International Nuclear Information System (INIS)
Keller, C.
1977-01-01
There are only very few investigations dealing with the chemical and physical properties of actinium, the lanthanum homologue in the actinide series, 227 Ac, the only long-lived isotope can be produced in gram amounts only by neutron irradiation of 226 Ra, the amounts occurring in nature are too low for isolation (about 1 μg 227 Ac/1 uranium ore). Experimental work with 227 Ac gives rise to a lot of problems due to the radiation characteristics of the 227 Ac daughter nuclides. Therefore, the metal and the only ten solid compounds, prepared up to now, have been isolated in the microgram scale. Due to the high specific activity of 227 Ac, the preparation of a lot of compounds, e.g. metal-organic compounds seems to be very difficult, if not impossible. The properties of actinium in aqueous solutions have been deduced from experiments in the tracer scale only. The present investigations on actinium show that only the oxidation state + 3 exists - only radiopolarographic studies indicate the possibility of a lower valancy state (Ac 2+ ). - This review will give a critical and comprehensive description on the present knowledge about this element. The presently decreasing interest in the development of thermionic batteries using 227 Ac 2 O 3 radionuclide also implies that there will be only small progress in the chemistry of this radio-element in the near future. (orig.) [de
Application of partition chromatography method for separation and analysis of actinium radionuclides
International Nuclear Information System (INIS)
Sinitsina, G.S.; Shestakova, I.A.; Shestakov, B.I.; Plyushcheva, N.A.; Malyshev, N.A.; Belyatskij, A.F.; Tsirlin, V.A.
1979-01-01
The method of partition chromatography is considered with the use of different extractants for the extraction of actinium-227, actinium-225 and actinium-228. It is advisable to extract actinium-227 from the irradiated radium with the help of D2FGFK. The use of 2DEGFK allows us to separate actinium-227 from alkaline and alkaline-earth elements. Amines have a higher radiative stability. An express-method has been developed for the identification of actinium-227 with TOA by its intrinsic α-emission in nonequilibrium preparations of irradiated radium-226 of small activity. Actinium-225 is extracted from uranium-233 with due regard for the fact that U, Th, and Ac are extracted differently by TBP from HNO 3 solutions. With the help of the given procedure one can reach the purifying coefficient of 10 4 . Actinium-228 is extracted from the radiummesothorium preparations by a deposition of decay products, including polonium-210 on the iron hydroxyde. Actinium-228 extraction from the mixture of radium radionuclides is performed by the partition chromatography method on D2EGFK. All the procedures for separation of actinium isotopes by the above methods are described
Separation of protactinum, actinium, and other radionuclides from proton irradiated thorium target
Fassbender, Michael E.; Radchenko, Valery
2018-04-24
Protactinium, actinium, radium, radiolanthanides and other radionuclide fission products were separated and recovered from a proton-irradiated thorium target. The target was dissolved in concentrated HCl, which formed anionic complexes of protactinium but not with thorium, actinium, radium, or radiolanthanides. Protactinium was separated from soluble thorium by loading a concentrated HCl solution of the target onto a column of strongly basic anion exchanger resin and eluting with concentrated HCl. Actinium, radium and radiolanthanides elute with thorium. The protactinium that is retained on the column, along with other radionuclides, is eluted may subsequently treated to remove radionuclide impurities to afford a fraction of substantially pure protactinium. The eluate with the soluble thorium, actinium, radium and radiolanthanides may be subjected to treatment with citric acid to form anionic thorium, loaded onto a cationic exchanger resin, and eluted. Actinium, radium and radiolanthanides that are retained can be subjected to extraction chromatography to separate the actinium from the radium and from the radio lanthanides.
Separation of actinium-227 from its daughter products by cationic resins technique
International Nuclear Information System (INIS)
Nastasi, M.J.C.
1976-01-01
A method for separating actinium-227 from its daughter products based on ion exchange principle is shown. Radionuclides mixture in perchloric acid 8,5 N and chloridric acid 0,5 N medium pass by a cationic resin column. Thorium-227 and actinium-227, which are retained by the resin, are eluted with nitric acid 6 N which releases actinium-227 while oxalic acid 7% is used for thorium-227 elution [pt
Separation of Actinium 227 from the uranium minerals
International Nuclear Information System (INIS)
Martinez-Tarango, S.
1991-01-01
The purpose of this work was to separate Actinium 227, whose content is 18%, from the mineral carnotite found in Gomez Chihuahua mountain range in Mexico. The mineral before processing is is pre-concentrated and passed, first through anionic exchange resins, later the eluate obtained is passed through cationic resins. The resins were 20-50 MESH QOWEX and 100-200 MESH 50 X 8-20 in some cased 200-400 MESH AG 50W-X8, 1X8 in other cases. The eluates from the ionic exchange were electrodeposited on stainless steel polished disc cathode and platinum electrode as anode; under a current ODF 10mA for 2.5 to 5 hours and of 100mA for .5 of an hour. it was possible to identify the Actinium 227 by means of its descendents, TH-227 and RA-223, through alpha spectroscopy. Due to the radiochemical purity which the electro deposits were obtained the Actinium 227 was low and was not quantitatively determined. A large majority of the members of the natural radioactive series 3 were identified and even alpha energies reported in the literature with very low percentages of non-identified emissions were observed. We conclude that a more precise study is needed concerning ionic exchange and electrodeposit to obtain an Actinium 227 of radiochemical purity. (Author)
Short history of radioactivity. No. XIII. The actinium and thorium series
Energy Technology Data Exchange (ETDEWEB)
Chalmers, T W
1950-06-16
Discussions of the actinium disintegration series (about 1905), the /sup 235/U or actinium series (as it is accepted today), the disintegration of thorium (about 1905), the thorium series in the modern form, and the 4n, 4n + 1, 4n + 2, and 4n + 3 series are presented.
Production of Actinium-225 via High Energy Proton Induced Spallation of Thorium-232
Energy Technology Data Exchange (ETDEWEB)
Harvey, James T.; Nolen, Jerry; Vandergrift, George; Gomes, Itacil; Kroc, Tom; Horwitz, Phil; McAlister, Dan; Bowers, Del; Sullivan, Vivian; Greene, John
2011-12-30
The science of cancer research is currently expanding its use of alpha particle emitting radioisotopes. Coupled with the discovery and proliferation of molecular species that seek out and attach to tumors, new therapy and diagnostics are being developed to enhance the treatment of cancer and other diseases. This latest technology is commonly referred to as Alpha Immunotherapy (AIT). Actinium-225/Bismuth-213 is a parent/daughter alpha-emitting radioisotope pair that is highly sought after because of the potential for treating numerous diseases and its ability to be chemically compatible with many known and widely used carrier molecules (such as monoclonal antibodies and proteins/peptides). Unfortunately, the worldwide supply of actinium-225 is limited to about 1,000mCi annually and most of that is currently spoken for, thus limiting the ability of this radioisotope pair to enter into research and subsequently clinical trials. The route proposed herein utilizes high energy protons to produce actinium-225 via spallation of a thorium-232 target. As part of previous R and D efforts carried out at Argonne National Laboratory recently in support of the proposed US FRIB facility, it was shown that a very effective production mechanism for actinium-225 is spallation of thorium-232 by high energy proton beams. The base-line simulation for the production rate of actinium-225 by this reaction mechanism is 8E12 atoms per second at 200 MeV proton beam energy with 50 g/cm2 thorium target and 100 kW beam power. An irradiation of one actinium-225 half-life (10 days) produces {approx}100 Ci of actinium-225. For a given beam current the reaction cross section increases slightly with energy to about 400 MeV and then decreases slightly for beam energies in the several GeV regime. The object of this effort is to refine the simulations at proton beam energies of 400 MeV and above up to about 8 GeV. Once completed, the simulations will be experimentally verified using 400 MeV and 8 Ge
The sorption of polonium, actinium and protactinium onto geological materials
International Nuclear Information System (INIS)
Baston, G.M.N.; Berry, J.A.; Brownsword, M.; Heath, T.G.; Ilett, D.J.; McCrohon, R.; Tweed, C.J.; Yui, M.
1999-01-01
This paper describes a combined experimental and modeling program of generic sorption studies to increase confidence in the performance assessment for a potential high-level radioactive waste repository in Japan. The sorption of polonium, actinium and protactinium onto geological materials has been investigated. Sorption of these radioelements onto bentonite, tuff and granodiorite from equilibrated de-ionized water was studied under reducing conditions at room temperature. In addition, the sorption of actinium and protactinium was investigated at 60 C. Thermodynamic chemical modeling was carried out to aid interpretation of the results
The sorption of polonium, actinium and protactinium onto geological materials
Energy Technology Data Exchange (ETDEWEB)
Baston, G.M.N.; Berry, J.A.; Brownsword, M.; Heath, T.G.; Ilett, D.J.; McCrohon, R.; Tweed, C.J.; Yui, M.
1999-07-01
This paper describes a combined experimental and modeling program of generic sorption studies to increase confidence in the performance assessment for a potential high-level radioactive waste repository in Japan. The sorption of polonium, actinium and protactinium onto geological materials has been investigated. Sorption of these radioelements onto bentonite, tuff and granodiorite from equilibrated de-ionized water was studied under reducing conditions at room temperature. In addition, the sorption of actinium and protactinium was investigated at 60 C. Thermodynamic chemical modeling was carried out to aid interpretation of the results.
Radchenko, V; Engle, J W; Wilson, J J; Maassen, J R; Nortier, F M; Taylor, W A; Birnbaum, E R; Hudston, L A; John, K D; Fassbender, M E
2015-02-06
Actinium-225 (t1/2=9.92d) is an α-emitting radionuclide with nuclear properties well-suited for use in targeted alpha therapy (TAT), a powerful treatment method for malignant tumors. Actinium-225 can also be utilized as a generator for (213)Bi (t1/2 45.6 min), which is another valuable candidate for TAT. Actinium-225 can be produced via proton irradiation of thorium metal; however, long-lived (227)Ac (t1/2=21.8a, 99% β(-), 1% α) is co-produced during this process and will impact the quality of the final product. Thus, accurate assays are needed to determine the (225)Ac/(227)Ac ratio, which is dependent on beam energy, irradiation time and target design. Accurate actinium assays, in turn, require efficient separation of actinium isotopes from both the Th matrix and highly radioactive activation by-products, especially radiolanthanides formed from proton-induced fission. In this study, we introduce a novel, selective chromatographic technique for the recovery and purification of actinium isotopes from irradiated Th matrices. A two-step sequence of cation exchange and extraction chromatography was implemented. Radiolanthanides were quantitatively removed from Ac, and no non-Ac radionuclidic impurities were detected in the final Ac fraction. An (225)Ac spike added prior to separation was recovered at ≥ 98%, and Ac decontamination from Th was found to be ≥ 10(6). The purified actinium fraction allowed for highly accurate (227)Ac determination at analytical scales, i.e., at (227)Ac activities of 1-100 kBq (27 nCi to 2.7 μCi). Copyright © 2014 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Cuillerdier, C.; Musikas, C.
1993-01-01
Present invention is concerned with new amides with nitrogenous heterocyclic substituent utilizable to separate trivalent actinium series from trivalent lanthanides. In these molecules, it is possible to obtain particularly covalent liaison which has more affinity with 5f series, that is to say actinium series; included a manufacturing process for these amides with nitrogenous heterocyclic substituent
Analysis of the gamma spectra of the uranium, actinium, and thorium decay series
International Nuclear Information System (INIS)
Momeni, M.H.
1981-09-01
This report describes the identification of radionuclides in the uranium, actinium, and thorium series by analysis of gamma spectra in the energy range of 40 to 1400 keV. Energies and absolute efficiencies for each gamma line were measured by means of a high-resolution germanium detector and compared with those in the literature. A gamma spectroscopy method, which utilizes an on-line computer for deconvolution of spectra, search and identification of each line, and estimation of activity for each radionuclide, was used to analyze soil and uranium tailings, and ore
18 CFR 385.207 - Petitions (Rule 207).
2010-04-01
... section 23(b) of the Federal Power Act is treated as a petition for a declaratory order. (c) Except as... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Petitions (Rule 207). 385.207 Section 385.207 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION...
Actinium-225 and Bismuth-213 Alpha Particle Immunotherapy of Cancer
International Nuclear Information System (INIS)
Scheinberg, D.
2013-01-01
Nuclides with appropriate half-lives and emission characteristics that would be potent enough to kill neoplastic cells in the small quantities that reach targets in vivo, include the high linear energy transfer (LET) alpha emitters such as Actinium-225 and Bi-213. We developed methods for the attachment of radiometals via bifunctional chelates to monoclonal antibodies (mAb) without loss of immunoreactivity. We developed alphaemitting Bi-213 lintuzumab constructs, characterized and qualified them in preclinical models, and took them into human clinical trials in patients with AML. Safety, anti-leukemic activity, and complete responses (CR’s) have been demonstrated through phase 2 trilas. Bi-213 is produced in a portable small generator device based on Ac- 225 in the hospital nuclear medicine lab. The isotope is then purified, attached to the antibody, and the product is qualified and processed. Despite this success, the major obstacle to the widespread use of these drugs remains the short 213 Bi half-life (46 minutes), which poses a large logistical hurdle before injection and limits its delivery to only the most accessible cancer cells after injection
Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL
International Nuclear Information System (INIS)
Raeder, S.; Bastin, B.; Block, M.; Creemers, P.; Delahaye, P.; Ferrer, R.; Fléchard, X.; Franchoo, S.; Ghys, L.; Gaffney, L.P.; Granados, C.; Heinke, R.; Hijazi, L.
2016-01-01
To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.
Developments towards in-gas-jet laser spectroscopy studies of actinium isotopes at LISOL
Energy Technology Data Exchange (ETDEWEB)
Raeder, S., E-mail: s.raeder@gsi.de [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Bastin, B. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Block, M. [Helmholtz-Institut Mainz, 55128 Mainz (Germany); GSI Helmholtzzentrum für Schwerionenforschung GmbH, Planckstraße 1, 64291 Darmstadt (Germany); Institut für Kernchemie, Johannes Gutenberg Universität, 55128 Mainz (Germany); Creemers, P. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Delahaye, P. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); Ferrer, R. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Fléchard, X. [LPC Caen, ENSICAEN, Université de Caen, CNRS/IN2P3, Caen (France); Franchoo, S. [Institute de Physique Nucléaire (IPN) d’Orsay, 91406 Orsay, Cedex (France); Ghys, L. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); SCK-CEN, Belgian Nuclear Research Center, Boeretang 200, 2400 Mol (Belgium); Gaffney, L.P.; Granados, C. [KU Leuven, Instituut voor Kern- en Stralingsfysica, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Heinke, R. [Institut für Physik, Johannes Gutenberg Universität, 55128 Mainz (Germany); Hijazi, L. [GANIL, CEA/DSM-CNRS/IN2P3, B.P. 55027, 14076 Caen (France); and others
2016-06-01
To study exotic nuclides at the borders of stability with laser ionization and spectroscopy techniques, highest efficiencies in combination with a high spectral resolution are required. These usually opposing requirements are reconciled by applying the in-gas-laser ionization and spectroscopy (IGLIS) technique in the supersonic gas jet produced by a de Laval nozzle installed at the exit of the stopping gas cell. Carrying out laser ionization in the low-temperature and low density supersonic gas jet eliminates pressure broadening, which will significantly improve the spectral resolution. This article presents the required modifications at the Leuven Isotope Separator On-Line (LISOL) facility that are needed for the first on-line studies of in-gas-jet laser spectroscopy. Different geometries for the gas outlet and extraction ion guides have been tested for their performance regarding the acceptance of laser ionized species as well as for their differential pumping capacities. The specifications and performance of the temporarily installed high repetition rate laser system, including a narrow bandwidth injection-locked Ti:sapphire laser, are discussed and first preliminary results on neutron-deficient actinium isotopes are presented indicating the high capability of this novel technique.
CERN PhotoLab
1976-01-01
The photo shows the fast electronics racks of the experiment R207 by the CERN-Holland-Manchester Collaboration. R207 aimed at the study of diffraction dissociation and formation at small momentum transfers. Gerjan Bobbink and Alan Rudge stand in front of the racks.
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Aesthetics. 240.207 Section 240.207 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES GUIDELINES FOR THE THERMAL PROCESSING OF SOLID WASTES Requirements and Recommended Procedures § 240.207 Aesthetics. ...
