; Moreno, S; Morettini, P; Müller, U; Münich, K; Mulders, M; Mundim, L; Murray, W; Muryn, B; Myatt, G; Myklebust, T; Nassiakou, M; Navarria, Francesco Luigi; Nawrocki, K; Nicolaidou, R; Nikolenko, M; Oblakowska-Mucha, A; Obraztsov, V F; Olshevskii, A G; Onofre, A; Orava, R; Österberg, K; Ouraou, A; Oyanguren, A; Paganoni, M; Paiano, S; Palacios, J P; Palka, H; Papadopoulou, T D; Pape, L; Parkes, C; Parodi, F; Parzefall, U; Passeri, A; Passon, O; Peralta, L; Perepelitsa, V F; Perrotta, A; Petrolini, A; Piedra, J; Pieri, L; Pierre, F; Pimenta, M; Piotto, E; Podobnik, T; Poireau, V; Pol, M E; Polok, G; Pozdnyakov, V; Pukhaeva, N; Pullia, Antonio; Rames, J; Read, A; Rebecchi, P; Rehn, J; Reid, D; Reinhardt, R; Renton, P B; Richard, F; Rídky, J; Rivero, M; Rodríguez, D; Romero, A; Ronchese, P; Roudeau, P; Rovelli, T; Ruhlmann-Kleider, V; Ryabtchikov, D; Sadovskii, A; Salmi, L; Salt, J; Sander, C; Savoy-Navarro, A; Schwickerath, U; Segar, A; Sekulin, R L; Siebel, M; Sissakian, A N; Smadja, G; Smirnova, O G; Sokolov, A; Sopczak, A; Sosnowski, R; Spassoff, Tz; Stanitzki, M; Stocchi, A; Strauss, J; Stugu, B; Szczekowski, M; Szeptycka, M; Szumlak, T; Tabarelli de Fatis, T; Taffard, A C; Tegenfeldt, F; Timmermans, J; Tkatchev, L G; Tobin, M; Todorovova, S; Tomé, B; Tonazzo, A; Tortosa, P; Travnicek, P; Treille, D; Tristram, G; Trochimczuk, M; Troncon, C; Turluer, M L; Tyapkin, I A; Tyapkin, P; Tzamarias, S; Uvarov, V; Valenti, G; van Dam, P; Van Eldik, J; Van Lysebetten, A; Van Remortel, N; Van Vulpen, I; Vegni, G; Veloso, F; Venus, W A; Verdier, P; Verzi, V; Vilanova, D; Vitale, L; Vrba, V; Wahlen, H; Washbrook, A J; Weiser, C; Wicke, D; Wickens, J H; Wilkinson, G; Winter, M; Witek, M; Yushchenko, O P; Zalewska-Bak, A; Zalewski, P; Zavrtanik, D; Zhuravlov, V; Zimin, N I; Zintchenko, A; Zupan, M

    2005-01-01

    The production of single- and multi-photon events has been studied in the reaction e+e- -> gamma (gamma) + invisible particles. The data collected with the DELPHI detector during the years 1999 and 2000 at centre-of-mass energies between 191 GeV and 209 GeV was combined with earlier data to search for phenomena beyond the Standard Model. The measured number of light neutrino families was consistent with three and the absence of an excess of events beyond that predicted by the Standard Model processes was used to set limits on new physics. Both model-independent searches and searches for new processes predicted by supersymmetric and extra-dimensional models have been made. Limits on new non-standard model interactions between neutrinos and electrons were also determined.

  17. Lightest Isotope of Bh Produced Via the 209Bi(52Cr,n)260BhReaction

    Nelson, Sarah L.; Gregorich, Kenneth E.; Dragojevic, Irena; Garcia, Mitch A.; Gates, Jacklyn M.; Sudowe, Ralf; Nitsche, Heino

    2007-05-07

    The lightest isotope of Bh known was produced in the new {sup 209}Bi({sup 52}Cr,n){sup 260}Bh reaction at the Lawrence Berkeley National Laboratory's 88-Inch Cyclotron. Positive identification was made by observation of eight correlated alpha particle decay chains in the focal plane detector of the Berkeley Gas-Filled Separator. {sup 260}Bh decays with a 35{sub -9}{sup +19} ms half-life by alpha particle emission mainly by a group at 10.16 MeV. The measured cross section of 59{sub -20}{sup +29} pb is approximately a factor of four larger than compared to recent model predictions. The influences of the N = 152 and Z = 108 shells on alpha decay properties are discussed.

  18. Complete and incomplete fusion cross sections for 6Li+209Bi reaction in multi-body classical molecular dynamical model

    Using the multi-body Classical Molecular Dynamics simulation of 6Li+209Bi reaction it is shown that: (i) the breakup of a projectile fragment near the barrier leads to substantial increase in the ICF probabilities; (ii) the expected increase in σCF on relaxation of the rigid-body (RB) constraint on the projectile is compensated by reduction in the flux leading to CF, due to ICF events; (iii) the breakup probability increases with ECM and, for given ECM it also increases as b increases and peaks around some b>0, while cross sections σCF and σTF were calculated for b=0 only Therefore, we present the results of σCF (Complete Fusion) and σTF (Total Fusion) calculations which are obtained at critical impact parameter, bcr, where many ICF channels open up and compare with the calculations performed at b=0 only, where only few ICF channels open up

  19. $Z\\gamma*$ production in $e^+ e^-$ interactions at $\\sqrt{s}$ = 183 - 209 GeV

    Abdallah, J; Adam, W; Adzic, P; Albrecht, T; Alemany-Fernandez, R; Allmendinger, T; Allport, P P; Amaldi, Ugo; Amapane, N; Amato, S; Anashkin, E; Andreazza, A; Andringa, S; Anjos, N; Antilogus, P; Apel, W D; Arnoud, Y; Ask, S; Åsman, B; Augustin, J E; Augustinus, A; Baillon, P; Ballestrero, A; Bambade, P; Barbier, R; Bardin, D; Barker, G J; Baroncelli, A; Battaglia, M; Baubillier, M; Becks, K H; Begalli, M; Behrmann, A; Ben-Haim, E; Benekos, N; Benvenuti, A; Bérat, C; Berggren, M; Bertrand, D; Besançon, M; Besson, N; Bloch, D; Blom, M; Bluj, M; Bonesini, M; Boonekamp, M; Booth, P S L; Borisov, G; Botner, O; Bouquet, B; Bowcock, T J V; Boyko, I; Bracko, M; Brenner, R; Brodet, E; Brückman, P; Brunet, J M; Buschbeck, B; Buschmann, P; Calvi, M; Camporesi, T; Canale, V; Carena, F; Castro, N; Cavallo, F; Chapkin, M; Charpentier, P; Checchia, P; Chierici, R; Chliapnikov, P V; Chudoba, J; Chung, S U; Cieslik, K; Collins, P; Contri, R; Cosme, G; Cossutti, F; Costa, M J; Crennell, D J; Cuevas-Maestro, J; D'Hondt, J; Da Silva, T; Da Silva, W; Della Ricca, G; De Angelis, A; de Boer, Wim; De Clercq, C; De Lotto, B; De Maria, N; De Min, A; De Paula, L; Di Ciaccio, L; Di Simone, A; Doroba, K; Drees, J; Eigen, G; Ekelöf, T J C; Ellert, M; Elsing, M; Espirito-Santo, M C; Fanourakis, G K; Fassouliotis, D; Feindt, M; Fernández, J; Ferrer, A; Ferro, F; Flagmeyer, U; Föth, H; Fokitis, E; Fulda-Quenzer, F; Fuster, J; Gandelman, M; García, C; Gavillet, P; Gazis, E; Gokieli, R; Golob, B; Gómez-Ceballos, G; Gonçalves, P; Graziani, E; Grosdidier, G; Grzelak, K; Guy, J; Haag, C; Hallgren, A; Hamacher, K; Hamilton, K; Haug, S; Hauler, F; Hedberg, V; Hennecke, M; Herr, H; Hoffman, J; Holmgren, S O; Holt, P J; Houlden, M A; Jackson, J N; Jarlskog, G; Jarry, P; Jeans, D; Johansson, E K; Jonsson, P; Joram, C; Jungermann, L; Kapusta, F; Katsanevas, S; Kokkinias, P; Leinonen, L; Katsoufis, E; Kernel, G; Kersevan, B P; Krumshtein, Z; Lesiak, T; Kerzel, U; Liebig, W; King, B T; Lamsa, J; Liko, D; Kjaer, N J; Leder, G; Kluit, P; Kourkoumelis, C; Leitner, R; Kuznetsov, O; Kucharczyk, M; Ledroit, F; Lopes, J H; Lemonne, J; Lepeltier, V; Lipniacka, A; López, J M; Loukas, D; Lutz, P; Lyons, L; MacNaughton, J; Malek, A; Maltezos, S; Mandl, F; Marco, J; Marco, R; Maréchal, B; Margoni, M; Marin, J C; Mariotti, C; Markou12, A; Martínez-Rivero, C; Masik, J; Mastroyiannopoulos, N; Matorras, F; Matteuzzi, C; Mazzucato, F; Mazzucato, M; McNulty, R; Meroni, C; Migliore, E; Mitaroff, W A; Mjörnmark, U; Moa, T; Moch, M; Mönig, K; Monge, R; Montenegro, J; Moraes, D; Moreno, S; Morettini, P; Müller, U; Münich, K; Mulders, M; Mundim, L; Murray, W; Muryn, B; Myatt, G; Myklebust, T; Paganoni, M; Nassiakou, M; Paiano, S; Navarria, F; Nawrocki, K; Nicolaidou, R; Nikolenko, M; Ouraou, A; Parkes, C; Oblakowska-Mucha, A; Oyanguren, A; Obraztsov, V F; Olshevskii, A G; Palacios, J P; Onofre, A; Palka, H; Orava, R; Österberg, K; Pape, L; Papadopoulou, T D; Parodi, F; Parzefall, U; Passeri, A; Passon, O; Peralta, L; Perepelitsa, V; Perrotta, A; Petrolini, A; Piedra, J; Pieri, L; Pierre, F; Pimenta, M; Piotto, E; Podobnik, T; Poireau, V; Pol, M E; Polok, G; Pozdnyakov, V; Pukhaeva, N; Pullia, A; Rames, J; Read, A; Rebecchi, P; Rehn, J; Reid, D; Reinhardt, R; Renton, P B; Richard, F; Rídky, J; Rivero, M; Rodríguez, D; Romero, A; Ronchese, P; Roudeau, P; Rovelli, T; Ruhlmann-Kleider, V; Ryabtchikov, D; Sadovskii, A; Salmi, L; Salt, J; Sander, C; Savoy-Navarro, A; Schwickerath, U; Sekulin, R; Siebel, M; Sisakian, A; Smadja, G; Smirnova, O; Sokolov, A; Sopczak, A; Sosnowski, R; Spassoff, Tz; Stanitzki, M; Stocchi, A; Strauss, J; Stugu, B; Szczekowski, M; Szeptycka, M; Szumlak, T; Tabarelli de Fatis, T; Tegenfeldt, F; Timmermans, J; Tkatchev, L G; Tobin, M; Todorovova, S; Tomé, B; Tonazzo, A; Tortosa, P; Travnicek, P; Treille, D; Tristram, G; Trochimczuk, M; Troncon, C; Turluer, M L; Tyapkin, I A; Tyapkin, P; Tzamarias, S; Uvarov, V; Valenti, G

    2007-01-01

    Measurements of Zgamma* production are presented using data collected by the DELPHI detector at centre-of-mass energies ranging from 183 to 209 GeV, corresponding to an integrated luminosity of about 667 pb^{-1}. The measurements cover a wide range of the possible final state four-fermion configurations: hadronic and leptonic (e+ e- q qbar, mu+ mu- q qbar, q qbar nu nubar), fully leptonic (l+ l- l'+ l'-) and fully hadronic final states (q qbar q qbar, with a low mass q qbar pair). Measurements of the Zgamma* cross-section for the various final states have been compared with the Standard Model expectations and found to be consistent within the errors. In addition, a total cross-section measurement of the l+ l- l'+ l'- cross-section is reported, and found to be in agreement with the prediction of the Standard Model.

  20. Study of viscosity on the fission dynamics of the excited nuclei 228U produced in 19F + 209Bi reactions

    A two-dimensional (2D) dynamical model based on Langevin equations was applied to study the fission dynamics of the compound nuclei 228U produced in 19F + 209Bi reactions at intermediate excitation energies. The distance between the centers of masses of the future fission fragments was used as the first dimension and the projection of the total spin of the compound nucleus onto the symmetry axis, K, was considered as the second dimension in Langevin dynamical calculations. The magnitude of post-saddle friction strength was inferred by fitting measured data on the average pre-scission neutron multiplicity for 228U. It was shown that the results of calculations are in good agreement with the experimental data by using values of the post-saddle friction equal to 6–8 × 1021s-1. (author)

  1. Shelf Edge Exchange Processes: 2, SEEP2-09, R/V ENDEAVOR cruise 193: Hydrographic data report

    Behrens, W.J.; Wilson, C.; Flagg, C.N.; Wallace, D.W.R.; Wilke, R.J.; Wyman, K.D.

    1990-01-01

    The R/V ENDEAVOR cruise 193, SEEP2-09, took place from 17--23 March 1989 and focused primarily on biological processes in the SEEP2 area. Mooring 1 was recovered and re-deployed and a replacement for mooring 4 was deployed. A 24 hour time series was conducted at mooring 1 to study primary and secondary production. The time series involved sampling nutrients, dissolved oxygen, chlorophyll {und a}, zooplankton abundance and distribution and fecal pellet production. Experiments to estimate grazing rates the fecal pellet production of the dominant copepods were also done. MOCNESS tows and box core samples were also taken during the cruise. Sediment and zooplankton data are not reported here. During this cruise 46 CTD casts were made measuring pressure, temperature, conductivity, dissolved oxygen, fluorescence and light transmission. Discrete samples were taken in rosette-mounted Niskin bottles and analyzed for concentration of nutrients, chlorophyll {und a}, dissolved oxygen, and particulate organic carbon and nitrogen.

  2. Extended optical model analyses for the 11B+209Bi system at near-Coulomb-barrier energies

    In the framework of an extended optical model approach in which the polarization potential is decomposed into direct-reaction (DR) and fusion parts, simultaneous χ2 analyses of elastic scattering and fusion cross-section data for the 11B+209Bi system at near-Coulomb-barrier energies are performed. We show that the DR and fusion potentials extracted from χ2 analyses separately satisfy the dispersion relation and that the threshold anomaly exhibits in both DR and fusion parts. We find that the analyses using only elastic scattering and fusion data can produce reliable predictions of cross-sections even though the direct reaction cross-section data are not complete. By using the extracted DR potential, we investigate the effects of the projectile breakup on fusion cross-sections. (orig.)

  3. Long term effects of murine postnatal exposure to decabromodiphenyl ether (BDE-209) on learning and memory are dependent upon APOE polymorphism and age

    Reverte, Ingrid; Klein, Anders Bue; Domingo, José L;

    2014-01-01

    and persistent effects are subject to debate. Of special concern are developmental exposures that can disrupt later-in-life adult health or aging. In this study, we investigated the effects of postnatal exposure to BDE-209 in combination with apolipoprotein E (apoE) genotype, a genetic factor that is...

  4. Comparative study of fusion barrier distribution in 16O and 18O induced reactions on 232Th and 209Bi targets

    In order to investigate the influence of projectile excitations and transfer channels, quasi-elastic excitation function measurements with 16,18O projectile on two targets, one heavy (232Th) and the other a lighter target (209Bi) at energies around their Coulomb barrier are investigated. The results are compared with a new CC code CCFULL

  5. Fission Cross Sections of {209}Bi, {232}Th, {235}U, {238}U and {237}Np for Intermediate Energy Protons and Deuterons

    Yurevich, V I; Yakovlev, R M; Sosnin, A N

    2001-01-01

    Fission cross sections of {209}Bi, {232}Th, {235}U, {238}U and {237}Np have been measured with 1.0-3.7 GeV protons and 1.0 GeV deuterons. The results are compared with other experimental data, available evaluations and predictions of the theoretical model.

  6. Calculations of Branching Ratios for Radiative-Capture, One-Proton, and Two-Neutron Channels in the Fusion Reaction $^{209}$Bi+$^{70}$Zn

    Ichikawa, Takatoshi; 10.1143/JPSJ.79.074201

    2010-01-01

    We discuss the possibility of the non-one-neutron emission channels in the cold fusion reaction $^{70}$Zn + $^{209}$Bi to produce the element Z=113. For this purpose, we calculate the evaporation-residue cross sections of one-proton, radiative-capture, and two-neutron emissions relative to the one-neutron emission in the reaction $^{70}$Zn + $^{209}$Bi. To estimate the upper bounds of those quantities, we vary model parameters in the calculations, such as the level-density parameter and the height of the fission barrier. We conclude that the highest possibility is for the 2n reaction channel, and its upper bounds are 2.4$%$ and at most less than 7.9% with unrealistic parameter values, under the actual experimental conditions of [J. Phys. Soc. Jpn. {\\bf 73} (2004) 2593].

  7. Hyperfine structure of the 6d2D3/2 level in trapped short-lived 211,209Ra+ ions

    The hyperfine structure of short-lived trapped 211,209Ra+ ions was investigated by means of laser spectroscopy. The hyperfine structure constants A and B of the 6d2D3/2 level were determined. There is a 2.2 standard deviation difference between the theoretical and the more accurate experimental value for the B coefficient of 211Ra+. These measurements provide a test for the atomic theory required for upcoming experiments on atomic parity violation and atomic clocks. -- Highlights: → The hyperfine structure of trapped 211,209Ra+ was studied with laser spectroscopy. → The hyperfine structure constants A and B of the 6d2D3/2 level were determined. → A 2.2σ difference with theory is found for the B coefficient of 211Ra+. → These measurements test atomic theory, needed in atomic parity violation experiments.

  8. Interaction at the barrier in the systems 9,10,11Be+209Bi: Well-established facts and open questions

    The experimental data relative to the interaction for the systems 9,10,11Be+209Bi at the Coulomb barrier are critically discussed and compared also with present theories. The break-up (BU) of the two loosely bound projectiles, 9,11Be, seems to influence the fusion process by ''hindering'' the fusion cross-sections; but, contrary to expectations, the 11Be halo structure has no influence, since no ''enhancement'' is evident from the existing data. Attempt to describe simultaneously all the 9Be+209Bi system data: fusion, elastic scattering and BU, within a coupled-channel (CC) approach is only partly successful. It is important, from a theoretical viewpoint, to include in the CC formalism as well as possible the BU process both to continuum states as well as to unbound resonances. More accurate and well-focused experiments are also necessary to pin down this problem. (orig.)

  9. Calculations of branching ratios for radiative-capture, one-proton, and two-neutron channels in the fusion reaction 209Bi+70Zn

    We discuss the possibility of the non-one-neutron emission channels in the cold fusion reaction 70Zn+209Bi to produce the element Z=113. For this purpose, we calculate the evaporation-residue cross sections of one-proton, radiative-capture, and two-neutron emissions relative to the one-neutron emission in the reaction 70Zn+209Bi. To estimate the upper bounds of those quantities, we vary model parameters in the calculations, such as the level-density parameter and the height of the fission barrier. We conclude that the highest possibility is for the 2n reaction channel, and its upper bounds are 2.4% and at most less than 7.9% with unrealistic parameter values, under the actual experimental conditions of [J.Phys.Soc.Jpn.73(2004)2593]. (author)

  10. Neuromodulatory role of Bacopa monnieri on oxidative stress induced by postnatal exposure to decabromodiphenyl ether (PBDE -209 in neonate and young female mice

    Priya Verma

    2014-04-01

    Full Text Available Objective(s:Bacopa monnieri (BM,a traditional ayurvedic medicine,is a well-known memory enhancer. We have explored the role of BM against decabrominated diphenyl ether (PBDE-209-induced alterations in neonate and young female mice. Materials and Methods: Mice were orally administered with B. monnieri at the doses of 40, 80 or 120 mg/kg body weight along with PBDE-209 (20 mg/kg body weight from postnatal day (PND 3-10. Levels of malondialdehyde, protein carbonyl and activities of superoxide dismutase and glutathione peroxidase were measured at both ages. The correct choices and reference/working memory errors of young mice were evaluated by Morris water and radial arm maze. Results: The results showed that BM at the dose of 120 mg/kg significantly (P

  11. Search for charged Higgs bosons in e+e- collisions at √(s)=189-209 GeV

    A search is made for charged Higgs bosons predicted by Two-Higgs-Doublet extensions of the Standard Model (2HDM) using electron-positron collision data collected by the OPAL experiment at √(s)=189-209 GeV, corresponding to an integrated luminosity of approximately 600 pb-1. Charged Higgs bosons are assumed to be pair-produced and to decay into q anti q, τντ or AW±. No signal is observed. Model-independent limits on the charged Higgs-boson production cross section are derived by combining these results with previous searches at lower energies. Under the assumption BR(H±→τντ) + BR(H±→q anti q)=1, motivated by general 2HDM type II models, excluded areas on the [mH±, BR(H±→τντ)] plane are presented and charged Higgs bosons are excluded up to a mass of 76.3 GeV at 95 % confidence level, independent of the branching ratio BR(H±→τντ). A scan of the 2HDM type I model parameter space is performed and limits on the Higgs-boson masses mH± and mA are presented for different choices of tan β. (orig.)

  12. Colour reconnection in $e^{+}e^{-} \\rightarrow W^{+}W^{-}$ at $\\sqrt{s}=189-209 GeV$

    Abbiendi, G; Åkesson, P F; Alexander, G; Allison, J; Amaral, P; Anagnostou, G; Anderson, K J; Asai, S; Axen, D A; Bailey, I; Barberio, E; Barillari, T; Barlow, R J; Batley, J Richard; Bechtle, P; Behnke, T; Bell, K W; Bell, P J; Bella, G; Bellerive, A; Benelli, G; Bethke, Siegfried; Biebel, O; Boeriu, O; Bock, P; Boutemeur, M; Braibant, S; Brown, R M; Burckhart, H J; Campana, S; Capiluppi, P; Carnegie, R K; Carter, A A; Carter, J R; Chang, C Y; Charlton, D G; Ciocca, C; Csilling, A; Cuffiani, M; Dado, S; de Roeck, A; De Wolf, E A; Desch, Klaus; Dienes, B; Donkers, M; Dubbert, J; Duchovni, E; Duckeck, G; Duerdoth, I P; Etzion, E; Fabbri, Franco Luigi; Ferrari, P; Fiedler, F; Fleck, I; Ford, M; Frey, A; Gagnon, P; Gary, J W; Geich-Gimbel, C; Giacomelli, G; Giacomelli, P; Giunta, M; Goldberg, J; Gross, E; Grunhaus, Jacob; Gruwé, M; Günther, P O; Sen-Gupta, A; Hajdu, C; Hamann, M; Hanson, G G; Harel, A; Hauschild, M; Hawkes, C M; Hawkings, R; Hemingway, R J; Herten, G; Heuer, R D; Hill, J C; Hoffman, K; Horváth, D; Igo-Kemenes, P; Ishii, K; Jeremie, H; Jovanovic, P; Junk, T R; Kanzaki, J; Karlen, Dean A; Kawagoe, K; Kawamoto, T; Keeler, R K; Kellogg, R G; Kennedy, B W; Kluth, S; Kobayashi, T; Kobel, M; Komamiya, S; Kramer, T; Krieger, P; Von, J H; Krogh, A; Kühl, T; Kupper, M; Lafferty, G D; Landsman, Hagar Yaël; Lanske, D; Lellouch, D; Letts, J; Levinson, L; Lillich, J; Lloyd, S L; Loebinger, F K; Lü, J; Ludwig, A; Ludwig, J; Mader, W; Marcellini, S; Martin, A J; Masetti, G; Mashimo, T; Mättig, P; McKenna, J A; McPherson, R A; Meijers, F; Menges, W; Merritt, F S; Mes, H; Meyer, N; Michelini, A; Mihara, S; Mikenberg, G; Miller, D J; Mohr, W; Mori, T; Mutter, A; Nagai, K; Nakamura, I; Nanjo, H; Neal, H A; Nisius, R; O'Neale, S W; Oh, A; Oreglia, M J; Orito, S; Pahl, C; Pásztor, G; Pater, J R; Pilcher, J E; Pinfold, J L; Plane, D E; Pooth, O; Przybycien, M B; Quadt, A; Rabbertz, K; Rembser, C; Renkel, P; Roney, J M; Rossi, A M; Rozen, Y; Runge, K; Sachs, K; Saeki, T; Sarkisyan-Grinbaum, E; Schaile, A D; Schaile, O; Scharff-Hansen, P; Schieck, J; Schörner-Sadenius, T; Schröder, M; Schumacher, M; Seuster, R; Shears, T G; Shen, B C; Sherwood, P; Skuja, A; Smith, A M; Sobie, R J; Söldner-Rembold, S; Spanó, F; Stahl, A; Strom, D; Ströhmer, R; Tarem, S; Tasevsky, M; Teuscher, R; Thomson, M A; Torrence, E; Toya, D; Tran, P; Trigger, I; Trócsányi, Z L; Tsur, E; Turner-Watson, M F; Ueda, I; Ujvári, B; Vollmer, C F; Vannerem, P; Vertesi, R; Verzocchi, M; Voss, H; Vossebeld, Joost Herman; Ward, C P; Ward, D R; Watkins, P M; Watson, A T; Watson, N K; Wells, P S; Wengler, T; Wermes, N; Wilson, G W; Wilson, J A; Wolf, G; Wyatt, T R; Yamashita, S; Zer-Zion, D; Zivkovic, L

    2006-01-01

    The effects of the final state interaction phenomenon known as colour reconnection are investigated at centre-of-mass energies in the range $\\sqrt{s}~ 189-209 GeV using the OPAL detector at LEP. Colour reconnection is expected to affect observables based on charged particles in hadronic decays of W+W-. Measurements of inclusive charged particle multiplicities, and of their angular distribution with respect to the four jet axes of the events, are used to test models of colour reconnection. The data are found to exclude extreme scenarios of the Sjostrand-Khoze Type I (SK-I) model and are compatible with other models, both with and without colour reconnection effects. In the context of the SK-I model, the best agreement with data is obtained for a reconnection probability of 37%. Assuming no colour reconnection, the charged particle multiplicity in hadronically decaying W bosons is measured to be (nqqch) = 19.38+-0.05(stat.)+-0.08 (syst.).

  13. Dijet production in photon-photon collision at $\\sqrt {s_{ee}}$ from 189 to 209 GeV

    Abbiendi, G; Ainsley, C; Alexander, G; Allison, J; Amaral, P; Anagnostou, G; Anderson, K J; Arcelli, S; Asai, S; Axen, D; Azuelos, Georges; Bailey, I; Barberio, E; Barlow, R J; Batley, J Richard; Bechtle, P; Behnke, T; Bell, K W; Bell, P J; Bella, G; Bellerive, A; Benelli, G; Bethke, Siegfried; Biebel, O; Bloodworth, Ian J; Bock, P; Boeriu, O; Bonacorsi, D; Boutemeur, M; Braibant, S; Brigliadori, L; Brown, R M; Büsser, K; Burckhart, H J; Campana, S; Carnegie, R K; Caron, B; Carter, A A; Carter, J R; Chang, C Y; Charlton, D G; Csilling, A; Cuffiani, M; Dado, S; Dallison, S; de Roeck, A; De Wolf, E A; Desch, Klaus; Dienes, B; Donkers, M; Dubbert, J; Duchovni, E; Duckeck, G; Duerdoth, I P; Elfgren, E; Etzion, E; Fabbri, F L; Feld, L; Ferrari, P; Fiedler, F; Fleck, I; Ford, M; Frey, A; Fürtjes, A; Gagnon, P; Gary, J W; Gaycken, G; Geich-Gimbel, C; Giacomelli, G; Giacomelli, P; Giunta, M; Goldberg, J; Gross, E; Grunhaus, Jacob; Gruwé, M; Günther, P O; Sen-Gupta, A; Hajdu, C; Hamann, M; Hanson, G G; Harder, K; Harel, A; Harin-Dirac, M; Hauschild, M; Hauschildt, J; Hawkes, C M; Hawkings, R; Hemingway, R J; Hensel, C; Herten, G; Heuer, R D; Hill, J C; Hoffman, K; Homer, R J; Horváth, D; Howard, R; Igo-Kemenes, P; Ishii, K; Jeremie, H; Jovanovic, P; Junk, T R; Kanaya, N; Kanzaki, J; Karapetian, G V; Karlen, D; Kartvelishvili, V G; Kawagoe, K; Kawamoto, T; Keeler, R K; Kellogg, R G; Kennedy, B W; Kim, D H; Klein, K; Klier, A; Kluth, S; Kobayashi, T; Kobel, M; Komamiya, S; Kormos, L; Kramer, T; Kress, T; Krieger, P; Krop, D; Krüger, K; Kühl, T; Kupper, M; Lafferty, G D; Landsman, H; Lanske, D; Layter, J G; Leins, A; Lellouch, D; Letts, J; Levinson, L; Lillich, J; Lloyd, S L; Loebinger, F K; Lü, J; Ludwig, J; MacPherson, A; Mader, W; Marcellini, S; Marchant, T E; Martin, A J; Martin, J P; Masetti, G; Mashimo, T; Mättig, P; McDonald, W J; McKenna, J; McMahon, T J; McPherson, R A; Meijers, F; Méndez-Lorenzo, P; Menges, W; Merritt, F S; Mes, H; Michelini, A; Mihara, S; Mikenberg, G; Miller, D J; Moed, S; Mohr, W; Mori, T; Mutter, A; Nagai, K; Nakamura, I; Neal, H A; Nisius, R; O'Neale, S W; Oh, A; Okpara, A; Oreglia, M J; Orito, S; Pahl, C; Pásztor, G; Pater, J R; Patrick, G N; Pilcher, J E; Pinfold, J L; Plane, D E; Poli, B; Polok, J; Pooth, O; Przybycien, M B; Quadt, A; Rabbertz, K; Rembser, C; Renkel, P; Rick, H; Roney, J M; Rosati, S; Rozen, Y; Runge, K; Sachs, K; Saeki, T; Sahr, O; Sarkisyan-Grinbaum, E; Schaile, A D; Schaile, O; Scharff-Hansen, P; Schieck, J; Schörner-Sadenius, T; Schröder, M; Schumacher, M; Schwick, C; Scott, W G; Seuster, R; Shears, T G; Shen, B C; Sherwood, P; Siroli, G; Skuja, A; Smith, A M; Sobie, R J; Söldner-Rembold, S; Spanó, F; Stahl, A; Stephens, K; Ströhmer, R; Strom, D; Tarem, S; Tasevsky, M; Taylor, R J; Teuscher, R; Thomson, M A; Torrence, E; Toya, D; Tran, P; Trefzger, T; Tricoli, A; Trigger, I; Trócsányi, Z L; Tsur, E; Turner-Watson, M F; Ueda, I; Ujvári, B; Vachon, B; Vannerem, P; Verzocchi, M; Vollmer, C F; Voss, H; Vossebeld, Joost Herman; Waller, D; Ward, C P; Ward, D R; Watkins, P M; Watson, A T; Watson, N K; Wells, P S; Wengler, T; Wermes, N; Wetterling, D; Wilson, G W; Wilson, J A; Wolf, G; Wyatt, T R; Yamashita, S; Zer-Zion, D; Zivkovic, L; Von Krogh, J

    2003-01-01

    Dijet production is studied in collisions of quasireal photons at e /sup +/e/sup $/centre-of-mass energies square root (s/sub ee/) from 189 to 209 GeV at LEP. The data were collected with the OPAL detector. Jets are reconstructed using an inclusive kappa /sub perpendicular to /-clustering algorithm for all cross-section measurements presented. A cone jet algorithm is used in addition to study the different structure of the jets resulting from either of the algorithms. The inclusive dijet cross-section is measured as a function of the mean transverse energy E/sub T//sup jet/ of the two leading jets, and as a function of the estimated fraction of the photon momentum carried by the parton entering the hard subprocess, x /sub gamma /, for different regions of E/sub T//sup jet/. Angular distributions in dijet events are measured and used to demonstrate the dominance of quark and gluon initiated processes in different regions of phase space. Furthermore the inclusive dijet cross-section as a function of ¿ eta /sup...

  14. Towards measurement of the 209Bi(n,γ)210m,gBi cross sections at SARAF

    The Main Incentives For This Work Is To Exploit The Large Proton Currents And High Neutron Flux Capabilities At The Soreq Applied Research Accelerator Facility (Saraf)Along Witha Liquid Lithium Target To Perform Sensitive Measurements Of Interest In Reactor Design And Safety. The First Measurement To Be Performed Is Neutron Activation Of209bi. This Measurement Is Important For Proposed Pb-Bi Eutectic Coolants For Gen Iv Reactors And For Targets For Accelerator Driven Systems (Ads). The Activity Of One Of The Reaction Products,210mbi, Is Very Difficult To Measure Because Of Long Half-Life (3 Million Years). Successful Measurements And Comparison With The Activation Of 210gbi (The 210bi Ground State) Requires High Neutron Flux And Very Sensitive Measurements. We Plan To Perform The Activation Using The 30 Kevmaxwellianlike Neutron Spectrum Produced By The 7li(P,N)7be Reaction Near Threshold. Subsequent To The Activation, The Plan Is To Measure Directly The γ-Decays From The Decay Products,206tl For The 210mbiand 206pb For The 210gbi Activation, In The Underground Laboratory Hades At Sck-Cen In Mol, Belgium.Level Diagram And Previous Measurements Of This Ratio Are Shown . This Reaction Is Also Of Significance For Nuclear Astrophysics Since It Is The End Of The Chain For S-Process For Nucleo-Synthesis In Heavy Stars, With The Maxwellianneutrons Mimicking Environment In Asymptotic Giant Branch (Agb) Stars

  15. Comet 209P/LINEAR's Very Close Approach to Earth: Probing the Inner-Coma Physical Environment and Volatile Composition

    Bonev, Boncho P.; DiSanti, Michael; Mumma, Michael; Gibb, Erika; Villanueva, Geronimo; Paganini, Lucas; Combi, Michael; Magee-Sauer, Karen

    2014-02-01

    Using NIRSPEC at Keck 2 we propose spatially-resolved high- resolution spectroscopic observations of H_2O emission in the coma of the Jupiter-family comet 209P/LINEAR. The exceptionally small geocentric distance - 0.06 AU - will afford very high spatial resolution. Using long-slit spectroscopy we will measure the spatial variation of the temperature and column density of water, providing a very rare direct quantitative view of the physical state in the innermost region of a cometary atmosphere, within 50-100 km from the nucleus. To maximize the science return, we will also measure the abundances of CH_3OH and C_2H_6 simultaneously with H_2O. Only one instrument setting is required for our entire investigation, thereby optimizing observing efficiency. Our proposed study targets improved understanding of the near-nucleus coma physics, and of the primary volatile composition of Jupiter-family comets, a dynamical group which remains underrepresented in modern taxonomical studies. In addition, this project will provide a context for interpreting results from the Rosetta mission, and also a test of state-of-the-art physical models of the coma.

  16. Study of the di-nuclear system $^{A}$Rb + $^{209}$Bi (Z$_{1}$ + Z$_{2}$ = 120)

    The exact location of the next spherical shell closures beyond Z = 82, N = 126 is still an open question. According to model predictions shell closures are expected at Z = 114 or 120 or 126 and N = 184. Also experimental data cannot yet give a definite answer. Known nuclei with Z = 114 are too neutron‐deficient with respect to the N = 184 shell and nuclei with Z = 120 and beyond are still unknown. An option for studying reactions of super-heavy systems at Z = 120 and neutron numbers up to 184 becomes possible with the use of $^{209}$Bi targets and neutron‐rich beams. By studying quasi-fission and fusion‐fission reactions, which have significantly larger production cross‐sections than the evaporation residues, a possible influence of shell closures at Z = 120, N = 184 can be explored. Well suitable for such studies will be neutron‐rich rubidium beams at energies of about 5 MeV/u delivered by the HIE‐ISOLDE facility.

  17. Fission cross section calculations for 209Bi target nucleus based on fission reaction models in high energy regions

    Kaplan Abdullah

    2015-01-01

    Full Text Available Implementation of projects of new generation nuclear power plants requires the solving of material science and technological issues in developing of reactor materials. Melts of heavy metals (Pb, Bi and Pb-Bi due to their nuclear and thermophysical properties, are the candidate coolants for fast reactors and accelerator-driven systems (ADS. In this study, α, γ, p, n and 3He induced fission cross section calculations for 209Bi target nucleus at high-energy regions for (α,f, (γ,f, (p,f, (n,f and (3He,f reactions have been investigated using different fission reaction models. Mamdouh Table, Sierk, Rotating Liquid Drop and Fission Path models of theoretical fission barriers of TALYS 1.6 code have been used for the fission cross section calculations. The calculated results have been compared with the experimental data taken from the EXFOR database. TALYS 1.6 Sierk model calculations exhibit generally good agreement with the experimental measurements for all reactions used in this study.

  18. Search for Charged Higgs Bosos in $e^{+}e^{-}$ Collisions at $\\sqrt{s}$ = 189-209 GeV

    Abbiendi, G; Åkesson, P F; Alexander, G; Anagnostou, G; Anderson, K J; Asai, S; Axen, D; Bailey, I; Barberio, E; Barillari, T; Barlow, R J; Batley, R J; Bechtle, P; Behnke, T; Bell, K W; Bell, P J; Bella, G; Bellerive, A; Benelli, G; Bethke, S; Biebel, O; Boeriu, O; Bock, P; Boutemeur, M; Braibant, S; Brown, R M; Burckhart, H J; Campana, S; Capiluppi, P; Carnegie, R K; Carter, A A; Carter, J R; Chang, C Y; Charlton, D G; Ciocca, C; Csilling, A; Cuffiani, M; Dado, S; Dallavalle, M; de Roeck, A; De Wolf, E A; Desch, K; Dienes, B; Dubbert, J; Duchovni, E; Duckeck, G; Duerdoth, I P; Etzion, E; Fabbri, F; Ferrari, P; Fiedler, F; Fleck, I; Ford, M; Frey, A; Gagnon, P; Gary, J W; Geich-Gimbel, C; Giacomelli, G; Giacomelli, P; Giunta, M; Goldberg, J; Gross, E; Grunhaus, J; Gruwé, M; Sen-Gupta, A; Hajdu, C; Hamann, M; Hanson, G G; Harel, A; Hauschild, M; Hawkes, C M; Hawkings, R; Herten, G; Heuer, R D; Hill, J C; Horváth, D; Igo-Kemenes, P; Ishii, K; Jeremie, H; Jovanovic, P; Junk, T R; Kanzaki, J; Karlen, D; Kawagoe, K; Kawamoto, T; Keeler, R K; Kellogg, R G; Kennedy, B W; Kluth, S; Kobayashi, T; Kobel, M; Komamiya, S; Kramer, T; Krasznahorkays, A Jr; Krieger, P; Von Krogh, J; Kühl, T; Kupper, M; Lafferty, G D; Landsman, H; Lanske, D; Lellouch, D; Letts, J; Levinson, L; Lillich, J; Lloyd, S L; Loebinger, F K; Lü, J; Ludwig, A; Ludwig, J; Mader, W; Marcellini, S; Martin, A J; Mashimo, T; Mättig, P; McKenna, J; McPherson, R A; Meijers, F; Menges, W; Merritt, F S; Mes, H; Meyer, V; Michelini, A; Mihara, S; Mikenberg, G; Miller, D J; Mohr, W; Mori, T; Mutter, A; Nagai, K; Nakamura, I; Nanjo, H; Neal, H A; O'Neale, S W; Oh, A; Oreglia, M J; Orito, S; Pahl, C; Pásztor, G; Pater, J R; Pilcher, J E; Pinfold, J L; Plane, D E; Pooth, O; Przybycien, M; Quadt, A; Rabbertz, K; Rembser, C; Renkel, P; Roney, J M; Rossi, A M; Rozen, Y; Runge, K; Sachs, K; Saeki, T; Sarkisyan-Grinbaum, E; Schaile, A D; Schaile, O; Scharff-Hansen, P; Schiecks, J; Schörner-Sadenius, T; Schröder, M; Schumacher, M; Seuster, R; Shears, T G; Shen, B C; Sherwood, P; Skuja, A; Smith, A M; Sobie, R J; Söldner-Rembold, S; Spanó, F; Stahl, A; Strom, D; Ströhmer, R; Tarem, S; Tasevsky, M; Teuscher, R; Thomson, M A; Torrence, E; Toya, D; Trigger, I; Trócsányi, Z L; Tsur, E; Turner-Watson, M F; Ueda, I; Ujvári, B; Vollmer, C F; Vannerem, P; Vertesi, R; Verzocchi, M; Voss, H; Vossebeld, J; Ward, C P; Ward, D R; Watkins, P M; Watson, A T; Watson, N K; Wells, P S; Wengler, T; Wermes, N; Wilson, G W; Wilson, J A; Wolf, G; Wyatt, T R; Yamashita, S; Zer-Zion, D; Zivkovic, L

    2012-01-01

    A search is made for charged Higgs bosons predicted by Two-Higgs-Doublet extensions of the Standard Model (2HDM) using electron-positron collision data collected by the OPAL experiment at sqrts=189-209 GeV, corresponding to an integrated luminosity of approximately 600pb-1. Charged Higgs bosons are assumed to be pair-produced and to decay into qq, tnt or AWpm. No signal is observed. Model-independent limits on the charged Higgs-boson production cross section are derived by combining these results with previous searches at lower energies. Excluded areas on the [mHpm, BR(Hpm->TV)] plane are presented assuming BR(Hpm->tnt)+BR(Hpm->qq)=1. Under the above assumption, motivated by general 2HDM type II models, charged Higgs bosons are excluded up to a mass of 76.6GeV at 95% confidence level, independent of the branching ratio BR(Hpm->tnt). A scan of the 2HDM type I model parameter space is performed and limits on the Higgs-boson masses mHpm and mA are presented for different choices of tanb.