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLH207 (Link to dictyBase) - - - Contig-U11514-1 SLH207P (Link to Original site) SLH2...07F 689 SLH207Z 675 SLH207P 1364 - - Show SLH207 Library SL (Link to library) Clone ID SLH2...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-A/SLH207Q.Seq.d/ Representative seq. ID SLH2...07P (Link to Original site) Representative DNA sequence >SLH207 (SLH207Q) /CSM/SL/SLH2-A/SLH2...**yi Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SLH207 (SLH207Q) /CSM/SL/SLH2-A/SLH2
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Hearing. 207.24 Section 207.24 Customs Duties... EXPORTS TO THE UNITED STATES Final Determinations, Short Life Cycle Products § 207.24 Hearing. (a) In general. The Commission shall hold a hearing concerning an investigation before making a final...
2010-01-01
... 7 Agriculture 7 2010-01-01 2010-01-01 false Moisture. 868.207 Section 868.207 Agriculture... Application of Standards § 868.207 Moisture. Water content in rough rice as determined by an approved device..., “approved device” shall include the Motomco Moisture Meter and any other equipment that is approved by the...
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Discovery. 207.109 Section 207.109 Customs Duties... and Committee Proceedings § 207.109 Discovery. (a) Discovery methods. All parties may obtain discovery under such terms and limitations as the administrative law judge may order. Discovery may be by one or...
Lifescience Database Archive (English)
Full Text Available VH (Link to library) VHK207 (Link to dictyBase) - - - Contig-U16260-1 VHK207P (Link to Original site) VHK2...07F 371 VHK207Z 713 VHK207P 1064 - - Show VHK207 Library VH (Link to library) Clone ID VHK2...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHK2-A/VHK207Q.Seq.d/ Representative seq. ID VHK2...07P (Link to Original site) Representative DNA sequence >VHK207 (VHK207Q) /CSM/VH/VHK2-A/VHK2...ducing significant alignments: (bits) Value N ( BJ446805 ) Dictyostelium discoideum cDNA clone:ddv63k21, 3'
2010-04-01
... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Discovery. 498.207 Section 498.207 Employees... § 498.207 Discovery. (a) For the purpose of inspection and copying, a party may make a request to...) Any form of discovery other than that permitted under paragraph (a) of this section, such as requests...
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Hearing. 207.66 Section 207.66 Customs Duties... EXPORTS TO THE UNITED STATES Five-Year Reviews § 207.66 Hearing. (a) In general. The Commission shall hold a hearing in each full review. The date of the hearing shall be specified in the scheduling notice...
5 CFR 430.207 - Monitoring performance.
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Monitoring performance. 430.207 Section 430.207 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PERFORMANCE MANAGEMENT Performance Appraisal for General Schedule, Prevailing Rate, and Certain Other Employees § 430.207...
2010-07-01
... 40 Protection of Environment 5 2010-07-01 2010-07-01 false Test methods. 59.207 Section 59.207 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) NATIONAL... Compound Emission Standards for Consumer Products § 59.207 Test methods. Each manufacturer or importer...
30 CFR 90.207 - Compliance sampling.
2010-07-01
... MANDATORY HEALTH STANDARDS-COAL MINERS WHO HAVE EVIDENCE OF THE DEVELOPMENT OF PNEUMOCONIOSIS Sampling Procedures § 90.207 Compliance sampling. (a) The operator shall take five valid respirable dust samples for... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Compliance sampling. 90.207 Section 90.207...
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Travel time. 630.207 Section 630.207... and General Provisions for Annual and Sick Leave § 630.207 Travel time. The travel time granted an employee under section 6303(d) of title 5, United States Code, is inclusive of the time necessarily...
Lifescience Database Archive (English)
Full Text Available VS (Link to library) VSH207 (Link to dictyBase) - - - Contig-U12548-1 VSH207P (Link... to Original site) VSH207F 228 VSH207Z 107 VSH207P 335 - - Show VSH207 Library VS (Link to library) Clone ID VSH207 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12548-1 Original site URL http://dict...ents: (bits) Value N ( AU267072 ) Dictyostelium discoideum vegetative cDNA clone:VS... 206 2e-58 2 ( AC116982 ) Dict...yostelium discoideum chromosome 2 map 3622643... 206 4e-49 1 ( AU267073 ) Dict
19 CFR 207.69 - Publication of determinations.
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Publication of determinations. 207.69 Section 207.69 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION NONADJUDICATIVE INVESTIGATIONS... SUBSIDIZED EXPORTS TO THE UNITED STATES Five-Year Reviews § 207.69 Publication of determinations. Whenever...
47 CFR 25.207 - Cessation of emissions.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Cessation of emissions. 25.207 Section 25.207 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Technical Standards § 25.207 Cessation of emissions. Space stations shall be made capable of ceasing radio...
42 CFR 50.207 - Sterilization by hysterectomy.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Sterilization by hysterectomy. 50.207 Section 50.207 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES GRANTS POLICIES OF GENERAL APPLICABILITY Sterilization of Persons in Federally Assisted Family Planning Projects § 50.207...
5 CFR 842.207 - Air traffic controllers.
2010-01-01
... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Air traffic controllers. 842.207 Section 842.207 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS (CONTINUED) FEDERAL EMPLOYEES RETIREMENT SYSTEM-BASIC ANNUITY Eligibility § 842.207 Air traffic controllers. (a) An employee who separates from...
47 CFR 90.207 - Types of emissions.
2010-10-01
... 47 Telecommunication 5 2010-10-01 2010-10-01 false Types of emissions. 90.207 Section 90.207... MOBILE RADIO SERVICES General Technical Standards § 90.207 Types of emissions. Unless specified elsewhere in this part, stations will be authorized emissions as provided for in paragraphs (b) through (n) of...
8 CFR 207.7 - Derivatives of refugees.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Derivatives of refugees. 207.7 Section 207... REFUGEES § 207.7 Derivatives of refugees. (a) Eligibility. A spouse, as defined in section 101(a)(35) of..., shall be granted refugee status if accompanying or following-to-join the principal alien. An...
19 CFR 207.11 - Contents of petition.
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Contents of petition. 207.11 Section 207.11... SUBSIDIZED EXPORTS TO THE UNITED STATES Preliminary Determinations § 207.11 Contents of petition. (a) The petition shall be signed by the petitioner or its duly authorized officer, attorney, or agent, and shall...
20 CFR 655.207 - Adverse effect rates.
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Adverse effect rates. 655.207 Section 655.207... Agricultural Employment § 655.207 Adverse effect rates. (a) Except as otherwise provided in this section, the adverse effect rates for all agricultural and logging employment shall be the prevailing wage rates in the...
19 CFR 207.115 - Petition for review.
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Petition for review. 207.115 Section 207.115... and Committee Proceedings § 207.115 Petition for review. (a) The petition and responses. (1) Any party... Secretary a petition for review, except that a party who has defaulted may not petition for review of any...
48 CFR 207.172 - Human research.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Human research. 207.172... OF DEFENSE ACQUISITION PLANNING ACQUISITION PLANNING Acquisition Plans 207.172 Human research. Any DoD component sponsoring research involving human subjects— (a) Is responsible for oversight of...
28 CFR 2.207 - Supervision reports to Commission.
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Supervision reports to Commission. 2.207 Section 2.207 Judicial Administration DEPARTMENT OF JUSTICE PAROLE, RELEASE, SUPERVISION AND RECOMMITMENT OF PRISONERS, YOUTH OFFENDERS, AND JUVENILE DELINQUENTS District of Columbia Supervised Releasees § 2.207 Supervision reports to Commission. A...
31 CFR 800.207 - Covered transaction.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Covered transaction. 800.207 Section 800.207 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF..., which could result in control of a U.S. business by a foreign person. ...
31 CFR 560.207 - Prohibited investment.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Prohibited investment. 560.207... § 560.207 Prohibited investment. Except as otherwise authorized pursuant to this part, and... investment by a United States person in Iran or in property (including entities) owned or controlled by the...
50 CFR 223.207 - Approved TEDs.
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Approved TEDs. 223.207 Section 223.207 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS THREATENED MARINE AND ANADROMOUS SPECIES Restrictions Applicable to Threatened Marine and Anadromous Specie...
2010-07-01
... 40 Protection of Environment 18 2010-07-01 2010-07-01 false [Reserved] 86.207-94 Section 86.207-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) CONTROL OF... Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium-Duty Passenger...
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Policy. 207.171-3 Section... DEFENSE ACQUISITION PLANNING ACQUISITION PLANNING Acquisition Plans 207.171-3 Policy. DoD policy is to... it is anticipated that a prime contract will be awarded without adequate price competition, and the...
49 CFR 393.207 - Suspension systems.
2010-10-01
... braking system. The vehicle shall be level (not tilting to the left or right). Air leakage shall not be... 49 Transportation 5 2010-10-01 2010-10-01 false Suspension systems. 393.207 Section 393.207... NECESSARY FOR SAFE OPERATION Frames, Cab and Body Components, Wheels, Steering, and Suspension Systems § 393...
24 CFR 207.259 - Insurance benefits.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance benefits. 207.259 Section... Contract of Insurance § 207.259 Insurance benefits. (a) Method of payment. Upon either an assignment of the... of mortgage. If the mortgage is assigned to the Commissioner, the insurance benefits shall be paid in...
20 CFR 725.207 - Determination of dependency; divorced spouse.
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Determination of dependency; divorced spouse. 725.207 Section 725.207 Employees' Benefits EMPLOYMENT STANDARDS ADMINISTRATION, DEPARTMENT OF LABOR...) § 725.207 Determination of dependency; divorced spouse. For the purpose of augmenting benefits, an...
49 CFR 195.207 - Transportation of pipe.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Transportation of pipe. 195.207 Section 195.207 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) PIPELINE SAFETY TRANSPORTATION OF HAZARDOUS LIQUIDS BY...
7 CFR 1280.207 - Term of office.
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Term of office. 1280.207 Section 1280.207 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS... INFORMATION ORDER Lamb Promotion, Research, and Information Order Lamb Promotion, Research, and Information...
27 CFR 26.207 - Destruction of marks and brands.
2010-04-01
... brands. 26.207 Section 26.207 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE... Products Coming Into the United States From the Virgin Islands § 26.207 Destruction of marks and brands. The marks, brands, and serial numbers required by this part to be placed on barrels, casks, or similar...
5 CFR 362.207 - Withdrawal and readmission.
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Withdrawal and readmission. 362.207... PRESIDENTIAL MANAGEMENT FELLOWS PROGRAM Program Administration § 362.207 Withdrawal and readmission. (a...) An agency must notify OPM when a Fellow or Senior Fellow withdraws from the Program. (b) Readmission...
40 CFR 6.207 - Environmental impact statements.
2010-07-01
... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Environmental impact statements. 6.207... ACTIONS EPA's NEPA Environmental Review Procedures § 6.207 Environmental impact statements. (a) The Responsible Official will prepare an environmental impact statement (EIS) (see 40 CFR 1508.11) for major...
48 CFR 217.207 - Exercise of options.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Exercise of options. 217..., DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Options 217.207 Exercise of options. (c) In addition to the requirements at FAR 17.207(c), exercise an option only after...
5 CFR 2606.207 - Accounting of disclosures.
2010-01-01
... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Accounting of disclosures. 2606.207... ACT RULES Access to Records and Accounting of Disclosures § 2606.207 Accounting of disclosures. (a... accounting of disclosures will be retained for at least five years or for the life of the record, whichever...
The diarylquinoline TMC207 for multidrug-resistant tuberculosis
Diacon, Andreas H.; Pym, Alexander; Grobusch, Martin; Patientia, Ramonde; Rustomjee, Roxana; Page-Shipp, Liesl; Pistorius, Christoffel; Krause, Rene; Bogoshi, Mampedi; Churchyard, Gavin; Venter, Amour; Allen, Jenny; Palomino, Juan Carlos; de Marez, Tine; van Heeswijk, Rolf P. G.; Lounis, Nacer; Meyvisch, Paul; Verbeeck, Johan; Parys, Wim; de Beule, Karel; Andries, Koen; Mc Neeley, David F.
2009-01-01
BACKGROUND: The diarylquinoline TMC207 offers a new mechanism of antituberculosis action by inhibiting mycobacterial ATP synthase. TMC207 potently inhibits drug-sensitive and drug-resistant Mycobacterium tuberculosis in vitro and shows bactericidal activity in patients who have drug-susceptible
34 CFR 682.207 - Due diligence in disbursing a loan.
2010-07-01
... 34 Education 3 2010-07-01 2010-07-01 false Due diligence in disbursing a loan. 682.207 Section 682.207 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF... § 682.207 Due diligence in disbursing a loan. (a)(1) This section prescribes procedures for lenders to...
27 CFR 44.207a - To a foreign-trade zone.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false To a foreign-trade zone. 44.207a Section 44.207a Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE... of Shipment § 44.207a To a foreign-trade zone. Where tobacco products, and cigarette papers and tubes...
23 CFR 633.207 - Construction labor and materials.
2010-04-01
... 23 Highways 1 2010-04-01 2010-04-01 false Construction labor and materials. 633.207 Section 633... OPERATIONS REQUIRED CONTRACT PROVISIONS Federal-Aid Contracts (Appalachian Contracts) § 633.207 Construction labor and materials. (a) Construction and materials shall be in accordance with the State highway...
41 CFR 101-39.207 - Reimbursement for services.
2010-07-01
... sufficient to recover applicable costs. Failure by using agencies to reimburse GSA for vehicle services will... or neglect. (e) Agencies may be charged for recovery of expenses for repairs or services to GSA IFMS... services. 101-39.207 Section 101-39.207 Public Contracts and Property Management Federal Property...
19 CFR 207.63 - Circulation of draft questionnaires.
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Circulation of draft questionnaires. 207.63... SUBSIDIZED EXPORTS TO THE UNITED STATES Five-Year Reviews § 207.63 Circulation of draft questionnaires. (a) The Director shall circulate draft questionnaires to the parties for comment in each full review. (b...
49 CFR 238.207 - Link between coupling mechanism and car body.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Link between coupling mechanism and car body. 238.207 Section 238.207 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL... Requirements for Tier I Passenger Equipment § 238.207 Link between coupling mechanism and car body. All...
5 CFR 880.207 - Adjustment of accounts after finding of death.
2010-01-01
... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Adjustment of accounts after finding of death. 880.207 Section 880.207 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL... Procedures § 880.207 Adjustment of accounts after finding of death. After a missing annuitant is determined...
1975-01-01
With R207 the CERN-Holland-Manchester Collaboration studied proton-proton diffraction dissociation at small momentum transfer. This followed, at Intersection 2, the study of correlations associated with high transverse momentum particles by Daresbury-Liverpool-RHEL Collaboration (R205) and of multiplicity and rapidity distributions in diffractive collisions by CERN-Holland-Lancaster-Manchester (R206), and used part of the previous set-up.
8 CFR 207.9 - Termination of refugee status.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Termination of refugee status. 207.9... REFUGEES § 207.9 Termination of refugee status. The refugee status of any alien (and of the spouse or child... district director in whose district the alien is found if the alien was not a refugee within the meaning of...
Radiotherapy combined with Tegafur (FT-207s) for brain tumors
International Nuclear Information System (INIS)
Aoki, Yoshiro
1981-01-01
5-Fluorouracil (5-FU) has anti-tumor effects as an anti-metabolite, but it cannot pass the Blood-Brain-Barrier (BBB). FT-207 a masked-compound of 5-FU, is easily lipid soluble and is able to pass the BBB. Twenty eight patients of primary brain tumor and 8 patients of metastatic brain tumor were treated with irradiation combined with 750 mg of FT-207 suppository. Twenty four patients of primary brain tumor were treated only with irradiation as control. The mean survival time was 20.4 +- 11.8 months for the combined therapy group and 17.6 +- 8.6 months for the control. The concentration of FT-207 and 5-FU in serum and in cerebrospinal fluid (CSF) was investigated after administration of 750 mg of FT-207 suppository per annum. The maximum concentration of FT-207 and of 5-FU in serum was 20.4 +- 11.8 mcg/ml and 0.06 +- 0.02 mcg/ml, respectively. There were observed several side effects, such as anorexia, nausea, exanthema and etc. These side effects were not so great as to interrupt the therapy at the dose level of 750 mg of FT-207. However, at the dose of 1500 mg, one case showed disturbance of consciousness, to which attention should be called. (author)
2010-04-01
... INJURY TO DOMESTIC INDUSTRIES RESULTS FROM IMPORTS SOLD AT LESS THAN FAIR VALUE OR FROM SUBSIDIZED... and Committee Proceedings § 207.107 Motions. (a) Presentation and disposition. (1) After issuance of...
9 CFR 113.207 - Encephalomyelitis Vaccine, Eastern, Western, and Venezuelan, Killed Virus.
2010-01-01
..., Western, and Venezuelan, Killed Virus. 113.207 Section 113.207 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.207 Encephalomyelitis...
5 CFR 591.207 - Which areas are COLA areas?
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Which areas are COLA areas? 591.207 Section 591.207 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS ALLOWANCES AND DIFFERENTIALS Cost-of-Living Allowance and Post Differential-Nonforeign Areas Cost-Of-Living...
Nuclear orientation and NMR/ON of sup(205,207)Po
International Nuclear Information System (INIS)
Herzog, P.; Walitzki, H.; Freitag, K.; Hildebrand, H.; Schloesser, K.
1983-01-01
sup(205,207)Po have been implanted with an isotope separator on-line into cold host matrices of Fe, Ni, Zn and Be. Nuclear magnetic resonance of oriented 207 Po has been observed in Fe and Ni, of 205 Po in Fe. From the dependence of the resonance frequency on external magnetic field the g-factor of 207 Po was derived. Using this value the magnetic hyperfine fields of Po in Fe and Ni were obtained. From the temperature dependence of the anisotropies of #betta#-lines in the decay of sup(205,207)Po the multipole mixing of several transitions was derived. The electric interaction frequencies #betta#sub(Q)=eQVsub(zz)/h in the hosts Zn and Be were measured. (orig./WL)
8 CFR 207.6 - Control over approved refugee numbers.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Control over approved refugee numbers. 207... ADMISSION OF REFUGEES § 207.6 Control over approved refugee numbers. Current numerical accounting of approved refugees is maintained for each special group designated by the President. As refugee status is...
A note on {sup 207}Bi in environmental samples
Energy Technology Data Exchange (ETDEWEB)
Bossew, P. [European Commission, DG Joint Research Centre, Institute of Environment and Sustainability, Radioactivity Environmental Monitoring Group. Via Fermi 1, I-21020 Ispra, Vatican City State, Holy See (Italy)]. E-mail: peter.bossew@jrc.it; Lettner, H. [Institute of Physics and Biophysics, University of Salzburg, Hellbrunner Strasse 34, A-5020 Salzburg (Austria)]. E-mail: herbert.lettner@sbg.ac.at; Hubmer, A. [Institute of Physics and Biophysics, University of Salzburg, Hellbrunner Strasse 34, A-5020 Salzburg (Austria)
2006-07-01
Traces of the radionuclide {sup 207}Bi were identified in soil and cryoconite (glacier sediment) samples from Alpine regions of Austria. This nuclide has been produced in thermonuclear explosions mainly in the early 1960s and subsequently dispersed in the atmosphere. Activity concentrations up to 22 Bq/kg d.m. have been found. The ratio {sup 207}Bi:{sup 137}Cs(global fallout) equals (1.70 {+-} 0.12)10{sup -3}, which is in accordance with literature data. When low levels of {sup 207}Bi are assessed by gamma spectrometry, corrections must be made for a gamma line produced in the lead shield by neutron activation due to cosmic neutrons.
48 CFR 616.207 - Firm-fixed-price, level-of-effort term contracts.
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Firm-fixed-price, level-of-effort term contracts. 616.207 Section 616.207 Federal Acquisition Regulations System DEPARTMENT OF STATE CONTRACTING METHODS AND CONTRACT TYPES TYPES OF CONTRACTS Fixed-Price Contracts 616.207 Firm-fixed-price...
48 CFR 16.207 - Firm-fixed-price, level-of-effort term contracts.
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Firm-fixed-price, level-of-effort term contracts. 16.207 Section 16.207 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION CONTRACTING METHODS AND CONTRACT TYPES TYPES OF CONTRACTS Fixed-Price Contracts 16.207 Firm-fixed...
42 CFR 441.207 - Drugs and devices and termination of ectopic pregnancies.
2010-10-01
... APPLICABLE TO SPECIFIC SERVICES Abortions § 441.207 Drugs and devices and termination of ectopic pregnancies... 42 Public Health 4 2010-10-01 2010-10-01 false Drugs and devices and termination of ectopic pregnancies. 441.207 Section 441.207 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF...
24 CFR 207.252e - Method of payment of mortgage insurance premiums.
2010-04-01
... insurance premiums. 207.252e Section 207.252e Housing and Urban Development Regulations Relating to Housing... Premiums § 207.252e Method of payment of mortgage insurance premiums. In the cases that the Commissioner... mortgagees, that mortgage insurance premiums be remitted electronically. [63 FR 1303, Jan. 8, 1998] ...
2010-10-01
... TRANSPORTATION CONTROL OF ALCOHOL AND DRUG USE Post-Accident Toxicological Testing § 219.207 Fatality. (a) In the..., United States Code (but not the agent of the Secretary for purposes of the Federal Tort Claims Act...
The half-life of 207Bi and decays of 211At and 211Po
International Nuclear Information System (INIS)
Yanokura, M.; Kudo, H.; Nakahara, H.; Miyano, K.; Ohya, S.; Nitoh, O.
1978-01-01
The half-life of 207 Bi was obtained from the genetic relation between 207 Po and 207 Bi, and between 211 At and 207 Bi. The half-life was found to be 33.4 +- 0.8 y. The half-life of 207 Po was determined to be 5.81 +- 0.04 h by following the decay of the characteristic γ-rays from 207 Po. The half-life of 211 At was determined to be 7.23 +- 0.02 h by following the decay of γ-rays and α-particles from 211 At and 211 Po. The half-lives determined in the present work for 207 Po and 211 At agree with the literature although the half-life of 207 Bi differs considerably from the currently accepted value of 38 y. The branching ratio of 211 At decaying through EC and α-decay modes was determined together with the branching ratios of the three α-particles emitted from 211 Po. (Auth.)
33 CFR 207.580 - Buffalo Harbor, N.Y.; use, administration, and navigation.
2010-07-01
... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Buffalo Harbor, N.Y.; use, administration, and navigation. 207.580 Section 207.580 Navigation and Navigable Waters CORPS OF ENGINEERS, DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE NAVIGATION REGULATIONS § 207.580 Buffalo Harbor, N.Y.; use...
48 CFR 47.207-2 - Duration of contract and time of performance.
2010-10-01
... performance of segments of a major job; e.g., an office relocation for which the work phases must be... time of performance. 47.207-2 Section 47.207-2 Federal Acquisition Regulations System FEDERAL...-Related Services 47.207-2 Duration of contract and time of performance. The contracting officer shall— (a...
5 CFR 532.207 - Time schedule for wage surveys.
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Time schedule for wage surveys. 532.207... PREVAILING RATE SYSTEMS Prevailing Rate Determinations § 532.207 Time schedule for wage surveys. (a) Wage... and the collection of wage data by visits to establishments. (c) A wage-change survey shall be made...
50 CFR 648.207 - Herring Research Set-Aside (RSA).
2010-10-01
... 50 Wildlife and Fisheries 8 2010-10-01 2010-10-01 false Herring Research Set-Aside (RSA). 648.207... Measures for the Atlantic Herring Fishery § 648.207 Herring Research Set-Aside (RSA). (a) NMFS shall... authorized to utilize RSA, based on the selection criteria described in the RFP. (d) NMFS shall consider each...
31 CFR 515.207 - Entry of vessels engaged in trade with Cuba.
2010-07-01
... with Cuba. 515.207 Section 515.207 Money and Finance: Treasury Regulations Relating to Money and... REGULATIONS Prohibitions § 515.207 Entry of vessels engaged in trade with Cuba. Except as specifically... place in Cuba to engage in the trade of goods or the purchase or provision of services, may enter a U.S...
48 CFR 207.401 - Acquisition considerations.
2010-10-01
..., DEPARTMENT OF DEFENSE ACQUISITION PLANNING ACQUISITION PLANNING Equipment Lease or Purchase 207.401... prepare and provide the contracting officer with the justification supporting the decision to lease or purchase. ...
30 CFR 250.207 - What ancillary activities may I conduct?
2010-07-01
... surveys; or (c) Studies that model potential oil and hazardous substance spills, drilling muds and... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What ancillary activities may I conduct? 250.207 Section 250.207 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE...
7 CFR 1744.207 - Investment not to jeopardize loan security.
2010-01-01
... 7 Agriculture 11 2010-01-01 2010-01-01 false Investment not to jeopardize loan security. 1744.207... SERVICE, DEPARTMENT OF AGRICULTURE POST-LOAN POLICIES AND PROCEDURES COMMON TO GUARANTEED AND INSURED TELEPHONE LOANS Borrower Investments § 1744.207 Investment not to jeopardize loan security. A borrower shall...
33 CFR 207.10 - Charles River, Mass.; dam of Charles River Basin Commission.
2010-07-01
... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Charles River, Mass.; dam of Charles River Basin Commission. 207.10 Section 207.10 Navigation and Navigable Waters CORPS OF ENGINEERS, DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE NAVIGATION REGULATIONS § 207.10 Charles River, Mass.; dam of...
34 CFR 668.207 - Preventing evasion of the consequences of cohort default rates.
2010-07-01
... 34 Education 3 2010-07-01 2010-07-01 false Preventing evasion of the consequences of cohort default rates. 668.207 Section 668.207 Education Regulations of the Offices of the Department of Education... Cohort Default Rates § 668.207 Preventing evasion of the consequences of cohort default rates. (a...
28 CFR 45.3 - Disciplinary proceedings under 18 U.S.C. 207(j).
2010-07-01
.... 207(j). 45.3 Section 45.3 Judicial Administration DEPARTMENT OF JUSTICE (CONTINUED) EMPLOYEE RESPONSIBILITIES § 45.3 Disciplinary proceedings under 18 U.S.C. 207(j). (a) Upon a determination by the Assistant... authorized by 18 U.S.C. 207(j), or subjected to other appropriate disciplinary action under that statute. The...
49 CFR 40.207 - What is the effect of a cancelled drug test?
2010-10-01
... 49 Transportation 1 2010-10-01 2010-10-01 false What is the effect of a cancelled drug test? 40.207 Section 40.207 Transportation Office of the Secretary of Transportation PROCEDURES FOR TRANSPORTATION WORKPLACE DRUG AND ALCOHOL TESTING PROGRAMS Problems in Drug Tests § 40.207 What is the effect of...
41 CFR 101-27.207-3 - Marking material to show extended shelf life.
2010-07-01
... extended shelf life. 101-27.207-3 Section 101-27.207-3 Public Contracts and Property Management Federal...-INVENTORY MANAGEMENT 27.2-Management of Shelf-Life Materials § 101-27.207-3 Marking material to show extended shelf life. When the shelf-life period of Type II material (except for critical end-use items as...
10 CFR 207.8 - Judicial actions.
2010-01-01
... Coordination Act of 1974 § 207.8 Judicial actions. (a) Enforcement of subpoenas; contempt. Any United States... such an order of the court may be punished by the court as contempt. (b) Injunctions. Whenever it...
24 CFR 51.207 - Special circumstances.
2010-04-01
... Handling Conventional Fuels or Chemicals of an Explosive or Flammable Nature § 51.207 Special circumstances..., require the application of this subpart C with respect to a substance not listed in appendix I to this...
Core breaking and octupole low-spin states in $^{207}$ Tl
We propose to study the low-spin level structure of the $^{207}$Tl nucleus populated by the $\\beta$- decay of $^{207}$Hg. While $^{207}$Tl is a single-proton hole nucleus, the majority of the observed states will have a three-particle structure thus requiring the breaking of the neutron or proton core, or a collective octupole phonon coupled to the single proton hole. Thus information will be obtained on the single particle orbitals in the vicinity of the N=126 and Z=82 magic numbers, and on the size of the shell gap. The results will be used to improve the predictive power of the shell model for more exotic nuclei as we move to lighter N=126 nuclei.The experiment will use the ISOLDE Decay station, and will take advantage of the $^{207}$Hg beam from the molten lead target. A test on the feasibility to produce an $^{208}$Hg beam from the same target, with the aim to study the $\\beta$-decay into $^{208}$Tl, could be performed at the same time.
Study of 207Tl126 Produced in Deep-Inelastic Reactions
Directory of Open Access Journals (Sweden)
Wilson E.
2014-03-01
Full Text Available Deep-inelastic collisions of a 208Pb beam on a 208Pb target were performed using the ATLAS accelerator at Argonne National Laboratory. The Gammasphere detector array was used for the detection of prompt and delayed gamma-rays of the reaction products.207Tl is one proton away from the 208Pb doubly-magic nucleus. Its low-energy level structure is dominated by the single proton-hole states πs1/2−1, πd3/2−1 and πh11/2−1. The 11/2− state is isomeric with T1/2 = 1.33(11 s. The reaction partner of 207Tl is 209Bi, which has arelatively well established level scheme compared to 207Tl. Cross-coincidences between these two nuclei were used to confirm or establish levels above the 11/2− isomeric state in 207Tl. These states are obtained via breaking of the neutron core. Angular correlation analysis was performed on known transitions in 208Pb, proving the applicability of this method for multipolarity assignment.
48 CFR 32.207 - Administration and payment of commercial financing payments.
2010-10-01
... contractual information, and the account(s) (see 32.206(d)) to be charged for the payment. (c) Management of... of commercial financing payments. 32.207 Section 32.207 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Commercial Item...
1975-01-01
At the centre, a barrel shaped hodoscope surrounds the beams' crossing point. It was previously used for experiments R205 and R206 which did run in 1974. After their completion in mid 1975 the equipment of R205 was removed, and that of R206 was modified and rearranged to create two small angle spectrometers, one on each side of the intersection, for experiment R207 (diffraction dissociation and formation at small momentum transfer), by the CERN-Holland-Manchester Collaboration. (see also photos 7508109X and 7508113X) Here on the right, Lars Leistam.
49 CFR 375.207 - What items must be in my advertisements?
2010-10-01
... 49 Transportation 5 2010-10-01 2010-10-01 false What items must be in my advertisements? 375.207 Section 375.207 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL MOTOR CARRIER SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION FEDERAL MOTOR CARRIER SAFETY REGULATIONS TRANSPORTATION OF HOUSEHOLD GOODS IN INTERSTATE...
24 CFR 207.252c - Premiums-mortgages insured pursuant to section 238(c) of the Act.
2010-04-01
.... All of the provisions of §§ 207.252 and 207.252a governing mortgage insurance premiums shall apply to... insurance premiums due on such mortgages in accordance with §§ 207.252 and 207.252a shall be calculated on... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Premiums-mortgages insured pursuant...
48 CFR 33.207 - Contractor certification.
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Contractor certification... CONTRACTING REQUIREMENTS PROTESTS, DISPUTES, AND APPEALS Disputes and Appeals 33.207 Contractor certification. (a) Contractors shall provide the certification specified in paragraph (c) of this section when...
21 CFR 207.25 - Information required in registration and drug listing.
2010-04-01
... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Information required in registration and drug listing. 207.25 Section 207.25 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN... manufactured by a registered blood bank, a copy of all current labeling (except that only one representative...
48 CFR 2917.207 - Exercising options.
2010-10-01
... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Exercising options. 2917... AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Options 2917.207 Exercising options. The contracting officer must use a standardized determination and finding before exercising an option in accordance with...
23 CFR 230.207 - Sources of assistance.
2010-04-01
... Services for Minority, Disadvantaged, and Women Business Enterprises § 230.207 Sources of assistance. It is the policy of the FHWA that all potential sources of assistance to minority business enterprises be...
31 CFR 575.207 - Prohibited transactions relating to travel to Iraq or to activities within Iraq.
2010-07-01
... or Iraq; (b) Relating to travel and activities for the conduct of the official business of the United... travel to Iraq or to activities within Iraq. 575.207 Section 575.207 Money and Finance: Treasury... TREASURY IRAQI SANCTIONS REGULATIONS Prohibitions § 575.207 Prohibited transactions relating to travel to...
Near-degeneracy in Excited Vibrational States of 207PbF
Mawhorter, Richard; Nguyen, Alexander; Kim, Yongrak; Biekert, Andreas; Sears, Trevor; Grabow, Jens-Uwe; Kudashov, A. D.; Skripnikov, L. V.; Titov, A. V.; Petrov, A. N.