  19. Investigations of the potential for accident mitigation of the conceptical design for a core retention device developed in SR 209

    The potential for accident mitigation of the conceptual design for the core retention device developed in SR 209, was estimated by core meltdown and containment analyses. Such a device should prevent late fission product release especially due to failure of the containment by overpressurization (according to release categories 5 and 6 of the German Risk Study, Phase A). Assuming ideal operation of the device, the long term course of a meltdown accident can be influenced in a positive sense including the prevention of overpressurization. However, functional operation of the design seems to be highly uncertain for several reasons, i.g. due to uncertainties in the behaviour of the melt in the retention device. The design does not or only insufficiently cover accident scenarios with high pressure in vessel melt, that means for sequences relevant for their high contribution to core melt frequency. The design may have strong negative impacts on the course of meltdown accidents, LOCA's, constructive details and operation of a plant. Implementation of the measure is expected to need extreme effort, without making sense from the technical point of view. The measure at all seems not to be recommendable for accident mitigation. (orig./HP)

  20. Exploring contributions from incomplete fusion in Li,76+209Bi and Li,76+198Pt reactions

    Parkar, V. V.; Jha, V.; Kailas, S.

    2016-08-01

    We use the breakup absorption model to simultaneously describe the measured cross sections of complete fusion (CF), incomplete fusion (ICF), and total fusion (TF) in nuclear reactions induced by weakly bound nuclei Li,76 on 209Bi and 198Pt targets. The absorption cross sections are calculated using the continuum discretized coupled channels (CDCC) method with different choices of short-range imaginary potentials to get the ICF, CF, and TF cross sections. It is observed that the cross sections for deuteron ICF / deuteron capture and α ICF / α capture are of similar magnitude, in the case of the 6Li projectile, while the cross sections for the triton ICF / triton capture is more dominant than that of α ICF / α capture in the case of the 7Li projectile. Both these observations are also corroborated by the experimental data. The ratio of ICF to TF cross sections, which defines the value of fusion suppression factor, is found to be in agreement with the data available from the literature. The cross-section ratios of CF/TF and ICF/TF show opposite behavior at below-barrier energies the former decreases while the latter increases as the energy is lowered, which shows the dominance of ICF at below-barrier energies. We have also studied the correlation of the ICF cross sections with the noncapture breakup (NCBU) cross sections as a function of energy, which shows that the NCBU is more significant than ICF at below-barrier energies.

  1. Exploring contributions from incomplete fusion in $^{6,7}$Li+$^{209}$Bi and $^{6,7}$Li+$^{198}$Pt reactions

    Parkar, V V; Kailas, S

    2016-01-01

    We use the breakup absorption model to simultaneously describe the measured cross-sections of the Complete fusion (CF), Incomplete fusion (ICF), and Total fusion (TF) in nuclear reactions induced by weakly bound nuclei $^{6,7}$Li on $^{209}$Bi and $^{198}$Pt targets. The absorption cross-sections are calculated using the Continuum Discretized Coupled Channels (CDCC) method with different choices of short range imaginary potentials to get the ICF, CF and TF cross-sections. It is observed that the cross-sections for deuteron-ICF/deuteron-capture are of similar magnitude as the $\\alpha$-ICF/$\\alpha$-capture, in case of $^{6}$Li projectile, while the cross-sections for triton-ICF/triton-capture is more dominant than $\\alpha$-ICF/$\\alpha$-capture in case of $^{7}$Li projectile. Both these observations are also corroborated by the experimental data. The ratio of ICF to TF cross-sections, which defines the value of fusion suppression factor is found to be in agreement with the data available from the literature. The...

  2. Measurement of the W-pair Production Cross-section and W Branching Ratios in $e^+ e^-$ Collisions at $\\sqrt{s}$ = 161-209 GeV

    Abdallah, J; Adam, W; Adzic, P; Albrecht, T; Alderweireld, T; Alemany-Fernandez, R; Allmendinger, T; Allport, P P; Amaldi, Ugo; Amapane, N; Amato, S; Anashkin, E; Andreazza, A; Andringa, S; Anjos, N; Antilogus, P; Apel, W D; Arnoud, Y; Ask, S; Åsman, B; Augustin, J E; Augustinus, A; Baillon, Paul; Ballestrero, A; Bambade, P; Barbier, R; Bardin, Dimitri Yuri; Barker, G; Baroncelli, A; Battaglia, Marco; Baubillier, M; Becks, K H; Begalli, M; Behrmann, A; Ben-Haim, E; Benekos, N C; Benvenuti, Alberto C; Bérat, C; Berggren, M; Berntzon, L; Bertrand, D; Besançon, M; Besson, N; Bloch, D; Blom, M; Bluj, M; Bonesini, M; Boonekamp, M; Booth, P S L; Borisov, G; Botner, O; Bouquet, B; Bowcock, T J V; Boyko, I; Bracko, M; Brenner, R; Brodet, E; Brückman, P; Brunet, J M; Bugge, L; Buschmann, P; Calvi, M; Camporesi, T; Canale, V; Carena, F; Castro, N; Cavallo, F R; Chapkin, M M; Charpentier, P; Checchia, P; Chierici, R; Shlyapnikov, P; Chudoba, J; Chung, S U; Cieslik, K; Collins, P; Contri, R; Cosme, G; Cossutti, F; Costa, M J; Crennell, D J; Cuevas-Maestro, J; D'Hondt, J; Dalmau, J; Da Silva, T; Da Silva, W; Della Ricca, G; De Angelis, A; de Boer, Wim; De Clercq, C; De Lotto, B; De Maria, N; De Min, A; De Paula, L S; Di Ciaccio, Lucia; Di Simone, A; Doroba, K; Drees, J; Dris, M; Eigen, G; Ekelöf, T J C; Ellert, M; Elsing, M; Espirito-Santo, M C; Fanourakis, G K; Fassouliotis, D; Feindt, M; Fernández, J; Ferrer, A; Ferro, F; Flagmeyer, U; Föth, H; Fokitis, E; Fulda-Quenzer, F; Fuster, J A; Gandelman, M; García, C; Gavillet, P; Gazis, E N; Gokieli, R; Golob, B; Gómez-Ceballos, G; Gonçalves, P; Graziani, E; Grosdidier, G; Grzelak, K; Guy, J; Haag, C; Hallgren, A; Hamacher, K; Hamilton, K; Haug, S; Hauler, F; Hedberg, V; Hennecke, M; Herr, H; Hoffman, J; Holmgren, S O; Holt, P J; Houlden, M A; Hultqvist, K; Jackson, J N; Jarlskog, G; Jarry, P; Jeans, D; Johansson, E K; Johansson, P D; Jonsson, P; Joram, C; Jungermann, L; Kapusta, F; Katsanevas, S; Katsoufis, E C; Kernel, G; Kersevan, Borut P; Kerzel, U; Kiiskinen, A P; King, B T; Kjaer, N J; Kluit, P; Kokkinias, P; Kourkoumelis, C; Kuznetsov, O; Krumshtein, Z; Kucharczyk, M; Lamsa, J; Leder, G; Ledroit, F; Leinonen, L; Leitner, R; Lemonne, J; Lepeltier, V; Lesiak, T; Liebig, W; Liko, D; Lipniacka, A; Lopes, J H; López, J M; Loukas, D; Lutz, P; Lyons, L; MacNaughton, J; Malek, A; Maltezos, S; Mandl, F; Marco, J; Marco, R; Maréchal, B; Margoni, M; Marin, J C; Mariotti, C; Markou, A; Martínez-Rivero, C; Masik, J; Mastroyiannopoulos, N; Matorras, F; Matteuzzi, C; Mazzucato, F; Mazzucato, M; McNulty, R; Meroni, C; Migliore, E; Mitaroff, W A; Mjörnmark, U; Moa, T; Moch, M; Mönig, K; Monge, R; Montenegro, J; Moraes, D; Moreno, S; Morettini, P; Müller, U; Münich, K; Mulders, M; Mundim, L M; Murray, W; Muryn, B; Myatt, Gerald; Myklebust, T; Nassiakou, M; Navarria, Francesco Luigi; Nawrocki, K; Nicolaidou, R; Nikolenko, M; Oblakowska-Mucha, A; Obraztsov, V F; Olshevskii, A G; Onofre, A; Orava, Risto; Österberg, K; Ouraou, A; Oyanguren, A; Paganoni, M; Paiano, S; Palacios, J P; Palka, H; Papadopoulou, T D; Pape, L; Parkes, C; Parodi, F; Parzefall, U; Passeri, A; Passon, O; Peralta, L; Perepelitsa, V F; Perrotta, A; Petrolini, A; Piedra, J; Pieri, L; Pierre, F; Pimenta, M; Piotto, E; Podobnik, T; Poireau, V; Pol, M E; Polok, G; Poropat, P; Pozdnyakov, V; Pukhaeva, N; Pullia, Antonio; Rames, J; Ramler, L; Read, A; Rebecchi, P; Rehn, J; Reid, D; Reinhardt, R; Renton, P B; Richard, F; Rídky, J; Rivero, M; Rodríguez, D; Romero, A; Ronchese, P; Roudeau, Patrick; Rovelli, T; Ruhlmann-Kleider, V; Ryabtchikov, D; Sadovskii, A; Salmi, L; Salt, J; Savoy-Navarro, A; Schwickerath, U; Segar, A; Sekulin, R L; Siebel, M; Sissakian, A N; Smadja, G; Smirnova, O G; Sokolov, A; Sopczak, A; Sosnowski, R; Spassoff, Tz; Stanitzki, M; Stocchi, A; Strauss, J; Stugu, B; Szczekowski, M; Szeptycka, M; Szumlak, T; Tabarelli de Fatis, T; Taffard, A C; Tegenfeldt, F; Timmermans, J; Tkatchev, L G; Tobin, M; Todorovova, S; Tomé, B; Tonazzo, A; Tortosa, P; Travnicek, P; Treille, D; Tristram, G; Trochimczuk, M; Troncon, C; Turluer, M L; Tyapkin, I A; Tyapkin, P; Tzamarias, S; Uvarov, V; Valenti, G; van Dam, P; Van Eldik, J; Van Lysebetten, A; Van Remortel, N; Van Vulpen, I B; Vegni, G; Veloso, F; Venus, W A; Verdier, P; Verzi, V; Vilanova, D; Vitale, L; Vrba, V; Wahlen, H; Washbrook, A J; Weiser, C; Wicke, D; Wickens, J H; Wilkinson, G; Winter, M; Witek, M; Yushchenko, O P; Zalewska-Bak, A; Zalewski, Piotr; Zavrtanik, D; Zhuravlov, V; Zimin, N I; Zinchenko, A I; Zupan, M

    2004-01-01

    These final results on e+e- -> W+W- production cross-section measurements at LEP2 use data collected by the DELPHI detector at centre-of-mass energies up to 209 GeV. Measurements of total cross-sections, W angular differential distributions and decay branching fractions, and the value of the CKM element |V_{cs}| are compared to the expectations of the Standard Model. These results supersede all values previously published by DELPHI.

  3. Breakup of 9Be on 209Bi above and near the Coulomb barrier as a molecular single-particle effect: Its influence on complete fusion and scattering

    The breakup of the 9Be projectile on the 209Bi target at bombarding energies above and near the Coulomb barrier is studied in the adiabatic two-center shell model approach. The effect of 9Be→n+2α breakup channel on complete fusion, elastic and inelastic cross sections is investigated. Results show that the breakup of the projectile 9Be could be due to a molecular single-particle effect shortly before the colliding nuclei reach the Coulomb barrier

  4. Cross Sections of the (HI, αn) Channel in the Cold-Fusion-Type Reactions 209 Bi + 40 Ar and 208 Pb + 37 Cl

    By using an off-line radiochemistry technique, production cross sections of 240 Cm(T1/2 = 27 d) in the 209 Bi + 40 Ar and 208 Pb + 37 Cl reactions at the bombarding energy Elab ≤ 230 MeV were determined to be 0,5 ± 0,2 and 0,6 ± 0,3 n b, respectively. The production of 240 Cm was attributed to the 1 n-deexcitation channel of the composite systems 249 Md and 245 Es. The measured 240 Cm production cross sections represent upper cross section limits for the (HI, αn) channel of the reactions under study, which limits are about 100 times lower than the section values reported by Nomura et al. for the (40 Ar, αx n) channels with x = 1,2 of the 209 Bi + 40 Ar reaction at Elab208 MeV. In this connection, presented and discussed is an up-to-date summary of the available data on cross sections of the (HI, αx n) channels in the cold-fusion-type reactions induced by projectiles 37 Cl to 50 Ti on targets of 203,205 Tl, 208 Pb and 209 Bi. Appreciable E C(β+)-delayed fission effects were detected in the 209 Bi + 40 Ar and 206,208 Pb + 37 Cl reactions. In particular, our data reveal the occurrence of E C(β+)-delayed fission in the decay chains 242 Es(E C, ∼7 s) 242 Cf and 238 Bk(E C, ∼2 m) 238 Cm. 28 refs., 4 figs., 4 tabs

  5. Oceanographic profile data collected aboard NAVIGATION RESPONSE TEAM 7 as part of project S-G905-NRT2-09 in the North Atlantic Ocean from 2009-11-17 to 2010-03-23 (NCEI Accession 0130673)

    National Oceanic and Atmospheric Administration, Department of Commerce — NCEI Accession 0130673 includes physical and profile data collected aboard the NAVIGATION RESPONSE TEAM 7 during project S-G905-NRT2-09 in the North Atlantic Ocean...

  6. Post-excavation analysis of a revised hydraulic model of the Room 209 fracture, URL, Manitoba, Canada

    An excavation response test was conducted in the Room 209 on the 240 m level of the AECL Underground Research Laboratory. Model predictions prior to excavation were made of the geomechanical response of the rock mass and the hydraulic response of an intercepted fracture. The model results were compared with excavation response data collected in a comprehensive instrument array. The work performed has addressed discrepancies between calculated and in-situ measured hydraulic response as part of a post-test analysis. Already existing hydraulic conceptual models of the fracture were revised and any available information was included in the new model. The model reproduced the pre-excavation hydraulic head distribution and hydraulic test results in terms of normalized flow rate within 5% and 75%, respectively. It was also found that the model reproduced the results of cross-hole hydraulic interference tests at least from a qualitative standpoint. The next stage of the modelling addressed the response of the model to a simulation of the excavated pilot tunnel. The preliminary results suggested the presence of a skin of different permeability in a thin zone around the periphery of the tunnel. By altering the permeability in the floor and along the walls and roof of the periphery, a better correspondence between calculated and measured drawdown was obtained. The same also applied for measured groundwater inflow in quantity, though not for the actual distribution on inflow. As probable causes for the interpreted positive skin in the crown and wall, temporary partial unsaturation and propulsion of debris into the fracture were suggested. The negative skin in the floor was interpreted as an effect of the dense and high energy charges used in the excavation process. (authors)

  7. Meteor showers from comet 209P/Linear at Earth and comet C/2013 A1 (Siding Spring) at Mars

    Jenniskens, P. M. M.

    2014-12-01

    The exceptionally close encounter of long-period comet comet C/2013 A1 (Siding Spring) to Mars on October 19, 2014, may result in the first meteor observations in the atmosphere of Mars. Large (few-mm to cm-sized) meteoroids are not easily observed by other techniques. The manner in which these meteoroids fragment will shed light on the physical properties of large freshly-ejected dust grains of a long-period comet, which carry most of the comet's mass loss. Their physical properties may be very different than those of the much more aged meteoroids typically encountered in annual meteor showers and the sporadic meteor background. The 2014 May 24 close encounter of comet 209P/LINEAR to Earth, for example, showed that the meteoroids ejected by this short-period comet about 100 years ago were still unusually fragile, some breaking vigorously into a cloud of dust towards the end of their entry trajectories. Moreover, the meteoroid stream encountered by Earth was dominated by small meteoroids, with a steep differential mass distribution index of s = 2.42+/-0.15 (0.003-4 g) and a differential size distribution index of a = 5.3 +/- 0.4 (0.2-2 cm). The fragile nature of the grains is likely the reason for the lack of large meteoroids in the stream. The encounter with comet Siding Spring may shed light onto the question whether this is because they do not survive the ejection process (in which case the shower on Mars would also lack bright meteors) or because they do not survive the thermal cycling in interplanetary space for more than a century or so (in which case larger meteoroids may still be present in the stream).

  8. Placental transfer of the polybrominated diphenyl ethers BDE-47, BDE-99 and BDE-209 in a human placenta perfusion system: an experimental study

    Frederiksen Marie

    2010-07-01

    Full Text Available Abstract Background Polybrominated diphenyl ethers (PBDEs have been widely used as flame retardants in consumer products. PBDEs may affect thyroid hormone homeostasis, which can result in irreversible damage of cognitive performance, motor skills and altered behaviour. Thus, in utero exposure is of very high concern due to critical windows in fetal development. Methods A human ex vivo placenta perfusion system was used to study the kinetics and extent of the placental transfer of BDE-47, BDE-99 and BDE-209 during four-hour perfusions. The PBDEs were added to the maternal circulation and monitored in the maternal and fetal compartments. In addition, the perfused cotyledon, the surrounding placental tissue as well as pre-perfusion placental tissue and umbilical cord plasma were also analysed. The PBDE analysis included Soxhlet extraction, clean-up by adsorption chromatography and GC-MS analysis. Results and Discussion Placental transfer of BDE-47 was faster and more extensive than for BDE-99. The fetal-maternal ratios (FM-ratio after four hours of perfusion were 0.47 and 0.25 for BDE-47 and BDE-99, respectively, while the indicative permeability coefficient (IPC measured after 60 minutes of perfusion was 0.26 h-1 and 0.10 h-1, respectively. The transport of BDE-209 seemed to be limited. These differences between the congeners may be related to the degree of bromination. Significant accumulation was observed for all congeners in the perfused cotyledon as well as in the surrounding placental tissue. Conclusion The transport of BDE-47 and BDE-99 indicates in utero exposure to these congeners. Although the transport of BDE-209 was limited, however, possible metabolic debromination may lead to products which are both more toxic and transportable. Our study demonstrates fetal exposure to PBDEs, which should be included in risk assessment of PBDE exposure of women of child-bearing age.

  9. Lithium and strontium isotope compositions of serpentinite-hosted carbonate veins from the MAR (ODP Leg 209): Records of different stages of seafloor metamorphism

    Rosner, M.; Bach, W.; Paulick, H.; Erzinger, J.

    2004-12-01

    Geochemical investigations of carbonate veins hosted in serpentinized peridotites drilled from the Mid-Atlantic Ridge 14° -16° N (ODP Leg 209) were conducted to gain insights into temperature and composition of the alteration fluids from which carbonates were precipitated. We have examined carbonate veins that can be grouped into low-T (kinetics, variations in fluid chemistry (e.g., strongly variable Mg/Ca), or combination of these effects. Calcite veins from Sites 1271 and 1275 display at least two compositional groups. Low T calcites range δ 7Li from 22 to 27 ‰ and precipitated at Tleached from the peridotite basement.

  10. Studies of Hadronic Event Structure in $e^+ e^-$ Annihilation from 30 GeV to 209 GeV with the L3 Detector

    Achard, P; Aguilar-Benítez, M; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alviggi, M G; Anderhub, H; Andreev, V P; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Bajo, A; Baksay, G; Baksay, L; Baldew, S V; Banerjee, S; Banerjee, Sw; Barczyk, A; Barillère, R; Bartalini, P; Basile, M; Batalova, N; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Bellucci, L; Berbeco, R; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Biasini, M; Biglietti, M; Biland, A; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böhm, A; Boldizsar, L; Borgia, B; Bottai, S; Bourilkov, D; Bourquin, Maurice; Braccini, S; Branson, J G; Brochu, F; Burger, J D; Burger, W J; Cai, X D; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A M; Casaus, J; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada, M; Chamizo-Llatas, M; Chang, Y H; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chiefari, G; Cifarelli, Luisa; Cindolo, F; Clare, I; Clare, R; Coignet, G; Colino, N; Costantini, S; de la Cruz, B; Cucciarelli, S; van Dalen, J A; De Asmundis, R; Déglon, P L; Debreczeni, J; Degré, A; Dehmelt, K; Deiters, K; Della Volpe, D; Delmeire, E; Denes, P; De Notaristefani, F; De Salvo, A; Diemoz, M; Dierckxsens, M; Dionisi, C; Dittmar, M; Doria, A; Dova, M T; Duchesneau, D; Duda, M; Echenard, B; Eline, A; El-Hage, A; El-Mamouni, H; Engler, A; Eppling, F J; Extermann, P; Falagán, M A; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, M; Ferguson, T; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, F; Fisher, P H; Fisher, W; Fisk, I; Forconi, G; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gataullin, M; Gentile, S; Giagu, S; Gong, Z F; Grenier, G; Grimm, O; Grünewald, M W; Guida, M; van Gulik, R; Gupta, V K; Gurtu, A; Gutay, L J; Haas, D; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Hirschfelder, J; Hofer, H; Hohlmann, M; Holzner, G; Hou, S R; Hu, Y; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Kaur, M; Kienzle-Focacci, M N; Kim, J K; Kirkby, Jasper; Kittel, E W; Klimentov, A; König, A C; Kopal, M; Koutsenko, V F; Kräber, M H; Krämer, R W; Krüger, A; Kunin, A; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Le Goff, J M; Leiste, R; Levtchenko, M; Levchenko, P M; Li, C; Likhoded, S; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lü, Y S; Luci, C; Luminari, L; Lustermann, W; Ma Wen Gan; Malgeri, L; Malinin, A; Maña, C; Mans, J; Martin, J P; Marzano, F; Mazumdar, K; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Mihul, A; Milcent, H; Mirabelli, G; Mnich, J; Mohanty, G B; Muanza, G S; Muijs, A J M; Musicar, B; Musy, M; Nagy, S; Natale, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Nisati, A; Novák, T; Nowak, H; Ofierzynski, R A; Organtini, G; Pal, I; Palomares, C; Paolucci, P; Paramatti, R; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Pedace, M; Pensotti, S; Perret-Gallix, D; Petersen, B; Piccolo, D; Pierella, F; Pioppi, M; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Pothier, J; Prokofev, D; Prokofiev, D O; Quartieri, J; Rahal-Callot, G; Rahaman, M A; Raics, P; Raja, N; Ramelli, R; Rancoita, P G; Ranieri, R; Raspereza, A V; Razis, P A; Ren, D; Rescigno, M; Reucroft, S; Riemann, S; Riles, K; Roe, B P; Romero, L; Rosca, A; Rosemann, C; Rosenbleck, C; Rosier-Lees, S; Roth, S; Rubio, J A; Ruggiero, G; Rykaczewski, H; Sakharov, A; Saremi, S; Sarkar, S; Salicio, J; Sánchez, E; Schäfer, C; Shchegelskii, V; Schopper, Herwig Franz; Schotanus, D J; Sciacca, C; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shumilov, E; Shvorob, A V; Son, D; Souga, C; Spillantini, P; Steuer, M; Stickland, D P; Stoyanov, B; Strässner, A; Sudhakar, K; Sultanov, G G; Sun, L Z; Sushkov, S; Suter, H; Swain, J D; Szillási, Z; Tang, X W; Tarjan, P; Tauscher, Ludwig; Taylor, L; Tellili, B; Teyssier, D; Timmermans, C; Ting, Samuel C C; Ting, S M; Tonwar, S C; Tóth, J; Tully, C; Tung, K L; Ulbricht, J; Valente, E; Van de Walle, R T; Vásquez, R; Veszpremi, V; Vesztergombi, G; Vetlitskii, I; Vicinanza, D; Viertel, Gert M; Villa, S; Vivargent, M; Vlachos, S; Vodopyanov, I; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Wadhwa, M; Wang, Q; Wang, X L; Wang, Z M; Weber, M; Wilkens, H; Wynhoff, S; Xia, L; Xu, Z Z; Yamamoto, J; Yang, B Z; Yang, C G; Yang, H J; Yang, M; Yeh, S C; Zalite, A; Zalite, Yu; Zhang, Z P; Zhao, J; Zhu, G Y; Zhu, R Y; Zhuang, H L; Zichichi, A; Zimmermann, B; Zöller, M

    2004-01-01

    In this Report, QCD results obtained from a study of hadronic event structure in high energy e^+e^- interactions with the L3 detector are presented. The operation of the LEP collider at many different collision energies from 91 GeV to 209 GeV offers a unique opportunity to test QCD by measuring the energy dependence of different observables. The main results concern the measurement of the strong coupling constant, \\alpha_s, from hadronic event shapes and the study of effects of soft gluon coherence through charged particle multiplicity and momentum distributions.

  11. Resonance parameters of the 6.67-, 20.9-, and 36.8-eV levels in 238U

    The ENDF/B-IV 238U cross sections (MAT-1262) yield an effective capture resonance integral in strongly self-shielded situations which is too high. This situation suggests that the ENDF/B capture widths for the first few s-wave levels may be too large. Recent ORELA measurements of transmission through 238U have been analyzed with a multilevel formula to determine the parameters of the 6.67-, 20.9-, and 36.6-eV levels. These three levels provide 86 percent of the infinitely dilute capture resonance integral

  12. Measurement of the photon-proton total cross section at a center-of-mass energy of 209 GeV at HERA

    The photon-proton total cross section has been measured in the process e+p→e+γp→e+X with the ZEUS detector at HERA. Events were collected with photon virtuality Q22 and average γp center-of-mass energy Wγp=209 GeV in a dedicated run, designed to control systematic effects, with an integrated luminosity of 49 nb-1. The measured total cross section is σtotγp=174±1 (stat.)±13 (syst.) μb. The energy dependence of the cross section is compatible with parameterizations of high-energy pp and pp-bar data

  13. DUST FROM COMET 209P/LINEAR DURING ITS 2014 RETURN: PARENT BODY OF A NEW METEOR SHOWER, THE MAY CAMELOPARDALIDS

    We report a new observation of the Jupiter family comet 209P/LINEAR during its 2014 return. The comet is recognized as a dust source of a new meteor shower, the May Camelopardalids. 209P/LINEAR was apparently inactive at a heliocentric distance rh = 1.6 AU and showed weak activity at rh ≤ 1.4 AU. We found an active region of <0.001% of the entire nuclear surface during the comet's dormant phase. An edge-on image suggests that particles up to 1 cm in size (with an uncertainty of factor 3-5) were ejected following a differential power-law size distribution with index q = –3.25 ± 0.10. We derived a mass-loss rate of 2-10 kg s–1 during the active phase and a total mass of ≈5 × 107 kg during the 2014 return. The ejection terminal velocity of millimeter- to centimeter-sized particles was 1-4 m s–1, which is comparable to the escape velocity from the nucleus (1.4 m s–1). These results imply that such large meteoric particles marginally escaped from the highly dormant comet nucleus via the gas drag force only within a few months of the perihelion passage

  14. In vitro screening of reversible and time-dependent inhibition on CYP3A by TM208 and TM209 in rat liver microsomes

    Miaoran Ning

    2012-04-01

    Full Text Available TM208 and TM209, dithiocarbamate derivatives with potential anti-cancer effects, were evaluated in reversible and time-dependent cytochrome P450 (CYP 3A inhibition assays in rat liver microsomes using testosterone as probe substrate. Both compounds were found to be weak reversible inhibitors and moderate mechanism-based inhibitors of rat CYP3A. For reversible inhibition on rat CYP3A, the Ki values of competitive inhibition model were 12.10±1.75 and 13.94±1.31 μM, respectively. For time-dependent inhibition, the inactivation constants (Kl were 31.93±12.64 and 32.91±15.58 μM, respectively, and the maximum inactivation rates (kinact were 0.03497±0.0069 and 0.07259±0.0172 min−1 respectively. These findings would provide useful in vitro information for future in vivo DDI studies on TM208 or TM209.

  15. DUST FROM COMET 209P/LINEAR DURING ITS 2014 RETURN: PARENT BODY OF A NEW METEOR SHOWER, THE MAY CAMELOPARDALIDS

    Ishiguro, Masateru [Department of Physics and Astronomy, Seoul National University, Gwanak, Seoul 151-742 (Korea, Republic of); Kuroda, Daisuke [Okayama Astrophysical Observatory, National Astronomical Observatory of Japan, Asakuchi, Okayama 719-0232 (Japan); Hanayama, Hidekazu [Ishigakijima Astronomical Observatory, National Astronomical Observatory of Japan, Ishigaki, Okinawa 907-0024 (Japan); Takahashi, Jun; Takagi, Yuhei; Morihana, Kumiko; Honda, Satoshi; Arai, Akira [Nishi-Harima Astronomical Observatory, Center for Astronomy, University of Hyogo, Sayo, Hyogo 679-5313 (Japan); Hasegawa, Sunao; Sarugaku, Yuki [Institute of Space and Astronautical Science (ISAS), Japan Aerospace Exploration Agency (JAXA), Sagamihara, Kanagawa 252-5210 (Japan); Watanabe, Makoto; Imai, Masataka; Goda, Shuhei [Department of Cosmosciences, Graduate School of Science, Hokkaido University, Sapporo 060-0810 (Japan); Akitaya, Hiroshi [Hiroshima Astrophysical Science Center, Hiroshima University, Higashihiroshima, Hiroshima 739-8526 (Japan); Sekiguchi, Kazuhiro [National Astronomical Observatory of Japan, National Institute of Natural Sciences, Mitaka, Tokyo 181-8588 (Japan); Oasa, Yumiko [Faculty of Education, Saitama University, Sakura, Saitama 338-8570 (Japan); Saito, Yoshihiko [Department of Physics, Tokyo Institute of Technology, Meguro-ku, Tokyo 152-8551 (Japan); Morokuma, Tomoki [Institute of Astronomy, Graduate School of Science, The University of Tokyo, Mitaka, Tokyo 181-0015 (Japan); Murata, Katsuhiro [Department of Astrophysics, Nagoya University, Chikusa-ku, Nagoya 464-8602 (Japan); Nogami, Daisaku [Department of Astronomy, Graduate School of Science, Kyoto University, Kyoto 606-8502 (Japan); and others

    2015-01-10

    We report a new observation of the Jupiter family comet 209P/LINEAR during its 2014 return. The comet is recognized as a dust source of a new meteor shower, the May Camelopardalids. 209P/LINEAR was apparently inactive at a heliocentric distance r{sub h} = 1.6 AU and showed weak activity at r{sub h} ≤ 1.4 AU. We found an active region of <0.001% of the entire nuclear surface during the comet's dormant phase. An edge-on image suggests that particles up to 1 cm in size (with an uncertainty of factor 3-5) were ejected following a differential power-law size distribution with index q = –3.25 ± 0.10. We derived a mass-loss rate of 2-10 kg s{sup –1} during the active phase and a total mass of ≈5 × 10{sup 7} kg during the 2014 return. The ejection terminal velocity of millimeter- to centimeter-sized particles was 1-4 m s{sup –1}, which is comparable to the escape velocity from the nucleus (1.4 m s{sup –1}). These results imply that such large meteoric particles marginally escaped from the highly dormant comet nucleus via the gas drag force only within a few months of the perihelion passage.

  16. Dust from Comet 209P/LINEAR during its 2014 Return: Parent Body of a New Meteor Shower, the May Camelopardalids

    Ishiguro, Masateru; Hanayama, Hidekazu; Takahashi, Jun; Hasegawa, Sunao; Sarugaku, Yuki; Watanabe, Makoto; Imai, Masataka; Goda, Shuhei; Akitaya, Hiroshi; Takagi, Yuhei; Morihana, Kumiko; Honda, Satoshi; Arai, Akira; Sekiguchi, Kazuhiro; Oasa, Yumiko; Saito, Yoshihiko; Morokuma, Tomoki; Murata, Katsuhiro; Nogami, Daisaku; Nagayama, Takahiro; Yanagisawa, Kenshi; Yoshida, Michitoshi; Ohta, Kouji; Kawai, Nobuyuki; Miyaji, Takeshi; Fukushima, Hideo; Watanabe, Jun-ichi; Opitom, Cyrielle; Jehin, Emmanuel; Gillon, Michael; Vaubaillon, Jeremie J

    2014-01-01

    We report a new observation of the Jupiter-family comet 209P/LINEAR during its 2014 return. The comet is recognized as a dust source of a new meteor shower, the May Camelopardalids. 209P/LINEAR was apparently inactive at a heliocentric distance rh = 1.6 au and showed weak activity at rh < 1.4 au. We found an active region of <0.001% of the entire nuclear surface during the comet's dormant phase. An edge-on image suggests that particles up to 1 cm in size (with an uncertainty of factor 3-5) were ejected following a differential power-law size distribution with index q=-3.25+-0.10. We derived a mass loss rate of 2-10 kg/s during the active phase and a total mass of ~5x10^7 kg during the 2014 return. The ejection terminal velocity of millimeter- to centimeter-sized particles was 1-4 m/s, which is comparable to the escape velocity from the nucleus (1.4 m/s). These results imply that such large meteoric particles marginally escaped from the highly dormant comet nucleus via the gas drag force only within a fe...

  17. Developments of 207Pb, 208Pb and 209Bi target wheels in the synthesis of 107Ns, 108Hs and 109Mt

    The developments of 207Pb, 208Pb and 209Bi target wheels and their applications in heavy-ion fusion reactions are reviewed. In both, fabrication and use, the centers of the evaporator or accelerator beams are focussed at wheel radii of 155 mm to specially shaped frames which generate very homogeneous target layers and very constant reaction and counting rates in the experiment. Target areas of up to ∼98% of a wheel's circumference of 974 mm can be provided. The preparation procedures for necessary C backings and protecting layers of C are described, and details are given for the developments of high-vacuum evaporations of 207Pb, 208Pb and 209Bi with deposition yields of 35-55% from tantalum crucibles. The applications of the target wheels in heavy-ion fusion reactions with beams of 54Cr and 58Fe at energies near the Coulomb barrier and intensities of ∼1012 particles/s are mentioned. The target parameters for the production runs of the new chemical elements 107Ns, 108Hs and 109Mt are included. (orig.)

  18. 母源性BDE-209暴露对仔鼠海马一氧化氮神经递质的影响%Eeffect of maternal BDE-209 exposure on the Nitric Oxide neurotransmitter in hippocampus of offspring rats

    吴英; 余艳红; 陈敦金

    2012-01-01

    目的 从一氧化氮神经递质角度探讨母源性BDE-209损伤仔鼠神经系统的可能机制.方法 3月龄wistar雌鼠自确定交配成功后随机分为实验组A、B、C、D和对照组E,通过胃灌方法建立自妊娠期至哺乳期的不同剂量BDE-209(100、300、600、1200mg/kg/d)的暴露模型,21天仔鼠断乳后各组随机选取10只仔鼠作为研究对象,应用光电比色法和放射免疫法分别测定各组仔鼠海马组织中一氧化氮(N0)含量、神经元型一氧化氮合成酶( nNOS)活性、环鸟苷酸(cGMP)含量.结果 与对照组E相比,C、D组NO含量和nNOS活性明显增加(P<0.05);B、C、D组cGMP含量明显升高(P<0.05).结论 一定剂量的母源性BDE-209可能通过影响仔鼠NO神经信号递质系统影响其神经认知功能.%Objective: To study the possible mechanism of the damage to nerve system of prenatal and lactational BDE — 209 ( brominated Diphenyl Ethers - 209 ) in offspring rats from the view of Nitric Oxide neurotransmitter system. Methods: After the determination of mate successfully, the female Wistar rats at the age of 3 months were divided in to five groups randomly, so it is the experimental group A, B, C, D and the control group E. Peanut oil suspensions of commercial BDE —209 was given in doses of 100 (group A) , 300 (group B) , 600 (group C) , 1200 (group D) mg/ kg ? D by oral gavage for maternal rats in the experimental groups. The control group (E) was administered only with the same capacity of Peanut oil at the same time. Pick up respectively ten male rats of the fist weaning offspring in each group randomly as the object of our study. We measure the levels of Nitric Oxide (NO) , neuro - nitricoxide synthase (nNOS) and the cyclic guanylic acid (cGMP) in hippocampus tissue of offspring rats by photoelectric colorimetry and radioimmunity in each group. Results: Compared to the offspring rats in control group E, the content of NO and activity of nNOS in the group C and group

  19. Calculation of neutron cross sections for 90Zr, 208Pb and 209Bi in the energy range of 0.5-25 MeV by using the optical model potentials

    Neutron total cross sections and differential elastic scattering cross sections for the nuclides 90Zr, 208Pb and 209Bi were calculated using different global spherical optical potential (SOP) parameter sets at neutron energies from 0.5-25 MeV. Calculated cross sections for the corresponding nuclides were compared with their experimental data obtained by the EXFOR file to select the best fit parameter sets. It is found that the parameter sets of Ferer Rapaport for 90Zr and Bechetti and Greenless for 208Pb and 209Bi are the best fitted set to obtain the experimental data of total cross sections and angular distributions of these nuclides. (author)

  20. Determination of αS using OPAL hadronic event shapes at √(s)= 91-209∝GeV and resummed NNLO calculations

    Hadronic event shape distributions from e+e- annihilation measured by the OPAL experiment at centre-of-mass energies between 91 GeV and 209 GeV are used to determine the strong coupling αS. The results are based on QCD predictions complete to the next-to-next-to-leading order (NNLO), and on NNLO calculations matched to the resummed next-to-leading-log-approximation terms (NNLO + NLLA). The combined NNLO result from all variables and centre-of-mass energies is while the combined NNLO + NLLA result is The completeness of the NNLO and NNLO + NLLA results with respect to missing higher order contributions, studied by varying the renormalization scale, is improved compared to previous results based on NLO or NLO + NLLA predictions only. The observed energy dependence of αS agrees with the QCD prediction of asymptotic freedom and excludes the absence of running. (orig.)