2017-04-01
High-resolution Fourier transform microwave (FTMW) spectroscopy studies of 207PbF have demonstrated the near-degeneracy of two levels of opposite parity. These have attracted attention for the study of parity violation effects and the variation of fundamental constants using 207PbF. Further theoretical work has improved our detailed understanding of both 207PbF and 208PbF, and furthermore recently indicated that the finely split +/- parity levels grow monotonically closer for higher vibrational states. Our experimental results for v = 0-3 confirm this, and are in excellent agreement with our extended theoretical calculations up to v = 4; both will be presented. TJS acknowledges support from Contract No. DE-SC0012704 with the U.S. Department of Energy, Office of Science, supported by its Division of Chemical Sciences, Geosciences and Biosciences within the Office of Basic Energy Sciences., as do RM, AB, YK, & AN from Pomona College & J-UG from the Deutsche Forschungsgemeinschaft (DFG).
30 CFR 75.207 - Pillar recovery.
2010-07-01
... SAFETY STANDARDS-UNDERGROUND COAL MINES Roof Support § 75.207 Pillar recovery. Pillar recovery shall be... be left in place. (b) Before mining is started in a pillar split or lift— (1) At least two rows of breaker posts or equivalent support shall be installed— (i) As close to the initial intended breakline as...
40 CFR 2.207 - Class determinations.
2010-07-01
... Confidentiality of Business Information § 2.207 Class determinations. (a) The General Counsel may make and issue a... items of business information; (2) One or more characteristics common to all such items of information... § 2.204(b)(1), § 2.204(d), § 2.205(d), or § 2.206. However, the existence of a class determination...
19 CFR 207.8 - Questionnaires to have the force of subpoenas; subpoena enforcement.
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Questionnaires to have the force of subpoenas; subpoena enforcement. 207.8 Section 207.8 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION... Questionnaires to have the force of subpoenas; subpoena enforcement. Any questionnaire issued by the Commission...
48 CFR 47.207-5 - Contractor responsibilities.
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Contractor....207-5 Contractor responsibilities. Contractor responsibilities vary with the kinds of freight to be... furnished by the contractor. Otherwise, state that the contractor shall furnish clean and sound closed-type...
High-power diode-side-pumped rod Tm:YAG laser at 2.07 μm.
Wang, Caili; Niu, Yanxiong; Du, Shifeng; Zhang, Chao; Wang, Zhichao; Li, Fangqin; Xu, Jialin; Bo, Yong; Peng, Qinjun; Cui, Dafu; Zhang, Jingyuan; Xu, Zuyan
2013-11-01
We report a high-power diode-laser (LD) side-pumped rod Tm:YAG laser of around 2 μm. The laser was water-cooled at 8°C and yielded a maximum output power of 267 W at 2.07 μm, which is the highest output power for an all solid-state cw 2.07 μm rod Tm:YAG laser reported as far as we know. The corresponding optical-optical conversion efficiency was 20.7%, and the slope efficiency was about 29.8%, respectively.
48 CFR 317.207 - Exercise of options.
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Exercise of options. 317... METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Options 317.207 Exercise of options. (h) Before exercising an option for a subsequent performance period/additional quantity under a multiple-year contract...
48 CFR 1517.207 - Exercise of options.
2010-10-01
... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Exercise of options. 1517... CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Options 1517.207 Exercise of options. (a) Unless otherwise approved by the Chief of the Contracting Office, contracts for services employing option...
5 CFR 551.207 - Professional exemption criteria.
2010-01-01
... Section 551.207 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PAY... criteria. To qualify for the professional exemption, an employee's primary duty must be the performance of work requiring knowledge of an advanced type in a field of science or learning customarily acquired by...
19 CFR 207.102 - Initiation of proceedings.
2010-04-01
... SUBSIDIZED EXPORTS TO THE UNITED STATES Implementing Regulations for the North American Free Trade Agreement... and Committee Proceedings § 207.102 Initiation of proceedings. (a) Upon completion of the inquiry, (1... charged is beyond the jurisdiction of the Commission and within the jurisdiction of another Free Trade...
Resonance capture cross section of 207Pb
Domingo-Pardo, C.; Aerts, G.; Alvarez-Pol, H.; Alvarez-Velarde, F.; Andriamonje, S.; Andrzejewski, J.; Assimakopoulos, P.; Audouin, L.; Badurek, G.; Baumann, P.; Becvar, F.; Berthoumieux, E.; Bisterzo, S.; Calvino, F.; Cano-Ott, D.; Capote, R.; Carrapico, C.; Cennini, P.; Chepel, V.; Chiaveri, E.; Colonna, N.; Cortes, G.; Couture, A.; Cox, J.; Dahlfors, M.; David, S.; Dillman, I.; Dolfini, R.; Dridi, W.; Duran, I.; Eleftheriadis, C.; Embid-Segura, M.; Ferrant, L.; Ferrari, A.; Ferreira-Marques, R.; Fitzpatrick, L.; Frais-Koelbl, H.; Fujii, K.; Furman, W.; Gallino, R.; Goncalves, I.; Gonzalez-Romero, E.; Goverdovski, A.; Gramegna, F.; Griesmayer, E.; Guerrero, C.; Gunsing, F.; Haas, B.; Haight, R.; Heil, M.; Herrera-Martinez, A.; Igashira, M.; Isaev, S.; Jericha, E.; Kadi, Y.; Kappeler, F.; Karamanis, D.; Karadimos, D.; Kerveno, M.; Ketlerov, V.; Koehler, P.; Konovalov, V.; Kossionides, E.; Krticka, M.; Lamboudis, C.; Leeb, H.; Lindote, A.; Lopes, I.; Lozano, M.; Lukic, S.; Marganiec, J.; Marrone, S.; Mastinu, P.; Mengoni, A.; Milazzo, P.M.; Moreau, C.; Mosconi, M.; Neves, F.; Oberhummer, H.; Oshima, M.; O'Brien, S.; Pancin, J.; Papachristodoulou, C.; Papadopoulos, C.; Paradela, C.; Patronis, N.; Pavlik, A.; Pavlopoulos, P.; Perrot, L.; Plag, R.; Plompen, A.; Plukis, A.; Poch, A.; Pretel, C.; Quesada, J.; Rauscher, T.; Reifarth, R.; Rosetti, M.; Rubbia, C.; Rudolf, G.; Rullhusen, P.; Salgado, J.; Sarchiapone, L.; Savvidis, I.; Stephan, C.; Tagliente, G.; Tain, J.L.; Tassan-Got, L.; Tavora, L.; Terlizzi, R.; Vannini, G.; Vaz, P.; Ventura, A.; Villamarin, D.; Vincente, M.C.; Vlachoudis, V.; Vlastou, R.; Voss, F.; Walter, S.; Wendler, H.; Wiescher, M.; Wisshak, K.
2006-01-01
The radiative neutron capture cross section of 207Pb has been measured at the CERN neutron time of flight installation n_TOF using the pulse height weighting technique in the resolved energy region. The measurement has been performed with an optimized setup of two C6D6 scintillation detectors, which allowed us to reduce scattered neutron backgrounds down to a negligible level. Resonance parameters and radiative kernels have been determined for 16 resonances by means of an R-matrix analysis in the neutron energy range from 3 keV to 320 keV. Good agreement with previous measurements was found at low neutron energies, whereas substantial discrepancies appear beyond 45 keV. With the present results, we obtain an s-process contribution of 77(8)% to the solar abundance of 207Pb. This corresponds to an r-process component of 23(8)%, which is important for deriving the U/Th ages of metal poor halo stars.
33 CFR 207.600 - Rochester (Charlotte) Harbor, N.Y.; use, administration, and navigation.
2010-07-01
... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Rochester (Charlotte) Harbor, N.Y.; use, administration, and navigation. 207.600 Section 207.600 Navigation and Navigable Waters CORPS OF... (Charlotte) Harbor, N.Y.; use, administration, and navigation. (a)-(b) [Reserved] (c) No vessel shall moor or...
48 CFR 517.207 - Exercise of options.
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Exercise of options. 517... METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Options 517.207 Exercise of options. Before exercising an option, you must: (a) Synopsize it unless you meet of the following conditions: (1) The option...
48 CFR 3417.207 - Exercise of options.
2010-10-01
... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Exercise of options. 3417... REGULATION CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Options 3417.207 Exercise of options. If any provision in a contract requires that an option may only be exercised within a specified...
48 CFR 17.207 - Exercise of options.
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Exercise of options. 17... METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Options 17.207 Exercise of options. (a) When exercising an option, the contracting officer shall provide written notice to the contractor within the time...
30 CFR 204.207 - Who will approve, deny, or modify my request for accounting and auditing relief?
2010-07-01
... for accounting and auditing relief? 204.207 Section 204.207 Mineral Resources MINERALS MANAGEMENT... Accounting and Auditing Relief § 204.207 Who will approve, deny, or modify my request for accounting and auditing relief? (a) If there is not a State concerned for your marginal property, only MMS will decide...
33 CFR 207.60 - Federal Dam, Hudson River, Troy, N.Y.; pool level.
2010-07-01
... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Federal Dam, Hudson River, Troy, N.Y.; pool level. 207.60 Section 207.60 Navigation and Navigable Waters CORPS OF ENGINEERS..., N.Y.; pool level. (a) Whenever the elevation of the pool created by the Federal dam at Troy, N.Y...
21 CFR 207.26 - Amendments to registration.
2010-04-01
... made for the purpose of changing the name of the manufacturer of a drug product under § 201.1 of this chapter. Changes in the names of officers and directors of the corporations do not require such amendment... Domestic Drug Establishments § 207.26 Amendments to registration. Changes in individual ownership...
2010-04-01
... amount fixed by the Office under the regulations in this part shall deposit any negotiable securities... deposited; conditions of deposit; acceptance of deposits. 703.207 Section 703.207 Employees' Benefits... AND RELATED STATUTES INSURANCE REGULATIONS Insurance Carrier Security Deposit Requirements § 703.207...
9 CFR 381.207 - Small importations for consignee's personal use, display, or laboratory analysis.
2010-01-01
... MEAT AND POULTRY PRODUCTS INSPECTION AND VOLUNTARY INSPECTION AND CERTIFICATION POULTRY PRODUCTS... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Small importations for consignee's personal use, display, or laboratory analysis. 381.207 Section 381.207 Animals and Animal Products FOOD...
20 CFR 726.207 - Discharge by the carrier of obligations and duties of operator.
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Discharge by the carrier of obligations and duties of operator. 726.207 Section 726.207 Employees' Benefits EMPLOYMENT STANDARDS ADMINISTRATION, DEPARTMENT OF LABOR FEDERAL COAL MINE HEALTH AND SAFETY ACT OF 1969, AS AMENDED BLACK LUNG BENEFITS...
27 CFR 9.207 - Outer Coastal Plain.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Outer Coastal Plain. 9.207... Outer Coastal Plain. (a) Name. The name of the viticultural area described in this section is “Outer Coastal Plain”. For purposes of part 4 of this chapter, “Outer Coastal Plain” is a term of viticultural...
207Pb and 205Tl NMR on Perovskite Type Crystals APbX3 (A = Cs, Tl, X = Br, I)
Sharma, Surendra; Weiden, Norbert; Weiss, Alarich
1987-11-01
By 205Tl and 207Pb NM R the chemical shift in polycrystalline samples of binary halides AX, BX2 and ternary halides ABX3 (A = Cs, Tl; B = Pb; X = Br, I) was studied at room temperature. The chemical shift tensors δ ( 205Tl) and δ (207Pb) were determined in magnitude and orientation on single crystals of the orthorhombic TlPbI3. The components of the δ(205Tl) tensor are δx (205Tl) || a = 611ppm; δy (205Tl) || b = 680 ppm; δZ(205Tl) || c = 1329 ppm; δiso(205Tl) = 873.3 ppm (with respect to 3.4 molar aqueous solution of TlOOCCH3). The chemical shift tensor of 207Pb in TlPbI3 shows two orientations. One of them is: δx (207Pb) = 3760 ppm, inclined 30° from b towards c, δy(207Pb) || a = 3485 ppm, δz(207Pb) = 2639 ppm inclined 120° from b towards c. δiso(207Pb) = 3295 ppm (with respect to saturated aqueous solution of Pb(NO3)2). The results are discussed with respect to the crystal structure and a model to explain orientation and anisotropy of the tensors δ(205Tl) and δ(207Pb) in TlPbI3 is proposed. In the system CsPbBr3-x Ix δ(207Pb) was studied on polycrystalline samples. The chemical shift increases with increasing x and negative excess shift is observed.
24 CFR 983.207 - Condition of contract units.
2010-04-01
... URBAN DEVELOPMENT PROJECT-BASED VOUCHER (PBV) PROGRAM Housing Assistance Payments Contract § 983.207... in accordance with the HQS. The PHA may not make any HAP payment to the owner for a contract unit.... Such remedies include termination of housing assistance payments, abatement or reduction of housing...
12 CFR 207.6 - Disclosure of covered agreements.
2010-01-01
... DISCLOSURE AND REPORTING OF CRA-RELATED AGREEMENTS (REGULATION G) § 207.6 Disclosure of covered agreements... CRA public file by insured depository institution or affiliate. An insured depository institution and...) by placing a copy of the covered agreement in the insured depository institution's CRA public file if...
12 CFR 207.11 - Other definitions and rules of construction used in this part.
2010-01-01
... THE FEDERAL RESERVE SYSTEM DISCLOSURE AND REPORTING OF CRA-RELATED AGREEMENTS (REGULATION G) § 207.11... (ii) The NGEP that is a party to the agreement makes a CRA communication, as described in § 207.3. (b) Control. “Control” is defined in section 2(a) of the Bank Holding Company Act (12 U.S.C. 1841(a)). (c) CRA...
48 CFR 415.207 - Handling proposals and information.
2010-10-01
... Information 415.207 Handling proposals and information. (a) Throughout the source selection process, agency... Proposals RFP Offeror 1. To the best of my knowledge and belief, no conflict of interest exists that may... otherwise result in a biased opinion or an unfair advantage. If a potential conflict of interest arises or...
12 CFR 207.4 - Fulfillment of the CRA.
2010-01-01
... REPORTING OF CRA-RELATED AGREEMENTS (REGULATION G) § 207.4 Fulfillment of the CRA. (a) List of factors that... party to the agreement— (i) Home-purchase, home-improvement, small business, small farm, community... institution that is evaluated on the basis of a strategic plan, any element of the strategic plan, as...
2010-07-01
... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false St. Lawrence River, Cape Vincent Harbor, N.Y.; use, administration, and navigation of the harbor and U.S. breakwater. 207.610 Section 207... NAVIGATION REGULATIONS § 207.610 St. Lawrence River, Cape Vincent Harbor, N.Y.; use, administration, and...
2010-07-01
... AGENCY RESPONSIBILITIES 71-AGENCY TRAVEL ACCOUNTABILITY REQUIREMENTS Travel Claims for Reimbursement... should submit a travel claim (including whether to use a standard form or an agency form and whether the... and procedures must we establish for travel reimbursement? 301-71.207 Section 301-71.207 Public...
48 CFR 1815.207-70 - Release of proposal information.
2010-10-01
... Announcements of Opportunity and NASA Research Announcements; (ii) Unsolicited proposals; and (iii) SBIR and... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Release of proposal... Receipt of Proposals and Information 1815.207-70 Release of proposal information. (a) NASA personnel...
27 CFR 46.207 - Articles held in bond.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Articles held in bond. 46... Tubes Held for Sale on April 1, 2009 Inventories § 46.207 Articles held in bond. If the dealer is a manufacturer or an export warehouse proprietor and holds articles in TTB bond on April 1, 2009, the floor...
14 CFR 135.207 - VFR: Helicopter surface reference requirements.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false VFR: Helicopter surface reference... VFR/IFR Operating Limitations and Weather Requirements § 135.207 VFR: Helicopter surface reference requirements. No person may operate a helicopter under VFR unless that person has visual surface reference or...
48 CFR 36.207 - Pricing fixed-price construction contracts.
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Pricing fixed-price... Contracting for Construction 36.207 Pricing fixed-price construction contracts. (a) Generally, firm-fixed... methods. (b) Lump-sum pricing shall be used in preference to unit pricing except when— (1) Large...
30 CFR 70.207 - Bimonthly sampling; mechanized mining units.
2010-07-01
... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Bimonthly sampling; mechanized mining units. 70... MINE SAFETY AND HEALTH MANDATORY HEALTH STANDARDS-UNDERGROUND COAL MINES Sampling Procedures § 70.207 Bimonthly sampling; mechanized mining units. (a) Each operator shall take five valid respirable dust samples...
48 CFR 52.207-5 - Option To Purchase Equipment.
2010-10-01
... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Option To Purchase....207-5 Option To Purchase Equipment. As prescribed in 7.404, insert a clause substantially the same as the following: Option To Purchase Equipment (FEB 1995) (a) The Government may purchase the equipment...
15 CFR 2011.207 - Suspension of the certificate system.
2010-01-01
..., SYRUPS AND MOLASSES Specialty Sugar § 2011.207 Suspension of the certificate system. (a) Suspension. The.... Notice of such suspension and the effective date thereof shall be published in the Federal Register. (b... such reinstatement and the effective date thereof shall be published in the Federal Register. (c...
In vivo release of FT-207 from irradiation polymerized composites
International Nuclear Information System (INIS)
Xie Huaijiang; Kou Qinghe; Song Juzhong; Peng Tao; Chen Xiaohui; Zhang Dexi
1999-01-01
Polymer-drugs composite with long periods of controlled slow release was made by radiation induced polymerization in room temperature. In experiment in vivo, the composite was implanted subcutaneously the back of rabbits. The concentration of 1-(2-tetrahydrofuryl)-5-fluorouracil (FT-207) was determined by HPLC. The results of test showed that the concentration of serum drug is 1.0 μg/mL after 1 week in the polymer-drug composites group. The drug concentration of tissue surrounding the composites is 76.2 +- 10.4 μg/mL. The drug concentration in the far organ (e.g.the lung 1.2 +- 0.5 μg/mL) is lower than the tissue surrounding the composite. The serum drug is higher and shorter time by the routine methods. The serum concentration of FT-207 is lower an retarded by implanted
Isomer shifts of the octupole doublet in muonic 207Pb
International Nuclear Information System (INIS)
Budick, B.; Anigstein, R.; Kast, J.W.
1980-01-01
Isomer shifts in the doublet 5/2 + , 7/2 + levels in muonic 207 Pb have been measured. The shifts are essentially the same as in the core 3 - collective state. They support the hypothesis that the octupole vibration does not conserve volume. (orig.)
International Nuclear Information System (INIS)
Slama, Nedra; Lazim, Hadeer; Barkallah, Insaf; Limam, Ferid
2008-01-01
A distinct streptomyces strains were isolated from Tunisian soil. the isolate designed CN207, was assigned to the genus streptomyces on the basis of morphological and chemotaxonomic criteria. A 16S rDNA sequence of the isolate was determined. Streptomyces sp CN207 secreted large amount antibiotic against gram positive bacteria, gram negative bacteria, yeast and fungi on his barley (HB) medium. (HB) medium was found to be suitable substrate of the medium for CN207 production. Maximum yield of CN207 product (700 mg/ml) after optimize fermentation process. Bioactive molecules from strain CN207 were extracted with ethyl acetate and analyzed by PTLC using silica gel plates.The separated compounds were visualiszed under UV at 254 nm and the active spots were detected by bioautography on silica gel plates using salmonella thyphimurium NRRL B4420 and Staphylococcus aureus CDC 103 as indicator microorganisms. The crude extract (8.36 g) was fractionated on Sep-pack column (C18 cartridge) and elution was performed using a discontinue gradient of methanol-water. Two active fractions eluted by 20% and 40% of methanol were obtained. The bioactive compounds were separated by preparative high performance liquid chromatography (HPLC) on a C18 reversed phase column and eluted with a linear gradient of acetonitrile -water in presence of 0.1% formic acid. The peaks were collected separately, concentrated and bioassayed against the routine indicator microorganisms. The absorption spectrum of the active molecules was determined with a shimadzu UV-160 a spectrophotometer. Determination of the chemical structure of these compounds on the basis on their IR, COSY and H 1: C13 is in progress
33 CFR 207.590 - Black Rock Canal and Lock at Buffalo, N.Y.; use, administration, and navigation.
2010-07-01
... Buffalo, N.Y.; use, administration, and navigation. 207.590 Section 207.590 Navigation and Navigable... Black Rock Canal and Lock at Buffalo, N.Y.; use, administration, and navigation. (a) The term “canal... immediately to the Black Rock Lock, foot of Bridge Street, Buffalo, N.Y., telephone 876-5454. (k) Ferry Street...
International Nuclear Information System (INIS)
Boutin, D.
2005-08-01
The first experimental observation of bound-state beta-decay showed, that due solely to the electron stripping, a stable nuclide, e.g. 163 Dy, became unstable. Also a drastic modification of the half-life of bare 187 Re, from 4.12(2) x 10 10 years down to 32.9(20) years, could be observed. It was mainly due to the possibility for the mother nuclide to decay into a previously inaccessible nuclear level of the daughter nuclide. It was proposed to study a nuclide where this decay mode was competing with continuum-state beta-decay, in order to measure their respective branchings. The ratio β b /β c could also be evaluated for the first time. 207 Tl was chosen due to its high atomic number, and Q-value of about 1.4 MeV, small enough to enhance the β b probability and large enough to allow the use of time-resolved Schottky Mass Spectrometry (SMS) to study the evolution of mother and bound-state beta-decay daughter ions. The decay properties of the ground state and isomeric state of 207 Tl 81+ have been investigated at the GSI accelerator facility in two separate experiments. For the first time β-decay where the electron could go either to a bound state (atomic orbitals) and lead to 207 Pb 81+ as a daughter nuclide, or to a continuum state and lead to 207 Pb 82+ , has been observed. The respective branchings of these two processes could be measured as well. The deduced total nuclear half-life of 255(17) s for 207 Tl 81+ , was slightly modified with respect to the half-life of the neutral atom of 286(2) s. It was nevertheless in very good agreement with calculations based on the assumption that the beta-decay was following an allowed type of transition. The branching β b /β c =0.192(20), was also in very good agreement with the same calculations. The application of stochastic precooling allowed to observe in addition the 1348 keV short-lived isomeric state of 207 Tl. The half-life of this isomeric state was measured as 1.47(32) s, which shows a small deviation
12 CFR 207.5 - Related agreements considered a single agreement.
2010-01-01
... RESERVE SYSTEM DISCLOSURE AND REPORTING OF CRA-RELATED AGREEMENTS (REGULATION G) § 207.5 Related... of the CRA. (b) Substantively related contracts. All written contracts to which an insured depository... each such contract is in fulfillment of the CRA, if the contracts were negotiated in a coordinated...
49 CFR 399.207 - Truck and truck-tractor access requirements.
2010-10-01
.... Exception. If air and electrical connections necessary to couple or uncouple a truck-tractor from a trailer... 49 Transportation 5 2010-10-01 2010-10-01 false Truck and truck-tractor access requirements. 399... Vehicles § 399.207 Truck and truck-tractor access requirements. (a) General rule. Any person entering or...
49 CFR 236.207 - Electric lock on hand-operated switch; control.
2010-10-01
..., AND APPLIANCES Automatic Block Signal Systems Standards § 236.207 Electric lock on hand-operated switch; control. Electric lock on hand-operated switch shall be controlled so that it cannot be unlocked... 49 Transportation 4 2010-10-01 2010-10-01 false Electric lock on hand-operated switch; control...
46 CFR 308.207 - War risk protection and indemnity insurance policy.
2010-10-01
... 46 Shipping 8 2010-10-01 2010-10-01 false War risk protection and indemnity insurance policy. 308... OPERATIONS WAR RISK INSURANCE War Risk Protection and Indemnity Insurance § 308.207 War risk protection and indemnity insurance policy. The standard form of war risk protection and indemnity insurance policy, Form MA...
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false How does a State meet the requirement for universal access to services provided under the Act? 652.207 Section 652.207 Employees' Benefits EMPLOYMENT... exercising this discretion, a State must meet the Act's requirements. (b) These requirements are: (1) Labor...
14 CFR 302.207 - Cases to be decided on written submissions.
2010-01-01
... administrative law judge is otherwise required by the public interest. (b) The standards employed in deciding... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Cases to be decided on written submissions....207 Cases to be decided on written submissions. (a) Applications under this subpart will be decided on...
Energy Technology Data Exchange (ETDEWEB)
Boutin, D.
2005-08-01
The first experimental observation of bound-state beta-decay showed, that due solely to the electron stripping, a stable nuclide, e.g. {sup 163}Dy, became unstable. Also a drastic modification of the half-life of bare {sup 187}Re, from 4.12(2) x 10{sup 10} years down to 32.9(20) years, could be observed. It was mainly due to the possibility for the mother nuclide to decay into a previously inaccessible nuclear level of the daughter nuclide. It was proposed to study a nuclide where this decay mode was competing with continuum-state beta-decay, in order to measure their respective branchings. The ratio {beta}{sub b}/{beta}{sub c} could also be evaluated for the first time. {sup 207}Tl was chosen due to its high atomic number, and Q-value of about 1.4 MeV, small enough to enhance the {beta}{sub b} probability and large enough to allow the use of time-resolved Schottky Mass Spectrometry (SMS) to study the evolution of mother and bound-state beta-decay daughter ions. The decay properties of the ground state and isomeric state of {sup 207}Tl{sup 81+} have been investigated at the GSI accelerator facility in two separate experiments. For the first time {beta}-decay where the electron could go either to a bound state (atomic orbitals) and lead to {sup 207}Pb{sup 81+} as a daughter nuclide, or to a continuum state and lead to {sup 207}Pb{sup 82+}, has been observed. The respective branchings of these two processes could be measured as well. The deduced total nuclear half-life of 255(17) s for {sup 207}Tl{sup 81+}, was slightly modified with respect to the half-life of the neutral atom of 286(2) s. It was nevertheless in very good agreement with calculations based on the assumption that the beta-decay was following an allowed type of transition. The branching {beta}{sub b}/{beta}{sub c}=0.192(20), was also in very good agreement with the same calculations. The application of stochastic precooling allowed to observe in addition the 1348 keV short-lived isomeric state of {sup
Buonanno, Manuela; Stanislauskas, Milda; Ponnaiya, Brian; Bigelow, Alan W; Randers-Pehrson, Gerhard; Xu, Yanping; Shuryak, Igor; Smilenov, Lubomir; Owens, David M; Brenner, David J
2016-01-01
UVC light generated by conventional germicidal lamps is a well-established anti-microbial modality, effective against both bacteria and viruses. However, it is a human health hazard, being both carcinogenic and cataractogenic. Earlier studies showed that single-wavelength far-UVC light (207 nm) generated by excimer lamps kills bacteria without apparent harm to human skin tissue in vitro. The biophysical explanation is that, due to its extremely short range in biological material, 207 nm UV light cannot penetrate the human stratum corneum (the outer dead-cell skin layer, thickness 5-20 μm) nor even the cytoplasm of individual human cells. By contrast, 207 nm UV light can penetrate bacteria and viruses because these cells are physically much smaller. To test the biophysically-based hypothesis that 207 nm UV light is not cytotoxic to exposed mammalian skin in vivo. Hairless mice were exposed to a bactericidal UV fluence of 157 mJ/cm2 delivered by a filtered Kr-Br excimer lamp producing monoenergetic 207-nm UV light, or delivered by a conventional 254-nm UV germicidal lamp. Sham irradiations constituted the negative control. Eight relevant cellular and molecular damage endpoints including epidermal hyperplasia, pre-mutagenic UV-associated DNA lesions, skin inflammation, and normal cell proliferation and differentiation were evaluated in mice dorsal skin harvested 48 h after UV exposure. While conventional germicidal UV (254 nm) exposure produced significant effects for all the studied skin damage endpoints, the same fluence of 207 nm UV light produced results that were not statistically distinguishable from the zero exposure controls. As predicted by biophysical considerations and in agreement with earlier in vitro studies, 207-nm light does not appear to be significantly cytotoxic to mouse skin. These results suggest that excimer-based far-UVC light could potentially be used for its anti-microbial properties, but without the associated hazards to skin of conventional
Buonanno, Manuela; Stanislauskas, Milda; Ponnaiya, Brian; Bigelow, Alan W.; Randers-Pehrson, Gerhard; Xu, Yanping; Shuryak, Igor; Smilenov, Lubomir; Owens, David M.; Brenner, David J.
2016-01-01
Background UVC light generated by conventional germicidal lamps is a well-established anti-microbial modality, effective against both bacteria and viruses. However, it is a human health hazard, being both carcinogenic and cataractogenic. Earlier studies showed that single-wavelength far-UVC light (207 nm) generated by excimer lamps kills bacteria without apparent harm to human skin tissue in vitro. The biophysical explanation is that, due to its extremely short range in biological material, 207 nm UV light cannot penetrate the human stratum corneum (the outer dead-cell skin layer, thickness 5–20 μm) nor even the cytoplasm of individual human cells. By contrast, 207 nm UV light can penetrate bacteria and viruses because these cells are physically much smaller. Aims To test the biophysically-based hypothesis that 207 nm UV light is not cytotoxic to exposed mammalian skin in vivo. Methods Hairless mice were exposed to a bactericidal UV fluence of 157 mJ/cm2 delivered by a filtered Kr-Br excimer lamp producing monoenergetic 207-nm UV light, or delivered by a conventional 254-nm UV germicidal lamp. Sham irradiations constituted the negative control. Eight relevant cellular and molecular damage endpoints including epidermal hyperplasia, pre-mutagenic UV-associated DNA lesions, skin inflammation, and normal cell proliferation and differentiation were evaluated in mice dorsal skin harvested 48 h after UV exposure. Results While conventional germicidal UV (254 nm) exposure produced significant effects for all the studied skin damage endpoints, the same fluence of 207 nm UV light produced results that were not statistically distinguishable from the zero exposure controls. Conclusions As predicted by biophysical considerations and in agreement with earlier in vitro studies, 207-nm light does not appear to be significantly cytotoxic to mouse skin. These results suggest that excimer-based far-UVC light could potentially be used for its anti-microbial properties, but without
Analisis Film Horor Indonesia Produksi Tahun 2014 (Studi Kasus: Mall Klender dan Kamar 207
Directory of Open Access Journals (Sweden)
Dedi Sukatno Sembiring Meliala
2016-02-01
Full Text Available Abstrak Film horor erat kaitannya dengan tokoh antagonis yang menimbulkan ketakutan pada penonton dalam bentuk makhluk supranatural seperti hantu, roh jahat dan sebagainya. Karakteristik film dengan genre horor membuat penonton terbawa suasana dengan alur ceritanya yang menakutkan. Namun, beberapa dari film horor Indonesia menyajikan adegan-adegan yang kurang sopan bahkan tergolong asusila atau porno. Untuk itu, penelitian ini ingin melihat apakah terdapat konten pornografi pada film Mall Klender dan Kamar 207 yang merupakan film horor Indonesia terlaris di tahun 2014. Analisis dilakukan dengan melihat pandangan dan penilaian 30 responden dengan karakteristik yaitu penonton film horor Indonesia yang berusia 20-40 tahun. Berdasarkan hasil analisis, tidak didapatkan konten pornografi pada film Mall Klender dan Kamar 207. Adegan-adegan yang terindikasi sebagai konten pornografi ternyata masih dapat diterima oleh penonton sebagai adegan yang berada dalam batas kewajaran dan mendukung pembawaan suasana dan kesan dalam cerita yang disampaikan. Kata Kunci: film horror Indonesia, analisis konten, pornografi Abstract The horror film is closely related to the antagonist that causes fear for audience in the form of supernatural creatures such as ghosts, demons and so on. Characteristic of the horor film is to make the audience carried away with the scary plot. However, some of the existing Indonesian horror film presents scenes that classified as obscene or pornographic. Therefore, this study wanted to see if there are any pornographic content on the film Klender Mall and Room 207 is the best-selling Indonesian horror movie in 2014. The analysis was done by looking at the view and assessment of 30 respondents which are Indonesian horror movie goers aged 20-40 years. Based on the analysis, there is no founding of pornographic content on the film Klender Mall and Room 207. The scenes that indicated as pornographic content was still acceptable by the audience
Investigation of 207 nm UV radiation for degradation of organic dye ...
African Journals Online (AJOL)
The photo-degradation of organic dye C.I. Acid Red 213 (AR-213) was achieved by 207 nm UV radiation emitted from a planar KrBr* excimer lamp without addition of oxidants at varying initial pH values. Precipitates were found to be generated when the irradiated solution of initial acid pH was adjusted to alkaline pH and ...
206Pb/207Pb ratios in dry deposit samples from the Metropolitan Zone of Mexico Valle
International Nuclear Information System (INIS)
Martinez, T.; Lartigue, J.; Marquez, C.