  1. Measurement of the photon proton total cross section at a center-of-mass energy of 209-GeV at HERA

    Chekanov, S; Krakauer, D A; Magill, S; Musgrave, B; Pellegrino, A; Repond, J; Yoshida, R; Mattingly, M C K; Antonioli, P; Bari, G; Basile, M; Bellagamba, L; Boscherini, D; Bruni, A; Bruni, G; Cara Romeo, G; Cifarelli, Luisa; Cindolo, F; Contin, A; Corradi, M; De Pasquale, S; Giusti, P; Iacobucci, G; Levi, G; Margotti, A; Massam, Thomas; Nania, R; Palmonari, F; Pesci, A; Sartorelli, G; Zichichi, A; Aghuzumtsyan, G; Bartsch, D; Brock, I; Crittenden, James Arthur; Goers, S; Hartmann, H; Hilger, E; Irrgang, P; Jakob, H P; Kappes, A; Katz, U F; Kerger, R; Kind, O; Paul, E; Rautenberg, J; Renner, R; Schnurbusch, H; Stifutkin, A; Tandler, J; Voss, K C; Weber, A; Wessoleck, H; Bailey, D S; Brook, N H; Cole, J E; Foster, B; Heath, G P; Heath, H F; Robins, S; Rodrigues, E; Scott, J; Tapper, R J; Wing, M; Capua, M; Mastroberardino, A; Schioppa, M; Susinno, G; Jeoung, H Y; Kim, J Y; Lee, J H; Lim, I T; Ma, K J; Pac, M Y; Caldwell, A; Helbich, M; Liu, X; Mellado, B; Paganis, S; Schmidke, W B; Sciulli, F; Chwastowski, J; Eskreys, Andrzej; Figiel, J; Olkiewicz, K; Przybycien, M B; Stopa, P; Zawiejski, L; Bednarek, B; Grabowska-Bold, I; Jelen, K; Kisielewska, D; Kowal, A M; Kowal, M; Kowal, T; Mindur, B; Rulikowska-Zarebska, E; Suszycki, L; Szuba, D; Szuba, J; Kotanski, Andrzej; Slominski, W; Bauerdick, L A T; Behrens, U; Borras, K; Chiochia, V; Dannheim, D; Desler, K; Drews, G; Fourletova, J; Fox-Murphy, A; Fricke, U; Geiser, A; Göbel, F; Göttlicher, P; Graciani, R; Haas, T; Hain, W; Hartner, G F; Hillert, S; Kötz, U; Kowalski, H; Labes, H; Lelas, D; Löhr, B; Mankel, R; Martens, J; Martínez, M; Moritz, M; Notz, D; Petrucci, M C; Polini, A; Schneekloth, U; Selonke, F; Stonjek, S; Surrow, B; Whitmore, J J; Wichmann, R; Wolf, G; Youngman, C; Zeuner, W; Coldewey, C; López-Duran-Viani, A; Meyer, A; Schlenstedt, S; Barbagli, G; Gallo, E; Genta, C; Pelfer, P G; Bamberger, Andreas; Benen, A; Coppola, N; Markun, P; Raach, H; Wölfle, S; Bell, M; Bussey, Peter J; Doyle, A T; Glasman, C; Hanlon, S; Lee, S W; Lupi, A; McCance, G J; Saxon, D H; Skillicorn, Ian O; Bodmann, B; Holm, U; Salehi, H; Wick, K; Ziegler, A; Carli, T; Gialas, I; Klimek, K; Lohrmann, E; Milite, M; Collins-Tooth, C; Foudas, C; Goncalo, R; Long, K R; Metlica, F; Miller, D B; Tapper, A D; Walker, R; Cloth, P; Filges, D; Kuze, M; Nagano, K; Tokushuku, K; Yamada, S; Yamazaki, Y; Barakbaev, A N; Boos, E G; Pokrovskiy, N S; Zhautykov, B O; Ahn, S H; Lee, S B; Park, S K; Lim, H; Son, D; Barreiro, F; García, G; González, O; Labarga, L; Del Peso, J; Redondo, I; Terron, J; Vázquez, M; Barbi, M; Bertolin, A; Corriveau, F; Ochs, A; Padhi, S; Stairs, D G; Saint-Laurent, M G; Tsurugai, T; Antonov, A; Bashkirov, V; Danilov, P; Dolgoshein, B A; Gladkov, D; Sosnovtsev, V V; Suchkov, S; Dementiev, R K; Ermolov, P F; Golubkov, Yu A; Katkov, I I; Khein, L A; Korotkova, N A; Korzhavina, I A; Kuzmin, V A; Levchenko, B B; Lukina, O Yu; Proskuryakov, A S; Shche, L M; Solomin, A N; Vlasov, N N; Zotkin, S A; Bokel, C; Engelen, J; Grijpink, S; Koffeman, E; Kooijman, P; Maddox, E; Schagen, S; Tassi, E; Tiecke, H G; Tuning, N; Velthuis, J J; Wiggers, L; De Wolf, E; Brümmer, N; Bylsma, B; Durkin, L S; Gilmore, J; Ginsburg, C M; Kim, C L; Ling, T Y; Boogert, S; Cooper-Sarkar, A M; Devenish, R C E; Ferrando, J; Matsushita, T; Rigby, M; Ruske, O; Sutton, M R; Walczak, R; Brugnera, R; Carlin, R; Dal Corso, F; Dusini, S; Garfagnini, A; Limentani, S; Longhin, A; Parenti, A; Posocco, M; Stanco, L; Turcato, M; Adamczyk, L; Oh, B Y; Saull, P R B; Iga, Y; D'Agostini, Giulio; Marini, G; Nigro, A; Cormack, C; Hart, J C; McCubbin, N A; Heusch, C A; Park, I H; Pavel, N; Abramowicz, H; Dagan, S; Gabareen, A; Kananov, S; Kreisel, A; Levy, A; Abe, T; Fusayasu, T; Kohno, T; Umemori, K; Yamashita, T; Hamatsu, R; Hirose, T; Inuzuka, M; Kitamura, S; Matsuzawa, K; Nishimura, T; Arneodo, M; Cartiglia, N; Cirio, R; Costa, M; Ferrero, M I; Maselli, S; Monaco, V; Peroni, C; Ruspa, M; Sacchi, R; Solano, A; Staiano, A; Galea, R; Koop, T; Levman, G M; Martin, J F; Mirea, A; Sabetfakhri, A; Butterworth, J M; Gwenlan, C; Hall-Wilton, R; Hayes, M E; Heaphy, E A; Jones, T W; Lane, J B; Lightwood, M S; West, B J; Ciborowski, J; Ciesielski, R; Grzelak, G; Nowak, R J; Pawlak, J M; Smalska, B; Sztuk, J; Tymieniecka, T; Ukleja, A; Ukleja, J; Zakrzewski, J A; Adamus, M; Plucinsky, P P; Eisenberg, Y; Gladilin, L K; Hochman, D; Karshon, U; Breitweg, J; Chapin, D; Cross, R; Kcira, D; Lammers, S; Reeder, D D; Savin, A A; Smith, W H; Deshpande, A A; Dhawan, S; Hughes, V W; Straub, P B; Bhadra, S; Catterall, C D; Fourletov, S; Menary, S R; Soares, M; Standage, J

    2002-01-01

    The photon-proton total cross section has been measured in the process e+ p -> e+ gamma p -> e+ X with the ZEUS detector at HERA. Events were collected with photon virtuality Q^2 < 0.02 GeV^2 and average gamma-p center-of-mass energy W_{gamma p} = 209 GeV in a dedicated run, designed to control systematic effects, with an integrated luminosity of 49 nb^{-1}. The measured total cross section is sigma_{tot}^{gamma p} = 174 +- 1 (stat.) +- 13 (syst.) microbarns. The energy dependence of the cross section is compatible with parameterizations of high-energy p-p and p-pbar data.

  2. Tests of the Standard Model and Constraints on New Physics from Measurements of Fermion-Pair Production at 189-209 GeV at LEP

    Abbiendi, G; Åkesson, P F; Alexander, G; Allison, J; Amaral, P; Anagnostou, G; Anderson, K J; Arcelli, S; Asai, S; Axen, D A; Azuelos, Georges; Bailey, I; Barberio, E; Barillari, T; Barlow, R J; Batley, J Richard; Bechtle, P; Behnke, T; Bell, K W; Bell, P J; Bella, G; Bellerive, A; Benelli, G; Bethke, Siegfried; Biebel, O; Boeriu, O; Bock, P; Boutemeur, M; Braibant, S; Brigliadori, L; Brown, R M; Büsser, K; Burckhart, H J; Campana, S; Carnegie, R K; Caron, B; Carter, A A; Carter, J R; Chang, C Y; Charlton, D G; Ciocca, C; Csilling, Akos; Cuffiani, M; Dado, S; de Roeck, A; De Wolf, E A; Desch, Klaus; Dienes, B; Donkers, M; Dubbert, J; Duchovni, E; Duckeck, G; Duerdoth, I P; Etzion, E; Fabbri, Franco Luigi; Feld, L; Ferrari, P; Fiedler, F; Fleck, I; Ford, M; Frey, A; Fürtjes, A; Gagnon, P; Gary, J W; Gaycken, G; Geich-Gimbel, C; Giacomelli, G; Giacomelli, P; Giunta, M; Goldberg, J; Gross, E; Grunhaus, Jacob; Gruwé, M; Günther, P O; Sen-Gupta, A; Hajdu, C; Hamann, M; Hanson, G G; Harel, A; Hauschild, M; Hawkes, C M; Hawkings, R; Hemingway, Richard J; Hensel, C; Herten, G; Heuer, R D; Hill, J C; Hoffman, K; Horváth, D; Igo-Kemenes, P; Ishii, K; Jeremie, H; Jovanovic, P; Junk, T R; Kanaya, N; Kanzaki, J; Karlen, Dean A; Kawagoe, K; Kawamoto, T; Keeler, Richard K; Kellogg, R G; Kennedy, B W; Klein, K; Klier, A; Kluth, S; Kobayashi, T; Kobel, M; Komamiya, S; Kormos, L L; Kramer, T; Krieger, P; Von Krogh, J; Krüger, K; Kühl, T; Kupper, M; Lafferty, G D; Landsman, Hagar Yaël; Lanske, D; Layter, J G; Lellouch, D; Letts, J; Levinson, L; Lillich, J; Lloyd, S L; Loebinger, F K; Lü, J; Ludwig, A; Ludwig, J; MacPherson, A; Mader, W; Marcellini, S; Martin, A J; Masetti, G; Mashimo, T; Mättig, P; McDonald, W J; McKenna, J A; McMahon, T J; McPherson, R A; Meijers, F; Menges, W; Merritt, F S; Mes, H; Michelini, Aldo; Mihara, S; Mikenberg, G; Miller, D J; Moed, S; Mohr, W; Mori, T; Mutter, A; Nagai, K; Nakamura, I; Nanjo, H; Neal, H A; Nisius, R; O'Neale, S W; Oh, A; Okpara, A N; Oreglia, M J; Orito, S; Pahl, C; Pásztor, G; Pater, J R; Pilcher, J E; Pinfold, J L; Plane, D E; Poli, B; Polok, J; Pooth, O; Przybycien, M B; Quadt, A; Rabbertz, K; Rembser, C; Renkel, P; Roney, J M; Rosati, S; Rozen, Y; Runge, K; Sachs, K; Saeki, T; Sarkisyan-Grinbaum, E; Schaile, A D; Schaile, O; Scharff-Hansen, P; Schieck, J; Schörner-Sadenius, T; Schröder, M; Schumacher, M; Schwick, C; Scott, W G; Seuster, R; Shears, T G; Shen, B C; Sherwood, P; Skuja, A; Smith, A M; Sobie, R J; Söldner-Rembold, S; Spanó, F; Stahl, A; Stephens, K; Strom, D; Ströhmer, R; Tarem, S; Tasevsky, M; Teuscher, R; Thomson, M A; Torrence, E; Toya, D; Tran, P; Trigger, I; Trócsányi, Z L; Tsur, E; Turner-Watson, M F; Ueda, I; Ujvári, B; Vollmer, C F; Vannerem, P; Vertesi, R; Verzocchi, M; Voss, H; Vossebeld, Joost Herman; Waller, D; Ward, C P; Ward, D R; Watkins, P M; Watson, A T; Watson, N K; Wells, P S; Wengler, T; Wermes, N; Wetterling, D; Wilson, G W; Wilson, J A; Wolf, G; Wyatt, T R; Yamashita, S; Zer-Zion, D; Zivkovic, L

    2004-01-01

    Cross-section and angular distributions for hadronic and lepton-pair final states in e+e- collisions at centre-of-mass energies between 189 GeV and 209 GeV, measured with the OPAL detector at LEP, are presented and compared with the predictions of the Standard Model. The measurements are used to determine the electromagnetic coupling constant alphaem at LEP2 energies. In addition, the results are used together with OPAL measurements at 91-183 GeV within the S-matrix formalism to determine the gamma-Z interference term and to make an almost model-independent measurement of the Z mass. Limits on extensions to the Standard Model described by effective four-fermion contact interactions or the addition of a heavy Z boson are also presented.

  3. Study of Z Pair Production and Anomalous Couplings in $e^+ e^-$ Collisions at $\\sqrt{s}$ between 190 GeV and 209 GeV

    Abbiendi, G; Åkesson, P F; Alexander, G; Allison, J; Amaral, P; Anagnostou, G; Anderson, K J; Arcelli, S; Asai, S; Axen, D A; Azuelos, Georges; Bailey, I; Barberio, E; Barlow, R J; Batley, J Richard; Bechtle, P; Behnke, T; Bell, K W; Bell, P J; Bella, G; Bellerive, A; Benelli, G; Bethke, Siegfried; Biebel, O; Boeriu, O; Bock, P; Boutemeur, M; Braibant, S; Brigliadori, L; Brown, R M; Büsser, K; Burckhart, H J; Campana, S; Carnegie, R K; Caron, B; Carter, A A; Carter, J R; Chang, C Y; Charlton, D G; Csilling, A; Cuffiani, M; Dado, S; de Roeck, A; De Wolf, E A; Desch, Klaus; Dienes, B; Donkers, M; Dubbert, J; Duchovni, E; Duckeck, G; Duerdoth, I P; Etzion, E; Fabbri, Franco Luigi; Feld, L; Ferrari, P; Fiedler, F; Fleck, I; Ford, M; Frey, A; Fürtjes, A; Gagnon, P; Gary, J W; Gaycken, G; Geich-Gimbel, C; Giacomelli, G; Giacomelli, P; Giunta, M; Goldberg, J; Gross, E; Grunhaus, Jacob; Gruwé, M; Günther, P O; Sen-Gupta, A; Hajdu, C; Hamann, M; Hanson, G G; Harder, K; Harel, A; Harin-Dirac, M; Hauschild, M; Hawkes, C M; Hawkings, R; Hemingway, R J; Hensel, C; Herten, G; Heuer, R D; Hill, J C; Hoffman, K; Horváth, D; Igo-Kemenes, P; Ishii, K; Jeremie, H; Jovanovic, P; Junk, T R; Kanaya, N; Kanzaki, J; Karapetian, G V; Karlen, Dean A; Kawagoe, K; Kawamoto, T; Keeler, R K; Kellogg, R G; Kennedy, B W; Kim, D H; Klein, K; Klier, A; Kluth, S; Kobayashi, T; Kobel, M; Komamiya, S; Kormos, L L; Kramer, T; Krieger, P; Von Krogh, J; Krüger, K; Kühl, T; Kupper, M; Lafferty, G D; Landsman, Hagar Yaël; Lanske, D; Layter, J G; Leins, A; Lellouch, D; Letts, J; Levinson, L; Lillich, J; Lloyd, S L; Loebinger, F K; Lü, J; Ludwig, J; MacPherson, A; Mader, W; Marcellini, S; Martin, A J; Masetti, G; Mashimo, T; Mättig, P; McDonald, W J; McKenna, J A; McMahon, T J; McPherson, R A; Meijers, F; Menges, W; Merritt, F S; Mes, H; Michelini, A; Mihara, S; Mikenberg, G; Miller, D J; Moed, S; Mohr, W; Mori, T; Mutter, A; Nagai, K; Nakamura, I; Nanjo, H; Neal, H A; Nisius, R; O'Neale, S W; Oh, A; Okpara, A N; Oreglia, M J; Orito, S; Pahl, C; Pásztor, G; Pater, J R; Patrick, G N; Pilcher, J E; Pinfold, J L; Plane, D E; Poli, B; Polok, J; Pooth, O; Przybycien, M B; Quadt, A; Rabbertz, K; Rembser, C; Renkel, P; Rick, H; Roney, J M; Rosati, S; Rozen, Y; Runge, K; Sachs, K; Saeki, T; Sarkisyan-Grinbaum, E; Schaile, A D; Schaile, O; Scharff-Hansen, P; Schieck, J; Schörner-Sadenius, T; Schröder, M; Schumacher, M; Schwick, C; Scott, W G; Seuster, R; Shears, T G; Shen, B C; Sherwood, P; Siroli, G P; Skuja, A; Smith, A M; Sobie, R J; Söldner-Rembold, S; Spanó, F; Stahl, A; Stephens, K; Strom, D; Ströhmer, R; Tarem, S; Tasevsky, M; Taylor, R J; Teuscher, R; Thomson, M A; Torrence, E; Toya, D; Tran, P; Trigger, I; Trócsányi, Z L; Tsur, E; Turner-Watson, M F; Ueda, I; Ujvári, B; Vollmer, C F; Vannerem, P; Vertesi, R; Verzocchi, M; Voss, H; Vossebeld, Joost Herman; Waller, D; Ward, C P; Ward, D R; Warsinsky, M; Watkins, P M; Watson, A T; Watson, N K; Wells, P S; Wengler, T; Wermes, N; Wetterling, D; Wilson, G W; Wilson, J A; Wolf, G; Wyatt, T R; Yamashita, S; Zer-Zion, D; Zivkovic, L

    2003-01-01

    A study of Z-boson pair production in e+e- annihilation at center-of-mass energies between 190 GeV and 209 GeV is reported. Final states containing only leptons, (l+l-l+l- and l+l-nn), quark and lepton pairs, (qql+l-, qqnn) and only hadrons (qqqq) are considered. In all states with at least one Z boson decaying hadronically, lifetime, lepton and event-shape tags are used to separate bb pairs from qq final state. Limits on anomalous ZZgamma and ZZZ couplings are derived from the measured cross sections and from event kinematics using an optimal observable method. Limits on low scale gravity with large dimensions are derived from the cross sections and their dependence on polar angle.

  4. Search for pair-produced leptoquarks in $e^{+}e^{-}$ interactions at $\\sqrt{s}\\simeq$ 189 -209 GeV

    Abbiendi, G; Åkesson, P F; Alexander, G; Allison, J; Amaral, P; Anagnostou, G; Anderson, K J; Arcelli, S; Asai, S; Axen, D A; Azuelos, Georges; Bailey, I; Barberio, E; Barlow, R J; Batley, J Richard; Bechtle, P; Behnke, T; Bell, K W; Bell, P J; Bella, G; Bellerive, A; Benelli, G; Bethke, Siegfried; Biebel, O; Bock, P; Boeriu, O; Boutemeur, M; Braibant, S; Brigliadori, L; Brown, R M; Burckhart, H J; Büsser, K; Campana, S; Carnegie, R K; Caron, B; Carter, A A; Carter, J R; Chang, C Y; Charlton, D G; Csilling, Akos; Cuffiani, M; Dado, S; de Roeck, A; De Wolf, E A; Desch, Klaus; Dienes, B; Donkers, M; Dubbert, J; Duchovni, E; Duckeck, G; Duerdoth, I P; Etzion, E; Fabbri, Franco Luigi; Feld, L; Ferrari, P; Fiedler, F; Fleck, I; Ford, M; Frey, A; Fürtjes, A; Gagnon, P; Gary, J W; Gaycken, G; Geich-Gimbel, C; Giacomelli, G; Giacomelli, P; Giunta, M; Goldberg, J; Gross, E; Grunhaus, Jacob; Gruwé, M; Günther, P O; Hajdu, C; Hamann, M; Hanson, G G; Harder, K; Harel, A; Harin-Dirac, M; Hauschild, M; Hawkes, C M; Hawkings, R; Hemingway, Richard J; Hensel, C; Herten, G; Heuer, R D; Hill, J C; Hoffman, K; Horváth, D; Igo-Kemenes, P; Ishii, K; Jeremie, H; Jovanovic, P; Junk, T R; Kanaya, N; Kanzaki, J; Karapetian, G V; Karlen, Dean A; Kawagoe, K; Kawamoto, T; Keeler, Richard K; Kellogg, R G; Kennedy, B W; Kim, D H; Klein, K; Klier, A; Kluth, S; Kobayashi, T; Kobel, M; Komamiya, S; Kormos, L L; Krämer, T; Krieger, P; Von Krogh, J; Krüger, K; Kupper, M; Kühl, T; Lafferty, G D; Landsman, Hagar Yaël; Lanske, D; Layter, J G; Leins, A; Lellouch, D; Letts, J; Levinson, L; Lillich, J; Lloyd, S L; Loebinger, F K; Lü, J; Ludwig, J; MacPherson, A; Mader, W; Marcellini, S; Martin, A J; Masetti, G; Mashimo, T; McDonald, W J; McKenna, J A; McMahon, T J; McPherson, R A; Meijers, F; Menges, W; Merritt, F S; Mes, H; Michelini, Aldo; Mihara, S; Mikenberg, G; Miller, D J; Moed, S; Mohr, W; Mori, T; Mutter, A; Mättig, P; Nagai, K; Nakamura, I; Nanjo, H; Neal, H A; Nisius, R; O'Neale, S W; Oh, A; Okpara, A N; Oreglia, M J; Orito, S; Pahl, C; Pater, J R; Patrick, G N; Pilcher, J E; Pinfold, J L; Plane, D E; Poli, B; Polok, J; Pooth, O; Przybycien, M B; Pásztor, G; Quadt, A; Rabbertz, K; Rembser, C; Renkel, P; Roney, J M; Rosati, S; Rozen, Y; Runge, K; Sachs, K; Saeki, T; Sarkisyan-Grinbaum, E; Schaile, A D; Schaile, O; Scharff-Hansen, P; Schieck, J; Schröder, M; Schumacher, M; Schwick, C; Schörner-Sadenius, T; Scott, W G; Sen-Gupta, A; Seuster, R; Shears, T G; Shen, B C; Sherwood, P; Siroli, G P; Skuja, A; Smith, A M; Sobie, R J; Spanó, F; Stahl, A; Stephens, K; Strom, D; Ströhmer, R; Söldner-Rembold, S; Tarem, S; Tasevsky, M; Taylor, R J; Teuscher, R; Thomson, M A; Torrence, E; Toya, D; Tran, P; Trigger, I; Trócsányi, Z L; Tsur, E; Turner-Watson, M F; Ueda, I; Ujvári, B; Vannerem, P; Vertesi, R; Verzocchi, M; Vollmer, C F; Voss, H; Vossebeld, Joost Herman; Waller, D; Ward, C P; Ward, D R; Watkins, P M; Watson, A T; Watson, N K; Wells, P S; Wengler, T; Wermes, N; Wetterling, D; Wilson, G W; Wilson, J A; Wolf, G; Wyatt, T R; Yamashita, S; Zer-Zion, D; Zivkovic, L

    2003-01-01

    A search for pair-produced leptoquarks is performed using e+e- collision events collected by the OPAL detector at LEP at centre-of-mass energies between 189 and 209 GeV. The data sample corresponds to a total integrated luminosity of 596 pb^-1. The leptoquarks are assumed to be produced via couplings to the photon and the Z0. For a given search channel only leptoquark decays involving a single lepton generation are considered. No evidence for leptoquark pair production is observed. Lower limits on masses for scalar and vector leptoquarks are calculated. The results improve most of the LEP limits derived from previous searches for the pair production process by 10-25 GeV, depending on the leptoquark quantum numbers.

  5. The damping of the single-particle proton strengths in 1isub(11/2) and 1jsub(15/2) states of 209Bi

    15 proton states have been mixed with the low-lying vibrational states as well as the vibrational states arising from the giant resonances in 208Pb to search for the broad fragmentations of the 1 'one' j15/2 and 'one' i11/2 states as observed in the most recent (α,t) reaction on 208Pb. The distribution of the shell-model strengths of these two high-spin states can be explained on the basis of the core polarisation effect on these two proton states of 209Bi. Knowledge of the altered shell-model energies of the proton states of 208Pb is necessary for the search for magicity in the superheavy nuclei. (author)

  6. Search for a fourth generation b'-quark at LEP-II at sqrt{s}=196-209 GeV

    Abdallah, J; Adam, W; Adzic, P; Albrecht, T; Alemany-Fernandez, R; Allmendinger, T; Allport, P P; Amaldi, Ugo; Amapane, N; Amato, S; Anashkin, E; Andreazza, A; Andringa, S; Anjos, N; Antilogus, P; Apel, W D; Arnoud, Y; Ask, S; Åsman, B; Augustin, J E; Augustinus, A; Baillon, P; Ballestrero, A; Bambade, P; Barbier, R; Bardin, D; Barker, G J; Baroncelli, A; Battaglia, M; Baubillier, M; Becks, K H; Begalli, M; Behrmann, A; Ben-Haim, E; Benekos, N; Benvenuti, A; Bérat, C; Berggren, M; Berntzon, L; Bertrand, D; Besançon, M; Besson, N; Bloch, D; Blom, M; Bluj, M; Bonesini, M; Boonekamp, M; Booth, P S L; Borisov, G; Botner, O; Bouquet, B; Bowcock, T J V; Boyko, I; Bracko, M; Brenner, R; Brodet, E; Brückman, P; Brunet, J M; Buschbeck, B; Buschmann, P; Calvi, M; Camporesi, T; Canale, V; Carena, F; Castro, N; Cavallo, F; Chapkin, M; Charpentier, P; Checchia, P; Chierici, R; Shlyapnikov, P; Chudoba, J; Chung, S U; Cieslik, K; Collins, P; Contri, R; Cosme, G; Cossutti, F; Costa, M J; Crennell, D J; Cuevas-Maestro, J; D'Hondt, J; Dalmau, J; Da Silva, T; Da Silva, W; Della Ricca, G; De Angelis, A; de Boer, Wim; De Clercq, C; De Lotto, B; De Maria, N; De Min, A; De Paula, L; Di Ciaccio, L; Di Simone, A; Doroba, K; Drees, J; Eigen, G; Ekelöf, T J C; Ellert, M; Elsing, M; Espirito-Santo, M C; Fanourakis, G K; Fassouliotis, D; Feindt, M; Fernández, J; Ferrer, A; Ferro, F; Flagmeyer, U; Föth, H; Fokitis, E; Fulda-Quenzer, F; Fuster, J; Gandelman, M; García, C; Gavillet, P; Gazis, E; Gokieli, R; Golob, B; Gómez-Ceballos, G; Gonçalves, P; Graziani, E; Grosdidier, G; Grzelak, K; Guy, J; Haag, C; Hallgren, A; Hamacher, K; Hamilton, K; Haug, S; Hauler, F; Hedberg, V; Hennecke, M; Herr, H; Hoffman, J; Holmgren, S O; Holt, P J; Houlden, M A; Jackson, J N; Jarlskog, G; Jarry, P; Jeans, D; Johansson, E K; Johansson, P D; Jonsson, P; Joram, C; Jungermann, L; Kapusta, F; Katsanevas, S; Katsoufis, E; Kernel, G; Kersevan, B P; Kerzel, U; King, B T; Kjaer, N J; Kluit, P; Kokkinias, P; Kourkoumelis, C; Kuznetsov, O; Krumshtein, Z; Kucharczyk, M; Lamsa, J; Leder, G; Ledroit, F; Leinonen, L; Leitner, R; Lemonne, J; Lepeltier, V; Lesiak, T; Liebig, W; Liko, D; Lipniacka, A; Lopes, J H; López, J M; Loukas, D; Lutz, P; Lyons, L; MacNaughton, J; Malek, A; Maltezos, S; Mandl, F; Marco, J; Marco, R; Maréchal, B; Margoni, M; Marin, J C; Mariotti, C; Markou, A; Martínez-Rivero, C; Mazzucato, M; Mönig, K; Mulders, M; Nawrocki, K; Olshevskii, A G; Masik, J; McNulty, R; Mastroyiannopoulos, N; Migliore, E; Matorras, F; Matteuzzi, C; Mazzucato, F; Moch, M; Montenegro, J; Moraes, D; Moreno, S; Morettini, P; Müller, U; Münich, K; Murray, W; Monge, R; Orava, R; Muryn, B; Österberg, K; Myatt, G; Myklebust, T; Nassiakou, M; Oliveira, O; Paganoni, M; Navarria, F; Nikolenko, M; Oblakowska-Mucha, A; Ouraou, A; Obraztsov, V F; Oyanguren, A; Oliveira, S M; Paiano, S; Meroni, C; Mitaroff, W A; Mjörnmark, U; Moa, T; Mundim, L; Onofre, A; Nicolaidou, R; Palacios, J P; Palka, H; Papadopoulou, T D; Pape, L; Parkes, C; Parodi, F; Parzefall, U; Passeri, A; Passon, O; Peralta, L; Perepelitsa, V; Perrotta, A; Petrolini, A; Piedra, J; Pieri, L; Pierre, F; Pimenta, M; Piotto, E; Podobnik, T; Poireau, V; Pol, M E; Polok, G; Pozdnyakov, V; Pukhaeva, N; Pullia, A; Rames, J; Read, A; Rebecchi, P; Rehn, J; Reid, D; Reinhardt, R; Renton, P B; Richard, F; Rídky, J; Rivero, M; Rodríguez, D; Romero, A; Ronchese, P; Roudeau, P; Rovelli, T; Ruhlmann-Kleider, V; Ryabtchikov, D; Sadovskii, A; Siebel, M; Stanitzki, M; Salmi, L; Stocchi, A; Salt, J; Sander, C; Stugu, B; Santos, R; Savoy-Navarro, A; Sopczak, A; Szeptycka, M; Schwickerath, U; Sosnowski, R; Szumlak, T; Sekulin, R; Spassoff, Tz; Tabarelli de Fatis, T; Sisakian, A; Smadja, G; Strauss, J; Smirnova, O; Sokolov, A; Szczekowski, M; Taffard, A C; Tegenfeldt, F; Timmermans, J; Tkatchev, L; Tobin, M; Todorovova, S; Tomé, B; Tonazzo, A; Tortosa, P; Travnicek, P; Treille, D; Tristram, G; Trochimczuk, M; Troncon, C; Turluer, M L; Tyapkin, I A; Tyapkin, P; Tzamarias, S; Uvarov, V; Valenti, G; van Dam, P; Van Eldik, J; Van Remortel, N; Van Vulpen, I; Vegni, G; Veloso, F; Venus, W; Verdier, P; Verzi, V; Vilanova, D; Vitale, L; Vrba, V; Wahlen, H; Washbrook, A J; Weiser, C; Wicke, D; Wickens, J; Wilkinson, G; Winter, M; Witek, M; Yushchenko, O; Zalewska-Bak, A; Zalewski, P; Zavrtanik, D; Zhuravlov, V; Zimin, N I; Zintchenko, A; Zupan, M

    2007-01-01

    A search for the pair production of fourth generation b'-quarks was performed using data taken by the DELPHI detector at LEP-II. The analysed data were collected at centre-of-mass energies ranging from 196 to 209 GeV, corresponding to an integrated luminosity of 420 pb^{-1}. No evidence for a signal was found. Upper limits on BR(b' -> bZ) and BR(b' -> cW) were obtained for b' masses ranging from 96 to 103 GeV/c^2. These limits, together with the theoretical branching ratios predicted by a sequential four generations model, were used to constrain the value of R_{CKM}=|V_{cb'}/V_{tb'}V_{tb}|, where V_{cb'}, V_{tb'} and V_{tb} are elements of the extended CKM matrix.

  7. Neutron-induced fission cross section of (nat)Pb and (209)Bi from threshold to 1 GeV: An improved parametrization

    Tarrio, D; Audouin, L; Berthier, B; Duran, I; Ferrant, L; Isaev, S; Le Naour, C; Paradela, C; Stephan, C; Trubert, D; Abbondanno, U; Aerts, G; Alvarez-Velarde, F; Andriamonje, S; Andrzejewski, J; Assimakopoulos, P; Badurek, G; Baumann, P; Becvar, F; Belloni, F; Berthoumieux, E; Calvino, F; Calviani, M; Cano-Ott, D; Capote, R; Carrapico, C; Carrillo de Albornoz, A; Cennini, P; Chepel, V; Chiaveri, E; Colonna, N; Cortes, G; Couture, A; Cox, J; Dahlfors, M; David, S; Dillmann, I; Dolfini, R; Domingo-Pardo, C; Dridi, W; Eleftheriadis, C; Embid-Segura, M; Ferrari, A; Ferreira-Marques, R; Fitzpatrick, L; Frais-Koelbl, H; Fujii, K; Furman, W; Goncalves, I; Gonzalez-Romero, E; Goverdovski, A; Gramegna, F; Griesmayer, E; Guerrero, C; Gunsing, F; Haas, B; Haight, R; Heil, M; Herrera-Martinez, A; Igashira, M; Jericha, E; Kadi, Y; Kappeler, F; Karadimos, D; Karamanis, D; Kerveno, M; Ketlerov, V; Koehler, P; Konovalov, V; Kossionides, E; Krticka, M; Lampoudis, C; Leeb, H; Lederer, C; Lindote, A; Lopes, I; Losito, R; Lozano, M; Lukic, S; Marganiec, J; Marques, L; Marrone, S; Martinez, T; Massimi, C; Mastinu, P; Mendoza, E; Mengoni, A; Milazzo, P.M; Moreau, C; Mosconi, M; Neves, F; Oberhummer, H; O'Brien, S; Oshima, M; Pancin, J; Papachristodoulou, C; Papadopoulos, C; Patronis, N; Pavlik, A; Pavlopoulos, P; Perrot, L; Pigni, M.T; Plag, R; Plompen, A; Plukis, A; Poch, A; Praena, J; Pretel, C; Quesada, J; Rauscher, T; Reifarth, R; Rosetti, M; Rubbia, C; Rudolf, G; Rullhusen, P; Salgado, J; Santos, C; Sarchiapone, L; Sarmento, R; Savvidis, I; Tagliente, G; Tain, J.L; Tavora, L; Terlizzi, R; Vannini, G; Vaz, P; Ventura, A; Villamarin, D; Vlachoudis, V; Vlastou, R; Voss, F; Walter, S; Wendler, H; Wiescher, M; Wisshak, K

    2011-01-01

    Neutron-induced fission cross sections for (nat)Pb and (209)Bi were measured with a white-spectrum neutron source at the CERN Neutron Time-of-Flight (n\\_TOF) facility. The experiment, using neutrons from threshold up to 1 GeV, provides the first results for these nuclei above 200 MeV. The cross sections were measured relative to (235)U and (238)U in a dedicated fission chamber with parallel plate avalanche counter detectors. Results are compared with previous experimental data. Upgraded parametrizations of the cross sections are presented, from threshold energy up to 1 GeV. The proposed new sets of fitting parameters improve former results along the whole energy range.

  8. Comparison of reactions for the production of 258,257Db: 208Pb(51V,xn) and 209Bi(50Ti,xn)

    Gates, Jacklyn M.

    2008-01-01

    Excitation functions for the 1n and 2n exit channels of the 208Pb(51V,xn)259-xDb reaction were measured. A maximum cross section of the 1n exit channel of 2070+1100/-760 pb was measured at an excitation energy of 16.0 +- 1.8 MeV. For the 2n exit channel, a maximum cross section of 1660+450/-370 pb was measured at 22.0 +- 1.8 MeV excitation energy. The 1n excitation function for the 209Bi(50Ti,n)258Db reaction was remeasured, resulting in a cross section of 5480+1750/-1370 pb at an excitati...

  9. Placental transfer of the polybrominated diphenyl ethers BDE-47, BDE-99 and BDE-209 in a human placenta perfusion system: an experimental study

    Frederiksen, Marie; Vorkamp, Katrin; Mathiesen, Line;

    2010-01-01

    high concern due to critical windows in fetal development. METHODS: A human ex vivo placenta perfusion system was used to study the kinetics and extent of the placental transfer of BDE-47, BDE-99 and BDE-209 during four-hour perfusions. The PBDEs were added to the maternal circulation and monitored in...... the maternal and fetal compartments. In addition, the perfused cotyledon, the surrounding placental tissue as well as pre-perfusion placental tissue and umbilical cord plasma were also analysed. The PBDE analysis included Soxhlet extraction, clean-up by adsorption chromatography and GC-MS analysis....... RESULTS AND DISCUSSION: Placental transfer of BDE-47 was faster and more extensive than for BDE-99. The fetal-maternal ratios (FM-ratio) after four hours of perfusion were 0.47 and 0.25 for BDE-47 and BDE-99, respectively, while the indicative permeability coefficient (IPC) measured after 60 minutes of...

  10. Energy dependence of the optical potentials for the 9Be +208Pb and 9Be +209Bi systems at near-Coulomb-barrier energies

    Gómez Camacho, A.; Yu, N.; Zhang, H. Q.; Gomes, P. R. S.; Jia, H. M.; Lubian, J.; Lin, C. J.

    2015-04-01

    We analyze the energy dependence of the interacting optical potential, at near barrier energies, for two systems involving the weakly bound projectile 9Be and the heavy 208Pb and 209Bi targets, by the simultaneous fit of elastic scattering angular distributions and fusion excitation functions. The approach used consists of dividing the optical potential into two parts. A short-range potential VF+i WF that is responsible for fusion, and a superficial potential VDR+i WDR for direct reactions. It is found, for both systems studied, that the fusion imaginary potential WF presents the usual threshold anomaly (TA) observed in tightly bound systems, whereas the direct reaction imaginary potential WDR shows a breakup threshold anomaly (BTA) behavior. Both potentials satisfy the dispersion relation. The direct reaction polarization potential predominates over the fusion potential and so a net overall behavior is found to follow the BTA phenomenon.

  11. DC-SIGN (CD209), pentraxin 3 and vitamin D receptor gene variants associate with pulmonary tuberculosis risk in West Africans

    Olesen, R; Wejse, C; Velez, D R; Bisseye, C; Sodemann, M; Aaby, P; Rabna, P; Worwui, A; Chapman, H; Diatta, M; Adegbola, R A; Hill, P C; Østergaard, L; Williams, S M; Sirugo, G

    2007-01-01

    We investigated the role of DC-SIGN (CD209), long pentraxin 3 (PTX3) and vitamin D receptor (VDR) gene single nucleotide polymorphisms (SNPs) in susceptibility to pulmonary tuberculosis (TB) in 321 TB cases and 347 healthy controls from Guinea-Bissau. Five additional, functionally relevant SNPs...... within toll-like receptors (TLRs) 2, 4 and 9 were typed but found, when polymorphic, not to affect host vulnerability to pulmonary TB. We did not replicate an association between SNPs in the DC-SIGN promoter and TB. However, we found that two polymorphisms, one in DC-SIGN and one in VDR, were associated...... in a nonadditive model with disease risk when analyzed in combination with ethnicity (P=0.03 for DC-SIGN and P=0.003 for VDR). In addition, PTX3 haplotype frequencies significantly differed in cases compared to controls and a protective effect was found in association with a specific haplotype (OR 0...

  12. Search for Neutral Higgs Bosons of the Minimal Supersymmetric Standard Model in $e^{+}e^{-}$ Interactions at $\\sqrt{s}$ up to 209 GeV

    Achard, P; Aguilar-Benítez, M; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alviggi, M G; Anderhub, H; Andreev, V P; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Bajo, A; Baksay, G; Baksay, L; Baldew, S V; Banerjee, S; Banerjee, Sw; Barczyk, A; Barillère, R; Bartalini, P; Basile, M; Batalova, N; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Bellucci, L; Berbeco, R; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Biasini, M; Biglietti, M; Biland, A; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böhm, A; Boldizsar, L; Borgia, B; Bottai, S; Bourilkov, D; Bourquin, Maurice; Braccini, S; Branson, J G; Brochu, F; Burger, J D; Burger, W J; Cai, X D; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A M; Casaus, J; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada, M; Chamizo-Llatas, M; Chang, Y H; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chiefari, G; Cifarelli, Luisa; Cindolo, F; Clare, I; Clare, R; Coignet, G; Colino, N; Costantini, S; de la Cruz, B; Cucciarelli, S; van Dalen, J A; De Asmundis, R; Déglon, P L; Debreczeni, J; Degré, A; Dehmelt, K; Deiters, K; Della Volpe, D; Delmeire, E; Denes, P; De Notaristefani, F; De Salvo, A; Diemoz, M; Dierckxsens, M; Dionisi, C; Dittmar, Michael; Doria, A; Dova, M T; Duchesneau, D; Echenard, B; Eline, A; El-Mamouni, H; Engler, A; Eppling, F J; Ewers, A; Extermann, Pierre; Falagán, M A; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, Marta; Ferguson, T; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Fisher, W; Fisk, I; Forconi, G; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gataullin, M; Gentile, S; Giagu, S; Gong, Z F; Grenier, G; Grimm, O; Grünewald, M W; Guida, M; van Gulik, R; Gupta, V K; Gurtu, A; Gutay, L J; Haas, D; Hakobyan, R S; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Hirschfelder, J; Hofer, H; Hohlmann, M; Holzner, G; Hou, S R; Hu, Y; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Käfer, D; Kaur, M; Kienzle-Focacci, M N; Kim, J K; Kirkby, Jasper; Kittel, E W; Klimentov, A; König, A C; Kopal, M; Koutsenko, V F; Kräber, M H; Krämer, R W; Krenz, W; Krüger, A; Kunin, A; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Le Goff, J M; Leiste, R; Levtchenko, M; Levchenko, P M; Li, C; Likhoded, S A; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lü, Y S; Lübelsmeyer, K; Luci, C; Luminari, L; Lustermann, W; Ma Wen Gan; Malgeri, L; Malinin, A; Maña, C; Mangeol, D J J; Mans, J; Martin, J P; Marzano, F; Mazumdar, K; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Mihul, A; Milcent, H; Mirabelli, G; Mnich, J; Mohanty, G B; Muanza, G S; Muijs, A J M; Musicar, B; Musy, M; Nagy, S; Natale, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Niessen, T; Nisati, A; Nowak, H; Ofierzynski, R A; Organtini, G; Palomares, C; Pandoulas, D; Paolucci, P; Paramatti, R; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Pedace, M; Pensotti, S; Perret-Gallix, D; Petersen, B; Piccolo, D; Pierella, F; Pioppi, M; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Pothier, J; Prokofiev, D O; Prokofev, D; Quartieri, J; Rahal-Callot, G; Rahaman, M A; Raics, P; Raja, N; Ramelli, R; Rancoita, P G; Ranieri, R; Raspereza, A V; Razis, P A; Ren, D; Rescigno, M; Reucroft, S; Riemann, S; Riles, K; Roe, B P; Romero, L; Rosca, A; Rosier-Lees, S; Roth, S; Rosenbleck, C; Roux, B; Rubio, Juan Antonio; Ruggiero, G; Rykaczewski, H; Sakharov, A; Saremi, S; Sarkar, S; Salicio, J; Sánchez, E; Sanders, M P; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Schopper, Herwig Franz; Schotanus, D J; Schwering, G; Sciacca, C; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shumilov, E; Shvorob, A V; Siedenburg, T; Son, D; Souga, C; Spillantini, P; Steuer, M; Stickland, D P; Stoyanov, B; Strässner, A; Sudhakar, K; Sultanov, G G; Sun, L Z; Sushkov, S V; Suter, H; Swain, J D; Szillási, Z; Tang, X W; Tarjan, P; Tauscher, Ludwig; Taylor, L; Tellili, B; Teyssier, D; Timmermans, C; Ting, Samuel C C; Ting, S M; Tonwar, S C; Tóth, J; Tully, C; Tung, K L; Ulbricht, J; Valente, E; Van de Walle, R T; Vásquez, R P; Veszpremi, V; Vesztergombi, G; Vetlitskii, I; Vicinanza, D; Viertel, Gert M; Villa, S; Vivargent, M; Vlachos, S; Vodopyanov, I; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Wadhwa, M; Wallraff, W; Wang, X L; Wang, Z M; Weber, M; Wienemann, P; Wilkens, H; Wynhoff, S; Xia, L; Xu, Z Z; Yamamoto, J; Yang, B Z; Yang, C G; Yang, H J; Yang, M; Yeh, S C; Zalite, A; Zalite, Yu; Zhang, Z P; Zhao, J; Zhu, G Y; Zhu, R Y; Zhuang, H L; Zichichi, A; Zimmermann, B; Zöller, M

    2002-01-01

    A search for the lightest neutral CP-even and neutral CP-odd Higgs bosons of the Minimal Supersymmetric Standard Model is performed using 216.6 pb-1 of data collected with the L3 detector at LEP at centre-of-mass energies between 203 and 209 GeV. No indication of a signal is found. Including our results from lower centre-of-mass energies, lower limits on the Higgs boson masses are set as a function of tan(beta) for several scenarios. For tan(beta) greater than 0.7 they are mh > 84.5 GeV and mA > 86.3 GeV at 95% confidence level.