2007-01-01
206 Pb/ 207 Pb isotope ratios of dry deposit samples in the Metropolitan Zone of Mexico Valley (MZMV) were determined and correlated with some contemporary environmental material such as gasoline, urban dust, etc., as possible pollution sources, the latter presenting different signatures. 206 Pb/ 207 Pb ratios were determined in samples 'as is' by ICP-MS, using an Elan-6100. A standard material NIST-981 was used to monitor accuracy and to correct mass fractionation. The calculated enrichment factors of lead (taking rubidium as a conservative endogenous element) show its anthropogenic origin with percentages higher than 97.65%. 206 Pb/ 207 Pb ratio in dry deposit samples ranges from 0.816 to a maximum of 1.154, following a normal distribution. Arithmetic mean was 0.9967±0.0864 lower than those of possible pollution sources: 1.1395±0.0165 for gasoline, 1.071±0.008 for industrially derived lead and, for the more radiogenic natural soil and urban dust values ranging from 1.2082±0.022 to 1.211±0.108. The possible origin of lead in gasoline used prior to 1960 is discussed. (author)
33 CFR 207.50 - Hudson River Lock at Troy, N.Y.; navigation.
2010-07-01
... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Hudson River Lock at Troy, N.Y..., DEPARTMENT OF DEFENSE NAVIGATION REGULATIONS § 207.50 Hudson River Lock at Troy, N.Y.; navigation. (a...) [Reserved] (n) Trespass on U.S. property. Trespass on U.S. property, or willful injury to the banks, masonry...
48 CFR 1815.207-71 - Appointing non-Government evaluators as special Government employees.
2010-10-01
...; (2) Unsolicited proposals; and (3) SBIR and STTR proposals. [63 FR 9954, Feb. 27, 1998, as amended at... BY NEGOTIATION Solicitation and Receipt of Proposals and Information 1815.207-71 Appointing non... employee shall be made by: (1) The NASA Headquarters personnel office when the release of proposal...
VANDEWIELE, J; LANGEVINJOLIOT, H; GUILLOT, J; ROSIER, LH; WILLIS, A; MORLET, M; DUHAMELCHRETIEN, G; GERLIC, E; TOMASIGUSTAFSSON, E; BLASI, N; MICHELETTI, S; VANDERWERF, SY
Cross sections and vector and tensor analyzing powers for the main levels in Pb-207 have been measured via the Pb-208(d over arrow pointing right, t)Pb-207 reaction at 200 and 360 MeV incident energies. A(y) and A(yy) spin observables allow a clear identification of the valence levels, especially at
24 CFR 207.259a - Waiver of title objection; mortgages formerly Commissioner-held.
2010-04-01
... UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES MULTIFAMILY HOUSING MORTGAGE INSURANCE Contract Rights and Obligations Rights and Duties of Mortgagee Under the Contract of Insurance § 207.259a Waiver of... any lien or other adverse interest that was senior to the mortgage on the date of the original sale of...
Energy Technology Data Exchange (ETDEWEB)
Kumar, Ashok; Soni, S K; Pancholi, S K; Gupta, S L [Delhi Univ. (India). Dept. of Physics and Astrophysics
1976-10-01
The results are presented of measuring the differential perturbed angular ..gamma gamma..-correlations for the ..gamma.. 1063.62 - ..gamma.. 569.67 keV cascade in /sup 207/Bi. The results obtained are analyzed and compared with data of other authors.
46 CFR 117.207 - Survival craft-vessels operating on lakes, bays, and sounds routes.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Survival craft-vessels operating on lakes, bays, and... 49 PASSENGERS LIFESAVING EQUIPMENT AND ARRANGEMENTS Number and Type of Survival Craft § 117.207 Survival craft—vessels operating on lakes, bays, and sounds routes. (a) Each vessel with overnight...
International Nuclear Information System (INIS)
2009-02-01
The presence of actinium-227 has been noticed in the Mont d'Arree region (Finistere district) and such a presence in the environment had never been reported before. Thus, a study has been performed to investigate the origin of this element: about 300 samples have been analysed. After an indication of the investigation chronology, the report outlines that there is no relationship between the excess of actinium-227 and land amendment or embankments, that there is no obvious relationship between this presence and radioactive liquid effluents or atmospheric effluents from the Brennilis nuclear site. It shows that there is an obvious relationship with the radiological quality. It states that this excess of actinium 227 is related to the management of rain waters about the Brennilis site. An appendix specifies the location, nature and agenda of samplings (bio-indicators, samplings in sludge, soils, food and tap water, aquatic foams and sediments, ponds, wet lands, and at the vicinity of the power plant channel), presents detailed results obtained by gamma spectrometry, and measurement equipment and methods
International Nuclear Information System (INIS)
Ioffe, A.; Ermakov, O.; Karpikhin, I.; Krupchitsky, P.; Mikula, P.; Lukas, P.; Vrana, M.
2000-01-01
The neutron scattering length of lead isotopes 204 Pb, 207 Pb and 208 Pb are determined by a set of neutron interferometry experiments. The obtained values b (208) =9.494(30) fm, b (207) =9.286(16) fm, b (204) =10.893(78) fm have much higher accuracy then current table data. Together with the precise value of b for natural lead, these results represent a complete set of data and allow one to calculate b (206) =9.221(69) fm, which is in the very good agreement with the present day experimental value. (orig.)
Directory of Open Access Journals (Sweden)
Manuela Buonanno
Full Text Available BACKGROUND: 0.5% to 10% of clean surgeries result in surgical-site infections, and attempts to reduce this rate have had limited success. Germicidal UV lamps, with a broad wavelength spectrum from 200 to 400 nm are an effective bactericidal option against drug-resistant and drug-sensitive bacteria, but represent a health hazard to patient and staff. By contrast, because of its limited penetration, ~200 nm far-UVC light is predicted to be effective in killing bacteria, but without the human health hazards to skin and eyes associated with conventional germicidal UV exposure. AIMS: The aim of this work was to test the biophysically-based hypothesis that ~200 nm UV light is significantly cytotoxic to bacteria, but minimally cytotoxic or mutagenic to human cells either isolated or within tissues. METHODS: A Kr-Br excimer lamp was used, which produces 207-nm UV light, with a filter to remove higher-wavelength components. Comparisons were made with results from a conventional broad spectrum 254-nm UV germicidal lamp. First, cell inactivation vs. UV fluence data were generated for methicillin-resistant S. aureus (MRSA bacteria and also for normal human fibroblasts. Second, yields of the main UV-associated pre-mutagenic DNA lesions (cyclobutane pyrimidine dimers and 6-4 photoproducts were measured, for both UV radiations incident on 3-D human skin tissue. RESULTS: We found that 207-nm UV light kills MRSA efficiently but, unlike conventional germicidal UV lamps, produces little cell killing in human cells. In a 3-D human skin model, 207-nm UV light produced almost no pre-mutagenic UV-associated DNA lesions, in contrast to significant yields induced by a conventional germicidal UV lamp. CONCLUSIONS: As predicted based on biophysical considerations, 207-nm light kills bacteria efficiently but does not appear to be significantly cytotoxic or mutagenic to human cells. Used appropriately, 207-nm light may have the potential for safely and inexpensively
Buonanno, Manuela; Randers-Pehrson, Gerhard; Bigelow, Alan W; Trivedi, Sheetal; Lowy, Franklin D; Spotnitz, Henry M; Hammer, Scott M; Brenner, David J
2013-01-01
0.5% to 10% of clean surgeries result in surgical-site infections, and attempts to reduce this rate have had limited success. Germicidal UV lamps, with a broad wavelength spectrum from 200 to 400 nm are an effective bactericidal option against drug-resistant and drug-sensitive bacteria, but represent a health hazard to patient and staff. By contrast, because of its limited penetration, ~200 nm far-UVC light is predicted to be effective in killing bacteria, but without the human health hazards to skin and eyes associated with conventional germicidal UV exposure. The aim of this work was to test the biophysically-based hypothesis that ~200 nm UV light is significantly cytotoxic to bacteria, but minimally cytotoxic or mutagenic to human cells either isolated or within tissues. A Kr-Br excimer lamp was used, which produces 207-nm UV light, with a filter to remove higher-wavelength components. Comparisons were made with results from a conventional broad spectrum 254-nm UV germicidal lamp. First, cell inactivation vs. UV fluence data were generated for methicillin-resistant S. aureus (MRSA) bacteria and also for normal human fibroblasts. Second, yields of the main UV-associated pre-mutagenic DNA lesions (cyclobutane pyrimidine dimers and 6-4 photoproducts) were measured, for both UV radiations incident on 3-D human skin tissue. We found that 207-nm UV light kills MRSA efficiently but, unlike conventional germicidal UV lamps, produces little cell killing in human cells. In a 3-D human skin model, 207-nm UV light produced almost no pre-mutagenic UV-associated DNA lesions, in contrast to significant yields induced by a conventional germicidal UV lamp. As predicted based on biophysical considerations, 207-nm light kills bacteria efficiently but does not appear to be significantly cytotoxic or mutagenic to human cells. Used appropriately, 207-nm light may have the potential for safely and inexpensively reducing surgical-site infection rates, including those of drug
46 CFR 180.207 - Survival craft-vessels operating on lakes, bays, and sounds routes.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Survival craft-vessels operating on lakes, bays, and... Survival Craft § 180.207 Survival craft—vessels operating on lakes, bays, and sounds routes. (a) Except as... warm water is not required to carry survival craft. (d) A vessel certificated to operate on lakes, bays...
Doctrow, Susan R; Lopez, Argelia; Schock, Ashley M; Duncan, Nathan E; Jourdan, Megan M; Olasz, Edit B; Moulder, John E; Fish, Brian L; Mäder, Marylou; Lazar, Jozef; Lazarova, Zelmira
2013-04-01
In the event of a radionuclear attack or nuclear accident, the skin would be the first barrier exposed to radiation, though skin injury can progress over days to years following exposure. Chronic oxidative stress has been implicated as being a potential contributor to the progression of delayed radiation-induced injury to skin and other organs. To examine the causative role of oxidative stress in delayed radiation-induced skin injury, including impaired wound healing, we tested a synthetic superoxide dismutase (SOD)/catalase mimetic, EUK-207, in a rat model of combined skin irradiation and wound injury. Administered systemically, beginning 48 hours after irradiation, EUK-207 mitigated radiation dermatitis, suppressed indicators of tissue oxidative stress, and enhanced wound healing. Evaluation of gene expression in irradiated skin at 30 days after exposure revealed a significant upregulation of several key genes involved in detoxication of reactive oxygen and nitrogen species. This gene expression pattern was primarily reversed by EUK-207 therapy. These results demonstrate that oxidative stress has a critical role in the progression of radiation-induced skin injury, and that the injury can be mitigated by appropriate antioxidant compounds administered 48 hours after exposure.
Nuclear excitation in the reaction 207Pb(μ-,ν6n)201Tl
International Nuclear Information System (INIS)
Budick, B.; Anigstein, R.; Kast, J.W.
1982-01-01
A probability of roughly 1% has been measured for the formation of the first excited state of 201 Tl following muon capture on 207 Pb. A probability of this magnitude for 6 neutron emission may indicate structure in the nuclear excitation function near 54 MeV. An alternative interpretation is provided by muon capture on a correlated np pair in analogy with pion absorption. (orig.)
2010-10-01
... AND HUMAN SERVICES GENERAL ADMINISTRATION PROTECTION OF HUMAN SUBJECTS Additional Protections for Pregnant Women, Human Fetuses and Neonates Involved in Research § 46.207 Research not otherwise approvable...: science, medicine, ethics, law) and following opportunity for public review and comment, including a...
2010-04-01
... 23 Highways 1 2010-04-01 2010-04-01 false What are the requirements for research, development, and..., DEPARTMENT OF TRANSPORTATION PLANNING AND RESEARCH PLANNING AND RESEARCH PROGRAM ADMINISTRATION Research, Development and Technology Transfer Program Management § 420.207 What are the requirements for research...
2010-01-01
... OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS (CONTINUED) FEDERAL FLEXIBLE BENEFITS PLAN: PRE-TAX PAYMENT OF HEALTH BENEFITS PREMIUMS Eligibility and Participation § 892.207 Can I make...
33 CFR 207.440 - St. Marys Falls Canal and Locks, Mich.; use, administration, and navigation.
2010-07-01
... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false St. Marys Falls Canal and Locks... CORPS OF ENGINEERS, DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE NAVIGATION REGULATIONS § 207.440 St... include all of the natural waters of the St. Marys River on the U.S. side of the International Boundary...
International Nuclear Information System (INIS)
Kuesters, H.; Lalovic, M.
1976-04-01
In this report a review is given on the actinium isotope build-up and decay in LWRs, LMFBRs and HTRs. The dependence of the corresponding physical aspects on reactor type, fuel cycle strategy, calculational methods and cross section uncertainties is discussed. Results from postirradiation analyses and from integral experiments in fast zero power assemblies are compared with theoretical predictions. Some sensitivity studies about the influence of actinium nuclear data uncertainties on the isotopic concentration, decay heat, and the radiation out-put in fuel and waste are presented. In a second part, the main results of the IAEA-Advisory Group Meeting on Transactinium Nuclear Data are summarized and discussed. (orig.) [de
International Nuclear Information System (INIS)
Woodhead, J.D.; McCulloch, M.T.; Volker, F.
1995-01-01
Lead-isotope data obtained on a multicollector mass spectrometer over a four year period using a 207 Pb- 204 Pb double spike to correct for the effects of mass discrimination, are reported. Considerable improvements in both precision and accuracy over conventional correction procedures were noted, without recourse to rigorous loading or run conditions. An external precision in 206 Pb/ 204 Pb, 207 Pb/ 204 Pb and 208 Pb/ 204 Pb ratios ± 0.003, 0.003 and 0.01 (2 x standard deviation), respectively, is routinely obtainable independent of minor variations in loading and run parameters. (author)
Clinical study of FT-207 suppository for head and neck malignancies
International Nuclear Information System (INIS)
Tomioka, Masashi; Usami, Masami; Sakamoto, Ayako
1982-01-01
Futraful suppository 1.5g per day was administered to 33 patients with head and neck malignancies. Among 33 cases which entered into the study, 16 cases were evaluated. Out of 16 evaluable cases, complete responses (CRs) were obtained in 4 cases and partial responses (PRs) in 7 cases. An overall response rate including 4 CRs and 7 PRs was 68.8%. Side effects due to FT-207 suppository were developed in 14 cases out of 33 patients (42.4%) Side effects such as anal pain, anorexia, diarrhea, pigmentation, exanthema and nail change were observed. No severe side effect was encountered. (author)
2010-01-01
... private sector assignee under the Information Technology Exchange Program representing, aiding, counseling... CONFLICT OF INTEREST RESTRICTIONS Prohibitions § 2641.207 One-year restriction on any former private sector... one year after the termination of his assignment from a private sector organization to an agency under...
2010-05-12
... and Standards for Intercity Passenger Rail Service under Section 207 of the Passenger Rail Investment... performance and service quality of intercity passenger train operations. In compliance with the statute, the... Intercity Passenger Rail Service,'' on the FRA's Web site. Simultaneously, the FRA published a notice in the...
2010-07-01
... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Mississippi River, Twin City... § 207.320 Mississippi River, Twin City Locks and Dam, St. Paul and Minneapolis, Minn.; pool level. In... the Twin City Locks and Dam, Minneapolis, in the interest of navigation, and supersedes rules and...
Investigation on the parity violation in the 207Pb(npol, γ)208Pb reaction
International Nuclear Information System (INIS)
Abov, Yu.G.; Ermakov, O.N.; Karpikhin, I.L.
1987-01-01
The results of the investigation of P-odd asymmetry in the emission of γ-rays after absorption of transverse-polarized neutrons by nuclei 207 Pb are given. The measurements were carried out on polarized thermal neutron beam of the ITEP reactor. The obtained upper limit of the P-odd asymmetry coefficient is 1.7x10 -5 at the 90% confidence level. This result may be crucial for one-particle (valent) mechanism of the mixing of compound resonance wave function componets having opposite parities
Nuclear magnetic shielding tensors of 207Pb2+ in Pb(NO3)2
International Nuclear Information System (INIS)
Lutz, O.; Nolle, A.
1980-01-01
The NMR signals of 207 Pb were observed in a single crystal of Pb(NO 3 ) 2 and could be assigned to the four different Pb 2+ sites by the dependence of the linewidths on the orientation. Four different nuclear magnetic shielding tensors with equal principal values but with different characteristic vectors could be determined. The symmetry of the shielding tensors is in agreement with the symmetry at the Pb 2+ sites. It is shown, that intermolecular contributions can not account for the anisotropy of the nuclear magnetic shielding, which is 3 0 / 00 of the isotropic absolute magnetic shielding. (orig.)
International Nuclear Information System (INIS)
Moulin, J.
2008-06-01
Understanding natural radionuclides behaviour in surface water is a required step to achieve uranium mine rehabilitation and preserve water quality. The first objective of this thesis is to determine which are the radionuclides sources in a drinking water reservoir. The second objective is to improve the knowledge about the behaviour of uranium series radionuclides, especially actinium. The investigated site is a brook (Sagnes, Limousin, France) which floods a peat bog contaminated by a former uranium mine and which empties into the Crouzille lake. It allows studying radionuclides transport in surface water and radionuclides retention through organic substance or water reservoir. Radionuclides distribution in particulate, colloidal and dissolved phases is determined thanks to ultra-filtrations. Gamma spectrometry allows measuring almost all natural radionuclides with only two counting stages. However, low activities of 235 U series radionuclides impose the use of very low background well-type Ge detectors, such as those of the Underground Laboratory of Modane (France). Firstly, this study shows that no or few radionuclides are released by the Sagnes peat bog, although its radioactivity is important. Secondly, it provides details on the behaviour of uranium series radionuclides in surface water. More specifically, it provides the first indications of actinium solubility in surface water. Actinium's behaviour is very close to uranium's even if it is a little less soluble. (author)
Wells, Tanya G.
"Utilization of Skills in the Care of Patients with Deviations in Psychosocial Adaptation" (NS 207) is an associate degree nursing course offered at Chattanooga State Technical Community College. The course stresses the individual as a system in his/her psychosocial adaptation to internal and external stressors, and highlights the…
International Nuclear Information System (INIS)
2007-01-01
This study resumes the discovery of an excess of actinium 227 found around by EL4 nuclear reactor actually in dismantling. The search for the origin of this excess revealed a real inquiry of investigation during three years. Because a nuclear reactor existed in this area a particular attention will have concerned this region. The doubt became the line of conduct to find the answer to the human or natural origin of this excess. Finally and against any evidence, it appears that the origin of this phenomenon was natural, consequence of the particular local geology. The detail of the different investigations is given: search of a possible correlation with the composition of elevations constituent of lanes, search (and underlining) of new sites in the surroundings of the Rusquec pond and the Plouenez station, study of the atmospheric deposits under winds of the nuclear power plant and in the east direction, search of a possible relationship with the gaseous effluents of the nuclear power plant in the past, historical study of radioactive effluents releases in the fifty last years by the analysis of the sedimentary deposits in the Saint-Herbiot reservoir, search of a possible correlation between the excess of actinium 227 and the nuclear power plant activity; search of a possible correlation with a human activity without any relationship with the nuclear activities, search of a correlation with the underground waters, search of a correlation with the geological context, collect of information on the possible transfers in direction of the food chain, determination of the radiological composition of the underground waters ( not perturbed by human activity), search of the cause of an excess of actinium 227 in the old channel of liquid effluents release of the nuclear power plant. The results are given and discussed. And contrary to all expectations the origin of the excess of actinium 227 is completely natural. (N.C.)
Energy Technology Data Exchange (ETDEWEB)
NONE
2007-07-01
This study resumes the discovery of an excess of actinium 227 found around by EL4 nuclear reactor actually in dismantling. The search for the origin of this excess revealed a real inquiry of investigation during three years. Because a nuclear reactor existed in this area a particular attention will have concerned this region. The doubt became the line of conduct to find the answer to the human or natural origin of this excess. Finally and against any evidence, it appears that the origin of this phenomenon was natural, consequence of the particular local geology. The detail of the different investigations is given: search of a possible correlation with the composition of elevations constituent of lanes, search (and underlining) of new sites in the surroundings of the Rusquec pond and the Plouenez station, study of the atmospheric deposits under winds of the nuclear power plant and in the east direction, search of a possible relationship with the gaseous effluents of the nuclear power plant in the past, historical study of radioactive effluents releases in the fifty last years by the analysis of the sedimentary deposits in the Saint-Herbiot reservoir, search of a possible correlation between the excess of actinium 227 and the nuclear power plant activity; search of a possible correlation with a human activity without any relationship with the nuclear activities, search of a correlation with the underground waters, search of a correlation with the geological context, collect of information on the possible transfers in direction of the food chain, determination of the radiological composition of the underground waters ( not perturbed by human activity), search of the cause of an excess of actinium 227 in the old channel of liquid effluents release of the nuclear power plant. The results are given and discussed. And contrary to all expectations the origin of the excess of actinium 227 is completely natural. (N.C.)
Forstner, M; Müller, A; Rognan, D; Kriechbaum, M; Wallimann, T
1998-07-01
We show that the mutation of an uncharged residue far from the active site to another uncharged residue can have effects on the active site without disturbing the overall structure of the protein. Cis-proline 207 of mitochondrial creatine kinase was mutated to alanine. The mutant showed a decrease in the pH-optimum for ATP synthesis by 1.5 units while the maximum relative activity was lowered to 53% of the wild-type enzyme. In the direction of ATP consumption, the pH optimum was lowered by 1.3 units and the maximum relative activity was 49% of the wild-type enzyme. The enzyme kinetic parameters Km and Kd for the substrates did not change dramatically, indicating a largely unperturbed active site. Small-angle X-ray scattering was used to investigate the structural change concomitant with the mutation, yielding a scattering profile only slightly different from that of the wild-type enzyme. Neither the radius of gyration nor the molecular mass showed any significant differences, leading to the conclusion that quarternary organization and fold of the mutant and the wild-type enzymes were similar. Theoretical analysis suggests the most probable primary source of structural change to be a transition of residue 207 peptide bond torsional angle co from the cis to the trans configuration.
Core excitations across the neutron shell gap in 207Tl
Directory of Open Access Journals (Sweden)
E. Wilson
2015-07-01
Full Text Available The single closed-neutron-shell, one proton–hole nucleus 207Tl was populated in deep-inelastic collisions of a 208Pb beam with a 208Pb target. The yrast and near-yrast level scheme has been established up to high excitation energy, comprising an octupole phonon state and a large number of core excited states. Based on shell-model calculations, all observed single core excitations were established to arise from the breaking of the N=126 neutron core. While the shell-model calculations correctly predict the ordering of these states, their energies are compressed at high spins. It is concluded that this compression is an intrinsic feature of shell-model calculations using two-body matrix elements developed for the description of two-body states, and that multiple core excitations need to be considered in order to accurately calculate the energy spacings of the predominantly three-quasiparticle states.
Sorption studies of radioelements on geological materials
International Nuclear Information System (INIS)
Berry, John A.; Yui, Mikazu; Kitamura, Akira
2007-11-01
Batch sorption experiments have been carried out to study the sorption of uranium, technetium, curium, neptunium, actinium, protactinium, polonium, americium and plutonium onto bentonite, granodiorite and tuff. Mathematical modelling using the HARPHRQ program and the HATCHES database was carried out to predict the speciation of uranium and technetium in the equilibrated seawater, and neptunium, americium and plutonium in the rock equilibrated water. Review of the literature for thermodynamic data for curium, actinium, protactinium and polonium was carried out. Where sufficient data were available, predictions of the speciation and solubility were made. This report is a summary report of the experimental work conducted by AEA Technology during April 1991-March 1998, and the main results have been presented at Material Research Society Symposium Proceedings and published as proceedings of them. (author)
Asakura, Mitsutoshi; Karaki, Fumika; Fujii, Hideaki; Atsuda, Koichiro; Itoh, Tomoo; Fujiwara, Ryoichi
2016-10-19
Vildagliptin is a potent, orally active inhibitor of dipeptidyl peptidase-4 (DPP-4) for the treatment of type 2 diabetes mellitus. It has been reported that vildagliptin can cause hepatic dysfunction in patients. However, the molecular-mechanism of vildagliptin-induced liver dysfunction has not been elucidated. In this study, we employed an expression microarray to determine hepatic genes that were highly regulated by vildagliptin in mice. We found that pro-inflammatory S100 calcium-binding protein (S100) a8 and S100a9 were induced more than 5-fold by vildagliptin in the mouse liver. We further examined the effects of vildagliptin and its major metabolite M20.7 on the mRNA expression levels of S100A8 and S100A9 in human hepatoma HepG2 and leukemia HL-60 cells. In HepG2 cells, vildagliptin, M20.7, and sitagliptin - another DPP-4 inhibitor - induced S100A9 mRNA. In HL-60 cells, in contrast, S100A8 and S100A9 mRNAs were significantly induced by vildagliptin and M20.7, but not by sitagliptin. The release of S100A8/A9 complex in the cell culturing medium was observed in the HL-60 cells treated with vildagliptin and M20.7. Therefore, the parental vildagliptin- and M20.7-induced release of S100A8/A9 complex from immune cells, such as neutrophils, might be a contributing factor of vildagliptin-associated liver dysfunction in humans.
2010-07-01
... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Taylor Creek, navigation lock (S-193) across the entrance to Taylor Creek at Lake Okeechobee, Okeechobee, Fla.; use, administration..., DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE NAVIGATION REGULATIONS § 207.170d Taylor Creek, navigation lock...
207,208Pb(n,xnγ) reactions for neutron energies from 3 to 200 MeV
International Nuclear Information System (INIS)
Vonach, H.; Pavlik, A.; Chadwick, M.B.; Haight, R.C.; Nelson, R.O.; Wender, S.A.; Young, P.G.
1994-01-01
High-resolution γ-ray spectra from the interaction of neutrons in the energy range from 3 to 200 MeV with 207,208 Pb were measured with the white neutron source at the weapons neutron research (WNR) facility at Los Alamos National Laboratory. From these data, excitation functions for prominent γ transitions in 200,202,204,206,207,208 Pb were derived from threshold to 200 MeV incident neutron energy. These γ-production cross sections reflect the excitation cross sections for the respective residual nuclei. The results are compared with the predictions of nuclear reaction calculations based on the exciton model for precompound emission, the Hauser-Feshbach theory for compound nucleus decay, and coupled channels calculations to account for direct excitation of collective levels. Good agreement was obtained over the entire energy range covered in the experiment with reasonable model parameters. The results of this work clearly demonstrate that multiple preequilibrium emission has to be taken into account above about 40 MeV, and that the level density model of Ignatyuk, which accounts for the gradual disappearance of shell effects with increasing excitation energy, should be used instead of the Gilbert-Cameron and backshifted Fermi-gas models if excitation energies exceed about 30 MeV. No indication for a reduction of the nuclear moment of inertia below the rigid body value was found
Fission threshold determination of 209Bi and sup(204,206,207,208)Pb by electrofission
International Nuclear Information System (INIS)
Tuerck, D.
1975-01-01
At the Darmstadt electron linear accelerator the cross sections for the electrofission of 209 Bi were measured for electron energies between 24 and 70 MeV, for the separated lead isotopes sup(204,206,207,208)Pb between 38 and 50 MeV. For the determination of the fission thresholds the cross sections were examined by the virtuel photon method using calculations in first Born approximation for the point nucleus with Coulomb wave functions. The analytic functions fitting the fission probability were based on level densities after the Fermi-gas-model. (orig./WL) [de
Suggested search for 207Pb nuclear Schiff moment in PbTiO3 ferroelectric
International Nuclear Information System (INIS)
Mukhamedjanov, T.N.; Sushkov, O.P.
2005-01-01
We suggest two types of experiments, NMR and macroscopic magnetometry, with solid PbTiO 3 to search for the nuclear Schiff moment of 207 Pb. Both kinds of experiments promise substantial improvement over the presently achieved sensitivities. Statistical considerations show that the improvement of the current sensitivity can be up to ten orders of magnitude for the magnetometry experiment and up to seven orders of magnitude for the NMR experiment. Such significant enhancement is due to the strong internal electric field of the ferroelectric, as well as due to the possibility to cool the nuclear-spin subsystem in the compound down to nanokelvin temperatures
2.07-micron CW diode-laser-pumped Tm,Ho:YLiF4 room-temperature
Hemmati, Hamid
1989-01-01
Continuous-wave action is obtained at 2.07 microns from a 2-mm-long Tm-sensitized Ho:YLiF4 crystal at room temperature when longitudinally pumped by a pair of diode-laser arrays. Laser output power at 300 K is 26 mW, with a 30-percent slope efficiency and a lasing threshold of 108 mW. A maximum output power of 187 mW is obtained from a 4-mm-long crystal at 77 K, with a 67 percent slope efficiency. A preliminary demonstration of cavity Q switching produced 165 microJ of pulse energy at a repetition rate of 100 Hz.
2010-07-01
... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Calumet River, Ill.; Thomas J. O... DEFENSE NAVIGATION REGULATIONS § 207.425 Calumet River, Ill.; Thomas J. O'Brien Lock and Controlling Works... paragraph (a)(1) of this section. (b) Lock—(1) Operation. The Thomas J. O'Brien Lock and Dam is part of the...
Developments of 207Pb, 208Pb and 209Bi target wheels in the synthesis of 107Ns, 108Hs and 109Mt
International Nuclear Information System (INIS)
Folger, H.; Hartmann, W.; Hessberger, F.P.; Hofmann, S.; Klemm, J.; Muenzenberg, G.; Ninov, V.; Schmidt, K.H.; Schoett, H.J.; Thalheimer, W.; Armbruster, P.
1993-05-01
The developments of 207 Pb, 208 Pb and 209 Bi target wheels and their applications in heavy-ion fusion reactions are reviewed. In both, fabrication and use, the centers of the evaporator or accelerator beams are focussed at wheel radii of 155 mm to specially shaped frames which generate very homogeneous target layers and very constant reaction and counting rates in the experiment. Target areas of up to ∼98% of a wheel's circumference of 974 mm can be provided. The preparation procedures for necessary C backings and protecting layers of C are described, and details are given for the developments of high-vacuum evaporations of 207 Pb, 208 Pb and 209 Bi with deposition yields of 35-55% from tantalum crucibles. The applications of the target wheels in heavy-ion fusion reactions with beams of 54 Cr and 58 Fe at energies near the Coulomb barrier and intensities of ∼10 12 particles/s are mentioned. The target parameters for the production runs of the new chemical elements 107 Ns, 108 Hs and 109 Mt are included. (orig.)
Formation and evolution of ultrafine particles produced by radiolysis and photolysis
International Nuclear Information System (INIS)
Madelaine, G.J.; Perrin, M.L.; Renoux, A.
1980-01-01
Results are presented, concerning the formation, the size distribution, and the behavior of ultrafine particles produced by alpha disintegration of actinium and uv irradiation in filtered and natural atmospheric air. The characterization of these particles is obtained by electrical aerosol analyzer and diffusion battery method. Measurements are made in the range between 0.003 and 0.5 micrometer. Some qualitative indications are obtained on the different mechanisms which govern the evolution of ultrafine particles in the atmosphere (nucleation, coagulation, and condensation). It is now well established that the photo-oxydation of SO 2 in the atmosphere leads to the production of sulphuric acid and of sulphate, which are usually found in the form of submicronic particles. This paper concerns the evolution of ultrafine particles generated in the presence of a preexisting aerosol. They are either instantaneously produced by the alpha disintegrations of actinium 219 or continuously produced by the transformation of SO 2 under uv irradiation
Energy Technology Data Exchange (ETDEWEB)
Brown, Paul L. [Geochem Australia, Kiama, NSW (Australia); Ekberg, Christian [Chalmers Univ. of Technology, Goeteborg (Sweden). Nuclear Chemistry/Industrial Materials Recycling
2016-07-01
All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO{sub 2}OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH{sup 2+} for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.
Status of liquid metal reactor development in the United States of America
International Nuclear Information System (INIS)
Griffith, J.D.; Horton, K.E.
1991-01-01
An existing network of government and industry research facilities and engineering test centers in the United States is currently providing test capabilities and the technical expertise required to conduct an aggressive advanced reactor development program. Subsequent to the directive to shut down the Fast Flux Test Facility in early 1990, a variety of activities were undertaken to provide support for continued operation. The United States has made substantial progress in achieving ALMR program objectives. The metal fuel cycle is designed to recycle and burn its own actiniums, and has the potential to be a very effective burner of actiniums generated in the LWRs. The current emphasis in the IFR Program is on the comprehensive development of the IFR (Integral Fast Reactor) technology, to be followed by a period of technology demonstration which would verify the economic feasibility of the concept. The United States has been active in international cooperative activities in the fast reactor sector since 1969. (author). 11 figs, 1 tab
International Nuclear Information System (INIS)
Brown, Paul L.; Ekberg, Christian
2016-01-01
All isotopes of actinium are radioactive and exist in aqueous solution only in the trivalent state. There have been very few studies on the hydrolytic reactions of actinium(III). The hydrolysis reactions for uranium would only be important in alkaline pH conditions. Thermodynamic parameters for the hydrolysis species of uranium(VI) and its oxide and hydroxide phases can be determined from the stability and solubility constants. The hydrolytic behaviour of neptunium(VI) is quite similar to that of uranium(VI). The solubility constant of NpO 2 OH(am) has been reported a number of times for both zero ionic strength and in fixed ionic strength media. Americium can form four oxidation states in aqueous solution, namely trivalent, tetravalent, pentavalent and hexavalent. Desire, Hussonnois and Guillaumont determined stability constants for the species AmOH 2+ for the actinides, plutonium(III), americium(III), curium(III), berkelium(III) and californium(III) using a solvent extraction technique.