  13. Determination of the neutron resonance parameters for 206Pb and of the thermal neutron capture cross section for 206Pb and 209Bi

    Chapter 1 describes the motivation of the measurements (accelerator driven systems, stellar nucleosynthesis, neutron induced reactions on 206Pb), the present status of the neutron capture data for 206Pb and 209Bi and the structure of this work. In Chapter 2 the basic reaction theory underlying this work is described. The neutron induced reaction mechanism and formalism are explained. The parameterisation of the cross section in terms of R-matrix theory is discussed and we put particular emphasis on the statistical behaviour of the resonance parameters and the impact of the angular distribution of gamma rays following neutron capture. The relation between experimental observables and the resonance parameters is discussed together with general comments related to resonance shape analysis. Chapter 3 is focused on the determination of resonance parameters for 206Pb. We performed high-resolution transmission and capture measurements at the Time-Of-Flight (TOF) facility GELINA of the IRMM at Geel (B) and determined the resonance parameters. For nuclei like 206Pb, where the total width is dominated by Γn, the capture area allows to determine G. Transmission measurements were carried out to determine Γn, and the statistical factor g of resonances. Before performing a Resonance Shape Analysis (RSA) on the transmission and capture data, we verified the neutron flux and resolution at GELINA. We also compared the characteristics of GELINA with those of the n-TOF facility at CERN. A special emphasis is placed on the total energy detection technique using C6D6 detectors. This technique was applied for the determination of the capture cross section. To reduce systematic bias effects on the capture cross section, the response of the detectors was determined by Monte Carlo simulations, which has been validated by experiments. Using these response functions the partial capture cross sections for individual resonances of 206Pb have been deduced, by unfolding the response of the C6D

  14. Di-Jet Production in Photon-Photon colisions at $\\sqrt{s_{ee}}$ from 189 to 209 GeV

    Abbiendi, G; Åkesson, P F; Alexander, Gideon; Allison, J; Amaral, P; Anagnostou, G; Anderson, K J; Arcelli, S; Asai, S; Axen, D A; Azuelos, Georges; Bailey, I; Barberio, E; Barlow, R J; Batley, J Richard; Bechtle, P; Behnke, T; Bell, K W; Bell, P J; Bella, G; Bellerive, A; Benelli, G; Bethke, Siegfried; Biebel, O; Bloodworth, Ian J; Boeriu, O; Bock, P; Bonacorsi, D; Boutemeur, M; Braibant, S; Brigliadori, L; Brown, R M; Büsser, K; Burckhart, H J; Campana, S; Carnegie, R K; Caron, B; Carter, A A; Carter, J R; Chang, C Y; Charlton, D G; Csilling, Akos; Cuffiani, M; Dado, S; Dallison, S; de Roeck, A; De Wolf, E A; Desch, Klaus; Dienes, B; Donkers, M; Dubbert, J; Duchovni, E; Duckeck, G; Duerdoth, I P; Elfgren, E; Etzion, E; Fabbri, Franco Luigi; Feld, L; Ferrari, P; Fiedler, F; Fleck, I; Ford, M; Frey, A; Fürtjes, A; Gagnon, P; Gary, J W; Gaycken, G; Geich-Gimbel, C; Giacomelli, G; Giacomelli, P; Giunta, M; Goldberg, J; Gross, E; Grunhaus, Jacob; Gruwé, M; Günther, P O; Sen-Gupta, A; Hajdu, C; Hamann, M; Hanson, G G; Harder, K; Harel, A; Harin-Dirac, M; Hauschild, M; Hauschildt, J; Hawkes, C M; Hawkings, R; Hemingway, Richard J; Hensel, C; Herten, G; Heuer, R D; Hill, J C; Hoffman, K; Homer, R James; Horváth, D; Howard, R; Igo-Kemenes, P; Ishii, K; Jeremie, H; Jovanovic, P; Junk, T R; Kanaya, N; Kanzaki, J; Karapetian, G V; Karlen, D A; Kartvelishvili, V G; Kawagoe, K; Kawamoto, T; Keeler, Richard K; Kellogg, R G; Kennedy, B W; Kim, D H; Klein, K; Klier, A; Kluth, S; Kobayashi, T; Kobel, M; Komamiya, S; Kormos, L L; Krämer, T; Kress, T; Krieger, P; Von Krogh, J; Krop, D; Krüger, K; Kühl, T; Kupper, M; Lafferty, G D; Landsman, Hagar Yaël; Lanske, D; Layter, J G; Leins, A; Lellouch, D; Letts, J; Levinson, L; Lillich, J; Lloyd, S L; Loebinger, F K; Lü, J; Ludwig, J; MacPherson, A; Mader, W; Marcellini, S; Marchant, T E; Martin, A J; Martin, J P; Masetti, G; Mashimo, T; Mättig, P; McDonald, W J; McKenna, J A; McMahon, T J; McPherson, R A; Meijers, F; Méndez-Lorenzo, P; Menges, W; Merritt, F S; Mes, H; Michelini, Aldo; Mihara, S; Mikenberg, G; Miller, D J; Moed, S; Mohr, W; Mori, T; Mutter, A; Nagai, K; Nakamura, I; Neal, H A; Nisius, R; O'Neale, S W; Oh, A; Okpara, A N; Oreglia, M J; Orito, S; Pahl, C; Pásztor, G; Pater, J R; Patrick, G N; Pilcher, J E; Pinfold, James L; Plane, D E; Poli, B; Polok, J; Pooth, O; Przybycien, M B; Quadt, A; Rabbertz, K; Rembser, C; Renkel, P; Rick, Hartmut; Roney, J M; Rosati, S; Rozen, Y; Runge, K; Sachs, K; Saeki, T; Sahr, O; Sarkisyan-Grinbaum, E; Schaile, A D; Schaile, O; Scharff-Hansen, P; Schieck, J; Schörner-Sadenius, T; Schröder, M; Schumacher, M; Schwick, C; Scott, W G; Seuster, R; Shears, T G; Shen, B C; Sherwood, P; Siroli, G P; Skuja, A; Smith, A M; Sobie, R J; Söldner-Rembold, S; Spanó, F; Stahl, A; Stephens, K; Strom, D; Ströhmer, R; Tarem, S; Tasevsky, M; Taylor, R J; Teuscher, R; Thomson, M A; Torrence, E; Toya, D; Tran, P; Trefzger, T M; Tricoli, A; Trigger, I; Trócsányi, Z L; Tsur, E; Turner-Watson, M F; Ueda, I; Ujvári, B; Vachon, B; Vollmer, C F; Vannerem, P; Verzocchi, M; Voss, H; Vossebeld, Joost Herman; Waller, D; Ward, C P; Ward, D R; Watkins, P M; Watson, A T; Watson, N K; Wells, P S; Wengler, T; Wermes, N; Wetterling, D; Wilson, G W; Wilson, J A; Wolf, G; Wyatt, T R; Yamashita, S; Zer-Zion, D; Zivkovic, L

    2003-01-01

    Di-jet producion is studied in collisions of quasi-real photons at e+e- centre- of-mass energies sqrt(s)ee from 189 to 209 GeV at LEP. The data were collected with the OPAL detector. Jets are reconstructed using an inclusive k_t clustering algorithm for all cross-section measurements presented. A cone jet algorithm is used in addition to study the different structure of the jets resulting from either of the algorithms. The inclusive di-jet cross-section is measured as a function of the mean transverse energy Etm(jet) of the two leading jets, and as a functiuon of the estimated fraction of the photon momentum carried by the parton entering the hard sub-process, xg, for different regions of Etm (jet). Angular distribution in di-jet events are measured and used to demonstrate the dominance of quark and gluon initiated processes in different regions of phase space. Furthermore the inclusive di-jet cross-section as a function of |eta(jet)| and |delta eta (jet)| is presented where eta(jet) is the jet pseudo-rapidit...

  15. Finite-element modelling of geomechanical and hydraulic responses to the room 209 heading extension excavation response experiment 2: post-excavation analysis of experimental results

    An in situ excavation response test was conducted at the 240 Level of the Underground Research Laboratory (URL) in conjunction with the excavation of a tunnel (Room 209) through a narrow, near-vertical, water-bearing fracture oriented almost perpendicular to the tunnel axis. This report presents a post-excavation analysis of the predicted mechanical response of the granitic rock mass to the tunnel excavation and the near-field hydraulic response of the fracture zone, compares the numerical modelling predictions with the actual measured response, provides information on the rock mass and fracture from back-analysis of the responses, and makes recommendations for future experiments. Results indicate that displacements and stress changes were reasonably well predicted. Pressure drops at hydrology boreholes and inflow to the tunnel were overpredicted, and fracture permeability changes were underpredicted. The permeability change is considered too large to be solely stress-induced. The back-calculated deformation modulus indicated nonlinear softening of the rock within 3.5 m of the tunnel wall. This is likely due to both excavation damage and the confining stress dependence of the modulus. For future excavation experiments it is recommended that mechanical excavation should replace the drill-and-blast technique; excavation damage should be incorporated into mechanical models; an improved hydraulic fracture model should be developed; and a coupled geomechanical-hydraulic analysis of fracture flow should be developed. (author). 16 refs., 15 tabs., 156 figs

  16. Effect of gamma radiation on electrical and optical properties of (TeO2)0.9 (In2O3)0.1 thin films

    S L Sharma; T K Maity

    2011-02-01

    We have studied in detail the gamma radiation induced changes in the electrical properties of the (TeO2)0.9 (In2O3)0.1 thin films of different thicknesses, prepared by thermal evaporation in vacuum. The current–voltage characteristics for the as-deposited and exposed thin films were analysed to obtain current versus dose plots at different applied voltages. These plots clearly show that the current increases quite linearly with the radiation dose over a wide range and that the range of doses is higher for the thicker films. Beyond certain dose (a quantity dependent on the film thickness), however, the current has been observed to decrease. In order to understand the dose dependence of the current, we analysed the optical absorption spectra for the as-deposited and exposed thin films to obtain the dose dependences of the optical bandgap and energy width of band tails of the localized states. The increase of the current with the gamma radiation dose may be attributed partly to the healing effect and partly to the lowering of the optical bandgap. Attempts are on to understand the decrease in the current at higher doses. Employing dose dependence of the current, some real-time gamma radiation dosimeters have been prepared, which have been found to possess sensitivity in the range 5–55 Gy/A/cm2. These values are far superior to any presently available real-time gamma radiation dosimeter.

  17. Search for invisibly decaying Higgs bosons in $e^{+}e^{-} \\rightarrow Z^{0}h^{0}$ production at $\\sqrt{s} = 183 - 209 GeV$

    Abbiendi, G; Åkesson, P F; Alexander, G; Anagnostou, G; Anderson, K J; Asai, S; Axen, D; Bailey, I; Barberio, E; Barillari, T; Barlow, R J; Batley, R J; Bechtle, P; Behnke, T; Bell, K W; Bell, P J; Bella, G; Bellerive, A; Benelli, G; Bethke, S; Biebel, O; Boeriu, O; Bock, P; Boutemeur, M; Braibant, S; Brown, R M; Burckhart, H J; Campana, S; Capiluppi, P; Carnegie, R K; Carter, A A; Carter, J R; Chang, C Y; Charlton, D G; Ciocca, C; Csilling, A; Cuffiani, M; Dado, S; Dallavalle, G M; de Roeck, A; De Wolf, E A; Desch, K; Dienes, B; Dubbert, J; Duchovni, E; Duckeck, G; Duerdoth, I P; Etzion, E; Fabbri, F; Ferrari, P; Fiedler, F; Fleck, I; Ford, M; Frey, A; Gagnon, P; Gary, J W; Geich-Gimbel, C; Giacomelli, G; Giacomelli, P; Giunta, M; Goldberg, J; Gross, E; Grunhaus, J; Gruwé, M; Sen-Gupta, A; Hajdu, C; Hamann, M; Hanson, G G; Harel, A; Hauschild, M; Hawkes, C M; Hawkings, R; Herten, G; Heuer, R D; Hill, J C; Horváth, D; Igo-Kemenes, P; Ishii, K; Jeremie, H; Jovanovic, P; Junk, T R; Kanzaki, J; Karlen, D; Kawagoe, K; Kawamoto, T; Keeler, R K; Kellogg, R G; Kennedy, B W; Kluth, S; Kobayashi, T; Kobel, M; Komamiya, S; Kramer, T; Krasznahorkay, A; Krieger, P; Von Krogh, J; Kühl, T; Kupper, M; Lafferty, G D; Landsman, H; Lanske, D; Lellouch, D; Letts, J; Levinson, L; Lillich, J; Lloyd, S L; Loebinger, F K; Lü, J; Ludwig, A; Ludwig, J; Mader, W; Marcellini, S; Martin, A J; Mashimo, T; Mättig, P; McKenna, J; McPherson, R A; Meijers, F; Menges, W; Merritt, F S; Mes, H; Meyer, N; Michelini, A; Mihara, S; Mikenberg, G; Miller, D J; Mohr, W; Mori, T; Mutter, A; Nagai, K; Nakamura, I; Nanjo, H; Neal, H A; Nisius, R; O'Neale, S W; Oh, A; Oreglia, M J; Orito, S; Pahl, C; Pásztor, G; Pater, J R; Pilcher, J E; Pinfold, J L; Plane, D E; Pooth, O; Przybycien, M; Quadt, A; Rabbertz, K; Rembser, C; Renkel, P; Roney, J M; Rossi, A M; Rozen, Y; Runge, K; Sachs, K; Saeki, T; Sarkisyan-Grinbaum, E; Schaile, A D; Schaile, O; Scharff-Hansen, P; Schiecks, J; Schörner-Sadenius, T; Schröder, M; Schumacher, M; Seuster, R; Shears, T G; Shen, B C; Sherwood, P; Skuja, A; Smith, A M; Sobie, R J; Söldner-Rembold, S; Spanó, F; Stahl, A; Strom, D; Ströhmer, R; Tarem, S; Tasevsky, M; Teuscher, R; Thomson, M A; Torrence, E; Toya, D; Tran, P; Trigger, I; Trócsányi, Z L; Tsur, E; Turner-Watson, M F; Ueda, I; Ujvári, B; Vollmer, C F; Vannerem, P; Vertesi, R; Verzocchi, M; Voss, H; Vossebeld, J; Ward, C P; Ward, D R; Watkins, P M; Watson, A T; Watson, N K; Wells, P S; Wengler, T; Wermes, N; Wilson, G W; Wilson, J A; Wolf, G; Wyatt, T R; Yamashita, S; Zer-Zion, D; Zivkovic, L

    2010-01-01

    A search is performed for Higgs bosons decaying into invisible final states, produced in association with a Zo boson in e+e- collisions at energies between 183 and 209 GeV. The search is based on data samples collected by the OPAL detector at LEP corresponding to an integrated luminosity of about 660 pb-1. The analysis aims to select events containing the hadronic decay products of the Zo boson and large missing momentum, as expected from Higgs boson decay into a pair of stable weakly interacting neutral particles, such as the lightest neutralino in the Minimal Supersymmetric Standard Model. The same analysis is applied to a search for nearly invisible Higgs boson cascade decays into stable weakly interacting neutral particles. No excess over the expected background from Standard Model processes is observed. Limits on the production of invisibly decaying Higgs bosons produced in association with a Zo boson are derived. Assuming a branching ratio BR(ho->invisible)=1, a lower limit of 108.2 GeV is placed on the...

  18. Search for Stable and Long-Lived Massive Charged Particles in $e^{+}e^{-}$ Collisions at $\\sqrt{s}$ = 130-209 GeV

    Abbiendi, G; Alexander, G; Allison, J; Amaral, P; Anagnostou, G; Anderson, K J; Arcelli, S; Asai, S; Axen, D A; Azuelos, Georges; Bailey, I; Barberio, E; Barlow, R J; Batley, J Richard; Bechtle, P; Behnke, T; Bell, K W; Bell, P J; Bella, G; Bellerive, A; Benelli, G; Bethke, Siegfried; Biebel, O; Bock, P; Boeriu, O; Boutemeur, M; Braibant, S; Brigliadori, L; Brown, R M; Burckhart, H J; Büsser, K; Campana, S; Carnegie, R K; Caron, B; Carter, A A; Carter, J R; Chang, C Y; Charlton, D G; Csilling, Akos; Cuffiani, M; Dado, S; De Wolf, E A; Desch, Klaus; Dienes, B; Donkers, M; Dubbert, J; Duchovni, E; Duckeck, G; Duerdoth, I P; Etzion, E; Fabbri, Franco Luigi; Feld, L; Ferrari, P; Fiedler, F; Fleck, I; Ford, M; Fürtjes, A; Frey, A; Gagnon, P; Gary, J W; Gaycken, G; Geich-Gimbel, C; Giacomelli, G; Giacomelli, P; Giunta, M; Goldberg, J; Gross, E; Grunhaus, Jacob; Gruwé, M; Günther, P O; Hajdu, C; Hamann, M; Hanson, G G; Harder, K; Harel, A; Harin-Dirac, M; Hauschild, M; Hawkes, C M; Hawkings, R; Hemingway, Richard J; Hensel, C; Herten, G; Heuer, R D; Hill, J C; Hoffman, K; Horváth, D; Igo-Kemenes, P; Ishii, K; Jeremie, H; Jovanovic, P; Junk, T R; Kanaya, N; Kanzaki, J; Karapetian, G V; Karlen, Dean A; Kawagoe, K; Kawamoto, T; Keeler, Richard K; Kellogg, R G; Kennedy, B W; Kim, D H; Klein, K; Klier, A; Kluth, S; Kobayashi, T; Kobel, M; Komamiya, S; Kormos, L L; Krämer, T; Krieger, P; Krüger, K; Kupper, M; Kühl, T; Lafferty, G D; Landsman, Hagar Yaël; Lanske, D; Layter, J G; Leins, A; Lellouch, D; Letts, J; Levinson, L; Lillich, J; Lloyd, S L; Loebinger, F K; Lü, J; Ludwig, J; MacPherson, A; Mader, W; Marcellini, S; Martin, A J; Masetti, G; Mashimo, T; McDonald, W J; McKenna, J A; McMahon, T J; McPherson, R A; Meijers, F; Menges, W; Merritt, F S; Mes, H; Michelini, Aldo; Mihara, S; Mikenberg, G; Miller, D J; Moed, S; Mohr, W; Mori, T; Mutter, A; Mättig, P; Nagai, K; Nakamura, I; Nanjo, H; Neal, H A; Nisius, R; O'Neale, S W; Oh, A; Okpara, A N; Oreglia, M J; Orito, S; Pahl, C; Pater, J R; Patrick, G N; Pilcher, J E; Pinfold, James L; Plane, D E; Poli, B; Polok, J; Pooth, O; Przybycien, M B; Pásztor, G; Quadt, A; Rabbertz, K; Rembser, C; Renkel, P; Roney, J M; Rosati, S; Rozen, Y; Runge, K; Sachs, K; Saeki, T; Sarkisyan-Grinbaum, E; Schaile, A D; Schaile, O; Scharff-Hansen, P; Schieck, J; Schumacher, M; Schwick, C; Schöder, M; Schörner-Sadenius, T; Scott, W G; Sen-Gupta, A; Seuster, R; Shears, T G; Shen, B C; Sherwood, P; Siroli, G P; Skuja, A; Smith, A M; Sobie, Randall J; Span, F; Stahl, A; Stephens, K; Strom, D; Ströhmer, R; Söldner-Rembold, S; Tarem, S; Tasevsky, M; Taylor, R J; Teuscher, R; Thomson, M A; Torrence, E; Toya, D; Trócsányi, Z L; Tran, P; Trigger, I; Tsur, E; Turner-Watson, M F; Ueda, I; Ujvári, B; Vannerem, P; Vertesi, R; Verzocchi, M; Vollmer, C F; Von Krogh, J; Voss, H; Vossebeld, Joost Herman; Waller, D; Ward, C P; Ward, D R; Watkins, P M; Watson, A T; Watson, N K; Wells, P S; Wengler, T; Wermes, N; Wetterling, D; Wilson, G W; Wilson, J A; Wolf, G; Wyatt, T R; Yamashita, S; Zer-Zion, D; Zivkovic, L; de Roeck, A; Åkesson, P F

    2003-01-01

    A search for stable and long-lived massive particles of electric charge |Q/e|=1 or fractional charges of 2/3, 4/3, and 5/3 is reported using data collected by the OPAL detector at LEP, at centre-of-mass energies from 130 to 209 GeV. These particles are assumed to be pair-produced in e+e- collisions and not to interact strongly. No evidence for the production of these particles was observed. Model-independent upper limits on the production cross-section between 0.005 and 0.028 pb have been derived for scalar and spin-1/2 particles with charge +-1. Within the framework of the Constrained Minimal Supersymmetric Standard Model (CMSSM), this implies a lower limit of 98.0 (98.5) GeV on the mass of long-lived right (left)- handed scalar muons and scalar taus. Long-lived charged heavy leptons and charginos are excluded for masses below 102.0 GeV. For particles with fractional charge +-2/3, +-4/3, and +-5/3, the upper limit on the production cross-section varies between 0.005 and 0.020 pb. All mass and cross-section l...

  19. Excitation functions of residual nuclei production from 40–2600 MeV proton-irradiated 206,207,208,natPb and 209Bi

    Yu E Titarenko; V F Batyaev; V M Zhivun; V O Kudryashov; K A Lipatov; A V Ignatyuk; S G Mashnik

    2007-02-01

    The work is aimed at experimental determination of the independent and cumulative yields of radioactive residual nuclei produced in intermediate-energy proton-irradiated thin targets made of highly isotopic enriched and natural lead (206,207,208,natPb) and 209Bi. 5972 radioactive product nuclide yields have been measured in 55 thin targets induced by 0.04, 0.07, 0.10, 0.15, 0.25, 0.6, 0.8, 1.2, 1.4, 1.6 and 2.6 GeV protons extracted from the ITEP U-10 proton synchrotron. The measured data have been compared with data obtained at other laboratories as well as with theoretical simulations by seven codes. We found that the predictive power of the tested codes is different but is satisfactory for most of the nuclides in the spallation region, though none of the codes agree well with the data in the whole mass region of product nuclides and all should be improved further.

  20. Measurement of the Mass and Width of the W Boson in $e^{+}e^{-}$ Collisions at $\\sqrt{s}$ = 161 - 209 GeV

    Abdallah, J; Adam, W; Adzic, P; Albrecht, T; Alemany-Fernandez, R; Allmendinger, T; Allport, P P; Amaldi, Ugo; Amapane, N; Amato, S; Anashkin, E; Andreazza, A; Andringa, S; Anjos, N; Antilogus, P; Apel, W D; Arnoud, Y; Ask, S; Åsman, B; Augustin, J E; Augustinus, A; Baillon, P; Ballestrero, A; Bambade, P; Barbier, R; Bardin, D; Barker, G J; Baroncelli, A; Battaglia, M; Baubillier, M; Becks, K H; Begalli, M; Behrmann, A; Ben-Haim, E; Benekos, N; Benvenuti, A; Bérat, C; Berggren, M; Bertrand, D; Besançon, M; Besson, N; Bloch, D; Blom, M; Bluj, M; Bonesini, M; Boonekamp, M; Booth, P S L; Borisov, G; Botner, O; Bouquet, B; Bowcock, T J V; Boyko, I; Bracko, M; Brenner, R; Brodet, E; Brückman, P; Brunet, J M; Buschbeck, B; Buschmann, P; Calvi, M; Camporesi, T; Canale, V; Carena, F; Castro, N; Cavallo, F; Chapkin, M; Charpentier, P; Checchia, P; Chierici, R; Chliapnikov, P V; Chudoba, J; Chung, S U; Cieslik, K; Collins, P; Contri, R; Cosme, G; Cossutti, F; Costa, M J; Crennell, D J; Cuevas-Maestro, J; D'Hondt, J; Da Silva, T; Da Silva, W; Della Ricca, G; De Angelis, A; de Boer, Wim; De Clercq, C; De Lotto, B; De Maria, N; De Min, A; De Paula, L; Di Ciaccio, L; Di Simone, A; Doroba, K; Drees, J; Duperrin, A; Eigen, G; Ekelöf, T J C; Ellert, M; Elsing, M; Espirito-Santo, M C; Fanourakis, G K; Fassouliotis, D; Feindt, M; Fernández, J; Ferrer, A; Ferro, F; Flagmeyer, U; Föth, H; Fokitis, E; Fulda-Quenzer, F; Fuster, J; Gandelman, M; García, C; Gavillet, P; Gazis, E; Gokieli, R; Golob, B; Gómez-Ceballos, G; Gonçalves, P; Graziani, E; Grosdidier, G; Grzelak, K; Guy, J; Haag, C; Hallgren, A; Hamacher, K; Hamilton, K; Haug, S; Hauler, F; Hedberg, V; Hennecke, M; Hoffman, J; Holmgren, S O; Holt, P J; Houlden, M A; Jackson, J N; Jarlskog, G; Jarry, P; Jeans, D; Johansson, E K; Jonsson, P; Joram, C; Jungermann, L; Kapusta, F; Katsanevas, S; Kokkinias, P; Leinonen, L; Katsoufis, E; Kernel, G; Kersevan, B P; Krumshtein, Z; Lesiak, T; Kerzel, U; Liebig, W; King, B T; Lamsa, J; Liko, D; Kjaer, N J; Leder, G; Kluit, P; Kourkoumelis, C; Leitner, R; Kuznetsov, O; Kucharczyk, M; Ledroit, F; Lopes, J H; Lemonne, J; Lepeltier, V; Lipniacka, A; López, J M; Loukas, D; Lutz, P; Lyons, L; MacNaughton, J; Malek, A; Maltezos, S; Mandl, F; Marco, J; Marco, R; Maréchal, B; Margoni, M; Marin, J C; Mariotti, C; Markou, A; Martínez-Rivero, C; Masik, J; Mastroyiannopoulos, N; Matorras, F; Matteuzzi, C; Mazzucato, F; Mazzucato, M; McNulty, R; Meroni, C; Migliore, E; Mitaroff, W A; Mjörnmark, U; Moa, T; Moch, M; Mönig, K; Monge, R; Montenegro, J; Moraes, D; Moreno, S; Morettini, P; Müller, U; Münich, K; Mulders, M; Mundim, L; Murray, W; Muryn, B; Myatt, G; Myklebust, T; Paganoni, M; Nassiakou, M; Paiano, S; Navarria, F; Nawrocki, K; Nicolaidou, R; Nikolenko, M; Ouraou, A; Parkes, C; Oblakowska-Mucha, A; Oyanguren, A; Obraztsov, V F; Olshevski, A; Palacios, J P; Onofre, A; Palka, H; Orava, R; Österberg, K; Pape, L; Papadopoulou, T D; Parodi, F; Parzefall, U; Passeri, A; Passon, O; Peralta, L; Perepelitsa, V; Perrotta, A; Petrolini, A; Piedra, J; Pieri, L; Pierre, F; Pimenta, M; Piotto, E; Podobnik, T; Poireau, V; Pol, M E; Polok, G; Pozdnyakov, V; Pukhaeva, N; Pullia, A; Radojicic, D; Rames, J; Read, A; Rebecchi, P; Rehn, J; Reid, D; Reinhardt, R; Renton, P B; Richard, F; Rídky, J; Rivero, M; Rodríguez, D; Romero, A; Ronchese, P; Roudeau, P; Rovelli, T; Ruhlmann-Kleider, V; Ryabtchikov, D; Sadovskii, A; Salmi, L; Salt, J; Sander, C; Savoy-Navarro, A; Schwickerath, U; Sopczak, A; Szeptycka, M; Sekulin, R; Siebel, M; Spassoff, Tz; Tabarelli de Fatis, T; Simard, L; Stanitzki, M; Tegenfeldt, F; Sisakian, A; Stocchi, A; Thomas, J; Smadja, G; Strauss, J; Smirnova, O; Stugu, B; Sokolov, A; Sosnowski, R; Szumlak, T; Szczekowski, M; Tkatchev, L; Tobin, M; Timmermans, J; Todorovova, S; Tomé, B; Tonazzo, A; Tortosa, P; Travnicek, P; Treille, D; Tristram, G; Trochimczuk, M; Troncon, C; Turluer, M L; Tyapkin, I A; Tyapkin, P; Tzamarias, S; Uvarov, V; Valenti, G; van Dam, P; Van Eldik, J; Vilanova, D; Winter, M; Van Remortel, N; Vitale, L; Witek, M; Vrba, V; Van Vulpen, I; Wahlen, H; Vegni, G; Veloso, F; Weiser, C; Venus, W; Wicke, D; Verdier, P; Verzi, V; Washbrook, A J; Wickens, J; Wilkinson, G; Zimin, N I; Yushchenko, O; Zalewska-Bak, A; Zalewski, P; Zavrtanik, D; Zhuravlov, V; Zintchenko, A; Zupan, M

    2008-01-01

    A measurement of the W boson mass and width has been performed by the DELPHI collaboration using the data collected during the full LEP2 programme (1996-2000). The data sample has an integrated luminosity of 660 pb^-1 and was collected over a range of centre-of-mass energies from 161 to 209 GeV. Results are obtained by applying the method of direct reconstruction of the mass of the W from its decay products in both the W+W- -> lvqq and W+W- -> qqqq channels. The W mass result for the combined data set is M_W = 80.336 +/- 0.055 (Stat.) +/- 0.028 (Syst.) +/- 0.025 (FSI) +/- 0.009 (LEP) GeV/c^2, where FSI represents the uncertainty due to final state interaction effects in the qqqq channel, and LEP represents that arising from the knowledge of the collision energy of the accelerator. The combined value for the W width is Gamma_W = 2.404 +/- 0.140 (Stat.) +/- 0.077 (Syst.) +/- 0.065 (FSI) GeV/c^2. These results supersede all values previously published by the DELPHI collaboration. This paper is dedicated to the m...

  1. Measurement of the mass and width of the W boson in e+e- collisions at sqrt{s} = 161-209 GeV

    Abdallah, J.; Abreu, P.; Adam, W.; Adzic, P.; Albrecht, T.; Alemany-Fernandez, R.; Allmendinger, T.; Allport, P. P.; Amaldi, U.; Amapane, N.; Amato, S.; Anashkin, E.; Andreazza, A.; Andringa, S.; Anjos, N.; Antilogus, P.; Apel, W.-D.; Arnoud, Y.; Ask, S.; Asman, B.; Augustin, J. E.; Augustinus, A.; Baillon, P.; Ballestrero, A.; Bambade, P.; Barbier, R.; Bardin, D.; Barker, G. J.; Baroncelli, A.; Battaglia, M.; Baubillier, M.; Becks, K.-H.; Begalli, M.; Behrmann, A.; Ben-Haim, E.; Benekos, N.; Benvenuti, A.; Berat, C.; Berggren, M.; Bertrand, D.; Besancon, M.; Besson, N.; Bloch, D.; Blom, M.; Bluj, M.; Bonesini, M.; Boonekamp, M.; Booth, P. S. L.; Borisov, G.; Botner, O.; Bouquet, B.; Bowcock, T. J. V.; Boyko, I.; Bracko, M.; Brenner, R.; Brodet, E.; Bruckman, P.; Brunet, J. M.; Buschbeck, B.; Buschmann, P.; Calvi, M.; Camporesi, T.; Canale, V.; Carena, F.; Castro, N.; Cavallo, F.; Chapkin, M.; Charpentier, Ph.; Checchia, P.; Chierici, R.; Chliapnikov, P.; Chudoba, J.; Chung, S. U.; Cieslik, K.; Collins, P.; Contri, R.; Cosme, G.; Cossutti, F.; Costa, M. J.; Crennell, D.; Cuevas, J.; D'Hondt, J.; da Silva, T.; da Silva, W.; Della Ricca, G.; de Angelis, A.; de Boer, W.; de Clercq, C.; de Lotto, B.; de Maria, N.; de Min, A.; de Paula, L.; di Ciaccio, L.; di Simone, A.; Doroba, K.; Drees, J.; Duperrin, A.; Eigen, G.; Ekelof, T.; Ellert, M.; Elsing, M.; Espirito Santo, M. C.; Fanourakis, G.; Fassouliotis, D.; Feindt, M.; Fernandez, J.; Ferrer, A.; Ferro, F.; Flagmeyer, U.; Foeth, H.; Fokitis, E.; Fulda-Quenzer, F.; Fuster, J.; Gandelman, M.; Garcia, C.; Gavillet, Ph.; Gazis, E.; Gokieli, R.; Golob, B.; Gomez-Ceballos, G.; Goncalves, P.; Graziani, E.; Grosdidier, G.; Grzelak, K.; Guy, J.; Haag, C.; Hallgren, A.; Hamacher, K.; Hamilton, K.; Haug, S.; Hauler, F.; Hedberg, V.; Hennecke, M.; Hoffman, J.; Holmgren, S.-O.; Holt, P. J.; Houlden, M. A.; Jackson, J. N.; Jarlskog, G.; Jarry, P.; Jeans, D.; Johansson, E. K.; Jonsson, P.; Joram, C.; Jungermann, L.; Kapusta, F.; Katsanevas, S.; Katsoufis, E.; Kernel, G.; Kersevan, B. P.; Kerzel, U.; King, B. T.; Kjaer, N. J.; Kluit, P.; Kokkinias, P.; Kourkoumelis, C.; Kouznetsov, O.; Krumstein, Z.; Kucharczyk, M.; Lamsa, J.; Leder, G.; Ledroit, F.; Leinonen, L.; Leitner, R.; Lemonne, J.; Lepeltier, V.; Lesiak, T.; Liebig, W.; Liko, D.; Lipniacka, A.; Lopes, J. H.; Lopez, J. M.; Loukas, D.; Lutz, P.; Lyons, L.; MacNaughton, J.; Malek, A.; Maltezos, S.; Mandl, F.; Marco, J.; Marco, R.; Marechal, B.; Margoni, M.; Marin, J.-C.; Mariotti, C.; Markou, A.; Martinez-Rivero, C.; Masik, J.; Mastroyiannopoulos, N.; Matorras, F.; Matteuzzi, C.; Mazzucato, F.; Mazzucato, M.; Mc Nulty, R.; Meroni, C.; Migliore, E.; Mitaroff, W.; Mjoernmark, U.; Moa, T.; Moch, M.; Moenig, K.; Monge, R.; Montenegro, J.; Moraes, D.; Moreno, S.; Morettini, P.; Mueller, U.; Muenich, K.; Mulders, M.; Mundim, L.; Murray, W.; Muryn, B.; Myatt, G.; Myklebust, T.; Nassiakou, M.; Navarria, F.; Nawrocki, K.; Nicolaidou, R.; Nikolenko, M.; Oblakowska-Mucha, A.; Obraztsov, V.; Olshevski, A.; Onofre, A.; Orava, R.; Osterberg, K.; Ouraou, A.; Oyanguren, A.; Paganoni, M.; Paiano, S.; Palacios, J. P.; Palka, H.; Papadopoulou, Th. D.; Pape, L.; Parkes, C.; Parodi, F.; Parzefall, U.; Passeri, A.; Passon, O.; Peralta, L.; Perepelitsa, V.; Perrotta, A.; Petrolini, A.; Piedra, J.; Pieri, L.; Pierre, F.; Pimenta, M.; Piotto, E.; Podobnik, T.; Poireau, V.; Pol, M. E.; Polok, G.; Pozdniakov, V.; Pukhaeva, N.; Pullia, A.; Radojicic, D.; Rames, J.; Read, A.; Rebecchi, P.; Rehn, J.; Reid, D.; Reinhardt, R.; Renton, P.; Richard, F.; Ridky, J.; Rivero, M.; Rodriguez, D.; Romero, A.; Ronchese, P.; Roudeau, P.; Rovelli, T.; Ruhlmann-Kleider, V.; Ryabtchikov, D.; Sadovsky, A.; Salmi, L.; Salt, J.; Sander, C.; Savoy-Navarro, A.; Schwickerath, U.; Sekulin, R.; Siebel, M.; Simard, L.; Sisakian, A.; Smadja, G.; Smirnova, O.; Sokolov, A.; Sopczak, A.; Sosnowski, R.; Spassov, T.; Stanitzki, M.; Stocchi, A.; Strauss, J.; Stugu, B.; Szczekowski, M.; Szeptycka, M.; Szumlak, T.; Tabarelli, T.; Tegenfeldt, F.; Thomas, J.; Timmermans, J.; Tkatchev, L.; Tobin, M.; Todorovova, S.; Tome, B.; Tonazzo, A.; Tortosa, P.; Travnicek, P.; Treille, D.; Tristram, G.; Trochimczuk, M.; Troncon, C.; Turluer, M.-L.; Tyapkin, I. A.; Tyapkin, P.; Tzamarias, S.; Uvarov, V.; Valenti, G.; van Dam, P.; van Eldik, J.; van Remortel, N.; van Vulpen, I.; Vegni, G.; Veloso, F.; Venus, W.; Verdier, P.; Verzi, V.; Vilanova, D.; Vitale, L.; Vrba, V.; Wahlen, H.; Washbrook, A. J.; Weiser, C.; Wicke, D.; Wickens, J.; Wilkinson, G.; Winter, M.; Witek, M.; Yushchenko, O.; Zalewska, A.; Zalewski, P.; Zavrtanik, D.; Zhuravlov, V.; Zimin, N. I.; Zintchenko, A.; Zupan, M.

    2008-05-01

    A measurement of the W boson mass and width has been performed by the DELPHI collaboration using the data collected during the full LEP2 programme (1996-2000). The data sample has an integrated luminosity of 660 pb-1 and was collected over a range of centre-of-mass energies from 161 to 209 GeV. Results are obtained by applying the method of direct reconstruction of the mass of the W from its decay products in both the W+W-→ℓν¯ℓqq¯’ and W+W-→qq¯’q¯q’ channels. The W mass result for the combined data set is M_W = 80.336 ±0.055 ({text{Stat.}}) ±0.028 ({text{Syst.}}) ±0.025 ({text{FSI}}) ±0.009 ({text{LEP}}) text{GeV}/c^2, where FSI represents the uncertainty due to final state interaction effects in the qq¯’q¯q’ channel, and LEP represents that arising from the knowledge of the collision energy of the accelerator. The combined value for the W width is {ΓW} = 2.404 ±0.140 ({text{Stat.}}) ±0.077 ({text{Syst.}}) ±0.065 ({text{FSI}}) text{GeV}/c^2. These results supersede all values previously published by the DELPHI collaboration.

  2. A new evaluation of neutron data for the 209Bi between 10-5 eV and 20 MeV

    A new evaluation of neutron induced cross-sections on 209Bi has been completed within the full energy range 10-5 eV - 20 MeV and put under ENDF format. A careful study of the resonance region led to a consistent set of resonance parameters. On this basis, the tabulated cross-sections (total, elastic, capture) have been calculated using the Reich-Moore formalism. At higher energies a consistent set of optical model parameters has been obtained by fitting mainly the total cross-section between 0.7 and 150 MeV and elastic scattering angular distributions from 4 to 24 MeV. The so obtained neutron penetrabilities have been used for Hauser-Feshbach statistical model calculations which have been completed with pre-equilibrium and direct interaction components to get elastic and inelastic cross sections, angular distributions, secondary neutron spectra and gamma production. All the results are generally in good agreement with the available experimental data

  3. Modes of transference and rupture of the nucleus with neutron halos 6 He on 209 Bi near of the Coulomb barrier

    In recent experiments, the fusion of the exotic radioactive nucleus 6 He with 209 Bi has been studied for the first time at energies above and below the Coulomb barrier. A considerable enhancement in the fusion was observed, which implies a reduction of about 25% in the nominal fusion barrier. Some previous theoretical works suggest that this striking effect may be caused by the coupling to neutron transfer channels with a positive Q-value which would lead to a neutron flow and the consequent formation of a neck between the projectile and the target. Later, in the current work, we ran two new experiments on the same reaction using the FN Tandem Van de Graaff (10 MV) accelerator and the dual superconducting TwinSol system, both of them belonging to the University of Notre Dame, USA. This time, the purpose was to study one- and two-neutron transfer and the 6 He projectile breakup at laboratory energies of 14.7, 16.2, 17.9, 19.0 and 22.5 MeV. A strong group of 4 He was observed (with an effective Q-value about .5 MeV) whose integrated cross section results exceptionally high, exceeding the fusion cross section both above and below the barrier. The simultaneously measured elastic scattering angular distribution required high total cross sections so that this yield is confirmed. Preliminary coupled channels calculations sing the computer program called Fresco developed at the University of Surrey (England) suggested that the reaction mechanisms may be better described as a direct nuclear breakup and two-neutron transfer to unbound states in 211 Bi. These calculations predicted also an enhancement in the fusion cross section below the barrier due to the transfer and breakup channel coupling, which strongly suggests that this channel is the 'doorway state' that explains the fusion barrier reduction observed in previous experiments. It was found that the 4 He group fully dominates the total reaction cross section at the measured energies and we show evidence that a new

  4. Evaluation of the toxic effects of brominated compounds (BDE-47, 99, 209, TBBPA) and bisphenol A (BPA) using a zebrafish liver cell line, ZFL

    Highlights: • A homologous zebrafish thyroid hormone (TH) receptor (TR) reporter gene system was developed in a zebrafish liver cell-line (ZFL) to study the possible effects of chemicals on TR activities. • BPA was found to have antagonistic effects on T3 induced TR activity, BDE-47, BDE-99, and TBBPA did not show any interference of TR activity. • Down regulation of deiodinases and some sulfation enzymes or phase II enzymes by the tested chemicals indicated their impacts on TH eleiminations. • The up-regulation of tranthyretin by BDE-47 at 96 h long-term exposure gave a link to the CYP family for its role in producing a more toxic and oxidized form. - Abstract: The toxic effects of three polybrominated diphenyl ether (PBDE) congeners (BDE-47, -99, and -209), tetrabromobisphenol A (TBBPA) and bisphenol A (BPA), were evaluated by determining their 24 h and 96 h median lethal concentrations using a zebrafish liver cell line, ZFL. It was found that BDE-47, BDE-99 and TBBPA showed comparative cytotoxicity within the range of 1.2–4.2 μM, and were more toxic than BPA (367.1 μM at 24 h and 357.6 μM at 96 h). However, BDE-209 induced only 15% lethality with exposures up to 25 μM. The molecular stresses of BDE-47, -99, TBBPA and BPA involved in thyroid hormone (TH) homeostasis and hepatic metabolism were also investigated. Using a reporter gene system to detect zebrafish thyroid hormone receptor β (zfTRβ) transcriptional activity, the median effective concentration of triiodothyronine (T3) was determined to be 9.2 × 10−11 M. BDE-47, BDE-99, TBBPA and BPA alone, however, did not exhibit zfTRβ agonistic activity. BPA displayed T3 (0.1 nM) induced zfTRβ antagonistic activity with a median inhibitory concentration of 19.3 μM. BDE-47, BDE-99 and TBBPA displayed no antagonistic effects of T3-induced zfTRβ activity. Target gene expressions were also examined under acute exposures. The significant inhibition of different types of deiodinases by all of the

  5. Evaluation of the toxic effects of brominated compounds (BDE-47, 99, 209, TBBPA) and bisphenol A (BPA) using a zebrafish liver cell line, ZFL

    Yang, Jie; Chan, King Ming, E-mail: kingchan@cuhk.edu.hk

    2015-02-15

    Highlights: • A homologous zebrafish thyroid hormone (TH) receptor (TR) reporter gene system was developed in a zebrafish liver cell-line (ZFL) to study the possible effects of chemicals on TR activities. • BPA was found to have antagonistic effects on T3 induced TR activity, BDE-47, BDE-99, and TBBPA did not show any interference of TR activity. • Down regulation of deiodinases and some sulfation enzymes or phase II enzymes by the tested chemicals indicated their impacts on TH eleiminations. • The up-regulation of tranthyretin by BDE-47 at 96 h long-term exposure gave a link to the CYP family for its role in producing a more toxic and oxidized form. - Abstract: The toxic effects of three polybrominated diphenyl ether (PBDE) congeners (BDE-47, -99, and -209), tetrabromobisphenol A (TBBPA) and bisphenol A (BPA), were evaluated by determining their 24 h and 96 h median lethal concentrations using a zebrafish liver cell line, ZFL. It was found that BDE-47, BDE-99 and TBBPA showed comparative cytotoxicity within the range of 1.2–4.2 μM, and were more toxic than BPA (367.1 μM at 24 h and 357.6 μM at 96 h). However, BDE-209 induced only 15% lethality with exposures up to 25 μM. The molecular stresses of BDE-47, -99, TBBPA and BPA involved in thyroid hormone (TH) homeostasis and hepatic metabolism were also investigated. Using a reporter gene system to detect zebrafish thyroid hormone receptor β (zfTRβ) transcriptional activity, the median effective concentration of triiodothyronine (T3) was determined to be 9.2 × 10{sup −11} M. BDE-47, BDE-99, TBBPA and BPA alone, however, did not exhibit zfTRβ agonistic activity. BPA displayed T3 (0.1 nM) induced zfTRβ antagonistic activity with a median inhibitory concentration of 19.3 μM. BDE-47, BDE-99 and TBBPA displayed no antagonistic effects of T3-induced zfTRβ activity. Target gene expressions were also examined under acute exposures. The significant inhibition of different types of deiodinases by all of

  6. Studies for a linear collider drift chamber and search for heavy stable charged particles in e+e- collisions up to √s=209 GeV

    In the first part of this thesis studies for a TPC (time projection chamber) are presented which is planned to constitute the main tracking device of the detector at the future linear e+e- collider TESLA. Instead of conventional readout based on wire chambers a gas amplification system using GEMs (gas electron multipliers) was developed. First basic studies with a TPC prototype equipped with a double GEM structure using cosmic muons are presented. The single point resolution is determined with different readout pad geometries, and the results are compared with simulations. In the second part a search for heavy stable charged particles (mass>45 GeV, lifetime≥ 10-6 s) in e+e- collisions is presented. The analysed data were recorded with the OPAL detector at LEP at centre-of-mass energies of (131-209) GeV. As the data selection is based only on the requirement of at least one track per event with an anomalous specific energy loss, many different signal event topologies are covered, e.g. cascade decays of pair-produced particles into heavy stable charged particles. In the analysed data corresponding to an integrated luminosity of 632.1 pb-1 no data event is selected while 0.795±0.394 events are expected from the Standard Model. Upper cross-section limits are derived for the direct and indirect production of heavy stable charged particles, which are interpreted within supersymmetric models, especially focussing on GMSB (gauge mediated supersymmetric breaking). (orig.)

  7. 20.9.Extrapyramidal disorder

    1992-01-01

    920191 Effect of 6-hydroxydopamine oncerebral catecholamines,lipid peroxidationand antioxidant enzymes in rat-concernedwith pathogensis of Parkinson’s disease.LIANG Liping (梁立平),JIANG Dehua (江德华).Dept Neurol,Neurolgic Instit,Tianjing,300052.Chin J Neurol and Psychiat 1991; 24 (4): 223-227.As an animal model of human Parkinson’s

  8. Measurements of Neutron-Induced Fission Cross Sections of 205Tl, 204, 206, 207, 208Pb, and 209Bi using Quasi-Monoenergetic Neutrons in the Energy Range 35 - 174 MeV

    Tutin, Gennady A.; Ryzhov, Igor V.; Eismont, Vilen P.; Mitryukhin, Andrey G.; Oplavin, Valery S.; Soloviev, Sergey M.; Blomgren, Jan; Condè, Henri; Olsson, Nils; Renberg, Per-Ulf

    2005-05-01

    Cross sections for neutron-induced fission of 205Tl, 204, 206, 207, 208Pb, and 209Bi were measured in the energy range from 35 MeV to 174 MeV. The experiments were done at the neutron beam facility of The Svedberg Laboratory, using a multi-section Frisch-gridded ionization chamber for detection of the fission fragments. The neutron-induced fission cross section of 238U was employed as a reference. The results of the measurements are compared with existing experimental data.

  9. Measurements of neutron-induced fission cross-sections of 205Tl, 204,206,207,208Pb and 209Bi with a multi-section Frisch-gridded ionization chamber

    Ryzhov, I. V.; Tutin, G. A.; Mitryukhin, A. G.; Oplavin, V. S.; Soloviev, S. M.; Blomgren, J.; Renberg, P.-U.; Meulders, J. P.; El Masri, Y.; Keutgen, Th.; Prieels, R.; Nolte, R.

    2006-06-01

    Neutron-induced fission cross-sections of 205Tl, 204,206,207,208Pb and 209Bi have been measured in the energy range from 30 to 180 MeV. The measurements were performed with quasi-monoenergetic neutron beams using a multi-section Frisch-gridded ionization chamber. The neutron-induced fission cross-sections of 238U were used as reference data. The experimental techniques are described in detail as well as the data processing. The results are compared with existing experimental data.

  10. Measurements of neutron-induced fission cross-sections of 205Tl, 204,206,207,208Pb and 209Bi with a multi-section Frisch-gridded ionization chamber

    Neutron-induced fission cross-sections of 205Tl, 204,206,207,208Pb and 209Bi have been measured in the energy range from 30 to 180 MeV. The measurements were performed with quasi-monoenergetic neutron beams using a multi-section Frisch-gridded ionization chamber. The neutron-induced fission cross-sections of 238U were used as reference data. The experimental techniques are described in detail as well as the data processing. The results are compared with existing experimental data

  11. Revision of FED-STD-209D and MIL-STD-1246B and development of IES (Institute of Environmental Sciences) contamination control recommended practices in the United States of America

    Mielke, R.L.

    1990-01-01

    In the United States of America, numerous organizations are writing standards and recommend practices for contamination control and cleanroom applications. The American Society for Testing and Materials (ASTM), the Institute of Environmental Sciences (IES), and various US Government agencies are among the organizations with a vested interest in publishing standards and recommended practices on these subjects. In the early years of contamination control and cleanroom technology, significant work was done in the US on standards and recommended practices. Proprietary standards were established by companies and other documents were produced by Federal agencies and technical organizations. In 1982, the IES began to focus on recommended practices, and the US General Services Administration (GSA) commissioned the IES to review and rewrite US Federal Standard 209 (FED-STD-209). The ASTM continues to review and update their standards on cleanroom applications on a periodic basis. Now, in 1990, US military organizations are beginning to review their cleanroom documents as well. This paper will discuss the preparation of IES Recommended Practices and Standards for contamination control and cleanroom applications. It will describe the current status of four IES Recommended Practices and two US Government documents.

  12. A new monohydrogendecavanadate (V)-dihydrogendecavanadate (V) with dibutylammonium cations [C8NH20]9[H2V10O28][HV10O28].2.13H2O: Synthesis, crystal structure, vibrational and optical properties

    Omri, Issam; Mhiri, Tahar; Graia, Mohsen

    2016-03-01

    A new decavanadate, [C8NH20]9[H2V10O28][HV10O28].2.13H2O, was synthesized by slow evaporation from aqueous solution and characterized by IR, Raman and UV-Vis spectroscopies. The crystal structure was solved by single-crystal X-ray diffraction. [C8NH20]9[H2V10O28][HV10O28].2.13H2O consists of dihydrogendecavanadate [H2V10O28]4-, monohydrogendecavanadate [HV10O28]5-, dibutylammonium cations and water molecules. The decavanadate units are assembled in tetramers arrays by interanionic hydrogen bonds O-H···O and cation-anion N-H···O interactions. The dibutylammonium [C8NH20]+ cations and water molecules connect the tetramers into a three-dimensional network. The presence of the two types of units, [HnV10O28](6-n)- with n = 1 and n = 2, in one compound was not yet observed and is herein reported for the first time. The IR and Raman spectra exhibit characteristic bands of all groups present in the structure. The optical analysis shows that this compound is a semiconductor material with an optical band gap of 2.59 eV.

  13. Polychlorinated biphenyl (PCB) concentrations and congener composition in masu salmon from Japan: A study of all 209 PCB congeners by high-resolution gas chromatography/high-resolution mass spectrometry (HRGC/HRMS)

    Highlights: • Two subspecies of masu salmon collected from central to northern Japan were examined. • All 209 PCB congeners in the fish were analyzed by HRGC/HRMS with δ15N and δ13C determinations. • ∑ PCBs was highest in fish that had upstreamed from Ise Bay, which is close to a heavy industrial area. • However, TEQdl-PCBs values were highest in fish from southern part of the Sea of Japan. - Abstract: We collected two subspecies of masu salmon: Oncorhynchus masou masou from four localities (southern Sea of Japan northward to Hokkaido) and O. masou ishikawae from upstream from Ise Bay close to a heavy industrial area. All 209 PCB congeners were analyzed using HRGC/HRMS. PCA ordination of congener concentrations divided data into three groups: (i) ssp. masou from Hokkaido, (ii) ssp. masou from the other regions and (iii) ssp. ishikawae. The highest ∑ PCB concentration (40.39 ng/wet wt) was in ssp. ishikawae followed by ssp. masou from southern waters; however the TEQdioxin-like PCBs was highest in ssp. masou from southern water (1.96 pg-TEQdioxin-like PCBs/g wet wt.) due to the high proportion of congener #126 in its complement (#126 has the highest toxic equivalency factor among congeners). There is likely a contamination source offshore in the southern Sea of Japan and/or along the migratory route of ssp. masou

  14. Modes of transference and rupture of the nucleus with neutron halos {sup 6} He on {sup 209} Bi near of the Coulomb barrier; Modos de transferencia y rompimiento del nucleo con halo neutronico {sup 6} He sobre {sup 209} Bi cerca de la barrera de Coulomb

    Lizcano C, D

    2003-07-01

    In recent experiments, the fusion of the exotic radioactive nucleus {sup 6} He with {sup 209} Bi has been studied for the first time at energies above and below the Coulomb barrier. A considerable enhancement in the fusion was observed, which implies a reduction of about 25% in the nominal fusion barrier. Some previous theoretical works suggest that this striking effect may be caused by the coupling to neutron transfer channels with a positive Q-value which would lead to a neutron flow and the consequent formation of a neck between the projectile and the target. Later, in the current work, we ran two new experiments on the same reaction using the FN Tandem Van de Graaff (10 MV) accelerator and the dual superconducting TwinSol system, both of them belonging to the University of Notre Dame, USA. This time, the purpose was to study one- and two-neutron transfer and the {sup 6} He projectile breakup at laboratory energies of 14.7, 16.2, 17.9, 19.0 and 22.5 MeV. A strong group of {sup 4} He was observed (with an effective Q-value about .5 MeV) whose integrated cross section results exceptionally high, exceeding the fusion cross section both above and below the barrier. The simultaneously measured elastic scattering angular distribution required high total cross sections so that this yield is confirmed. Preliminary coupled channels calculations sing the computer program called Fresco developed at the University of Surrey (England) suggested that the reaction mechanisms may be better described as a direct nuclear breakup and two-neutron transfer to unbound states in {sup 211} Bi. These calculations predicted also an enhancement in the fusion cross section below the barrier due to the transfer and breakup channel coupling, which strongly suggests that this channel is the 'doorway state' that explains the fusion barrier reduction observed in previous experiments. It was found that the {sup 4} He group fully dominates the total reaction cross section at the

  15. Wet-chemistry method for the separation of no-carrier-added 211At/211gPo from 209Bi target irradiated by alpha-beam in cyclotron

    We present a fast and effective wet-chemistry method, used to obtain the pure alpha-emitter 211At/211gPo (T1/2 = 7.214 h/516 ms), produced by 209Bi(α,2n) reaction in NCA form. It is a selective radiochemical separation of the At radionuclides from the target and the impurities, characterized by a radionuclidic purity close to 100%, based on the dissolution and the dilution of the irradiated target in acidic medium, on the extraction with DIPE, followed by the back-extraction with NaOH. As a result, we obtain a yield greater than 90-97% in a range from 0.75M to 2.00M. (author)

  16. Reflection asymmetry in odd-A and odd-odd actinium nuclei

    Theoretical calculations and measurements indicate that octupole correlations are at a maximum in the ground states of the odd-proton nuclei Ac and Pa. It has been expected that odd-odd nuclei should have even larger amount of octupole-octupole correlations. We have recently made measurements on the structure of 224Ac. Although spin and parity assignments could not be made, two bands starting at 354.1 and 360.0 keV have properties characteristic of reflection asymmetric shape. These two bands have very similar rotational constants and also similar alpha decay rates, which suggest similarity between the wavefunctions of these bands. These signatures provide evidence for octupole correlations in these nuclides

  17. Bestimmung der Ionisationsenergie von Actinium und Ultraspurenanalyse von Plutonium mit resonanter Ionisationsmassenspektrometrie (RIMS)

    Waldek, Achim Marcus

    2001-01-01

    ZusammenfassungDie Resonanzionisationsmassenspektrometrie (RIMS) verbindet hohe Elementselektivität mit guter Nachweiseffizienz. Aufgrund dieser Eigenschaften ist die Methode für Ultraspurenanalyse und Untersuchungen an seltenen oder schwer handhabbaren Elementen gut geeignet. Für RIMS werden neutrale Atome mit monochromatischem Laserlicht ein- oder mehrfach resonant auf energetisch hoch liegende Niveaus angeregt und anschließend durch einen weiteren Laserstrahl oder durch ein elektrisches Fe...

  18. Radium-228 analysis of natural waters by Cherenkov counting of Actinium-228

    The activities of 228Ra in natural waters were determined by the Cherenkov counting of the daughter nuclide 228Ac. The radium was pre-concentrated on MnO2 and the radium purified via ion exchange and, after a 2-day period of incubation to allow for secular equilibrium between the parent-daughter 228Ra(228Ac), the daughter nuclide 228Ac was isolated by ion exchange according to the method of Nour et al. [2004. Radium-228 determination of natural waters via concentration on manganese dioxide and separation using Diphonix ion exchange resin. Appl. Radiat. Isot. 61, 1173-1178]. The Cherenkov photons produced by 228Ac were counted directly without the addition of any scintillation reagents. The optimum Cherenkov counting window, sample volume, and vial type were determined experimentally to achieve optimum Cherenkov photon detection efficiency and lowest background count rates. An optimum detection efficiency of 10.9±0.1% was measured for 228Ac by Cherenkov counting with a very low Cherenkov photon background of 0.317±0.013 cpm. The addition of sodium salicylate into the sample counting vial at a concentration of 0.1 g/mL yielded a more than 3-fold increase in the Cherenkov detection efficiency of 228Ac to 38%. Tests of the Cherenkov counting technique were conducted with several water standards of known activity and the results obtained compared closely with a conventional liquid scintillation counting technique. The advantages and disadvantages of Cherenkov counting compared to liquid scintillation counting methods are discussed. Advantages include much lower Cherenkov background count rates and consequently lower minimal detectable activities for 228Ra and no need for expensive environmentally unfriendly liquid scintillation cocktails. The disadvantages of the Cherenkov counting method include the need to measure 228Ac Cherenkov photon detection efficiency and optimum Cherenkov counting volume, which are not at all required when liquid scintillation analysis is used

  19. Linear free energy relationship applied to trivalent cations with lanthanum and actinium oxide and hydroxide structure

    Linear free energy relationships for trivalent cations with crystalline M2O3 and, M(OH)3 phases of lanthanides and actinides were developed from known thermodynamic properties of the aqueous trivalent cations, modifying the Sverjensky and Molling equation. The linear free energy relationship for trivalent cations is as ΔGf,MvX0=aMvXΔGn,M3+0+bMvX+βMvXrM3+, where the coefficients aMvX, bMvX, and βMvX characterize a particular structural family of MvX, rM3+ is the ionic radius of M3+ cation, ΔGf,MvX0 is the standard Gibbs free energy of formation of MvX and ΔGn,M3+0 is the standard non-solvation free energy of the cation. The coefficients for the oxide family are: aMvX=0.2705, bMvX=-1984.75 (kJ/mol), and βMvX=197.24 (kJ/molnm). The coefficients for the hydroxide family are: aMvX=0.1587, bMvX=-1474.09 (kJ/mol), and βMvX=791.70 (kJ/molnm).

  20. Actinium: A RESTful Runtime Container for Scriptable Internet of Things Applications

    Kovatsch, Matthias; Lanter, Martin; Duquennoy, Simon

    2012-01-01

    Programming Internet of Things (IoT) applications is challenging because developers have to be knowledgeable in various technical domains, from low-power networking, over embedded operating systems, to distributed algorithms. Hence, it will be challenging to find enough experts to provide software for the vast number of expected devices, which must also be scalable and particularly safe due to the connection to the physical world. To remedy this situation, we propose an architecture that pr...

  1. New method for large scale production of medically applicable Actinium-225 and Radium-223

    Alpha-emitters (211At, 212Bi, 213Bi, 223Ra, 225Ac) are promising for targeted radiotherapy of cancer. Only two alpha decays near a cell membrane result in 50% death of cancer cell and only a single decay inside the cell is required for this. 225Ac may be used either directly or as a mother radionuclide in 213Bi isotope generator. Production of 225Ac is provided by three main suppliers - Institute for Transuranium Elements in Germany, Oak Ridge National Laboratory in USA and Institute of Physics and Power Engineering in Obninsk, Russia. The current worldwide production of 225Ac is approximately 1.7 Ci per year that corresponds to only 100-200 patients that could be treated annually. The common approach for 225Ac production is separation from mother 229Th or irradiation of 226Ra with protons in a cyclotron. Both the methods have some practical limitations to be applied routinely. 225Ac can be also produced by irradiation of natural thorium with medium energy protons . Cumulative cross sections of 225Ac, 227Ac, 227Th, 228Th formations have been obtained recently. Thorium targets (1-9 g) were irradiated by 114-91 MeV proton beam (1-50 μA) at INR linear accelerator. After dissolution in 8 M HNO3 + 0.004 M HF thorium was removed by double LLX by HDEHP in toluene (1:1). Ac and REE were pre-concentrated and separated from Ra and most fission products by DGA-Resin (Triskem). After washing out by 0.01 M HNO3 Ac was separated from REE by TRU Resin (Triskem) in 3 M HNO3 media. About 6 mCi 225Ac were separated in hot cell with chemical yield 85%. The method may be upscaled for production of Ci amounts of the radionuclide. The main impurity is 227Ac (0.1% at the EOB) but it does not hinder 225Ac from being used for medical 225Ac/213Bi generators. (author)

  2. Synthesis of chelating agents for actinium 225 complexation and its application in radioimmunotherapy

    Immunotherapy with radiolabeled antibodies should allow fairly specific targeting of certain cancers. However, iodine 131 may not be the best isotope for tumor therapy because of its limited specific activity, low beta-energy, relatively long half life and strong gamma emission. Another approach to improve therapeutic efficacy is the use of replacement isotopes with better physical properties. Chelator that can hold radio-metals with high stability under physiological conditions are essential to avoid excessive damage to non-target cells; Moreover, the development of new bifunctional chelating agents is essential for this purpose. Accordingly, our efforts have been directed, for several years, to the synthesis of original chelating agents likely to form stable complexes in vivo with the numerous potential candidates for such applications. Therefore, we have developed a new simple and efficient synthesis pathway of 2-(4-iso-thio-cyanate-benzyl)-1,4,7,10,13,16- hexa-aza-cyclo-hexadecane- 1,4,7,10,13,16-hexa-acetic acid, though functionalized on the cycle by a termination allowed coupling to an antibody or any other biological substance such as a hapten. (author)

  3. Purification of selenium from thorium, uranium, radium, actinium and potassium impurities for low background measurements

    A technique of selenium purification from 232Th, 238U, 226,228Ra, 227Ac and 40K was developed. This technique is simple to perform and employs a minimum number of highly pure reagents (bidistilled water, nitric acid). Operations carried out during purification (elution, evaporation) practically exclude losses of the target product (chemical yields of Se > 99%). A test purification of 100 g of selenium was carried out using this technique. The efficiency of this technique was confirmed by low background gamma spectrometry of the purified selenium sample. Distribution coefficients of Th, U, Ra and Ac on DOWEX 50W- x 8 cation-exchange resin at different concentrations of selenium and nitric acid were experimentally determinated. Instrumental neutron activation analysis of bidistilled water, deionized water and nitric acid was performed. (orig.)

  4. Purification of selenium from thorium, uranium, radium, actinium and potassium impurities for low background measurements

    Rakhimov, A.V. [Joint Institute for Nuclear Research (JINR), Dubna (Russian Federation); Uzbek Academy of Sciences, Tashkent (Uzbekistan). Inst. of Nuclear Physics (INP AS RUz); Warot, G. [CEA-CNRS, Modane (France). Laboratoire Souterrain de Modane (LSM); Karaivanov, D.V. [Joint Institute for Nuclear Research (JINR), Dubna (Russian Federation); Institute for Nuclear Research and Nuclear Energy (INRNE), Sofia (Bulgaria); Kochetov, O.I.; Lebedev, N.A.; Filosofov, D.V. [Joint Institute for Nuclear Research (JINR), Dubna (Russian Federation); Mukhamedshina, N.M.; Sadikov, I.I. [Uzbek Academy of Sciences, Tashkent (Uzbekistan). Inst. of Nuclear Physics (INP AS RUz)

    2013-07-01

    A technique of selenium purification from {sup 232}Th, {sup 238}U, {sup 226,228}Ra, {sup 227}Ac and {sup 40}K was developed. This technique is simple to perform and employs a minimum number of highly pure reagents (bidistilled water, nitric acid). Operations carried out during purification (elution, evaporation) practically exclude losses of the target product (chemical yields of Se > 99%). A test purification of 100 g of selenium was carried out using this technique. The efficiency of this technique was confirmed by low background gamma spectrometry of the purified selenium sample. Distribution coefficients of Th, U, Ra and Ac on DOWEX 50W- x 8 cation-exchange resin at different concentrations of selenium and nitric acid were experimentally determinated. Instrumental neutron activation analysis of bidistilled water, deionized water and nitric acid was performed. (orig.)

  5. Eeffect of maternal BDE-209 on the cholinergic neurotransmitter system in the hippocampus of offspring rats%母源性十溴联苯醚暴露对仔鼠海马胆碱能神经递质系统的影响

    吴英; 余艳红; 陈敦金

    2013-01-01

    目的:从胆碱能神经递质系统角度探讨母源性十溴联苯醚(BDE-209)损伤仔鼠神经系统的可能机制.方法:3 月龄wistar雌鼠自确定交配成功后随机分为实验组(A、B、C、D组)和对照组(E组),通过灌胃方法建立自妊娠期至哺乳期的不同剂量BDE-209[100、300、600、1 200 mg/(kg?d)]的暴露模型,21 d仔鼠断乳后各组随机选取10只仔鼠作为研究对象,应用免疫组织化学和比色法分别测定各组仔鼠海马组织中乙酰胆碱纤维(ACH)含量、乙酰胆碱酯酶(ACHE)活性、毒蕈碱受体(M.ACHR)含量、烟碱受体(N-ACHR)含量.结果:与E组相比,B、C、D组ACH含量和ACHE活性下降;C、D组M.ACHR含量下降;仅D组N-ACHR含量下降.结论:-定剂量的母源性BDE-209可能通过影响仔鼠胆碱能神经递质系统而具有神经毒性,且存在剂量效应关系.%Objective To study the possible mechanism of the damage of nerve system of prenatal induced by lactational BDE-209 (brominated Diphenyl Ethers-209) in the offspring rats from the cholinergic neurotransmitter system point of view. Methods After mating successfully, the female Wistar rats at the age of 3 months were divided into five groups randomly including the experimental group A, B, C, D and the control group E. BDE-209 was given in doses of 100(group A) , 300(group B) , 600(group C) , 1 200 (group D) mg/(kg·d) by oral gavage for maternal rats in the experimental groups. Ten rats of the first weaning offspring in each group were selected randomly. We determined the contents of acetylcholine, muscarinic cholinoreceptor, cholinergic nicotinic receptor and the activity of acetylcholinesterase by immunohistochemistry and chromatometry in each group. Results Compared with group E, the concentration of acetylcholine and the activity of acetylcholinesterase decreased significantly in group B , C and D, the concentration of muscarinic cholinoreceptor decreased significantly in group C and D , and the concentration

  6. 10 CFR 209.3 - Definitions.

    2010-01-01

    ... pursuant to the Agreement on an International Energy Program signed at Paris on November 18, 1974, including (1) the Annex entitled “Emergency Reserves”, (2) any amendment to such Agreement which includes another nation as a Party to such Agreement, and (3) any technical or clerical amendment to such...

  7. 48 CFR 209.570-2 - Policy.

    2010-10-01

    ... appropriate steps to prevent any organizational conflict of interest in the selection process; or (2) The... DEFENSE ACQUISITION PLANNING CONTRACTOR QUALIFICATIONS Organizational and Consultant Conflicts of...

  8. 22 CFR 1203.735-209 - Indebtedness.

    2010-04-01

    ... Foreign Relations UNITED STATES INTERNATIONAL DEVELOPMENT COOPERATION AGENCY EMPLOYEE RESPONSIBILITIES AND... obligation means one acknowledged by the employee or reduced to judgement by a court or one imposed by law such as Federal, State, or local taxes, and “in a proper and timely manner” means in a manner which...

  9. QTL Information Table: 209 [Q-TARO

    Full Text Available Physiological trait Source activity spikelet fertility RFLP C)Interval RIL Zhenshan 97B Milyang ... .L. (2001). Comparison of the detection of QTL for yi eld traits in different generations of a rice cross ... using two mapping approaches. Yi ... Chuan Xue Bao 28, 458-464. ...

  10. 22 CFR 209.3 - Definitions.

    2010-04-01

    ..., or by a primary recipient as a condition to eligibility for Federal financial assistance, and the... provision of facilities includes the construction, expansion, renovation, remodeling, alteration or acquisition of facilities. (e) The term Federal financial assistance includes (1) grants and loans of...

  11. 21 CFR 209.2 - Definitions.

    2010-04-01

    .... Pharmacy includes, but is not limited to, a retail, mail order, Internet, hospital, university, or clinic pharmacy, or a public health agency, regularly and lawfully engaged in dispensing prescription drugs....

  12. Underground research laboratory room 209 instrument array

    An in situ excavation response test was conducted at the 240 level of the Underground Research Laboratory (URL). The test was carried out in conjunction with drill and blast excavation of a near-circular tunnel, about 3.5 m in diameter. The tunnel was excavated through a tunnel axis. Three modelling groups made predictions of the response of the rock mass and hydraulic behaviour of the water-bearing fracture to excavation. Two of the groups used the three-dimensional Finite-element Method and one group used the Discontinuous Deformation Analysis Method. Both methods predicted displacements and stress changes that agreed reasonably well with the measured response, but none of the methods predicted the hydraulic response of the fracture

  13. 23 CFR 645.209 - General requirements.

    2010-04-01

    ... 23 CFR part 924, Highway Safety Improvement Program. (l) Wetlands. The installation of privately... this part and the provisions of 23 CFR 1.23(c) for longitudinal installations. (f) Direct Federal... CFR part 630, subpart J. This publication is available for inspection and copying from the...

  14. Underground research laboratory room 209 instrument array

    An in situ excavation response test was conducted at the 240 Level of the Underground Research Laboratory (URL). The test was carried out in conjunction with the drill and blast excavation of a near-circular tunnel, about 3.5 m in diameter. The tunnel was excavated through a near-vertical water-bearing fracture oriented almost perpendicular to the tunnel axis. Three modelling groups made predictions of the response of the rock mass and hydraulic behaviour of the water-bearing fracture to excavation. Two of the groups used the three-dimensional Finite-Element Method and one group used the Discontinuous Deformation Analysis Method. Both methods predicted displacements and stress changes that agreed reasonably well with the measured response, but none of the methods predicted the hydraulic response of the fracture

  15. Purification of radium-226 for the manufacturing of actinium-225 in a cyclotron for alpha-immunotherapy; Radium-Aufreinigung zur Herstellung von Actinium-225 am Zyklotron fuer die Alpha-Immuntherapie

    Marx, Sebastian Markus

    2014-09-23

    The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.

  16. Renal uptake of bismuth-213 and its contribution to kidney radiation dose following administration of actinium-225-labeled antibody

    Schwartz, J; O' Donoghue, J A; Humm, J L [Department of Medical Physics, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); Jaggi, J S [Bristol-Myers Squibb, Plainsboro, NJ (United States); Ruan, S; Larson, S M [Nuclear Medicine Service Department of Radiology, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); McDevitt, M; Scheinberg, D A, E-mail: schwarj1@mskcc.org [Molecular Pharmacology and Chemistry, Sloan-Kettering Institute, 1275 York Avenue, New York, NY 10065 (United States)

    2011-02-07

    Clinical therapeutic studies using {sup 225}Ac-labeled antibodies have begun. Of major concern is renal toxicity that may result from the three alpha-emitting progeny generated following the decay of {sup 225}Ac. The purpose of this study was to determine the amount of {sup 225}Ac and non-equilibrium progeny in the mouse kidney after the injection of {sup 225}Ac-huM195 antibody and examine the dosimetric consequences. Groups of mice were sacrificed at 24, 96 and 144 h after injection with {sup 225}Ac-huM195 antibody and kidneys excised. One kidney was used for gamma ray spectroscopic measurements by a high-purity germanium (HPGe) detector. The second kidney was used to generate frozen tissue sections which were examined by digital autoradiography (DAR). Two measurements were performed on each kidney specimen: (1) immediately post-resection and (2) after sufficient time for any non-equilibrium excess {sup 213}Bi to decay completely. Comparison of these measurements enabled estimation of the amount of excess {sup 213}Bi reaching the kidney ({gamma}-ray spectroscopy) and its sub-regional distribution (DAR). The average absorbed dose to whole kidney, determined by spectroscopy, was 0.77 (SD 0.21) Gy kBq{sup -1}, of which 0.46 (SD 0.16) Gy kBq{sup -1} (i.e. 60%) was due to non-equilibrium excess {sup 213}Bi. The relative contributions to renal cortex and medulla were determined by DAR. The estimated dose to the cortex from non-equilibrium excess {sup 213}Bi (0.31 (SD 0.11) Gy kBq{sup -1}) represented {approx}46% of the total. For the medulla the dose contribution from excess {sup 213}Bi (0.81 (SD 0.28) Gy kBq{sup -1}) was {approx}80% of the total. Based on these estimates, for human patients we project a kidney-absorbed dose of 0.28 Gy MBq{sup -1} following administration of {sup 225}Ac-huM195 with non-equilibrium excess {sup 213}Bi responsible for approximately 60% of the total. Methods to reduce renal accumulation of radioactive progeny appear to be necessary for the success of {sup 225}Ac radioimmunotherapy.

  17. Purification of radium-226 for the manufacturing of actinium-225 in a cyclotron for alpha-immunotherapy

    The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.

  18. Distribution of trace elements in land plants and botanical taxonomy with special reference to rare earth elements and actinium

    Distribution profiles of trace elements in land plants were studied by neutron activation analysis and radioactivity measurements without activation. Number of botanical samples analyzed were more than three thousand in which more than three hundred botanical species were included. New accumulator plants of Co, Cr, Zn, Cd, rare earth elements, Ac, U, etc., were found. Capabilities of accumulating trace elements can be related to the botanical taxonomy. Discussions are given from view points of inorganic chemistry as well as from botanical physiology

  19. Residual nuclide formation in 206,207,208,natPb and 209Bi induced by 0.04 - 2.6 GeV protons as well as in 56Fe induced by 0.3 - 2.6 GeV protons

    This work is aimed at experimental determination of independent and cumulative yields of radioactive residual product nuclei in the intermediate energy proton-irradiated thin targets made of highly isotopic enriched and natural lead (206,207,208,natPb), bismuth (209Bi), and highly isotopic enriched iron (56Fe). 5972 independent and cumulative yields of radioactive residuals nuclei have been measured in 55 thin Pb and Bi targets irradiated by 0.04, 0.07, 0.10, 0.15, 0.25, 0.6, 0.8, 1.2, 1.4, 1.6, and 2.6 GeV protons. Besides, 219 yields have been measured in 0.3, 0.5, 0.75, 1.0, 1.5, and 2.6 GeV proton-irradiated Fe target. In both cases, the protons were extracted from the ITEP U-10 synchrotron. The measured data are compared with experimental results obtained elsewhere and with theoretical calculations by seven codes. The predictive power was found to be different for each of the codes tested, but was satisfactory on the whole in the case of spallation products. At the same time, none of the codes can describe well the product yields throughout the whole product mass range, and all codes must be further improved. (authors)

  20. Contribution to construction and setup of a detection system for the focal plan of the BBS spectrometer. Application to study of the neutron emission decay of the resonant states populated by the reaction (4He,3He) at 42 MeV/u in nuclei 208Pb and 209Pb

    In order to realize an experimental program dedicated to nuclear structure studies we have conceived and constructed at IPN Orsay a detection system for the focal plane of the magnetic spectrometer BBS, installed at the cryogenic cyclotron AGOR of the laboratory KVI (The Netherlands). Two detection units, consisting each of two localization plans of the Cathode Strip Chamber (CSC) type, measure the position and angle of particle trajectory. This information is used for the determination of the reaction parameters at the target by a backtracking procedure. The identification of the reaction products is done by the measurement of their time-of-flight and energy loss. For light ions this task is assumed by plastic scintillators, and for heavy ions by a parallel plan detector (PPAC) and an ionization chamber. This detection system is well adapted to the requirements given by the detection of a large range of ions (protons to 36Ar at energies of several tenths of MeV/nucleon) as well as the big acceptance, the small dispersion and the aberration of the BBS. The results of the test show the good performances of the detection system. In a first experiment the focal plane detection system was coupled to the neutron multidetector EVEN in order to study the decay of resonant high spin states at high excitation energies by the (4He, 3He) reaction on 207Pb and 208Pb targets. The transfer spectra, inclusive and in coincidence, of the nuclei 208Pb and 209Pb show a striking resemblance except for an excitation energy shift which is due to the hole in the last neutron shell of 207Pb. The resonances at l 8 and l = 9 are clearly populated, in agreement with the predictions of the Bonaccorso-Brink model. A sizeable fraction of the decay of the l = 8 resonance is direct, but at excitation energies higher than 15 MeV (in 208Pb) the decay is mostly statistical. (author)

  1. Dicty_cDB: AHA209 [Dicty_cDB

    Full Text Available omplete cds. 515 0.0 3 AY171066 |AY171066.1 Dictyostelium discoideum extrachromosomal palindromic ribosomal RNA gene sequence, centra...2.1 D.discoideum 5S ribosomal RNA gene. 236 3e-58 1 AY293825 |AY293825.1 Dictyostelium discoideum transposon... sequence. 192 4e-45 1 AC116988 |AC116988.2 Dictyostelium discoideum chromosome 2 map 6445720-6776760 strain...e FJ374900_1( FJ374900 |pid:none) Dictyostelium discoideum strain QS... 146 2e-54... FJ374901_1( FJ374901 |pid:none) Dictyostelium discoideum strain QS... 145 2e-54 FJ374891_1( FJ374891 |pid:none) Dict

  2. 48 CFR 1352.209-74 - Organizational conflict of interest.

    2010-10-01

    ... Organizational conflict of interest. As prescribed in 48 CFR 1309.507-2(d), insert the following clause: Organizational Conflict of Interest (APR 2010) (a) Purpose. The purpose of this clause is to ensure that the... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Organizational conflict...

  3. 48 CFR 1852.209-71 - Limitation of future contracting.

    2010-10-01

    ... that this acquisition may give rise to a potential organizational conflict of interest. Accordingly, the attention of prospective offerors is invited to FAR Subpart 9.5—Organizational Conflicts of Interest. (b) The nature of this conflict is . (c) The restrictions upon future contracting are as...

  4. 48 CFR 1352.209-71 - Limitation of future contracting.

    2010-10-01

    ... Limitation of future contracting. As prescribed in 48 CFR 1309.507-2(a), insert the following clause... obtaining an unfair competitive advantage in concurrent or future acquisitions. (1) Descriptions or... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Limitation of...

  5. 22 CFR 209.7 - Conduct of investigations.

    2010-04-01

    ... Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT NON-DISCRIMINATION IN FEDERALLY-ASSISTED PROGRAMS OF THE AGENCY FOR INTERNATIONAL DEVELOPMENT-EFFECTUATION OF TITLE VI OF THE CIVIL RIGHTS ACT OF 1964... identity of complainant shall be kept confidential except to the extent necessary to carry out the...

  6. 12 CFR 347.209 - Pledge of assets.

    2010-01-01

    ... such time as any such asset is placed with the depository, as follows: (1)(i) Negotiable certificates... country as the pledging bank's domicile; (ii) Non-negotiable certificates of deposit, subject to the terms..., or political subdivision of the foregoing or any obligation guaranteed by a state of the...

  7. 44 CFR 209.8 - Application and review process.

    2010-10-01

    ... processing subgrants to applicants in accordance with 44 CFR part 13 and this part. (b) Timeframes. We will... tax assessor's office. For any jurisdictions where the adjustment factor is over 25...

  8. Dicty_cDB: CHR209 [Dicty_cDB

    Full Text Available YDSCNGVTKSHSIYDS*sqetl*sr*ewsitl grsy*sles*tnflwfcwylyfimerrfrfnr*ts*s*kd*ss*vshveleerfrketss l*sfpsn*igq*k*...p--- ---ASPLIMSIWTVPNRCKRSNHFHSRRYDSCNGVTKSHSIYDS*sqetl*sr*ewsitl grsy*sles*tnflwfcwylyfimerrfrfnr*ts*s*kd*s

  9. 40 CFR 180.209 - Terbacil; tolerances for residues.

    2010-07-01

    ... terbacil, in or on the following raw agricultural commodities: Commodity Parts per million Alfalfa, forage 1.0 Alfalfa, hay 2.0 Apple 0.3 Asparagus 0.4 Blueberry 0.2 Caneberry subgroup 13A 0.2 Peach...

  10. n-Alcohol/Water Partition Coefficients for Decachlorobiphenyl (PCB 209)

    Measurements of n-octanol/water partition coefficients (Kow) for highly hydrophobic chemicals are extremely difficult and are rarely made, in part due to the large volumes of water typically needed to quantify these compounds in the aqueous phase. An extrapolation approach using ...

  11. 48 CFR 1552.209-76 - Contractor performance evaluations.

    2010-10-01

    ... any information regarding subcontracts, key personnel, and customer satisfaction; (4) Assign a... evaluations (if any), and provide any information regarding subcontracts, key personnel, and customer satisfaction; and (5) Forward the Report to the contractor within ten (10) business days after the...

  12. 48 CFR 852.209-70 - Organizational conflicts of interest.

    2010-10-01

    ... Government to avoid situations which might create an organizational conflict of interest or where the offeror... advantage. The term “organizational conflict of interest” means that because of other activities or... officer may determine that an organizational conflict of interest exists which would warrant...

  13. 48 CFR 1552.209-71 - Organizational conflicts of interest.

    2010-10-01

    ..., there are no relevant facts or circumstances which could give rise to an organizational conflict of...) working days. (c) The Contractor agrees that if an actual or potential organizational conflict of interest... avoid an organizational conflict of interest. If the Contractor was aware of a potential...

  14. 48 CFR 2452.209-72 - Organizational conflicts of interest.

    2010-10-01

    ... does not have any organizational conflict of interest which is defined as a situation in which the... Contractor agrees that if after award he or she discovers an organizational conflict of interest with respect... Contractor was aware of an organizational conflict of interest before the award of this contract...

  15. 48 CFR 2452.209-71 - Limitation on future contracts.

    2010-10-01

    ... URBAN DEVELOPMENT CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Texts of Provisions and... give rise to potential organizational conflicts of interest as defined at FAR subpart 9.5. (b)...

  16. 5 CFR 930.209 - Senior Administrative Law Judge Program.

    2010-01-01

    ... is classified at pay level AL-3, the senior administrative law judge is paid the lowest rate of basic... as an administrative law judge immediately before retirement, up to the maximum rate F. ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Senior Administrative Law Judge...

  17. 48 CFR 209.104-1 - General standards.

    2010-10-01

    ..., Office of the Deputy Under Secretary of Defense, Human Intelligence, Counterintelligence, and Security... Undersecretary of Defense for Intelligence. Waiver requests, prepared by the requiring activity in...

  18. Dicty_cDB: SSK209 [Dicty_cDB

    Full Text Available d Amino Acid sequence nqyh*nn*NMMMMMKMMKTKMIKRKRKHLVNMVINVIVNQLITLKNFHIHS*likfnfrf *k*nkik*nkik*nknkksndclil...RKHLVNMVINVIVNQLITLKNFHIHS*likfnfrf *k*nkik*nkik*nknkksndclilkn Frame B: tntirtiri*****r**rrr*lkekestl*iw**m

  19. 29 CFR 825.209 - Maintenance of employee benefits.

    2010-07-01

    ... not increase in the event the employment relationship terminates. (b) The same group health plan..., hospital care, dental care, eye care, mental health counseling, substance abuse treatment, etc., must be... FMLA ceases if and when the employment relationship would have terminated if the employee had not...

  20. Dicty_cDB: AFA209 [Dicty_cDB

    Full Text Available 955_1( AM228955 |pid:none) Pinus sylvestris mRNA for ornithin... 54 1e-06 ( P07991 ) RecName: Full=Ornithine aminotransfera...ssica napus ornithine aminotran... 51 1e-05 AP007157_557( AP007157 |pid:none) Aspergillus oryzae RIB40 genomi...kqnehn*l**NLSKEQWIQYHHKF KECTSKELIEMESEFAAHTYHPIPVVFKKASGVHVWGR*--- Translated Amin...o Acid sequence (All Frames) Frame A: llaywifqsnlk**qyfklk**n*knkiflkfknniqnktniinyskiyqknngsniitn srnvpqr...AA XXXXXXXXXX sequence update 2001. 6. 1 Translated Amino Acid sequence vglldfsikpkvitvl*ikvvklkkqnffki*kqyt

  1. 20 CFR 209.5 - Information regarding change in status.

    2010-04-01

    ... and Railroad Unemployment Insurance Act. The notice must fully advise the Board of the type of change... Act and the Railroad Unemployment Insurance Act; (b) Any change in the ownership or control by the... Retirement Act or Railroad Unemployment Insurance Act; and (c) The gain of ownership or control by...

  2. Diagnose in beeld (209). Een te water geraakte man

    van Noord, T; Ligtenberg, J J M; Zijlstra, J G

    2004-01-01

    A 32-year-old man was presented with severe hypothermia and respiratory insufficiency after submersion in water. The ECG showed Osborn waves and a prolonged QRS and QT duration which normalized after correction of the hypothermia.

  3. 10 CFR 1015.209 - Tax refund offset.

    2010-01-01

    ... offset as part of Treasury's mandatory centralized offset at 31 CFR 285.2, Offset of Tax Refund to Collect Past-Due, Legally Enforceable Non-tax Debt. DOE has adopted 31 U.S.C. 3720A and 31 CFR 285.2 in... 1015.203(e) of this part. (b) As described in § 1015.201(e) of this part, under the DCIA (31...

  4. 20 CFR 209.13 - Employers' gross earnings reports.

    2010-04-01

    ... digits 30. This report is used to determine: (1) Tax and benefit amounts involved in the Financial Interchange with the Social Security Administration and the Health Care Financing Administration; and...

  5. 46 CFR 13.209 - Eligibility: Cargo course.

    2010-10-01

    ... for an original “Tankerman-PIC” endorsement shall present a certificate of completion from a course in... Commandant. The date of the certificate may not be more than 5 years earlier than the date of application....

  6. The underground research laboratory room 209 excavation response test

    The response of the rock mass to excavation is an important factor in the design and performance of underground excavations and installations. This is particularly true in the excavation of vaults for the disposal of nuclear fuel waste, where the conditions in the rock mass around the disposal areas may affect the performance of engineered sealing systems installed to isolate the waste. The factors influencing, and mechanisms controlling, rock mass response to excavation must be understood in order to accommodate excavation response effects in disposal vault design and construction

  7. 48 CFR 15.209 - Solicitation provisions and contract clauses.

    2010-10-01

    ... of commercial items exempted under 15.403-1. (2)(i) When using funds appropriated or otherwise made... REGULATION CONTRACTING METHODS AND CONTRACT TYPES CONTRACTING BY NEGOTIATION Solicitation and Receipt...

  8. 34 CFR 685.209 - Income contingent repayment plan.

    2010-07-01

    ... one person in the borrower's family, the Secretary applies the HHS Poverty Guidelines for the borrower's family size. 1 The HHS Poverty Guidelines are available from the Office of the Assistant Secretary... consent form, developed consistent with 26 CFR 301.6103(c)-1 and provided to the borrower by the...

  9. Renal Scintiscanning with Hg209-Neohydrin in Urologic Diseases

    Renal scintiscanning has been carried out using Hg203 - labelled Neohydrin. The equipment used is the Nuclear Chicago Isotope Scanner Type 1700 with 2 x 2 - i n crystal and a 7 - cm focal-length honeycomb collimator. Usually the scintigrams are registered both on paper and on photographic film. Hg203 - labelled Neohydrin is usually employed in doses of 120 - 160 μc (about 2 μc/kg). The scanning examination starts about 2 h after the injection and lasts about 40-50 min. The selective storage of labelled Neohydrin at the level of the renal cortex makes it possible to obtain a graphic representation of the two kidneys and to identify their position, orientation and shape, and the homogeneity of the actively functioning parenchyma. In some cases, autoradiographic investigations have been carried out on diseased kidneys after surgical removal. By this method anomalies in position and orientation, both congenital and acquired, can be ascertained. As regards shape, the limits of the renal patterns are the mote clearly defined as the renal function is better. Technical aspects such as the width of the crystal, type of collimator (whose focal plane should pass through the transverse medial plane of the kidneys), and dose - which should be not too high not too low - are essential conditions for a correct graphic reproduction of the renal patterns. Failure in tabular activity in the parenchyma is shown by a lack in the uptake of radioactivity. The position, extent and shape of such defects in uptake vary according to the entity of the renal structures and their derangement due to various pathological processes: tumours, cysts, hydronephrosis, tuberculosis etc. In normal subjects a homogeneous scintigram is usual, although a clearer hilar region is not a rare occurrence. Any circumscribed decrease of scintigraphic density outside the hilum is the expression of a less actively functioning zone. Among kidney patterns larger than normal, the homogeneous ones which point to a compensatory hypertrophy should be distinguished from the dishomogeneous and irregular ones. These last pictures suggest the presence of large hydronephroses, tumours or multiple cysts. In renal vascular disease, the character of the uptake in the two kidneys can be of significant value in assessing the reduced function and in differentiating unilateral from bilateral diseases. Renal scintiscanning thus shows promise of proving a useful clinical technique, particularly if combined with radiological examination of the kidneys by traditional means (urography, ascending pyelography, retropneumoperitoneum, tomography, aortography, etc.). (author)

  10. 48 CFR 253.209-1 - Responsible prospective contractors.

    2010-10-01

    ... obtain needed facilities, equipment, materials, etc. (E) Accounting system and related internal controls... an accounting system review when soliciting and awarding cost-reimbursement or incentive type... contractor's key management personnel to determine if they have the basic technical knowledge,...

  11. Dicty_cDB: SFL209 [Dicty_cDB

    Full Text Available update 2001. 6. 1 Translated Amino Acid sequence nxflxyky*ihilffyil*HFIKKKKKKKXKKXPFXKKK--- ---VKTKXQDXEGIPPDQQRXIXRW*xixxmxxls...nsyfiflyivtfhkkkkkkkx*kxpfxekk--- ---m*kxxfkixkvfpxinnvsfxvgxqxrxcxxsl*lqypkrixlshlvxrlrgwyxnl cqninw*dhhs*s... ixfyxtnikfifyffiycnis*kkkkkkxlkxplfxkkk--- ---VKTKXQDXEGIPPDQQRXIXRW*xixxmxxlslitiskknxtxplgxqikrvvxksl skh

  12. 49 CFR 37.209 - Training and other requirements.

    2010-10-01

    ... assistance, securement of mobility aids, sensitive and appropriate interaction with passengers with disabilities, handling and storage of mobility devices, and familiarity with the requirements of this...

  13. Dicty_cDB: VSA209 [Dicty_cDB

    Full Text Available ikifrll **yrwfkecsnhll**yvtmlfkgkkgsnalvaakkalelspndikalfrkakalslmee ydeaikdfqkiietdsenkdakleler... 38 0.26 4 AC026169 |AC026169.2 Homo sapiens chromosome 3 clone RP11-156H1 map 3p, WORKING DRAFT SEQUENCE, 19 unordere...e RP11-499N6 map 3p, WORKING DRAFT SEQUENCE, 23 unordered pieces. 46 0.46 1 AC026175 |AC026175.4 Homo sapiens chromosome...0.65 3 AC020752 |AC020752.3 Homo sapiens chromosome 3p clone RP11-30M15, WORKING DRAFT SEQUENCE, 8 unordered...dylprolyl ... 61 3e-14 BC071388_1( BC071388 |pid:none) Danio rerio peptidylprolyl isomer

  14. Contribution to construction and setup of a detection system for the focal plan of the BBS spectrometer. Application to study of the neutron emission decay of the resonant states populated by the reaction ({sup 4}He,{sup 3}He) at 42 MeV/u in nuclei {sup 208}Pb and {sup 209}Pb; Contribution a la construction et a la mise au point d'un systeme de detection pour le plan focal du spectrometre BBS. Application a l'etude de la decroissance par emission de neutrons d'etats resonants peuples par la reaction ({sup 4}He,{sup 3}He) a 42 MeV/u dans les noyaux {sup 208}Pb et {sup 209}Pb

    Plankl-Chabib, Elke [Inst. de Physique Nucleaire, Paris-11 Univ., 91 - Orsay (France)

    1999-06-11

    In order to realizean experimental program dedicated to nuclear structure studies we have conceived and constructed at IPN Orsay a detection system for the focal plane of the magnetic spectrometer BBS, installed at the cryogenic cyclotron AGOR of the laboratory KVI (The Netherlands). Two detection units, consisting each of two localization plans of the Cathode Strip Chamber (CSC) type, measure the position and angle of particle trajectory. This information is used for the determination of the reaction parameters at the target by a backtracking procedure. The identification of the reaction products is done by the measurement of their time-of-flight and energy loss. For light ions this task is assumed by plastic scintillators, and for heavy ions by a parallel plan detector (PPAC) and an ionization chamber. This detection system is well adapted to the requirements given by the detection of a large range of ions (protons to {sup 36}Ar at energies of several tenths of MeV/nucleon) as well as the big acceptance, the small dispersion and the aberration of the BBS. The results of the test show the good performances of the detection system. In a first experiment the focal plane detection system was coupled to the neutron multidetector EVEN in order to study the decay of resonant high spin states at high excitation energies by the ({sup 4}He, {sup 3}He) reaction on {sup 207}Pb and {sup 208}Pb targets. The transfer spectra, inclusive and in coincidence, of the nuclei {sup 208}Pb and {sup 209}Pb show a striking resemblance except for an excitation energy shift which is due to the hole in the last neutron shell of {sup 207}Pb. The resonances at l 8 and l = 9 are clearly populated, in agreement with the predictions of the Bonaccorso-Brink model. A sizeable fraction of the decay of the l = 8 resonance is direct, but at excitation energies higher than 15 MeV (in {sup 208}Pb) the decay is mostly statistical.

  15. Study on laser atomic spectroscopy

    Laser atomic spectroscopic study on actinium element has been performed in many areas of spectroscopy. The study on characteristic of atomic vapor has been proceeded for copper atom and the spatial density distribution of copper vapor is measured. This experimental data has been compared with the theoretically calculated data. In spectroscopic experiment, the first and second excited states for actinium element are identified and the most efficient ionization scheme for actinium element is identified. In addition, the corrosion problem for filament material due to the heating of the actinium element has been studied. (Author)

  16. Removal of actinium from europium for the determination of specific radioactivity of ultra low-level Eu-152 in a sample exposed to atomic-bomb neutrons in Nagasaki

    Measurements of specific radioactivities of residual neutron-induced radionuclides such as 152Eu and 60Co have been carried out to check the validity of a series of computer calculations employed for the atomic-bomb neutron dosimetry in Hiroshima (exposed to uranium bomb) and Nagasaki (exposed to plutonium bomb). The use of these nuclides for atomic-bomb neutron dosimetry, however, has been limited by the following difficulties: (1) today, these radionuclides are found only at extremely low concentrations in materials exposed to the atomic-bomb and (2) the neutrons that induced these radionuclides were thermal and epithermal, while the neutron dose received in Hiroshima and Nagasaki is attributable to fast neutrons. In order to overcome the first difficulty, we established a chemical procedure to extract Eu and Co from materials exposed to the atomic-bomb, and the chemical procedure has been successful for the materials exposed to atomic-bomb within 1400 m in slant distance from the explosion point. As for Nagasaki, materials exposed in the distances farther than 1200 m have never been subjected to the measurement of residual neutron-induced radionuclides. In this work, determination of specific radioactivity of 152Eu (half-life: 13.542 y) in a sample exposed to Nagasaki atomic-bomb at a distant place from the explosion point was undertaken. But, because of radioactive decay during this ∝60 years since 1945 and long distance from the explosion point, the present specific radioactivity of 152Eu in the sample is extremely low (estimated to be ∝3 x 10-4 Bq-152Eu/mg-Eu), and a serious problem is interferences from daughters of 227Ac (half-life: 21.8 y) in the measurement of ultra low-level radioactivity of 152Eu. Hence, our chemical procedure to obtain Eu-enriched counting source should be improved, and much attention is being denoted to removal of Ac from Eu. (orig.)

  17. 24 CFR 1003.209 - Prohibition on use of assistance for employment relocation activities.

    2010-04-01

    ... constitute a significant loss of jobs. (ii) A job is considered to be lost due to the provision of ICDBG... job loss as defined in this rule. (d) Assistance not covered by this section. This section does not... loss of jobs in the Identified Service Area from which the relocation occurs. (b) Definitions....

  18. Fission fragment mass distribution studies for 28Si + 197Au, 209Bi, 235U reactions

    In reactions with heavy ions, complete fusion and quasi-fission are the competing processes at energies above the Coulomb barrier. The quasi-fission process, in which the system reseparates before reaching a compact compound nucleus, is a major hurdle in forming heavy and superheavy evaporation residues (ER) in heavy-ion reactions. Fission fragment mass distribution for the fully equilibrated compound nucleus is decided at the scission point due to a long descent from saddle to scission. At higher excitation energies, the shell effects are washed out and the mass distribution is expected to be symmetric. The width of the distribution strongly depends on the entrance channel properties, such as mass asymmetry, deformation of interacting nuclei, collision energy, and the Coulomb factor Z1 Z2. Any sudden change in the width of the mass distribution would indicate departure from full equilibration, while onset of mass asymmetry or a sudden increase in width would be a strong signal of quasi fission

  19. 47 CFR 54.209 - Annual reporting requirements for designated eligible telecommunications carriers.

    2010-10-01

    ... 911 special facility, as defined in 47 CFR 4.5(e). (iii) Specifically, the eligible telecommunications... CFR 4.5, of at least 30 minutes in duration for each service area in which an eligible... 47 Telecommunication 3 2010-10-01 2010-10-01 false Annual reporting requirements for...

  20. Study of ZZ Production at LEP at √s=183 - 209 GeV

    Pásztor, Gabriella

    A study of Z boson pair production in e+e- annihilation using the OPAL detector at LEP is reported . The ZZ production cross-section is measured, limits on anomalous ZZγ and ZZZ couplings are derived, and constraints on models of low scale quantum gravity in extra spatial dimensions are set.

  1. Study of ZZ production at LEP at $\\sqrt{s}$ = 183-209 GeV

    Pásztor, G

    2001-01-01

    A study of Z boson pair production in e+e- annihilation using the OPAL detector at LEP is reported. The ZZ production cross-section is measured, limits on anomalous ZZgamma and ZZZ couplings are derived, and constraints on models of low scale quantum gravity in extra spatial dimensions are set.

  2. 48 CFR 2052.209-71 - Contractor organizational conflicts of interest (representation).

    2010-10-01

    ... / / involve situations or relationships of the type set forth in 48 CFR 2009.570-3(b). (a) If the representation, as completed, indicates that situations or relationships of the type set forth in 48 CFR 2009.570... provisions of 48 CFR 2009-570-9. (b) The refusal to provide the representation required by 48 CFR...

  3. 48 CFR 752.209-71 - Organizational conflicts of interest discovered after award.

    2010-10-01

    ... provision in accordance with (48 CFR) FAR 9.507-1, or a clause in accordance with (48 CFR) FAR 9.507-2... either an actual or potential organizational conflict of interest with respect to this contract, it shall... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Organizational...

  4. 48 CFR 2052.209-72 - Contractor organizational conflicts of interest.

    2010-10-01

    ... does not have any organizational conflicts of interest as defined in 48 CFR 2009.570-2. (2) The... defined in 48 CFR 2009.570-2 in the activities covered by this clause. (c) Work for others. (1... contract have been met. (f) Subcontracts. Except as provided in 48 CFR 2009.570-2, the contractor...

  5. Tank 241-AP-105, cores 208, 209 and 210, analytical results for the final report

    This document is the final laboratory report for Tank 241-AP-105. Push mode core segments were removed from Risers 24 and 28 between July 2, 1997, and July 14, 1997. Segments were received and extruded at 222-S Laboratory. Analyses were performed in accordance with Tank 241-AP-105 Push Mode Core Sampling and Analysis Plan (TSAP) (Hu, 1997) and Tank Safety Screening Data Quality Objective (DQO) (Dukelow, et al., 1995). None of the subsamples submitted for total alpha activity (AT), differential scanning calorimetry (DSC) analysis, or total organic carbon (TOC) analysis exceeded the notification limits as stated in TSAP and DQO. The statistical results of the 95% confidence interval on the mean calculations are provided by the Tank Waste Remediation Systems Technical Basis Group, and are not considered in this report. Appearance and Sample Handling Two cores, each consisting of four segments, were expected from Tank 241-AP-105. Three cores were sampled, and complete cores were not obtained. TSAP states core samples should be transported to the laboratory within three calendar days from the time each segment is removed from the tank. This requirement was not met for all cores. Attachment 1 illustrates subsamples generated in the laboratory for analysis and identifies their sources. This reference also relates tank farm identification numbers to their corresponding 222-S Laboratory sample numbers

  6. 34 CFR 300.209 - Treatment of charter schools and their students.

    2010-07-01

    ... schools that are public schools of the LEA. (1) In carrying out Part B of the Act and these regulations with respect to charter schools that are public schools of the LEA, the LEA must— (i) Serve children... the site to its other public schools; and (ii) Provide funds under Part B of the Act to those...

  7. 7 CFR 1710.209 - Approval requirements for load forecast work plans.

    2010-01-01

    ... approved work plan represents a commitment by a power supply borrower and its members, or by a large... the majority of the members that are borrowers. (j) The borrower's board of directors must approve...

  8. Statistical mapping of sheet aiquile SE-20-9 (national map) making use of ERTS images

    Torrez, J. G.; Brockman, C. E.; Castro, A. F.

    1977-01-01

    New possibilities of remote sensing by means of satellites to do research on natural resources are reported. These images make it possible to carry out integrated studies of natural resources in the shortest time possible and with small investments. Various maps and a complete description of each are included. With the use of these satellites, scientists can hopefully plan development projects at the national level.

  9. 49 CFR 1542.209 - Fingerprint-based criminal history records checks (CHRC).

    2010-10-01

    ... certification to an airport operator pursuant to paragraph (n) of this section, or 14 CFR 108.31(n) in effect prior to November 14, 2001 (see 14 CFR Parts 60 to 139 revised as of January 1, 2001). An airport user... disqualifying criminal offense. (iii) A statement informing the individual that Federal regulations under 49...

  10. The Mars Hand Lens Imager (MAHLI) for the 209 Mars Science Laboratory

    Edgett, K. S.; Bell, J. F., III; Herkenhoff, K. E.; Heydari, E.; Kah, L. C.; Minitti, M. E.; Olson, T. S.; Rowland, S. K.; Schieber, J.; Sullivan, R. J.

    2005-01-01

    The MArs Hand Lens Imager (MAHLI) is a small, RGB-color camera designed to examine geologic material at 12.5-75 microns/pixel resolution at the Mars Science Laboratory (MSL) landing site. MAHLI is a PI-led investigation competitively selected by NASA in December 2004 as part of the science payload for the MSL rover launching in 2009. The instrument is being fabricated by, and will be operated by, Malin Space Science Systems of San Diego, California.

  11. 20 CFR 209.6 - Employers' notice of death of employees.

    2010-04-01

    ... employees. Each employer shall notify the Board immediately of the death of an employee who, prior to the employee's death, performed compensated service which has not been reported to the Board. (Approved by the Office of Management and Budget under control number 3220-0005)...

  12. 48 CFR 3052.209-75 - Prohibited financial interests for lead system integrators.

    2010-10-01

    ... interests for lead system integrators. As prescribed in (HSAR) 48 CFR 3009.570-4(b), use the following clause: PROHIBITED FINANCIAL INTERESTS FOR LEAD SYSTEM INTEGRATORS (JUL 2010) (a) Definitions. As used in... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Prohibited...

  13. 7 CFR 1486.209 - How are program applications evaluated and approved?

    2010-01-01

    ... various constraints to U.S. exports, including sanitary and phytosanitary issues and other non-tariff barriers; (v) Assessments and follow-up activities designed to improve country-wide food and...

  14. 48 CFR 252.209-7005 - Reserve Officer Training Corps and military recruiting on campus.

    2010-10-01

    ... following information pertaining to students (who are 17 years of age or older) enrolled at that institution.... (vi) Academic major. (vii) Degrees received. (viii) Most recent educational institution enrollment. (c... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Reserve Officer...

  15. Generator method of 225Ac production without a carrier for nuclear medicine

    The two-steps isotope generator scheme of 225Ac production from 229Th has been developed. The first step is used for separation of thorium, actinium, radium and daughter decay products (DDP), and removals of parent radionuclide. The second step provides additional separation of actinium from traces of radium and DDP, and conversion of actinium in the nitrate form. The chosen solutions provide optimal conditions for carry out of process. The yield of the 225Ac was 99.9% at minimal losses of parent 229Th (less than 0.1%)

  16. Astatine-211 Pathway from Radiochemistry to Clinical Investigation

    Particularly in clinical settings where tumour burden is low and cancers are located in close proximity to essential normal tissue structures, α-particle emitting radionuclides can offer significant advantages for targeted radionuclide therapy. One of the first alpha emitters to be evaluated for this purpose is the 7.2-h half-life radiohalogen Astatine-211 (211At). From a commercialization-potential perspective 211At, is less appealing than the longer half-life alpha particle emitters Radium-223, Actinium-225 and Thorium-227, which have become the focus of many laboratories. However, if methods for providing a better supply of 211At could be developed, this alpha emitter would be the radionuclide of choice for many potential therapeutic applications. With regard to the production of 211At, this can be readily be accomplished by bombarding natural bismuth targets with 28−29.5 MeV alpha particles via the 209Bi(α,2n)211At reaction. The goal is to utilize an alpha particle beam energy that provides the required balance for maximizing 211At production while minimizing creation of 210At, which is problematic because of its 138.4-day half life alpha-particle emitting daughter, 210Po. For most intended clinical applications, alpha particle beam energy of about 29 MeV offers the best compromise between maximizing yield and providing 211At with sufficient radionuclidic purity for clinical use. Clinically relevant levels of 211At have been produced at several institutions using both internal and external cyclotron targets

  17. 18 CFR 376.209 - Procedures during periods of emergency requiring activation of the Continuity of Operations Plan.

    2010-04-01

    ... on requests to ensure continued construction of essential natural gas facilities with sensitive construction timelines, on Commencement of Service requests, and on completion of dam safety work, in a manner... major wire services, industry press, and appropriate metropolitan area radio stations announcing...

  18. Fission of 209Bi, natPb and 197Au in the particle field of a fast accelerator driven system

    Highlights: ► Fission rates of Bi, Pb and Au were measured in a particle field similar to that of fast ADS. ► The experimental results on fission rates are in agreement with MCNPX calculations. ► The most up to date fission cross-sections and related parameterizations were used. ► New parameterizations were produced from the published cross-section data. - Abstract: Accelerator driven systems (ADS) are expected to have particle spectra of significantly greater energy range than that of current power reactors. The Energy plus Transmutation (EpT) set-up of the Joint Institute for Nuclear Research, Dubna, Russia, is designed to emulate the neutron spectrum in a fast ADS through the use of a spallation target surrounded by a blanket of natural uranium. The spectrum is further modified by a reflective layer of polyethylene and an internal absorbing layer of cadmium. The spallation target of EpT was irradiated with a beam of 4 GeV deuterons, and the fission rates of bismuth, lead and gold samples, placed in the target-blanket region were recorded using a fission track detector technique. The fission rates were also calculated using the MCNPX Monte Carlo code with the INCL4 cascade model and cross sections for nucleon induced fission obtained from literature. Agreement between the measured and calculated results indicates the model’s ability to predict the particle spectra and spatial distribution

  19. Q- and Z-dependence of angular momentum transfer in deeply inelastic collisions of 86Kr with 209Bi

    The dependence of the in-plane and out-of-plane angular correlations of fragments from fissioning heavy products on the kinetic energy and Z of the light reaction partner have been measured. From the dependence of the angular correlations on Q-value and hence energy loss, together with existing data from which the total angular-integrated cross section as a function of energy loss can be extracted, the dependence of the angular momentum transferred to the heavy product on the initial orbital angular momentum or impact parameter has been determined. The resulting dependence is qualitatively consistent with the sticking limit for a reaction intermediate of touching deformed fragments. More specific nuclear models generally underestimate the angular momentum transfer, although the one-body proximity-friction model accounts for the major fraction of the angular momentum transfer. A recent model incorporating both one-body proximity friction and collective excitations accounts quite well for the observed angular momentum transfer. The Z-dependence of the anisotropy shows the importance of angular momentum fractionation for the less probable events, where the Z of the fissioning system is appreciably less than that of the target. The transferred angular momentum is shown to be fairly strongly aligned along the perpendicular to the reaction plane, with alignment values of 0.6 to 0.8. The component of angular momentum not along the perpendicular to the reaction plane is found to be primarily oriented perpendicular rather than parallel to the recoil directions. The absolute fission probabilities are found to be qualitatively consistent with J-dependent calculations using the J-values deduced from the angular correlations. (Auth.)

  20. 76 FR 16526 - Airworthiness Directives; Pratt & Whitney JT8D-209, -217, -217A, -217C, and -219 Series Turbofan...

    2011-03-24

    .../stage 4 LPT turbine blades shroud wear and subsequent high-cycle fatigue. They suggested that the... stage and 4th stage low- pressure turbine (LPT) blades for shroud notch wear and replacement of the... prevent turbine blade failures that could result in uncontained engine debris and damage to the...

  1. Oahu Photomosaic 2000 (208-209-0516) - Orthorectification and Mosaicing of Color Aerial Photography Main Eight Hawaiian Islands

    National Oceanic and Atmospheric Administration, Department of Commerce — Habitat maps of the main Hawaiian Islands were created by visual interpretation of aerial photos and hyperspectral imagery using the Habitat Digitizer extension....

  2. 49 CFR Appendix A to Part 209 - Statement of Agency Policy Concerning Enforcement of the Federal Railroad Safety Laws

    2010-10-01

    ... transportation. E.g., 49 CFR 214.3 (railroad workplace safety). By “general railroad system of transportation..., steam locomotives, and grade crossing signals apply to these non-insular tourist operations (see 49 CFR... the rapid transit line are considered a “rail fixed guideway system” under 49 CFR Part 659,...

  3. SU-E-J-209: Geometric Distortion at 3T in a Commercial 4D MRI-Compatible Phantom

    Fatemi-Ardekani, A; Wronski, M; Kim, A; Stanisz, G; Sarfehnia, A; Keller, B [Sunnybrook Health Sciences Centre, Toronto, ON (Canada)

    2015-06-15

    Purpose: There are very few commercial 4D phantoms that are marketed as MRI compatible. We are evaluating one such commercial phantom, made to be used with an MRI-Linear accelerator. The focus of this work is to characterize the geometric distortions produced in this phantom at 3T using 3 clinical MR pulse sequences. Methods: The CIRS MRI-Linac Dynamic Phantom (CIRSTM) under investigation in this study consists of a softwaredriven moving tumour volume within a thorax phantom body and enables dose accumulation by placing a dosimeter within the tumour volume. Our initial investigation is to evaluate the phantom in static mode prior to examining its 4D capability. The water-filled thorax phantom was scanned using a wide-bore Philips 3T Achieva MRI scanner employing a Thoracic xl coil and clinical 2D T1W FFE, 2D T1W TSE and 3D T1W TFE pulse sequences. Each of the MR image sets was rigidly fused with a reference CT image of the phantom employing a rigid registration with 6 degrees of freedom. Geometric distortions between the MR and CT image sets were measured in 3 dimensions at selected points along the periphery of the distortion grid embedded within the phantom body (11.5, 7.5 and 3 cm laterally, ant/post and sup/inf of magnetic isocenter respectively). Results: The maximal measured geometric distortions between the MR and reference CT points of interest were 0.9, 1.8 and 1.3 mm in the lateral, anteriorposterior and cranio-caudal directions, respectively. For all 3 spatial dimensions, the maximal distortions occurred for the FFE pulse sequence. Maximal distortions for the 2D FFE, 2D TSE and 3D TFE sequences were 1, 0.7 and 1.8 mm, respectively. Conclusion: Our initial static investigation of this phantom shows minimal geometric distortions at 3T along the periphery of the embedded grid. CIRS has provided us with a phantom at no charge for evaluation at 3 Tesla.

  4. 44 CFR 206.209 - Arbitration for Public Assistance determinations related to Hurricanes Katrina and Rita (Major...

    2010-10-01

    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Arbitration for Public Assistance determinations related to Hurricanes Katrina and Rita (Major disaster declarations DR-1603, DR... determinations related to Hurricanes Katrina and Rita (Major disaster declarations DR-1603, DR-1604, DR-1605,...

  5. Orthorectification and Mosaicing of Color Aerial Photographyfor the Main Eight Hawaiian Islands: Oahu (208-209-0516)

    National Oceanic and Atmospheric Administration, Department of Commerce — This project is a cooperative effort among the National Ocean Service, National Centers for Coastal Ocean Science, Center for Coastal Monitoring and Assessment; the...

  6. 75 FR 51332 - Eleventh Meeting: RTCA Special Committee 209: In Joint Session With EUROCAE WG-49: ATCRBS/Mode S...

    2010-08-19

    ...) Review of the Status of Open Action Items AI-10-11--Review of Documents for P5 Pulse Position Differences (WP11-03) AI-10-03--Issues Related to Zeroing Registers 08 16 & 20 16 (WP11-04) AI-10-02--Register 60 16 Maximum Update Interval Changes (WP11-05) AI-10-01--Errata for Register 60 16 for GPS Data Input...

  7. 33 CFR 209.325 - Navigation lights, aids to navigation, navigation charts, and related data policy, practices and...

    2010-07-01

    ... greater (ENG Form 4020-R). (ii) For channels 100 to 400 feet wide (ENG Form 4021-R). Name of channel Date... Channel 3-78 300 1.14 26 24 23 26 Whitehall Channel 3-78 200 1.81 26 27 26 25 ENG FORM 4021-R (Jul...

  8. 48 CFR 3052.209-76 - Prohibition on Federal Protective Service guard services contracts with business concerns owned...

    2010-10-01

    ... or business ethics and that an award would be consistent with the mission of FPS. The business... longer calls into question the individual or business concern's integrity or business ethics and that an... by an individual convicted of a felony. As prescribed at (HSAR) 48 CFR 3009.171-9, insert...

  9. AB209. The effect of 4-week pedometer and sleep monitoring programme on asthenospermia patients in information technology workers: a prospective study

    Gao, Ming; Wang, Lei; Liu, Xiang; Sun, Jianhua

    2016-01-01

    Objective In China, information technology (IT) workers face many health problems as a result of the nature of work by computer. For instance, IT workers often work overtime and irregular life (such as staying up late, sedentary, lack of exercise, etc.), IT related occupational diseases are more and more. There are many asthenospermia patients in IT workers in clinic, how to improve sperm-related outcomes of them is a problem for us. Using real-time pedometer and sleep monitoring is an innova...

  10. NHEXAS PHASE I REGION 5 STUDY--STANDARD OPERATING PROCEDURE--NHEXAS PILOT FIELD STUDY SCRIPTING AND LOGISTICS (RTI/ACS-AP-209-080)

    This protocol provides an overview of the schedule, scripting, and logistics for home visits conducted in the NHEXAS Region 5 study. By its nature, this protocol provides a general description of these activities, since the actual schedule was subject to change due to outside cir...

  11. Short pulse-width gain-switched Ho:YAG ceramic laser at ∼2.09  μm.

    Zhang, Jianing; Liu, QiYao; Shen, Deyuan; Zhang, Jian; Tang, Dingyuan; Chen, Hao

    2016-03-10

    This paper presents a short pulse-width gain-switched Ho:YAG ceramic laser at 2089 nm resonantly pumped by a homemade Q-switched Tm:fiber laser at ∼1908  nm. We generated stable pulses of 44-103 ns duration and 0.13-2 kW peak power at 20 kHz of pulse repetition frequency when the incident pump pulse energy increased from ∼0.1 to 0.3 mJ. We also obtained an average output power of 1.76 W under an incident pump power of 6 W, corresponding to a slope efficiency of 41.8%. Finally, this paper discusses the prospects to further improve the results with even a shorter pulse-width and higher peak power. PMID:26974778

  12. Correlations between Polarisation States of W Particles in the Reaction $e^- e^+\\to W^- W^+$ at LEP2 Energies 189-209 GeV

    Abdallah, J; Adam, W; Adzic, P; Albrecht, T; Alemany-Fernandez, R; Allmendinger, T; Allport, P P; Amaldi, U; Amapane, N; Amato, S; Anashkin, E; Andreazza, A; Andringa, S; Anjos, N; Antilogus, P; Apel, W-D; Arnoud, Y; Ask, S; Åsman, B; Augustin, J E; Augustinus, A; Baillon, P; Ballestrero, A; Bambade, P; Barbier, R; Bardin, D; Barker, G J; Baroncelli, A; Battaglia, M; Baubillier, M; Becks, K-H; Begalli, M; Behrmann, A; Ben-Haim, E; Benekos, N; Benvenuti, A; Bérat, C; Berggren, M; Bertrand, D; Besançon, M; Besson, N; Bloch, D; Blom, M; Bluj, M; Bonesini, M; Boonekamp, M; Booth, P S L; Borisov, G; Botner, O; Bouquet, B; Bowcock, T J V; Boyko, I; Bracko, M; Brenner, R; Brodet, E; Brückman, P; Brunet, J M; Buschbeck, B; Buschmann, P; Calvi, M; Camporesi, T; Canale, V; Carena, F; Castro, N; Cavallo, F; Chapkin, M; Charpentier, Ph; Checchia, P; Chierici, R; Chliapnikov, P V; Chudoba, J; Chung, S U; Cieslik, K; Collins, P; Contri, R; Cosme, G; Cossutti, F; Costa, M J; Crennell, D J; Cuevas-Maestro, J; D'Hondt, J; Da Silva, T; Da Silva, W; Della Ricca, G; De Angelis, A; de Boer, Wim; De Clercq, C; De Lotto, B; De Maria, N; De Min, A; De Paula, L; Di Ciaccio, L; Di Simone, A; Doroba, K; Drees, J; Eigen, G; Ekelöf, T J C; Ellert, M; Elsing, M; Espirito-Santo, M C; Fanourakis, G K; Fassouliotis, D; Feindt, M; Fernández, J; Ferrer, A; Ferro, F; Flagmeyer, U; Föth, H; Fokitis, E; Fulda-Quenzer, F; Fuster, J; Gandelman, M; García, C; Gavillet, Ph; Gazis, E; Gokieli, R; Golob, B; Gómez-Ceballos, G; Gonçalves, P; Graziani, E; Grosdidier, G; Grzelak, K; Guy, J; Haag, C; Hallgren, A; Hamacher, K; Hamilton, K; Haug, S; Hauler, F; Hedberg, V; Hennecke, M; Hoffman, J; Holmgren, S-O; Holt, P J; Houlden, M A; Jackson, J N; Jarlskog, G; Jarry, P; Jeans, D; Johansson, E K; Jonsson, P; Joram, C; Jungermann, L; Kapusta, F; Katsanevas, S; Katsoufis, E; Kernel, G; Kersevan, B P; Kerzel, U; King, B T; Kjaer, N J; Kluit, P; Kokkinias, P; Kourkoumelis, C; Kuznetsov, O; Krumshtein, Z; Kucharczyk, M; Lamsa, J; Leder, G; Ledroit, F; Leinonen, L; Leitner, R; Lemonne, J; Lepeltier, V; Lesiak, T; Liebig, W; Liko, D; Lipniacka, A; Lopes, J H; López, J M; Loukas, D; Lutz, P; Lyons, L; MacNaughton, J; Malek, A; Maltezos, S; Mandl, F; Marco, J; Marco, R; Maréchal, B; Margoni, M; Marin, J-C; Mariotti, C; Markou, A; Martínez-Rivero, C; Masik, J; Mastroyiannopoulos, N; Matorras, F; Matteuzzi, C; Mazzucato, F; Mazzucato, M; McNulty, R; Meroni, C; Migliore, E; Mitaroff, W A; Mjörnmark, U; Moa, T; Moch, M; Mönig, K; Monge, R; Montenegro, J; Moraes, D; Moreno, S; Morettini, P; Müller, U; Münich, K; Mulders, M; Mundim, L; Murray, W; Muryn, B; Myatt, G; Myklebust, T; Nassiakou, M; Navarria, F; Nawrocki, K; Némécek, S; Nicolaidou, R; Nikolenko, M; Oblakowska-Mucha, A; Obraztsov, V F; Olshevski, A; Onofre, A; Orava, R; Österberg, K; Ouraou, A; Oyanguren, A; Paganoni, M; Paiano, S; Palacios, J P; Palka, H; Papadopoulou, Th D; Pape, L; Parkes, C; Parodi, F; Parzefall, U; Passeri, A; Passon, O; Peralta, L; Perepelitsa, V; Perrotta, A; Petrolini, A; Piedra, J; Pieri, L; Pierre, F; Pimenta, M; Piotto, E; Podobnik, T; Poireau, V; Pol, M E; Polok, G; Pozdnyakov, V; Pukhaeva, N; Pullia, A; Radojicic, D; Rebecchi, P; Rehn, J; Reid, D; Reinhardt, R; Renton, P B; Richard, F; Rídky, J; Rivero, M; Rodríguez, D; Romero, A; Ronchese, P; Roudeau, P; Rovelli, T; Ruhlmann-Kleider, V; Ryabtchikov, D; Sadovskii, A; Salmi, L; Salt, J; Sander, C; Savoy-Navarro, A; Schwickerath, U; Sekulin, R; Siebel, M; Sisakian, A; Smadja, G; Smirnova, O; Sokolov, A; Sopczak, A; Sosnowski, R; Spassoff, Tz; Stanitzki, M; Stocchi, A; Strauss, J; Stugu, B; Szczekowski, M; Szeptycka, M; Szumlak, T; Tabarelli de Fatis, T; Tegenfeldt, F; Timmermans, J; Tkatchev, L; Tobin, M; Todorovova, S; Tomé, B; Tonazzo, A; Tortosa, P; Travnicek, P; Treille, D; Tristram, G; Trochimczuk, M; Troncon, C; Turluer, M-L; Tyapkin, I A; Tyapkin, P; Tzamarias, S; Uvarov, V; Valenti, G; van Dam, P; Van Eldik, J; Van Remortel, N; Van Vulpen, I; Vegni, G; Veloso, F; Venus, W; Verdier, P; Verzi, V; Vilanova, D; Vitale, L; Vrba, V; Wahlen, H; Washbrook, A J; Weiser, C; Wicke, D; Wickens, J; Wilkinson, G; Winter, M; Witek, M; Yushchenko, O; Zalewska-Bak, A; Zalewski, P; Zavrtanik, D; Zhuravlov, V; Zimin, N I; Zintchenko, A; Zupan, M

    2009-01-01

    In a study of the reaction e-e+ -> W-W+ with the DELPHI detector, the probabilities of the two W particles occurring in the joint polarisation states transverse-transverse (TT), longitudinal-transverse plus transverse-longitudinal (LT) and longitudinal-longitudinal (LL) have been determined using the final states WW -> l nu q qbar (l = e, mu). The two-particle joint polarisation probabilities, i.e. the spin density matrix elements rho_TT, rho_LT, rho_LL, are measured as functions of the W- production angle, theta_W-, at an average reaction energy of 198.2 GeV. Averaged over all cos(theta_W-), the following joint probabilities are obtained: rho_TT = (67 +/- 8)%, rho_LT = (30 +/- 8)%, rho_LL = (3 +/- 7)% . These results are in agreement with the Standard Model predictions of 63.0%, 28.9% and 8.1%, respectively. The related polarisation cross-sections sigma_TT, sigma_LT and sigma_LL are also presented.

  13. American Recovery and Reinvestment Act (ARRA) - FEMP Technical Assistance - Federal Aviation Administration - Project 209 - Control Tower and Support Building, Boise, Idaho

    Arends, J.; Sandusky, William F.

    2010-06-28

    This report documents an energy audit performed by Pacific Northwest National Laboratory (PNNL) and Redhorse Corporation (Redhorse) conducted on the Federal Aviation Administration (FAA) control tower and base building in Boise, Idaho. This report presents findings of the energy audit team that evaluated construction documents and operating specifications (at the 100% level) followed by a site visit of the facility under construction. The focus of the review was to identify measures that could be incorporated into the final design and operating specifications that would result in additional energy savings for FAA that would not have otherwise occurred.

  14. Study of Multiphoton Final States and Tests of QED in $e^+ e^-$ collisions at $\\sqrt{s}$ up to 209 GeV

    Achard, P; Aguilar-Benítez, M; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alviggi, M G; Anderhub, H; Andreev, V P; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Bajo, A; Baksay, G; Baksay, L; Baldew, S V; Banerjee, S; Banerjee, Sw; Barczyk, A; Barillère, R; Bartalini, P; Basile, M; Batalova, N; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Bellucci, L; Berbeco, R; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Biasini, M; Biglietti, M; Biland, A; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böhm, A; Boldizsar, L; Borgia, B; Bottai, S; Bourilkov, D; Bourquin, Maurice; Braccini, S; Branson, J G; Brochu, F; Burger, J D; Burger, W J; Cai, X D; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A M; Casaus, J; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada, M; Chamizo-Llatas, M; Chang, Y H; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chiefari, G; Cifarelli, Luisa; Cindolo, F; Clare, I; Clare, R; Coignet, G; Colino, N; Costantini, S; de la Cruz, B; Cucciarelli, S; van Dalen, J A; De Asmundis, R; Déglon, P L; Debreczeni, J; Degré, A; Deiters, K; Della Volpe, D; Delmeire, E; Denes, P; De Notaristefani, F; De Salvo, A; Diemoz, M; Dierckxsens, M; Dionisi, C; Dittmar, Michael; Doria, A; Dova, M T; Duchesneau, D; Echenard, B; Eline, A; El-Mamouni, H; Engler, A; Eppling, F J; Ewers, A; Extermann, Pierre; Falagán, M A; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, Marta; Ferguson, T; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Fisher, W; Fisk, I; Forconi, G; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gataullin, M; Gentile, S; Giagu, S; Gong, Z F; Grenier, G; Grimm, O; Grünewald, M W; Guida, M; van Gulik, R; Gupta, V K; Gurtu, A; Gutay, L J; Haas, D; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Hirschfelder, J; Hofer, H; Hohlmann, M; Holzner, G; Hou, S R; Hu, Y; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Käfer, D; Kaur, M; Kienzle-Focacci, M N; Kim, J K; Kirkby, Jasper; Kittel, E W; Klimentov, A; König, A C; Kopal, M; Koutsenko, V F; Kräber, M H; Krämer, R W; Krenz, W; Krüger, A; Kunin, A; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Le Goff, J M; Leiste, R; Levchenko, P M; Li, C; Likhoded, S A; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lü, Y S; Lübelsmeyer, K; Luci, C; Luminari, L; Lustermann, W; Ma Wen Gan; Malgeri, L; Malinin, A; Maña, C; Mangeol, D J J; Mans, J; Martin, J P; Marzano, F; Mazumdar, K; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Mihul, A; Milcent, H; Mirabelli, G; Mnich, J; Mohanty, G B; Muanza, G S; Muijs, A J M; Musicar, B; Musy, M; Nagy, S; Natale, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Niessen, T; Nisati, A; Nowak, H; Ofierzynski, R A; Organtini, G; Palomares, C; Pandoulas, D; Paolucci, P; Paramatti, R; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Pedace, M; Pensotti, S; Perret-Gallix, D; Petersen, B; Piccolo, D; Pierella, F; Pioppi, M; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Pothier, J; Prokofiev, D O; Prokofev, D; Quartieri, J; Rahal-Callot, G; Rahaman, M A; Raics, P; Raja, N; Ramelli, R; Rancoita, P G; Ranieri, R; Raspereza, A V; Razis, P A; Ren, D; Rescigno, M; Reucroft, S; Riemann, S; Riles, K; Roe, B P; Romero, L; Rosca, A; Rosier-Lees, S; Roth, S; Rosenbleck, C; Roux, B; Rubio, Juan Antonio; Ruggiero, G; Rykaczewski, H; Sakharov, A; Saremi, S; Sarkar, S; Salicio, J; Sánchez, E; Sanders, M P; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Schopper, Herwig Franz; Schotanus, D J; Schwering, G; Sciacca, C; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shumilov, E; Shvorob, A V; Siedenburg, T; Son, D; Spillantini, P; Steuer, M; Stickland, D P; Stoyanov, B; Strässner, A; Sudhakar, K; Sultanov, G G; Sun, L Z; Sushkov, S V; Suter, H; Swain, J D; Szillási, Z; Tang, X W; Tarjan, P; Tauscher, Ludwig; Taylor, L; Tellili, B; Teyssier, D; Timmermans, C; Ting, Samuel C C; Ting, S M; Tonwar, S C; Tóth, J; Tully, C; Tung, K L; Ulbricht, J; Valente, E; Van de Walle, R T; Veszpremi, V; Vesztergombi, G; Vetlitskii, I; Vicinanza, D; Viertel, Gert M; Villa, S; Vivargent, M; Vlachos, S; Vodopyanov, I; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Wadhwa, M; Wallraff, W; Wang, X L; Wang, Z M; Weber, M; Wienemann, P; Wilkens, H; Wynhoff, S; Xia, L; Xu, Z Z; Yamamoto, J; Yang, B Z; Yang, C G; Yang, H J; Yang, M; Yeh, S C; Zalite, A; Zalite, Yu; Zhang, Z P; Zhao, J; Zhu, G Y; Zhu, R Y; Zhuang, H L; Zichichi, A; Zilizi, G; Zimmermann, B; Zöller, M

    2002-01-01

    The process e+ e- -> n gamma with n>=2 is studied at centre-of-mass energies ranging from \\root(s)=192 to 208 GeV. The data sample corresponds to a total integrated luminosity of 427 1/pb. The total and differential cross sections are found to be in agreement with the QED expectations. Using all the data collected with the L3 detector above the Z pole, limits on deviations from QED, excited electrons, contact interactions, extra space dimensions and excited spin-3/2 leptons are set.

  15. Rendimento de óleo essencial de Salvia officinalis L. sob ação de reguladores vegetais - DOI: 10.4025/actascibiolsci.v28i3.209 Essential oil yield in Salvia officinallis L. under the action of plant growth regulators - DOI: 10.4025/actascibiolsci.v28i3.209

    Elizabeth Orika Ono

    2007-11-01

    Full Text Available O objetivo deste trabalho foi avaliar o efeito de diferentes reguladores vegetais no rendimento do óleo essencial de plantas de Salvia officinalis L. O experimento foi conduzido em casa de vegetação e o delineamento experimental foi inteiramente casualizado, consistindo em cinco tratamentos com três repetições cada. Os tratamentos consistiram na aplicação de ácido giberélico (GA3, benzilaminopurina (BAP e ácido 2- cloroetil-fosfônico (ethephon e Stimulate a 2%, comparados com plantas controle (água. A pulverização, via foliar, dos reguladores vegetais foram realizadas em três épocas, aos 15, 25 e 35 dias após o transplante de plântulas previamente germinadas em câmaras de germinação a 25ºC e luz constante. A produção de massa seca da parte aérea e rendimento do óleo essencial foi avaliada aos 131 dias após o transplante. A parte aérea das plantas foi seca em estufa a 35ºC determinando a massa seca e a extração do óleo foi realizada pelo método de hidrodestilação, determinando o volume de óleo. Plantas tratadas com GA3 e Stimulate apresentaram incrementos no teor de óleo essencial, enquanto que as plantas tratadas com BAP e ethephon apresentaram diminuição no volume de óleo essencial comparado às plantas controle.This study aimed to evaluate the effect of different plant growth regulators on essential oil yield in Salvia officinalis L. plants. The experiment was held in a greenhouse and the experimental design was completely randomized, with 5 treatments and three replications. The Treatments consisted in the application of gibberellic acid (GA3, benzylaminopurine (BAP, 2-chloroethyl phosphonic acid (ethephon, and Stimulate at 2%, compared with control plants (water. Applications of plant growth regulators were performed in three consecutive periods, in turn, 15, 25 and 35 days after transplanting of seeding germinating in the light at 25ºC. The dry mass yield of the aerial part and the oil essential content were determined 131 days after the transplant. The aerial part of the plants was dried in an oven at 35ºC; after dry mass determination, the oil was extracted by hydrodistillation and its volume was determined. Plants treated with GA3 and Stimulate showed increase in essential oil content, while plants treated with BAP and ethephon showed decrease in essential oil volume when compared with the control plants.

  16. I. The metabolic properties of plutonium and allied materials

    Hamilton, J.G.

    1948-05-24

    This report on the metabolic properties of plutonium and related radioactive materials presents experimental information in the following areas: radioautographic studies; tracer studies (with tables of accumulation in tissues) of actinium, radio-zirconium, technetium, radio-rubidium, radio-germanium, beryllium, and cadmium; decontamination and bone metabolism studies; and radio-chemical isolation.

  17. Iceland and mid-ocean ridges : S. Björnsson (editor). Vísindafélag Islendinga, Reykjavik, 1967, 209 pp., 65 illus., U.S. $8.50

    Rutten, M.G.

    1968-01-01

    Although the quality of the papers is high and the insights obtained are rewarding and modern, I should have still preferred the inclusion of some more factual data. For instance, in Gudmundur Sigwaldason’s paper on the chemistry of basalts, the 43 analyses known are promised, but not produced. In K

  18. Elastic magnetic scattering of electrons, and radial distribution of valence nucleons. Study of the magnetisation of 49Ti, 51V, 59Co, 87Sr, 93Nb and 209Bi nuclei

    After an introduction on the use of elastic scattering of electrons, of magnetic scattering, and of their combination, this research thesis describes the theoretical framework of electron magnetic scattering, and the properties of the highest multi-poles. The author then presents the experimental installation, describes the experimental procedure from data acquisition to the derivation of final form factors. These form factors are then analysed and interpreted with respect to valence wave forms. Experimental and analysis results are compared with results of three different Hartree-Fock calculations. The limitations of these interpretations and theoretical calculations are discussed, notably by reference to the most recent calculations on core polarisation and on meson exchange currents. Results are also compared with those of other experiments

  19. Handbook of RF, Microwave, and Millimeter-Wave Components. Edited by Leonid A. Belov, Sergey M. Smolskiy and Victor N. Kochemasov, Artech House, 2012; 504 pages. Price: £119.00, ISBN 978-1-60807-209-5

    Shu-Kun Lin

    2013-01-01

    Full Text Available This unique and comprehensive resource offers you a detailed treatment of the operations principles, key parameters, and specific characteristics of active and passive RF, microwave, and millimeter-wave components. The book covers both linear and nonlinear components that are used in a wide range of application areas, from communications and information sciences, to avionics, space, and military engineering.

  20. Maternal glycated haemoglobin, pre-gestational weight, pregnancy weight gain and risk of large-for-gestational-age babies: a Danish cohort study of 209 singleton Type 1 diabetic pregnacies

    Nielsen, G.L.; Dethlefsen, Claus; Møller, M.;

    2007-01-01

    Aims To examine the association between maternal glycated haemoglobin in the second half of diabetic pregnancies and the relative risk of delivering large-for-gestational-age (LGA) babies, controlling for maternal body mass index (BMI) before pregnancy, weight gain, age, White class and smoking...... habits. Methods We identified all pregnant diabetic women in North Jutland County, Denmark from 1985 to 2003. Data on HbA1c values from the 20th gestational week to term were collected from medical records and the babies were classified as large, normal or small for gestational age. The association...

  1. Information Literacy Programs and Research: Reflections on "Information Literacy Programs and Research: An International Review" by Christine Bruce. 2000. "The Australian Library Journal" 49 no. 3: 209-218.

    Bruce, Christine

    2011-01-01

    Although in the late 1990s there was much discussion as to whether the idea of information literacy was necessary or had longevity, global interest in the phenomenon has increased rather than diminished. Information literacy standards have been developed and become widely accepted in educational systems. Research centres for information literacy…

  2. Multibeam collection for KN209-02: Multibeam data collected aboard Knorr from 2012-10-16 to 2012-11-09, departing from Ponta Delgada, Azores and returning to Charleston, SC

    National Oceanic and Atmospheric Administration, Department of Commerce — This data set is part of a larger set of data called the Multibeam Bathymetry Database (MBBDB) where other similar data can be found at...

  3. Sorption studies of radioelements on geological materials

    Batch sorption experiments have been carried out to study the sorption of uranium, technetium, curium, neptunium, actinium, protactinium, polonium, americium and plutonium onto bentonite, granodiorite and tuff. Mathematical modelling using the HARPHRQ program and the HATCHES database was carried out to predict the speciation of uranium and technetium in the equilibrated seawater, and neptunium, americium and plutonium in the rock equilibrated water. Review of the literature for thermodynamic data for curium, actinium, protactinium and polonium was carried out. Where sufficient data were available, predictions of the speciation and solubility were made. This report is a summary report of the experimental work conducted by AEA Technology during April 1991-March 1998, and the main results have been presented at Material Research Society Symposium Proceedings and published as proceedings of them. (author)

  4. Investigation for determining the retention properties of rock over the ASSE II mine for dissolved radionuclides

    For a model consideration of groundwater movement and the associated transport of dissolved substance in deep groundwater, the retention properties of the ASSE II mine for radionuclides dissolved in water were determined. A series of properties of rocks were examined and described for this purpose. Apart from the chemical, mineralogical and petrophysical characteristics of the rocks, the retention was determined by 3 different methods and stated in the form of distribution coefficients for specific elements. A comparison of the results of vibration and diffusion experiments gave good agreement, while the results in through column experiments only reached the same order of magnitude after an expensive determination with the aid of a place concentration distribution. The distribution coefficients for the elements carbon, selenium, strontium, technetium, iodine, caesium, lead, radium, actinium, proto-actinium, uranium, neptunium, plutonium, americium and curium are listed and collected for model rock packages. (orig./HP)

  5. Sorption studies of radioelements on geological materials

    Berry, J. A; 油井 三和; 北村 暁

    2007-01-01

    Batch sorption experiments have been carried out to study the sorption of uranium, technetium, curium, neptunium, actinium, protactinium, polonium, americium and plutonium onto bentonite, granodiorite and tuff. Mathematical modelling using the HARPHRQ program and the HATCHES database was carried out to predict the speciation of uranium and technetium in the equilibrated seawater, and neptunium, americium and plutonium in the rock equilibrated water. Review of the literature for thermodynamic ...

  6. Purification of cerium, neodymium and gadolinium for low background experiments

    Boiko R.S.; Barabash A.S.; Belli P.; Bernabei R.; Cappella F.; Cerulli R.; Danevich F.A.; Incicchitti A.; Laubenstein M.; Mokina V.M.; Nisi S.; Poda D.V.; Polischuk O.G.; Tretyak V.I.

    2014-01-01

    Cerium, neodymium and gadolinium contain double beta active isotopes. The most interesting are 150Nd and 160Gd (promising for 0ν2β search), 136Ce (2β+ candidate with one of the highest Q2β). The main problem of compounds containing lanthanide elements is their high radioactive contamination by uranium, radium, actinium and thorium. The new generation 2β experiments require development of methods for a deep purification of lanthanides from the radioactive elements. A combination of physical an...

  7. LASL experience in decontamination of the environment

    This discussion represents one part of a major effort in soil decontamination at the Los Alamos site. A contaminated industrial waste line in the Los Alamos townsite was removed, and a plutonium incineration facility, and a filter building contaminated with actinium-227 were dismantled. The former plutonium handling facility has been decontaminated, and canyons and an old firing site contaminated with strontium-90 have been surveyed

  8. Study of the origin of elements of the uranium-235 family observed in excess in the vicinity of the experimental nuclear EL4 reactor under dismantling. Lessons got at this day and conclusions; Etude de l'origine des elements de la famille de l'uranium-235 observes en exces dans les environs du reacteur nucleaire experimental EL4 en cours de demantelement. Enseignements retires a ce jour et conclusion

    NONE

    2007-07-01

    This study resumes the discovery of an excess of actinium 227 found around by EL4 nuclear reactor actually in dismantling. The search for the origin of this excess revealed a real inquiry of investigation during three years. Because a nuclear reactor existed in this area a particular attention will have concerned this region. The doubt became the line of conduct to find the answer to the human or natural origin of this excess. Finally and against any evidence, it appears that the origin of this phenomenon was natural, consequence of the particular local geology. The detail of the different investigations is given: search of a possible correlation with the composition of elevations constituent of lanes, search (and underlining) of new sites in the surroundings of the Rusquec pond and the Plouenez station, study of the atmospheric deposits under winds of the nuclear power plant and in the east direction, search of a possible relationship with the gaseous effluents of the nuclear power plant in the past, historical study of radioactive effluents releases in the fifty last years by the analysis of the sedimentary deposits in the Saint-Herbiot reservoir, search of a possible correlation between the excess of actinium 227 and the nuclear power plant activity; search of a possible correlation with a human activity without any relationship with the nuclear activities, search of a correlation with the underground waters, search of a correlation with the geological context, collect of information on the possible transfers in direction of the food chain, determination of the radiological composition of the underground waters ( not perturbed by human activity), search of the cause of an excess of actinium 227 in the old channel of liquid effluents release of the nuclear power plant. The results are given and discussed. And contrary to all expectations the origin of the excess of actinium 227 is completely natural. (N.C.)

  9. The discoveries of uranium 237 and symmetric fission — From the archival papers of Nishina and Kimura

    IKEDA, Nagao

    2011-01-01

    Shortly before the Second World War time, Nishina reported on a series of prominent nuclear physical and radiochemical studies in collaboration with Kimura. They artificially produced 231Th, a member of the natural actinium series of nuclides, by bombarding thorium with fast neutrons. This resulted in the discovery of 237U, a new isotope of uranium, by bombarding uranium with fast neutrons, and confirmed that 237U disintegrates into element 93 with a mass number of 237. They also identified t...

  10. History of the unraveling of the natural decay series

    Milestones in the subject of radioactivity, which were important to the unraveling of natural decay series, have been identified and described. The interplay between all these issues is very complex, and some aspects of the development of the uranium series is discussed as an example, the thorium and actinium series evolved in a similar way from research by many of the same people. All three series as understood in 1913 are compared with their present-day representation. (orig.)

  11. History of the unraveling of the natural decay series

    Milestones in the subject of radioactivity, which were important to the unraveling of natural decay series, have been identified and described. The interplay between all these issues is very complex, and some aspects of the development of the uranium series is discussed as an example, the thorium and actinium series evolved in a similar way from research by many of the same people. All three series as understood in 1913 are compared with their present-day representation. (author)

  12. System for recovery of daughter isotopes from a source material

    Tranter, Troy J [Idaho Falls, ID; Todd, Terry A [Aberdeen, ID; Lewis, Leroy C [Idaho Falls, ID; Henscheid, Joseph P [Idaho Falls, ID

    2009-08-04

    A method of separating isotopes from a mixture containing at least two isotopes in a solution is disclosed. A first isotope is precipitated and is collected from the solution. A daughter isotope is generated and collected from the first isotope. The invention includes a method of producing an actinium-225/bismuth-213 product from a material containing thorium-229 and thorium-232. A solution is formed containing nitric acid and the material containing thorium-229 and thorium-232, and iodate is added to form a thorium iodate precipitate. A supernatant is separated from the thorium iodate precipitate and a second volume of nitric acid is added to the thorium iodate precipitate. The thorium iodate precipitate is stored and a decay product comprising actinium-225 and bismuth-213 is generated in the second volume of nitric acid, which is then separated from the thorium iodate precipitate, filtered, and treated using at least one chromatographic procedure. A system for producing an actinium-225/bismuth-213 product is also disclosed.

  13. Behaviour of uranium series radionuclides in surface water (Crouzille, Limousin). Geochemical implications

    Understanding natural radionuclides behaviour in surface water is a required step to achieve uranium mine rehabilitation and preserve water quality. The first objective of this thesis is to determine which are the radionuclides sources in a drinking water reservoir. The second objective is to improve the knowledge about the behaviour of uranium series radionuclides, especially actinium. The investigated site is a brook (Sagnes, Limousin, France) which floods a peat bog contaminated by a former uranium mine and which empties into the Crouzille lake. It allows studying radionuclides transport in surface water and radionuclides retention through organic substance or water reservoir. Radionuclides distribution in particulate, colloidal and dissolved phases is determined thanks to ultra-filtrations. Gamma spectrometry allows measuring almost all natural radionuclides with only two counting stages. However, low activities of 235U series radionuclides impose the use of very low background well-type Ge detectors, such as those of the Underground Laboratory of Modane (France). Firstly, this study shows that no or few radionuclides are released by the Sagnes peat bog, although its radioactivity is important. Secondly, it provides details on the behaviour of uranium series radionuclides in surface water. More specifically, it provides the first indications of actinium solubility in surface water. Actinium's behaviour is very close to uranium's even if it is a little less soluble. (author)

  14. Soubor písní a tanců J. Vycpálka

    Stavělová, Daniela

    Praha : Divadelní ústav, 2001, s. 209-209. ISBN 80-7008-112-0 Institutional research plan: CEZ:AV0Z9058907 Keywords : folk ensemble, repertory, stage production Subject RIV: AC - Archeology, Anthropology, Ethnology

  15. Drug: D08442 [KEGG MEDICUS

    Full Text Available D08442 Drug Propoxur (BAN); Bolfo (TN) C11H15NO3 209.1052 209.2417 D08442.gif Insecticide; Antip ... arasitic Same as: C14334 veterinary ... medicine acetylcholinesterase (AChE) inhibitor [KO ...

  16. 32 CFR 516.66 - Administrative and contractual actions.

    2010-07-01

    ... AUTHORITIES AND PUBLIC RELATIONS LITIGATION Remedies in Procurement Fraud and Corruption § 516.66... DFARS 209.406-3 (48 CFR 209.406-3) report must be prepared where contractor nonresponsibility is...

  17. 32 CFR 516.65 - Litigation reports in civil recovery cases.

    2010-07-01

    ... CIVIL AUTHORITIES AND PUBLIC RELATIONS LITIGATION Remedies in Procurement Fraud and Corruption § 516.65... prepared on a given case such as the DFARS 209.406-3 (48 CFR 209.406-3) report. (d) The MACOM...

  18. 32 CFR 516.67 - Overseas cases of fraud or corruption.

    2010-07-01

    ... AUTHORITIES AND PUBLIC RELATIONS LITIGATION Remedies in Procurement Fraud and Corruption § 516.67 Overseas... suspension and debarment actions are governed by DFARS 209.403 (48 CFR 209.403). The names of all firms...

  19. 32 CFR 516.61 - Reporting requirements.

    2010-07-01

    ... PUBLIC RELATIONS LITIGATION Remedies in Procurement Fraud and Corruption § 516.61 Reporting requirements... is requested by PFD, the provisions of DFARS 209.406-3 (48 CFR 209.406-3) will be followed....

  20. Communications of 17 October 1996 received from Member States regarding the export of nuclear material and of certain categories of equipment and other materials

    The document is a correction to the document of 26 April 1999, issued as INFCIRC/209/Rev.1/Mod.4, bringing it in line with the usual format for modifications to INFCIRC/209. Additionally, the revised document includes details of communications from three Member States which were not mentioned in INFCIRC/209/Rev.1/Mod.4

  1. 76 FR 71922 - Defense Federal Acquisition Regulation Supplement: Separation of Combined Provisions and Clauses...

    2011-11-21

    .... * * * * * (ii) 252.209-7002, Disclosure of Ownership or Control by a Foreign Government. (iii) 252.209-7003...) 252.209-7001, Disclosure of Ownership or Control by the Government of a Terrorist Country. Applies to... part in a foreign country; and (B) A foreign government controls wage rates or material prices and...

  2. Molecular and Biological Characterization of an Isolate of Cucumber mosaic virus from Glycine soja by Generating its Infectious Full-genome cDNA Clones

    Mi Sa Vo Phan

    2014-06-01

    Full Text Available Molecular and biological characteristics of an isolate of Cucumber mosaic virus (CMV from Glycine soja (wild soybean, named as CMV-209, was examined in this study. Comparison of nucleotide sequences and phylogenetic analyses of CMV-209 with the other CMV strains revealed that CMV-209 belonged to CMV subgroup I. However, CMV-209 showed some genetic distance from the CMV strains assigned to subgroup IA or subgroup IB. Infectious full-genome cDNA clones of CMV-209 were generated under the control of the Cauliflower mosaic virus 35S promoter. Infectivity of the CMV-209 clones was evaluated in Nicotiana benthamiana and various legume species. Our assays revealed that CMV-209 could systemically infect Glycine soja (wild soybean and Pisum sativum (pea as well as N. benthamiana, but not the other legume species.

  3. DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS

    P. Bernot

    2005-07-13

    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this activity is to predict dissolved concentrations or solubility limits for elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) relevant to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are provided in the form of tabulated functions with pH and log fCO{sub 2} as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. Even though selection of an appropriate set of radionuclides documented in Radionuclide Screening (BSC 2002 [DIRS 160059]) includes actinium, transport of Ac is not modeled in the total system performance assessment for the license application (TSPA-LA) model because of its extremely short half-life. Actinium dose is calculated in the TSPA-LA by assuming secular equilibrium with {sup 231}Pa (Section 6.10); therefore, Ac is not analyzed in this report. The output data from this report are fundamental inputs for TSPA-LA used to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for the actinides discussed in this report. These models cover broad ranges of environmental conditions so they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or

  4. DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS

    The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this activity is to predict dissolved concentrations or solubility limits for elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) relevant to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are provided in the form of tabulated functions with pH and log fCO2 as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. Even though selection of an appropriate set of radionuclides documented in Radionuclide Screening (BSC 2002 [DIRS 160059]) includes actinium, transport of Ac is not modeled in the total system performance assessment for the license application (TSPA-LA) model because of its extremely short half-life. Actinium dose is calculated in the TSPA-LA by assuming secular equilibrium with 231Pa (Section 6.10); therefore, Ac is not analyzed in this report. The output data from this report are fundamental inputs for TSPA-LA used to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for the actinides discussed in this report. These models cover broad ranges of environmental conditions so they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or otherwise

  5. Detection of rare earth elements in Powder River Basin sub-bituminous coal ash using laser-induced breakdown spectroscopy (LIBS)

    Tran, Phuoc [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State; Mcintyre, Dustin [National Energy Technology Lab. (NETL), Pittsburgh, PA, (United State

    2015-10-01

    We reported our preliminary results on the use of laser-induced breakdown spectroscopy to analyze the rare earth elements contained in ash samples from Powder River Basin sub-bituminous coal (PRB-coal). We have identified many elements in the lanthanide series (cerium, europium, holmium, lanthanum, lutetium, praseodymium, promethium, samarium, terbium, ytterbium) and some elements in the actinide series (actinium, thorium, uranium, plutonium, berkelium, californium) in the ash samples. In addition, various metals were also seen to present in the ash samples

  6. The identification of soil radionuclides in the area of Puspiptek and surrounding

    The area of PUSPIPTEK and the surrounding are potentially exposed by radionuclides, because the operation of the nuclear research plant. The PPTN Serpong was operated long than 10 years, therefore soil radioactivity need to evaluate. The determination of radioactivity in the soil samples which be taken from research location using gamma spectrometry on June-August. The result of the research identified natural radionuclides K-40; Thorium decay series Ac-228, Bi-212, Pb-212, Tl-208, Ra-224 and Rn-220; Uranium decay series Bi-214, Pa-234, Pb-214 and Actinium decay series Bi-211, Po-211. There are no identification radionuclides produce from the activation of PPTN Serpong

  7. Cause analysis on sidewall enclosure superheater tube rupture of 2 209 t/h boiler in Huaneng Dezhou Power Plant%华能德州电厂2209t/h锅炉侧墙包复过热器爆管原因分析

    黄新元; 刘长振; 张凯; 马东森

    2004-01-01

    建立了计算华能德州电厂2209t/h锅炉侧墙包复过热器流量偏差的数学模型,指出该炉频繁爆管的根本原因在于侧墙包复过热器存在固定的滞流区域.利用本模型对增加的管子入口节流圈的流量分布进行估计,采取相应措施后解决了该炉的爆管问题.

  8. Communication Breakdown: Librarian and Student Approaches to Virtual Reference Differ. A review of: Walter, Virginia A. and Cindy Mediavilla. “Teens Are from Neptune, Librarians Are from Pluto: An Analysis of Online Reference Transactions.” Library Trends 54.2 (2005: 209-227.

    Stephanie Hall

    2006-09-01

    Full Text Available Objective – To evaluate the effectiveness of an online reference and referral service for students (primarily those in middle school and high school seeking homework help. Design – Analysis of 114 transcripts of reference transactions. Setting – A centralized homework reference and tutor referral service provided on behalf of the California State Library by the Metropolitan Cooperative Library System. Subjects – Virtual reference librarians at a large urban library system and middle and high school students in California. Methods – One hundred fourteen virtual reference transactions recorded between October 12 and November 8, 2003 were evaluated against the Reference and User Services Association’s (RUSA “Guidelines for Behavioral Performance of Reference and Information Service Providers.” Secondly, the transcripts were subjected to discourse analysis. Main results Performance of virtual reference librarians vis‐àvis RUSA guidelines In the majority of cases, there was some evidence that librarians communicated clearly (110 out of 114 transactions. In 78 cases, it appeared that a librarian was available quickly, and in 92 of the transactions a friendly greeting was given. What was striking, however, was that in a clear majority of cases, some of the classic reference interview strategies were not employed. In 100 or more cases each, the following strategies were not observed: repeating or paraphrasing the question; helping to interpret the question; verifying mutual understanding; asking if the question has been answered; asking if the student needs more information. Furthermore, in 75 cases librarians did not probe for further information to clarify the question, while in 87 cases they did not check that information had been clearly understood. Possibly related to these findings, the researchers felt that the transcripts revealed “a conviction that homework questions are not the proper content for reference transactions” (222. In addition, librarians were found to be frequently too quick to refer students to a tutor, when a query might have been better answered as a reference question. Findings of discourse analysis In general, the virtual reference librarians used impersonal, formal language to “reinforce the professional’s superior position vis‐à‐vis the help‐seeker” (217. There were repeated attempts by the students to interject a lighter or warmer tone (using humour, emoticons, informal language, introducing a personal note, etc.. These attempts were rarely reciprocated, with librarians continuing to use impersonal language, including stock messages such as: “we are experiencing a very busy time right now,” (217; or, “I am going to send you a page which will give you some help with your homework. After we disconnect this session, click on this link and follow the instructions to be connected with a tutor. Please do not click on any links on this page until after we have disconnected” (217. In several cases librarians were preoccupied with defining their roles—for example, specifying that they could give reference help but not advice. In all, the distancing mechanisms used by librarians, combined with occasional inaccurate referrals and technical problems with the software, were seen to create an enormous potential forfrustration on the part of the student. Conclusions – The most important implication of the study was that librarians and students were worlds (or planets apart in their approach to the reference interaction. While “teens attempted to create meaningby recreating the chat discourse environment in which they were most at home”, librarians “tried to create meaning in a parallel discourse environment that duplicated as much as possible the standard impersonal protocols of a face‐to‐face reference counter” (223. One suggested way to alleviate the disconnect between librarians and students was to involve students in the planning of the services. For now, however, the authors conclude that “teens are from Neptune, librarians are from Pluto. Better services would result if they could meet somewhere closer together” (224.

  9. An aerial radiological survey of the Sandia National Laboratories and surrounding area

    A team from the Remote Sensing Laboratory conducted an aerial radiological survey of the area surrounding the Sandia National Laboratories and Kirtland Air Force Base in Albuquerque, New Mexico, during March and April 1993. The survey team measured the terrestrial gamma radiation at the site to determine the levels of natural and man-made radiation. This survey includes the areas covered by a previous survey in 1981. The results of the aerial survey show a background exposure rate which varies between 5 and 18 μR/h plus an approximate 6 μR/h contribution from cosmic rays. The major radioactive isotopes found in this survey were: potassium-40, thallium-208, bismuth-214, and actinium-228, which are all naturally-occurring isotopes, and cobalt-60, cesium-137, and excess amounts of thallium-208 and actinium-228, which are due to human actions in the survey area. In regions away from man-made activity, the exposure rates inferred from this survey's gamma ray measurements agree almost exactly with the exposure rates inferred from the 1981 survey. In addition to the aerial measurements, another survey team conducted in situ and soil sample radiation measurements at three sites within the survey perimeter. These ground-based measurements agree with the aerial measurements within ± 5%

  10. Mixed valency of the RE and Ac ions in solid states

    Full text: This review is devoted to consideration of the methods and results of the theoretical and experimental investigations of the electronic state of the rare earths and actinium ions in the separate compound. The methods of the high resolution X ray spectroscopy were used for our consideration. Energy of the X ray lines of the rare earths and actinium ions in free state and solid states was study carefully. Valency shifts of X Ray lines under change of electronic state of nf - ions in different oxide, fluoride and chloride compounds were determined for K -, L- and M - lines for these ions with accuracy near 10 -100 MeV. We studied the electronic state of nf- ions which is changed from '+2' to '+4' and determined the concentration of ions in different electronic state. Relative error for theoretical energy of the most lines for HFP - approach in comparison with experiment is less than 0.5%, and deviation for concentration is less than 5%

  11. A study of uranium and thorium migration at the Koongarra uranium deposit with application to actinide transport from nuclear waste repositories

    One way to gain confidence in modelling possible radionuclide releases is to study natural systems which are similar to components of the multibarrier waste repository. Several such analogues are currently under study and these provide useful data about radionuclide behaviour in the natural environment. One such system is the Koongarra uranium deposit in the Northern Territory. In this dissertation, the migration of actinides, primarily uranium and thorium, has been studied as an analogue for the behaviour of transuranics in the far-field of a waste repository. The major findings of this study are: 1. the main process retarding uranium migration in the dispersion fan at Koongarra is sorption, which suppresses dissolved uranium concentrations well below solubility limits, with ferrihydrite being a major sorbing phase; 2. thorium is extremely immobile, with very low dissolved concentrations and corresponding high distribution ratios for 230Th. Overall, it is estimated that colloids are relatively unimportant in Koongarra groundwater. Uranium migrates mostly as dissolved species, whereas thorium and actinium are mostly adsorbed to larger, relatively immobile particles and the stationary phase. However, of the small amount of 230Th that passes through a 1μm filter, a significant proportion is associated with colloidal particles. Actinium appears to be slightly more mobile than thorium and is associated with colloids to a greater extent, although generally present in low concentrations. These results support the possibility of colloidal transport of trivalent and tetravalent actinides in the vicinity of a nuclear waste repository. 112 refs., 23 tabs., 32 figs

  12. Purification of cerium, neodymium and gadolinium for low background experiments

    Boiko R.S.

    2014-01-01

    Full Text Available Cerium, neodymium and gadolinium contain double beta active isotopes. The most interesting are 150Nd and 160Gd (promising for 0ν2β search, 136Ce (2β+ candidate with one of the highest Q2β. The main problem of compounds containing lanthanide elements is their high radioactive contamination by uranium, radium, actinium and thorium. The new generation 2β experiments require development of methods for a deep purification of lanthanides from the radioactive elements. A combination of physical and chemical methods was applied to purify cerium, neodymium and gadolinium. Liquid-liquid extraction technique was used to remove traces of Th and U from neodymium, gadolinium and for purification of cerium from Th, U, Ra and K. Co-precipitation and recrystallization methods were utilized for further reduction of the impurities. The radioactive contamination of the samples before and after the purification was tested by using ultra-low-background HPGe gamma spectrometry. As a result of the purification procedure the radioactive contamination of gadolinium oxide (a similar purification efficiency was reached also with cerium and neodymium oxides was decreased from 0.12 Bq/kg to 0.007 Bq/kg in 228Th, from 0.04 Bq/kg to <0.006 Bq/kg in 226Ra, and from 0.9 Bq/kg to 0.04 Bq/kg in 40K. The purification methods are much less efficient for chemically very similar radioactive elements like actinium, lanthanum and lutetium.

  13. The Technological Enhancement of Normally Occurring Radioactive Materials in Red Mud due to the Production of Alumina

    Maurice O. Miller

    2016-01-01

    Full Text Available This study investigates the level of technological enhancement of normally occurring radioactive materials (TENORM in the red mud waste due to the production of alumina in Jamaica. Technological enhancements factors (TEF were determined for the uranium, thorium, actinium series, their progenies, and the nonseries potassium-40 using gamma spectrometry. The study concluded that bauxite production technologically enhances the uranium progenies Th-234, Pb-214, Bi-214, and Pa-234 and the thorium-232 progenies Ac-228, Pb-212, and Bi-212 in red mud. The actinium series was technologically enhanced, but K-40 and the thorium daughter, Tl-208, were reduced. The spectrometric comparison of Tl-208 (at 510 keV was unexpected since its other photopeaks at 583 keV, 934 keV, and 968 keV were markedly different. An explanation for this anomaly is discussed. An explanation regarding the process of accumulation and fractionation of organically derived phosphate deposits and potassium-feldspar is offered to explain the spectrometric differences between the alumina product and its waste material, red mud.

  14. Low background counting of 222Rn, 220Rn and 219Rn with electrostatic counters

    Mong, Brian; EXO-200 Collaboration; nEXO Collaboration

    2014-09-01

    The radon counting technique based on electrostatic precipitation of progenies in gas followed by alpha spectroscopy has been applied to support the material selection programs of low background, neutrino and dark matter experiments with emphasis on EXO. An array of 8 counters operated by Laurentian University at SNOLAB and the Waste Isolation Pilot Plant have reached the sensitivity of 10 atoms/day in the uranium, thorium and actinium chains. Hardware improvements are underway to further increase the capacity and sensitivity in support of nEXO. The radon counting technique based on electrostatic precipitation of progenies in gas followed by alpha spectroscopy has been applied to support the material selection programs of low background, neutrino and dark matter experiments with emphasis on EXO. An array of 8 counters operated by Laurentian University at SNOLAB and the Waste Isolation Pilot Plant have reached the sensitivity of 10 atoms/day in the uranium, thorium and actinium chains. Hardware improvements are underway to further increase the capacity and sensitivity in support of nEXO. Supported by NSERC Project Grants ``Search for Double Beta Decay with EXO.''

  15. Purification of cerium, neodymium and gadolinium for low background experiments

    Boiko, R. S.; Barabash, A. S.; Belli, P.; Bernabei, R.; Cappella, F.; Cerulli, R.; Danevich, F. A.; Incicchitti, A.; Laubenstein, M.; Mokina, V. M.; Nisi, S.; Poda, D. V.; Polischuk, O. G.; Tretyak, V. I.

    2014-01-01

    Cerium, neodymium and gadolinium contain double beta active isotopes. The most interesting are 150Nd and 160Gd (promising for 0ν2β search), 136Ce (2β+ candidate with one of the highest Q2β). The main problem of compounds containing lanthanide elements is their high radioactive contamination by uranium, radium, actinium and thorium. The new generation 2β experiments require development of methods for a deep purification of lanthanides from the radioactive elements. A combination of physical and chemical methods was applied to purify cerium, neodymium and gadolinium. Liquid-liquid extraction technique was used to remove traces of Th and U from neodymium, gadolinium and for purification of cerium from Th, U, Ra and K. Co-precipitation and recrystallization methods were utilized for further reduction of the impurities. The radioactive contamination of the samples before and after the purification was tested by using ultra-low-background HPGe gamma spectrometry. As a result of the purification procedure the radioactive contamination of gadolinium oxide (a similar purification efficiency was reached also with cerium and neodymium oxides) was decreased from 0.12 Bq/kg to 0.007 Bq/kg in 228Th, from 0.04 Bq/kg to <0.006 Bq/kg in 226Ra, and from 0.9 Bq/kg to 0.04 Bq/kg in 40K. The purification methods are much less efficient for chemically very similar radioactive elements like actinium, lanthanum and lutetium.

  16. 77 FR 69638 - Eunice Kennedy Shriver National Institute of Child Health & Human Development; Notice of Closed...

    2012-11-20

    ... and Human Development Special Emphasis Panel; Contraceptive Clinical Trail Network: Female Sites. Date... Research; 93.209, Contraception and Infertility Loan Repayment Program, National Institutes of Health,...

  17. 77 FR 69641 - Eunice Kennedy Shriver National Institute of Child Health & Human Development; Notice of Closed...

    2012-11-20

    ... Development Special Emphasis Panel; Contraceptive Clinical Trail Network: Female Sites. Date: December 7, 2012....209, Contraception and Infertility Loan Repayment Program, National Institutes of Health, HHS)...

  18. On a Signature of a Flux-rope Formation by Vortex Motions in its Footpoint

    Kotrč, Pavel; Bárta, Miroslav; Kupryakov, Yu. A.; Kashapova, L. K.

    2013-01-01

    Roč. 37, č. 2 (2013), s. 513-520. ISSN 1845-8319. [Hvar Astrophysical Colloquium /12./. Hvar, 03.09.2012-07.09.2012] R&D Projects: GA ČR GAP209/10/1680; GA ČR GAP209/10/1706; GA ČR GAP209/12/1652; GA ČR GAP209/12/0103; GA ČR GA13-24782S Institutional support: RVO:67985815 Keywords : filaments * solar eruptions * magnetic helicity Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

  19. Protein (Cyanobacteria): 294385 [PGDBj - Ortholog DB

    Full Text Available YP_007105521.1 1117:5160 1118:2838 1129:209 1173263:841 parallel beta-helix repeat (two copie...NLIEGNRQTGITILGNSSPDLGNADSLGNNRIRNNLLRDVQYTGTEAIAAVGNEISRLSGNIQLSGTLQSQPLSVPNISSAPNVSPNLPNGVTRTIIPNSVIVRTLPIE

  20. Drug: D03690 [KEGG MEDICUS

    Full Text Available D03690 Drug Desciclovir (USAN/INN) C8H11N5O2 209.0913 209.2052 D03690.gif Antiviral...08307] Antivirals Anti-HSV agent DNA polymerase inhibitor Purine analogue Desciclovir D03690 Desciclovir (US

  1. Magnetoacoustic waves in a vertical flare current-sheet in a gravitationally stratified solar atmosphere

    Jelínek, P.; Karlický, Marian; Murawski, K.

    2012-01-01

    Roč. 546, October (2012), A49/1-A49/9. ISSN 0004-6361 R&D Projects: GA ČR GAP209/10/1680; GA ČR GAP209/12/0103 Institutional support: RVO:67985815 Keywords : Sun * corona * flares Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 5.084, year: 2012

  2. An Estimate of Chromospheric Heating by Acoustic Waves

    Sobotka, Michal; Švanda, Michal; Jurčák, Jan; Heinzel, Petr; Del Moro, D.; Berrilli, F.

    2014-01-01

    Roč. 38, č. 1 (2014), s. 53-58. ISSN 1845-8319 R&D Projects: GA ČR(CZ) GA14-04338S; GA ČR GPP209/12/P568; GA ČR GAP209/12/0287 Institutional support: RVO:67985815 Keywords : Sun * chromosphere * heating Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics

  3. 40 CFR 225.3 - Procedure for invoking economic impact.

    2010-07-01

    ... accordance with 33 CFR 209.120 and 209.145. (b) If the decision of the Chief of Engineers is that ocean... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Procedure for invoking economic impact... DUMPING CORPS OF ENGINEERS DREDGED MATERIAL PERMITS § 225.3 Procedure for invoking economic impact....

  4. 10 CFR Appendix L to Part 110 - Illustrative List of Byproduct Materials Under NRC Export/Import Licensing Authority a

    2010-01-01

    ...) Antimony 126 (Sb 126) Arsenic 73 (As 73) Arsenic 74 (As 74) Arsenic 76 (As 76) Arsenic 77 (As 77) Barium 131 (Ba 131) Barium 133 (Ba 133) Barium 140 (Ba 140) Bismuth 207 (Bi 207) Bismuth 210 (Bi 210) Bromine...) Polonium 209 (Po 209) Polonium 210 (Po 210) Potassium 42 (K 42) Praseodymium 142 (Pr 142) Praseodymium...

  5. 77 FR 76352 - Adjustment of Status of Refugees and Aliens Granted Asylum

    2012-12-28

    ... SECURITY 8 CFR Part 209 Adjustment of Status of Refugees and Aliens Granted Asylum CFR Correction In Title..., reinstate paragraphs (b) through (f) to read as follows: Sec. 209.2 Adjustment of status of alien granted asylum. * * * * * ] (b) Inadmissible alien. An applicant who is not admissible to the United States...

  6. Indian national information programme for marine science

    Tapaswi, M.P.

    stream_size 11 stream_content_type text/plain stream_name Natl_Inf_Policies_Program_1991_209.pdf.txt stream_source_info Natl_Inf_Policies_Program_1991_209.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO...

  7. 33 CFR 221.1 - Investigation and supervision of hydropower projects under the Federal Power Act (ER 1140-2-4).

    2010-07-01

    ... the U.S. Government Printing Office, Washington, D.C. 20402. (3) ER 1145-2-303 (33 CFR 209.120), 2 Permits for Activities in Navigable Waters or Ocean Waters. 2 33 CFR 209.120 was removed at 42 FR 37133... full public interest review pursuant to 33 CFR part 320 and the application of the...

  8. Planktonní mikrofosilie Concentricystes Ross. 1962 ze sedimentů neogénu a (Kampan?)-Paleogénu tropické a aridní oblasti (Malajsie a Střední Východ)

    Konzalová, Magda

    2003-01-01

    Roč. 2002, - (2003), s. 209-210. ISSN 0514-8057 Institutional research plan: CEZ:AV0Z3013912 Keywords : planctonic microfossils * terrestrial and marine environment * Kalimantan and Middle East Subject RIV: DB - Geology ; Mineralogy http://www.geology.cz/zpravy/obsah/2002/zpravy-o-vyzkumech-2002-str-209-210.pdf

  9. 49 CFR 1544.229 - Fingerprint-based criminal history records checks (CHRC): Unescorted access authority, authority...

    2010-10-01

    ... certification made to an airport operator on or after December 6, 2001, pursuant to 14 CFR 107.209(n) in effect prior to November 14, 2001 (see 14 CFR parts 60 to 139 revised as of January 1, 2001) or § 1542.209(n... employee or contract employee covered under a certification made to an airport operator pursuant to 14...

  10. 33 CFR 263.12 - References.

    2010-07-01

    ... and Appearance of Feasibility Reports. (f) ER 1105-2-502 Public Meetings (33 CFR 209.405). (g) ER 1105-2-507 Preparation and Coordination of Environmental Statements (33 CFR 209.410). (h) ER 1105-2-800 Public Involvement: General Policies (33 CFR 380). (i) ER 1105-2-811 A-95 Clearinghouse Coordination...

  11. Drug: D08558 [KEGG MEDICUS

    Full Text Available D08558 Drug Talipexole (INN) C10H15N3S 209.0987 209.3112 D08558.gif Antiparkinsonia...ceptor interaction hsa04728(1813) Dopaminergic synapse map07057 Antiparkinsonian agents map07213 Dopamine re

  12. 78 FR 721 - California State Nonroad Engine Pollution Control Standards; Transport Refrigeration Units...

    2013-01-04

    ... 209(e) of the Clean Air Act, or are not subject to Clean Air Act preemption. \\4\\ 74 FR 3030 (January... 209(b) motor vehicle waivers).\\7\\ \\5\\ 59 FR 36969 (July 20, 1994). \\6\\ 62 FR 67733 (December 30, 1997... or fire) associated with compliance with the California standard. \\7\\ 59 FR 36969 (July 20, 1994)....

  13. Dynamics of the solar atmosphere above a pore with a light bridge

    Sobotka, Michal; Švanda, Michal; Jurčák, Jan; Heinzel, Petr; Del Moro, D.; Berrilli, F.

    2013-01-01

    Roč. 560, December (2013), A84/1-A84/14. ISSN 0004-6361 R&D Projects: GA ČR GAP209/12/0287; GA ČR GPP209/12/P568 Institutional support: RVO:67985815 Keywords : sunspots * chromosphere * photosphere Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.479, year: 2013

  14. LSFEM Implementation of MHD Numerical Solver

    Skála, J.; Bárta, Miroslav

    2012-01-01

    Roč. 36, 11A (2012), s. 1842-1850. ISSN 2152-7385 R&D Projects: GA ČR GAP209/12/0103; GA ČR GAP209/10/1680 Institutional support: RVO:67985815 Keywords : magnetohydrodynamics * least-squares finite element method * adaptive mesh refinemen Subject RIV: BA - General Mathematics

  15. 32 CFR 516.15 - General.

    2010-07-01

    ... 32 National Defense 3 2010-07-01 2010-07-01 true General. 516.15 Section 516.15 National Defense Department of Defense (Continued) DEPARTMENT OF THE ARMY AID OF CIVIL AUTHORITIES AND PUBLIC RELATIONS... Regulation Supplement, section 209.406-3 (48 CFR 209.406-3); reporting the exercise of criminal...

  16. Purification system of gram-amount neptunium using anion exchange chromatography

    To develop a purification system of gram-amount neptunium using anion exchange chromatography, adsorption elution of excess amount of actinium in 6M HNO3 aqueous solution was studied using thorium and uranium tracer. The partition coefficient (Kd) of Th (IV) decreased from Kd=99.1 of tracer to Kd=44.0, 5% load. By decreasing the partition coefficient, we can wash until 30 Vs under the purification conditions of 1% load and 95% recovery. The retention volume of U (IV) was about 300 Vs, a large value. The partition coefficient of Np (IV) may be larger than it and the large amount of washable eluting solution may be obtained. Washing of impurity of 3d transition metal and actinide (VI) can be done until 20Vs. With washing of 150Vs, impurity of alkali earth metal, metals (III) and platinum group metals decreased less than 0.1%. (S.Y.)

  17. A francium-223 reservoir source

    By improving and accelerating a method which had been earlier tried for caesium-rubidium separation on a cellulose column, i.e. elution with 2N HCl-equilibrated phenol, the author succeeded in obtaining consecutive and quasi-selective elutions of francium-223, starting with actinium-227 fixed at the top of a small cellulose column to which ZrO2 had been added. The francium-223, rapidly eluted under pressure, is extracted by water while the phenol is extracted by ether; it can easily be cleared of any residual traces of radioactive contaminants (thallium-207, radium-223, thorium-227) by two consecutive BaSO4 precipitations. The preparation of a Fr223 solution (HCl-H2SO4) requires approximately 20 min; the time noted for Fr223 was closer to 22 than to 21 min. (author)

  18. Radionuclide interactions with marine sediments

    A critical review of the literature on the subject of the interactions of radionuclides with marine sediments has been carried out. On the basis of the information available, an attempt has been made to give ranges and 'best estimates' for the distribution ratios between seawater and sediments. These estimates have been based on an understanding of the sediment seawater system and the porewater chemistry and mineralogy. Field measurements, laboratory measurements and estimates based on stable-element geochemical data are all taken into account. Laboratory measurements include distribution-ratio and diffusion-coefficient determinations. The elements reviewed are carbon, chlorine, calcium, nickel, selenium, strontium, zirconium, niobium, technetium, tin, iodine, caesium, lead, radium, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium and curium. (author)

  19. Formerly utilized MED/AEC sites Remedial Action Program. Radiological survey of the St. Louis Airport Storage Site, St. Louis, Missouri. Final report

    Results of two radiological surveys of the St. Louis-Lambert Airport property, formerly known as the Airport Storage Site, St. Louis, Missouri, are presented. Uranium- and radium-bearing waste materials were stored from the 1940's to the late 1960's in this area. The surveys included direct measurements of beta-gamma radiation; determination of uranium, actinium, and radium concentrations in soil samples and from bore holes; determination of radionuclide concentrations in groundwater and surface water; measurement of radon flux from the ground surface; and measurements of 222Rn in air near the site. Results indicate that some offsite drainage pathways are becoming contaminated, probably by runoff from the site; no migration of 222Rn from the site was observed

  20. JAEA thermodynamic database for performance assessment of geological disposal of high-level and TRU wastes. Refinement of thermodynamic data for trivalent actinoids and samarium

    Within the scope of the JAEA thermodynamic database project for performance assessment of geological disposal of high-level radioactive and TRU wastes, the refinement of the thermodynamic data for the inorganic compounds and complexes of trivalent actinoids (actinium(III), plutonium(III), americium(III) and curium(III)) and samarium(III) was carried out. Refinement of thermodynamic data for these elements was based on the thermodynamic database for americium published by the Nuclear Energy Agency in the Organisation for Economic Co-operation and Development (OECD/NEA). Based on the similarity of chemical properties among trivalent actinoids and samarium, complementary thermodynamic data for their species expected under the geological disposal conditions were selected to complete the thermodynamic data set for the performance assessment of geological disposal of radioactive wastes. (author)

  1. Theoretical Study on Properties of New Isotope 265Bh

    2006-01-01

    The properties of nuclei belonging to the newly observed α-decay chain starting from 265Bh have been studied. The axially deformed relativistic mean-field calculation with the force NL-Z2 has been performed in the blockedBCS approximation. Some ground state properties such as binding energies, deformations, spins, and parities, as well as Q-values of the α-decay for this decay chain have been calculated and compared with known experimental data. Good agreement is found. The single-particle spectrum of the nucleus 265 Bh is studied and some new magic numbers are found,while the magnitudes of the shell gaps in superheavy nuclei are much smaller than those of nuclei before the actinium region, and the Fermi surfaces are close to the continuum. Thus the superheavy nuclei are usually not stable. The The methods which give good agreement with the data are selected.

  2. Proposed training program for construction personnel involved in remedial action work at sites contaminated by naturally occurring radionuclides

    Many sites used during the early days of the US atomic energy program are contaminated with radionuclides of the primordial decay chains (uranium, thorium, and actinium series). This contamination consists of residues resulting from refining and processing uranium and thorium. Preparation of these sites for release to unrestricted private use will involve the assistance of construction workers, many of whom have limited knowledge of the hazards associated with radioactive materials. Therefore, there is a need to educate these workers in the fundamentals of radioactive material handling to minimize exposures and possible spread of contamination. This training should disseminate relevant information at an appropriate educational level and should instill a cautious, common-sense attitude toward the handling of radioactive materials. The training should emphasize basic information concerning environmental radiation within a context of relative risk. A multi-media format, including colorful visual aids, demonstration, and discussion, should be used to maximize motivation and retention. A detailed, proposed training program design is presented

  3. Origin of elements of the Uranium-235 family observed in the Ellez river near the EL-4 experimental nuclear reactor in dismantling (Monts d'Arree- Finistere department); Origine des elements de la famille de l'uranium-235 observes dans la riviere Ellez a proximite du reacteur nucleaire experimental EL4 en cours de demantelement (Mont d'Arree - departement du Finistere). Resultats et premiers constats annee 2006

    NONE

    2006-07-01

    In a previous study which concerned the catchment basin of the harbour of Brest, the A.C.R.O. put in evidence a marking by artificial radioelements around the power plant of Brennilis which can be imputed without ambiguities to the nuclear installation. It also put in evidence abnormalities concerning the natural radioactivity which justifies this new study. In the area of the Monts d'Arree, actinium 227 ({sup 227}Ac), non born by its ascendents which are {sup 235}U and {sup 231}Pa is observed. This phenomenon is characterized by mass activities superior to these ones of {sup 235}U and able to reach these ones of {sup 238}U. Its presence corresponds with the drainage of the Ellez river since the former channel of radioactive effluents releases from the nuclear power plant EL-4 up to the reservoir Saint-Herblot situated 6 km downstream. The strongest values of radioactivity are registered near the disused power plant, at this place a relationship exists between the level of actinium 227 and this one of the artificial radioactivity as it exists a relationship with the decay products of radon exhaled from the subsoil ({sup 210}Pb). But its presence is not limited to a part of the Ellez river, it is equally observed in terrestrial medium, in places in priori not influenced by the direct liquid effluents of the power plant. This place is situated at more than 4 km and without any connection with the Ellez waters. At this stage of the study, it is not possible to answer with certainty the question of the origin of this phenomenon. A new reorientation is considered indispensable to clarify definitively the origin of this unknown phenomenon in the scientific publications and the environmental monitoring. (N.C.)

  4. origin of elements of the Uranium-235 family observed in the Ellez river near the EL-4 experimental nuclear reactor in dismantling (Monts d'Arree- Finistere department)

    In a previous study which concerned the catchment basin of the harbour of Brest, the A.C.R.O. put in evidence a marking by artificial radioelements around the power plant of Brennilis which can be imputed without ambiguities to the nuclear installation. It also put in evidence abnormalities concerning the natural radioactivity which justifies this new study. In the area of the Monts d'Arree, actinium 227 (227Ac), non born by its ascendents which are 235U and 231Pa is observed. This phenomenon is characterized by mass activities superior to these ones of 235U and able to reach these ones of 238U. Its presence corresponds with the drainage of the Ellez river since the former channel of radioactive effluents releases from the nuclear power plant EL-4 up to the reservoir Saint-Herblot situated 6 km downstream. The strongest values of radioactivity are registered near the disused power plant, at this place a relationship exists between the level of actinium 227 and this one of the artificial radioactivity as it exists a relationship with the decay products of radon exhaled from the subsoil (210Pb). But its presence is not limited to a part of the Ellez river, it is equally observed in terrestrial medium, in places in priori not influenced by the direct liquid effluents of the power plant. This place is situated at more than 4 km and without any connection with the Ellez waters. At this stage of the study, it is not possible to answer with certainty the question of the origin of this phenomenon. A new reorientation is considered indispensable to clarify definitively the origin of this unknown phenomenon in the scientific publications and the environmental monitoring. (N.C.)

  5. Physical Measurements and Clinical Findings of Persons with Radium Burdens

    Results of physical measurements and some clinical findings of persons with radium burdens are reported and discussed. Ten workers of the dial painting industry, two chemists, who have been working for between 10 and 20 yr in the radium- industry, one technician, who has been- working for over 20 yr with high-emanation radium preparations and one person with high radium intake of rather unknown history were measured in a whole-body counter for evaluation of the body burdens of radium-226 and radium-228+ actinium-228. In some cases the radon concentration of expired air was also measured. For four of the measured persons the radium-226 burden is of the order of the maximum permissible amount (MPA : 10-7 c) or more. In one case the burden amounts to more than three times the MPA, (3.4 x 10-7 c), in another case to more than 100 times the MPA (160 x 10-7 c). In one case the radium-228 + actinium-228 burden exceeds the MPA (6 x 10-8 c in bone). The measured radon concentrations in the expired air were used to calculate the excretion rate of radon. The average was 67%. Clinical findings with some of the measured persons are related to the measured body burdens. The patient with the high body burden of 160 x 10-7 c radium-226 shows heavy bone changes leading to spontaneous bone fractures. The blood picture shows a decrease in the number of erythrocytes and a low haemoglobin content but puncture of the sternum indicates normal haematopoiesis. It seems that the low number of erythrocytes is caused by chronic nephropathia, the reason for which might be an additional intake of uranium because.uranium was found in the urine by gamma spectroscopy. The results are discussed with respect to the MPA of radium-226 recommended by the International Commission on Radiological Protection. (author)

  6. Polybrominated diphenyl ethers (PBDES) at a solid waste incineration plant I: Atmospheric concentrations

    Agrell, Cecilia; ter Schure, Arnout F. H.; Sveder, Jeanette; Bokenstrand, Alma; Larsson, Per; Zegers, Bart N.

    2004-09-01

    In the first of two papers, the atmospheric poly brominated diphenyl ether (PBDE) concentrations at a municipal solid waste incineration (MSW) plant with electronic recycling is compared with that at an industrial urban reference site producing asphalt and concrete. In the second paper, atmospheric deposition and washout behaviour is presented (Atmos. Environ. (2004a)). PBDEs (BDE28, -47, -66, -100, -154, -153, -183, -209) in the gaseous and particulate phase were measured with high resolution in time during the colder parts of the year to minimise the influence of potential historical pollution at the sites through volatilisation. This also means that reported levels are lower compared to other reported data. Results of BDE47 (TetraBDE) and BDE209 (DecaBDE) as representatives of "old" vs. "new" PBDEs as well as ∑PBDE, excluding BDE209, are presented. Median ∑PBDE, BDE47 and BDE209 concentration were 6.3, 2.1 and 10.4 pg m-3 at the MSW and 3.5, 1.7 and 6.5 pg m-3 at the reference site. The total concentrations (gaseous and particulate phase) were significantly higher at the MSW compared to the reference site for ∑PBDE and BDE47 but not for BDE209. The same results were obtained regarding concentrations in the gaseous phase. Particle concentrations were significantly higher at the MSW for ∑PBDE, BDE47 and BDE209. Within each site, the gaseous-phase concentration was significantly higher than the particulate-phase concentration except for BDE209 at the MSW. Thus, the proportion of BDE209 detected in the particulate phase was higher at the MSW compared to the reference site. Together with the results of the second paper, we suggest that treatment of waste is presently a source of "old" PBDEs to the environment, whereas the rather similar BDE209 concentrations at the two sites are more a result of proximity to potential diffuse sources.

  7. Probing a potential in vivo drug-excipient interaction: temporal effects of a modified β-cyclodextrin on the intravenous pharmacokinetics of a model high-affinity drug ligand.

    Mannila, Anne; Morizzi, Julia; Nguyen, Thuy Tien; Charman, Susan A; McIntosh, Michelle P; Shackleford, David M

    2012-09-01

    The investigational synthetic ozonide, OZ209, has previously been shown to have high binding affinity for sulfobutylether(7)-β-cyclodextrin [(SBE)(7)-β-CD] resulting in altered pharmacokinetics when administered intravenously to rats in a (SBE)(7)-β-CD aqueous formulation. In the present study, OZ209 and (SBE)(7)-β-CD have been used to probe whether a modified β-CD excipient, on systemic administration, can bind to and alter the pharmacokinetics of a coadministered drug. When (SBE)(7)-β-CD was administered 60 min after OZ209, a spike in the concentration of OZ209 in blood and plasma was detected within 2 min of the (SBE)(7)-β-CD infusion, and this was accompanied by a temporary decrease in the whole blood-to-plasma partitioning ratio of OZ209, the duration of which was dependent upon the dose of (SBE)(7)-β-CD. Administration of (SBE)(7)-β-CD also resulted in increased urinary excretion of OZ209. By contrast, administration of (SBE)(7)-β-CD 4 h prior to OZ209 had no pronounced effect on the blood or plasma pharmacokinetics of OZ209, consistent with the (SBE)(7)-β-CD having been largely eliminated prior to the administration of OZ209. This study is the first to demonstrate an in vivo drug-excipient interaction between a modified β-CD and a coadministered drug, and also demonstrates that such an interaction can be avoided through appropriate consideration of CD pharmacokinetics. PMID:22549698

  8. Remediation of polybrominated diphenyl ethers in soil using Ni/Fe bimetallic nanoparticles: Influencing factors, kinetics and mechanism

    Xie, Yingying [School of Chemistry and Environment, South China Normal University, Guangzhou 51006 (China); Guangdong Technology Research Center for Ecological Management and Remediation of Urban Water System, Guangzhou 51006 (China); Fang, Zhanqiang, E-mail: zhqfang@scnu.edu.cn [School of Chemistry and Environment, South China Normal University, Guangzhou 51006 (China); Guangdong Technology Research Center for Ecological Management and Remediation of Urban Water System, Guangzhou 51006 (China); Cheng, Wen [School of Chemistry and Environment, South China Normal University, Guangzhou 51006 (China); Guangdong Technology Research Center for Ecological Management and Remediation of Urban Water System, Guangzhou 51006 (China); Tsang, Pokeung Eric [Department of Science and Environmental Studies, The Hong Kong Institute of Education, Hong Kong 00852 (China); Zhao, Dongye [Environmental Engineering Program, Department of Civil Engineering, Auburn University, Auburn, AL 36849 (United States)

    2014-07-01

    Polybrominated diphenyl ethers (PBDEs) are commonly used as additive flame retardants in all kinds of electronic products. PBDEs are now ubiquitous in the environment, with soil as a major sink, especially in e-waste recycling sites. This study investigated the degradation of decabromodiphenyl ether (BDE209) in a spiked soil using Ni/Fe bimetallic nanoparticles. The results indicated that Ni/Fe bimetallic nanoparticles are able to degrade BDE209 in soil at ambient temperature and the removal efficiency can reach 72% when an initial pH of 5.6 and at a Ni/Fe dosage of 0.03 g/g. A declining trend in degradation was noticed with decreasing Ni loading and increasing of initial BDE209 concentration. The degradation products of BDE209 were analyzed by GC-MS, which showed that the degradation of BDE209 was a process of stepwise debromination from nBr to (n − 1)Br. And a possible debromination pathway was proposed. At last, the degradation process was analyzed as two-step mechanism, mass transfer and reaction. This current study shows the potential ability of Ni/Fe nanoparticles to be used for removal of PBDEs in contaminated soil. - Highlights: • Ni/Fe bimetallic nanoparticles could effectively degradate BDE209 in soil. • The effects of various factors on remediation of BDE209 in soil using Ni/Fe were considered. • The degradation of BDE209 was a process of stepwise debromination from nBr to (n − 1)Br. • A possible debromination pathway and mechanism about removal of BDE209 in soil were proposed.

  9. Dicty_cDB: Contig-U13132-1 [Dicty_cDB

    Full Text Available nas mobilis subsp. mobilis... 35 3.0 A70179( A70179 ) exodeo..._1( AF093783 |pid:none) Salmonella typhimurium 2-oxoglutar... 99 3e-19 DQ423340_1( DQ423340 |pid:none) Sinorhizobium melil...Pea aphid whole body normalized full le... 44 1e-04 3 ( FE849223 ) CAFO396.fwd CAFO Pichia stipitis aerobic ... 9e-53 CP000672_326( CP000672 |pid:none) Haemophilus influenzae PittGG, c... 209 ...a DC2201 DNA, c... 209 2e-52 AM942759_562( AM942759 |pid:none) Proteus mirabilis strain HI4320,... 209 2e-5

  10. Dicty_cDB: Contig-U02156-1 [Dicty_cDB

    Full Text Available tagat 125 Query: 126 ttaccnaatgggacccntttnaatttatc 154 ||||||||||||||||||||||||||||| Sbjct: 126 ttaccnaatggg...||||||| Sbjct: 268 aganatcnaattaanatttggcnattagggtcnactaatgataanaatganaatttagat 209 Query: 126 ttaccnaatggga...cccntttnaatttatc 154 ||||||||||||||||||||||||||||| Sbjct: 208 ttaccnaatgggacccntttnaatttatc 180 Score = 143 ...|||||||||||||||||||||||||||||||||||||||||| Sbjct: 66 aganatcnaattaanatttggcnattagggtcnactaatgataanaatganaatt

  11. Comparing i-Tree modeled ozone deposition with field measurements in a periurban Mediterranean forest

    Morani, A.; Nowak, D.; Hirabayashi, S.; Guidolotti, G.; Medori, M.; Muzzini, V.; Fares, S.; Scarascia-Mugnozza, G.; Calfapietra, Carlo

    2014-01-01

    Roč. 195, DEC 2014 (2014), s. 202-209. ISSN 0269-7491 Institutional support: RVO:67179843 Keywords : Ball–Berry * ozone flux * mediterranean region Subject RIV: EH - Ecology, Behaviour Impact factor: 4.143, year: 2014

  12. Poslední den světa v husitských vizích. Zjevení Martinovo

    Cermanová; Libichová, Pavlína

    Praha: Nakladatelství Lidové noviny, 2014 - (Nodl, M.; Sommer, P.), s. 197-209 ISBN 978-80-7422-356-3 Institutional support: RVO:67985955 Keywords : Hussites * prophecies * visions literature Subject RIV: AB - History

  13. Ionisation Equilibrium for the Non-Maxwellian Electron -Distributions in Solar Flares: Updated Calculations

    Dzifčáková, Elena; Dudík, Jaroslav

    2015-01-01

    Roč. 209, č. 12 (2015), s. 3545-3558. ISSN 0038-0938 Institutional support: RVO:67985815 Keywords : energetic particles * acceleration * electrons Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.039, year: 2014

  14. 28 CFR 541.13 - Prohibited acts and disciplinary severity scale.

    2010-07-01

    ... coded 102A. Likewise, attempting the adulteration of any food or drink would be coded 209A. (c... damaging any security device, mechanism, or procedure Adulteration of any food or drink (Not to be...

  15. 5 CFR 2638.309 - Reliance on formal advisory opinions.

    2010-01-01

    ... not, as a result of such act, be subject to prosecution under 18 U.S.C. 202-209 or, in the case where the opinion is exculpatory, be subject to any administrative adverse action or civil action based...

  16. Galveston Bay, TX (G260) Bathymetric Digital Elevation Model(30 meter resolution) Derived From Source Hydrographic SurveySoundings Collected by NOAA

    National Oceanic and Atmospheric Administration, Department of Commerce — Bathymetry for Galveston Bay was derived from thirty-three surveyscontaining 209,359 soundings. Twelve overlapping, older, lessaccurate surveys were omitted, and...

  17. An Epigenetic Model for Pigment Patterning Based on Mechanical and Cellular Interactions

    Caballero, L.; Benitez, M.; Alvarez-Buylla, E. R.; Hernandez, S.; Arzola, Alejandro V.; Cocho, G.

    2012-01-01

    Roč. 318, č. 3 (2012), s. 209-223. ISSN 1552-5007 Institutional support: RVO:68081731 Keywords : epithelial-mesenchymal transitions * neural crest * traction forces * morphogenesis Subject RIV: ED - Physiology Impact factor: 2.123, year: 2012

  18. Cognitive load theory

    Kirschner, Paul A.; Kirschner, Femke; Paas, Fred

    2010-01-01

    Kirschner, P. A., Kirschner, F. C., & Paas, F. (2009). Cognitive load theory. In E. M. Anderman & L. H. Anderman (Eds.). Psychology of classroom learning: An encyclopedia, Volume 1, a-j (pp. 205-209). Detroit, MI: Macmillan Reference.

  19. Thunderstorm – lower ionosphere relationship as shown by ionograms recorded at Pruhonice in two summer campaigns of 2013

    Barta, V.; Burešová, Dalia; Chum, Jaroslav; Sátori, G.; Bencze, P.; Bór, J.; Betz, H. D.

    Paris : Centre national de la recherche scientifique, 2014 R&D Projects: GA ČR(CZ) GAP209/12/2440 Institutional support: RVO:68378289 Keywords : thunderstorm * ionosphere * ionograms Subject RIV: DG - Athmosphere Sciences, Meteorology

  20. 29 CFR Appendix A to Part 510 - Manufacturing Industries Eligible for Minimum Wage Phase-In

    2010-07-01

    ... classified. 209 1 Miscellaneous food preparations and kindred products. 2091 1 Canned and cured fish and... shops). 3444 2 Sheet metal work. 3446 3 Architectural and ornamental metal work. 3449 2...

  1. Organisation and methods for the transport of dangerous goods by road

    This article reviews certain parts of Act No. 209 BGBL1 (1967) concerning the transport of dangerous goods by road. In particular, it sets out the dangerous goods, by class, covered by the Act and describes the labelling requirements. (NEA)

  2. Habermasův proceduralismus a některé pokusy o hodnotové vymezení

    Hála, Vlastimil

    Praha : Filosofia, 2013, s. 209-220 ISBN 978-80-7007-391-9. - (Filosofie a sociální vědy. 45) Institutional support: RVO:67985955 Keywords : values * universalism * European Union Subject RIV: AA - Philosophy ; Religion

  3. Debromination of decabromodiphenyl ether by organo-montmorillonite-supported nanoscale zero-valent iron: preparation, characterization and influence factors.

    Pang, Zhihua; Yan, Mengyue; Jia, Xiaoshan; Wang, Zhenxing; Chen, Jianyu

    2014-02-01

    An organo-montmorillonite-supported nanoscale zero-valent iron material (M-NZVI) was synthesized to degrade decabromodiphenyl ether (BDE-209). The results showed that nanoscale zero-valent iron had good dispersion on organo-montmorillonite and was present as a core-shell structure with a particle size range of nanoscale iron between 30-90 nm, characterized by XRD, SEM, TEM, XRF, ICP-AES, and XPS. The results of the degradation of BDE-209 by M-NZVI showed that the efficiency of M-NZVI in removing BDE-209 was much higher than that of NZVI. The efficiency of M-NZVI in removing BDE-209 decreased as the pH and the initial dissolved oxygen content of the reaction solution increased, but increased as the proportion of water in the reaction solution increased. PMID:25076541

  4. Evoluční teorie poznání a transcendentální argumenty

    Nosek, Jiří

    Praha: Filosofia, 2011, s. 209-253. ISBN 978-80-7007-358-2 Institutional research plan: CEZ:AV0Z90090514 Keywords : evolution * knowledge * transcendental deduction * explanation * signification Subject RIV: AA - Philosophy ; Religion

  5. International Scientific Technology Exchanges in 2012

    LI; Lin

    2012-01-01

    <正>In 2012, CIAE sent 209 teams abroad for taking part in international meeting, technical visiting, further studying and training. CIAE received 412 foreign scholars from about 30 countries, and some reports were given by foreign scholars as follows:

  6. Mammoth bone deposits and subsistence practices during Mid-Upper Palaeolithic in Central Europe: three cases from Moravia and Poland

    Svoboda, Jiří; Péan, S.; Wojtal, P.

    126-128, - (2005), s. 209-221. ISSN 1040-6182 Institutional research plan: CEZ:AV0Z80010507 Keywords : Moravia, Poland * gravettian * Mammuthus primigenius Subject RIV: AC - Archeology, Anthropology, Ethnology Impact factor: 1.210, year: 2005

  7. Not EEG abnormalities but epilepsy is associated with autistic regression and mental functioning in childhood autism

    Hrdlička, M.; Komárek, V.; Propper, L.; Kulísek, R.; Zumrová, A.; Faladová, L.; Havlovicová, M.; Sedláček, Z.; Blatný, Marek; Urbánek, Tomáš

    2004-01-01

    Roč. 13, č. 4 (2004), s. 209-213. ISSN 1018-8827 Institutional research plan: CEZ:AV0Z7025918 Keywords : childhood autism * epilepsy * EEG Subject RIV: AN - Psychology Impact factor: 1.167, year: 2004

  8. Constructing and Analyzing Fusion Promoter of Partial Sericin 1 and Bombyx A3 Cytoplasmic Actin

    2008-01-01

    Previous report showed that the 209 bp DNA sequence upstream of the sericin 1 transcriptional start site (-586 to -378 bp) is involved in promoting transcription and responsible for the tissue specificity of sericin 1 promoter in silkworm Bombyx mori. In the present study, this 209 bp sequence exhibited enhancive effect by assembling in two different locations of ubiquitous Bombyx A3 cytoplasmic actin promoter. Sf-9 cells were transfected with recombinant plasmids using Cellfectin reagent. Firefly luciferase gene located downstream of fusion promoter was considered as a reporter, whereas the activity of the co-transfected Renilla luciferase gene (pGL2-SV40) provides an internal control. This 209 bp region up-regulates the strength of A3 promoter significantly (P < 0.01) when it enters into A3 promoter with respect to the position in sericin 1 gene promoter. This 209-bp fragment was almost functionless when being located upstream of A3 promoter.

  9. Successful Use of Hydroxocobalamin and Sodium Thiosulfate in Acute Cyanide Poisoning: A Case Report with Follow-up

    Zakharov, S.; Vaněčková, M.; Seidl, Z.; Diblik, P.; Kuthan, P.; Urban, P.; Navrátil, Tomáš; Pelclová, D.

    2015-01-01

    Roč. 117, č. 3 (2015), s. 209-212. ISSN 1742-7835 Institutional support: RVO:61388955 Keywords : glycosylated hemoglobin * hydroxocobalamin * lactic acid Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.377, year: 2014

  10. Logic Reduced To Bare (Proof-Theoretical) Bones

    Peregrin, Jaroslav

    2015-01-01

    Roč. 24, č. 2 (2015), s. 193-209. ISSN 0925-8531 Institutional support: RVO:67985955 Keywords : inference * incompatibility * proof theory * intuitionistic logic Subject RIV: AA - Philosophy ; Religion

  11. Geographic variation in diapause response of adult Rhipicephalus appendiculatus ticks

    Madder, M.; Speybroeck, N.; Brandt, J.; Tirry, L.; Hodek, Ivo; Berkvens, D.

    2002-01-01

    Roč. 277, - (2002), s. 209-221. ISSN 0168-8162 Institutional research plan: CEZ:AV0Z5007907 Keywords : Diapause * Life cycle * Rhipicephalus appendiculatus Subject RIV: ED - Physiology Impact factor: 0.921, year: 2002

  12. Kolmnurkkelmus, vahendlikult toimepandud vargus ja nõude omastamine. Riigikohtu kriminaalkolleegiumi otsus 3-1-1-85-11 / Kristina Domaškina

    Domaškina, Kristina

    2012-01-01

    Riigikohtu lahendist 3-1-1-85-11, mis käsitleb varguse, kelmuse ja omastamise objektiivsete koosseisude temaatikat. Materiaalõiguslikest küsimustest karistusseadustiku paragrahvide 199, 209 ja 201 järgi

  13. Protein (Viridiplantae): 308813045 [PGDBj - Ortholog DB

    Full Text Available otein involved in mRNA turnover (ISS) Ostreococcus tauri MPKSKRARVVSLTKTKKKDREWKSSIIDRARDALELRASAYVFKYTCMRNG...XP_003083829.1 33090:209 3041:6341 1035538:5129 13792:5129 70447:4042 70448:4808 Pr

  14. K ústní zkoušce z češtiny (Máj Karla Hynka Máchy)

    Ibrahim, Robert

    2014-01-01

    Roč. 64, č. 5 (2014), s. 209-212. ISSN 0009-0786 Institutional support: RVO:68378068 Keywords : Czech secondary school-leaving examination * text edition * theory of verse Subject RIV: AJ - Letters, Mass-media, Audiovision

  15. Cool dwarfs in wide multiple systems. Paper 3: Two common-proper-motion, late-type stars separated by over 11 arcmin

    Caballero, J A; Miret, F X; Tobal, T; Cairol, J

    2012-01-01

    LP 209-28 and LP 209-27 have similar proper motions as tabulated by several catalogues. Using seven astrometric epochs spanning 59 years, we confirm a common tangential velocity by measuring a constant angular separation of rho = 666.62+/-0.09 arcsec. Accurate SDSS and 2MASS photometry indicates that they are normal dwarfs of approximate spectral types K7 V and M3 V. However, from their apparent magnitudes, both LP 209-28 and LP 209-27 are located at 200-250 pc, from where one can deduce an astonishing projected physical separation of 0.6-0.8 pc. The system Koenigstuhl 6 AB represents another world record among the least-bound systems with low-mass star components.

  16. 铜绿假单胞菌胞内酶粗提液对十溴联苯醚的降解%Biodegradation of Decabromodiphenyl Ether by Intracellular Enzyme Obtained from Pseudomonas aeruginosa

    史广宇; 尹华; 叶锦韶; 彭辉; 张娜; 何宝燕

    2013-01-01

    探讨了铜绿假单胞菌粗酶液对十溴联苯醚(BDE-209)的降解特性,结果表明,该菌株胞内酶在12h内对1 mg·L-1的BDE-209降解率达到了69.22%,温度、pH值、酶蛋白浓度及底物BDE-209浓度均会影响胞内酶粗提液对BDE-209的降解效率.当BDE-209浓度为1 mg·L-时,BDE-209适宜的酶促降解条件为:温度30℃,反应pH值7.5,且降解率随着酶浓度的增加而增大.胞内酶对BDE-209的降解过程符合一级动力学反应模型,底物浓度为1mg· L-时降解速率最快,半衰期为6.9h.胞内酶降解BDE-209符合高浓度底物抑制的酶促反应类型,其基本降解动力学参数为rma =0.133 mg·(L·h)-1,Km=0.642mg·L-1,Ki=1.558 mg·L-1.%The degradation characteristics of decabromodiphenyl ether (BDE-209) by crude enzyme from Pseudomonas aeruginosa were investigated. The results revealed that the degradation efficiency of the intracellular enzyme excreted from this bacterial strain reached 69.22% after incubation with 1 mg·L-1 BDE-209 for 12 h. Temperature, pH, enzyme concentration and BDE-209 concentration all influenced the ability of crude enzyme to degrade BDE-209. When the BDE-209 concentration was 1 mg·L , the optimal condition for enzymatic degradation was temperature 30℃ and pH 7. 5 , and the degradation rate increased with increasing enzyme concentration. The degradation process of BDE- 209 by intracellular enzyme of the strain conformed to the first-order kinetic model. The highest reaction rate was achieved when the initial concentration of BDE-209 was 1 mg·L and the half-life of this substrate was 6. 9 h. In addition, the biodegradation of BDE-209 can be well described by enzymatic reaction of high concentration substrate inhibition, with a maximum substrate utilization rate of 0. 133 mg·(L·h)-1 , a Michaelis-Menten constant of 0. 642 mg·L-1 , and an inhibitory constant of 1. 558 mg·L , respectively.

  17. 29 CFR 780.112 - General meaning of “agriculture or horticultural commodities.”

    2010-07-01

    ... mineral wealth or other natural resources, or by uncultivated natural growth. For example, peat humus or peat moss is not an agricultural commodity. Wirtz v. Ti Ti Peat Humus Co., 373 f(2d) 209 (C.A.4)....

  18. Modeling of H alpha Eruptive Events Observed at the Solar Limb

    Kotrč, Pavel; Bárta, Miroslav; Schwartz, Pavol; Kupryakov, Yu. A.; Kashapova, L. K.; Karlický, Marian

    2013-01-01

    Roč. 284, č. 2 (2013), s. 447-466. ISSN 0038-0938 R&D Projects: GA ČR GA205/09/1705; GA ČR(CZ) GA205/09/1469; GA ČR GAP209/10/1706; GA ČR GAP209/10/1680; GA ČR GAP209/12/1652; GA ČR GAP209/12/0103 Grant ostatní: EU(XE) PCIG-GA-2011-304265; EU(XE) People-2011-IRES 295272 Institutional support: RVO:67985815 Keywords : flares * eruptions * spectrum Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 3.805, year: 2013

  19. 75 FR 76263 - Inmate Discipline Program/Special Housing Units: Subpart Revision and Clarification

    2010-12-08

    ... a detailed section-by-section analysis (published on July ] 26, 2005, at 70 FR 43093). This... damaging any security device, mechanism, or procedure. 209 Adulteration of any food or drink. 210 (Not...

  20. Distinguishing PCB Isomeric Congeners with their Gas Chromatographic and Mass Spectrometric Ortho Effect using Comprehensive Gas Chromatography

    The 209 polychlorinated biphenyl (PCB) congeners and associated nine isomeric groups (nine groups of PCBs with the same degree of chlorination) have been long recorded as high endocrine disrupting chemicals in the environment. Difficult analytical problems exist, in those frequen...