LANGEVINJOLIOT, H; VANDEWIELE, J; GUILLOT, J; GERLIC, E; ROSIER, LH; WILLIS, A; MORLET, M; DUHAMELCHRETIEN, G; TOMASIGUSTAFSSON, E; BLASI, N; MICHELETTI, S; VANDERWERF, SY
Highly excited neutron hole states in Pb-207 have been studied via the (d, over arrow pointing right, t) reaction at E(d) = 200 MeV using for the first time a polarized beam, with both vector and tensor components. The determination of overlapping neutron hole response functions takes advantage of
International Nuclear Information System (INIS)
Lima, E. de; Kawakami, H.; Lima, A. de; Hichwa, R.; Ramayya, A.V.; Hamilton, J.H.; Dunn, W.; Kim, H.J.
1978-01-01
Customarily one extracts the half-life of the nuclear state from a delayed time spectrum by an analysis of the centroid shift, the slope and lately by the convolution method. Recently there have been two formulas relating the centroid shift to the half-life of the nuclear state. These two procedures can give different results for the half-life when Tsub(1/2) the same order or less than the time width of one channel. An extensive investigation of these two formulas and precedures has been made by measuring the half-life of the first excited state in 207 Pb at 569.6 keV. This analysis confirms Bay's formula relating the centroid shift to the half-life of the state. The half-life of the 569.6 keV level in 207 Pb is measured to be (129+-3) ps in excellent agreement with Weisskopf's single particle estimate of 128 ps for an E2 transition. (Auth.)
Energy Technology Data Exchange (ETDEWEB)
Vallois, G [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires
1968-03-01
{sup 206,207,208}pb have been studied by 24.5 MeV proton inelastic scattering with a resolution of 20 keV. The angular distributions of the differential cross-sections corresponding to the different excited levels have been measured in a large angular region and analysed with the DWBA.This work shows that it exists between 4 and 5 MeV of excitation energy some strongly excited levels corresponding to transfer momenta l = 2, 4, 6 and 8. The single particle-hole models do not explain these states; so it will probably be necessary to introduce some several particle - hole configurations. (author) [French] Les isotopes 206, 207 et 208 du plomb ont ete etudies par diffusion inelastique de protons de 24,5 MeV avec une resolution de 20 keV. Les distributions angulaires des sections efficaces differentielles correspondant aux differents niveaux excites ont ete mesurees sur un large domaine angulaire et analysees a l'aide de la DWBA. Ce travail met en evidence l'existence, entre 4 et 5 MeV d'excitation, de niveaux fortement excites correspondant a des moments de transfert de 2, 4, 6 et 8. Les modeles a simple particule-trou ne rendant pas compte de ces niveaux, il faudra sans doute recourir a des configurations a plusieurs particules-trous pour les expliquer. (auteur)
Energy Technology Data Exchange (ETDEWEB)
Comas, V.F.; Heinz, S.; Ackermann, D.; Heredia, J.A.; Hessberger, F.P.; Khuyagbaatar, J.; Kindler, B.; Lommel, B.; Mann, R. [GSI Helmholtzzentrum fuer Schwerionenforschung GmbH, Darmstadt (Germany); Hofmann, S. [GSI Helmholtzzentrum fuer Schwerionenforschung GmbH, Darmstadt (Germany); Goethe-Universitaet Frankfurt, Institut fuer Physik, Frankfurt (Germany)
2013-09-15
We investigated multi-nucleon transfer reactions in collisions of {sup 58}Ni + {sup 207}Pb and {sup 64}Ni + {sup 207}Pb at Coulomb barrier energies. The new aspect is that we used a velocity filter (SHIP at GSI) for the separation of the heavy target-like transfer products from background events. The isotopic identification was performed via the {alpha} decay properties of the reaction products. The goal of the experiment was to study the characteristics of multi-nucleon transfer reactions in the region of heavy nuclei and the applicability of existing separation and detection techniques, which are usually used for identification of heavy fusion-evaporation residues, to heavy transfer products. This was motivated by recent theoretical results from macroscopic-microscopic models which suggest deep inelastic transfer reactions in heavy systems as a means to produce new neutron-rich isotopes in the region of N = 126 and in the region of superheavy nuclei. In this paper we present the isotopic yields, the excitation functions and the excitation energies of the heavy transfer products with Z > 82 as well as the influence of shell effects on the reaction products. The influence of the different neutron numbers of the projectiles is also discussed. (orig.)
Directory of Open Access Journals (Sweden)
Eloi Machado Alves
2010-04-01
Full Text Available O objetivo foi avaliar a concentração de açúcares no néctar de soja (Glycine max L. Merrill em áreas com ou sem a presença de abelhas Apis mellifera L. Foi utilizada a variedade Coodetec 207 em quatro tratamentos: área de 24 m2 coberta com colônia de abelhas africanizadas em seu interior; área semicoberta com livre acesso para insetos visitantes; área livre e área coberta sem abelhas. As flores foram coletadas durante três dias, a cada 2h. e a concentração dos açúcares totais por flor foi determinada por espectrofotometria. A área coberta com abelha apresentou maior concentração de açúcares totais em relação à área coberta sem abelhas e livre, contudo, aconcentração de açúcares totais na área livre não diferiu da concentração observada na área coberta sem abelhas. Houve redução na concentração média de sacarose na área livre, diferindo das concentrações nas demais áreas. A concentração média de glicose não diferiu entre os tratamentos, enquanto que a de frutose não apresentou diferença entre as áreas cobertas com abelhas, semicoberta e livre. A variedade Coodetec 207 da soja apresentou maior concentração total de açúcares e de frutose nas áreas cobertas com abelhas. Contudo, a presença de Apis mellifera não interferiu nesta concentração de açúcares no néctar das flores de soja desta variedade.This research was carried out to evaluate the sugar concentration in soybean nectar in areas with Africanized honeybee colonies. The var. Coodetec 207 was used in four treatments: 24 m2 covered area with Africanized honeybee colony inside, semi-covered area for free insect visitation, uncovered area, and covered area without insect visitation. Flowers were harvested for three days at two-hour intervals, and the total sugar concentration per flower was determined by spectrophotometry. The covered area with Africanized honeybee colony presented higher sugar concentration than the covered area
DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS
Energy Technology Data Exchange (ETDEWEB)
P. Bernot
2005-07-13
The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this activity is to predict dissolved concentrations or solubility limits for elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) relevant to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are provided in the form of tabulated functions with pH and log fCO{sub 2} as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. Even though selection of an appropriate set of radionuclides documented in Radionuclide Screening (BSC 2002 [DIRS 160059]) includes actinium, transport of Ac is not modeled in the total system performance assessment for the license application (TSPA-LA) model because of its extremely short half-life. Actinium dose is calculated in the TSPA-LA by assuming secular equilibrium with {sup 231}Pa (Section 6.10); therefore, Ac is not analyzed in this report. The output data from this report are fundamental inputs for TSPA-LA used to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for the actinides discussed in this report. These models cover broad ranges of environmental conditions so they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or
DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS
International Nuclear Information System (INIS)
P. Bernot
2005-01-01
The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this activity is to predict dissolved concentrations or solubility limits for elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) relevant to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are provided in the form of tabulated functions with pH and log fCO 2 as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. Even though selection of an appropriate set of radionuclides documented in Radionuclide Screening (BSC 2002 [DIRS 160059]) includes actinium, transport of Ac is not modeled in the total system performance assessment for the license application (TSPA-LA) model because of its extremely short half-life. Actinium dose is calculated in the TSPA-LA by assuming secular equilibrium with 231 Pa (Section 6.10); therefore, Ac is not analyzed in this report. The output data from this report are fundamental inputs for TSPA-LA used to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for the actinides discussed in this report. These models cover broad ranges of environmental conditions so they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or otherwise
Kinetics of radioisotope exchange between brine and rock in a geothermal system
International Nuclear Information System (INIS)
Hammond, D.E.; Zukin, J.G.; Teh-Lung Ku
1988-01-01
A wide range of isotopes in the /sup 238/U, /sup 235/U, and /sup 232/Th decay chains was measured in geothermal brines collected from two production zones at 1898 and 3220 m in the Salton Sea Scientific Drilling Project well. High concentrations of radium, radon, and lead isotopes are generated and maintained by the input of these isotopes from solid phases into brine by both recoil and leaching processes, by the high chloride content of the brine which complexes radium and lead, and by the apparent absence of suitable unoccupied adsorption sites. In contrast, uranium, thorium, actinium, bismuth, and polonium isotopes all have low concentrations due to their efficient sorption from brine to rock. Measurements of short-lived isotopes in these decay series yield insights regarding the mechanisms controlling radioisotope exchange, and they permit estimation of rates of brine-rock interaction. For example, the /sup 228/Ac//sup 228/Ra activity ratio of 0.2 in brines indicates that the mean residence time of actinium in solution before sorption onto solid surfaces is less than 2.5 hours
2010-07-01
... reimbursed if I transport my POV from a point of origin or to a destination that is different from my... Federal Travel Regulation System RELOCATION ALLOWANCES TRANSPORTATION AND STORAGE OF PROPERTY 9-ALLOWANCES... From a Post of Duty § 302-9.207 What will I be reimbursed if I transport my POV from a point of origin...
International Nuclear Information System (INIS)
Vallois, G.
1968-03-01
206,207,208 pb have been studied by 24.5 MeV proton inelastic scattering with a resolution of 20 keV. The angular distributions of the differential cross-sections corresponding to the different excited levels have been measured in a large angular region and analysed with the DWBA.This work shows that it exists between 4 and 5 MeV of excitation energy some strongly excited levels corresponding to transfer momenta l = 2, 4, 6 and 8. The single particle-hole models do not explain these states; so it will probably be necessary to introduce some several particle - hole configurations. (author) [fr
Experiments on multi-nucleon transfer reactions with the systems {sup 58,64}Ni+{sup 207}Pb at SHIP
Energy Technology Data Exchange (ETDEWEB)
Fernandovich Comas Lijachev, Victor
2012-07-01
This work presents experimental results on multi-nucleon transfer reactions in the collision systems {sup 58}Ni+{sup 207}Pb and {sup 64}Ni+{sup 207}Pb which were measured at the velocity filter SHIP at GSI. The reactions were performed at beam energies below and up to 10% above the Coulomb barrier. The work was motivated by theoretical predictions to apply multi-nucleon transfer reactions in heavy systems to synthesize new neutron-rich isotopes in the region of superheavy nuclei with Z>100 and in the region of the closed neutron shell N=126. The expected cross-sections for the production of these nuclei in transfer reactions are small and reach typically nanobarn and below. Therefore, efficient separation techniques have to be applied and the detection system must allow for the identification of single nuclei. A dedicated experimental setup to study such rare transfer products does not exist presently. But already existing facilities which are used for the synthesis of superheavy fusion products meet the requirements for the detection of rare reaction products. In this context, the velocity filter SHIP offers the possibility to separate heavy target-like transfer products from projectiles and projectile-like reaction products before they reach the detection system where the particles are identified by their alpha-decay properties. At SHIP, a cross-section limit of 10 pb can be reached at usual beam intensities. In the present work on collisions of {sup 58,64}Ni+{sup 207}Pb the influence of the projectile neutron number on the cross-sections, isotopic distributions and excitation energies of the transfer products was studied. Especially with the more neutron-rich {sup 64}Ni projectiles a transfer of up to seven protons and eight neutrons to the target nucleus was observed. The largest cross-sections for the most neutron-rich isotopes were reached at the beam energies around the Coulomb barrier. The transfer was accompanied by the full dissipation of the available
LASL experience in decontamination of the environment
International Nuclear Information System (INIS)
Ahlquist, A.J.
1981-01-01
This discussion represents one part of a major effort in soil decontamination at the Los Alamos site. A contaminated industrial waste line in the Los Alamos townsite was removed, and a plutonium incineration facility, and a filter building contaminated with actinium-227 were dismantled. The former plutonium handling facility has been decontaminated, and canyons and an old firing site contaminated with strontium-90 have been surveyed
Determination of radionuclides in discharged water from gold ...
African Journals Online (AJOL)
Long-lived radionuclides from the Uranium-, Thorium- and Actinium-decay chains in the discharged water into the environment were radiochemically separated and the activity concentrations determined for 238U-series ranged from 3.8 ± 1.5 to 178 ± 19 mBqL-1, 232Th-series ranged from < 2.0 to 47.8 ± 7.3 mBqL-1 and ...
A walk-free centroid method for lifetime measutement of 207Pb 569.7 keV state
International Nuclear Information System (INIS)
Gu Jiahui; Liu Jingyi; Xiao Genlai
1988-01-01
An improvement have been made in acquiring data of delayed coincidence spectra with ND-620 data acquisition system and off-line data analysis program. The delayed and anti-delayed coincidence spectra can be obtained in one run. The difference of their centroids is the mean lifetime τ. The centroid position of a delayed coincidence spectrum is the zero time of another delayed coincidence spectrum, so the requirement of measuring prompt time spectrum is avoided. The walk of prompt and delayed coincidence spectrum coming from different run are resolved and the walk during the measurement is compensated partly. The delayed coincidence time spectra of 207 Pb 569.7 keV state are measured and the half lifetime is calculated via three different methods (slop method, convolution method, centroid shift). The final value of half lifetime is 129.5±1.4ps. THe experimental reduced transition probability is compared with theoretical values
Liebscher, G; Vanchangiri, K; Mueller, Th; Feige, K; Cavalleri, J-M V; Paschke, R
2016-02-25
Betulinic acid, a pentacyclic triterpene, and its derivatives are promising compounds for cancer treatment in humans. Melanoma is not only a problem for humans but also for grey horses as they have a high potential of developing melanoma lesions coupled to the mutation causing their phenotype. Current chemotherapeutic treatment carries the risk of adverse health effects for the horse owner or the treating veterinarian by exposure to antineoplastic compounds. Most treatments have low prospects for systemic tumor regression. Thus, a new therapy is needed. In this in vitro study, Betulinic acid and its two derivatives B10 and NVX-207, both with an improved water solubility compared to Betulinic acid, were tested on two equine melanoma cell lines (MelDuWi and MellJess/HoMelZh) and human melanoma (A375) cell line. We could demonstrate that all three compounds especially NVX-207 show high cytotoxicity on both equine melanoma cell lines. The treatment with these compounds lead to externalization of phosphatidylserines on the cell membrane (AnnexinV-staining), DNA-fragmentation (cell cycle analysis) and activation of initiator and effector caspases (Caspase assays). Our results indicate that the apoptosis is induced in the equine melanoma cells by all three compounds. Furthermore, we succeed in encapsulating the most active compound NVX-207 in 2-Hydroxyprolyl-β-cyclodextrine without a loss of its activity. This formulation can be used as a promising antitumor agent for treating grey horse melanoma. In a first tolerability evaluation in vivo the formulation was administered every one week for 19 consecutive weeks and well tolerated in two adult melanoma affected horses. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.
Nissimov, Jozef I; Worthy, Charlotte A; Rooks, Paul; Napier, Johnathan A; Kimmance, Susan A; Henn, Matthew R; Ogata, Hiroyuki; Allen, Michael J
2012-03-01
The Coccolithoviridae are a group of viruses which infect the marine coccolithophorid microalga Emiliania huxleyi. The Emiliania huxleyi viruses (known as EhVs) described herein have 160- to 180-nm diameter icosahedral structures, have genomes of approximately 400 kbp, and consist of more than 450 predicted coding sequences (CDSs). Here, we describe the genomic features of four newly sequenced coccolithoviruses (EhV-88, EhV-201, EhV-207, and EhV-208) together with their draft genome sequences and their annotations, highlighting the homology and heterogeneity of these genomes to the EhV-86 model reference genome.
An aerial radiological survey of the Sandia National Laboratories and surrounding area
International Nuclear Information System (INIS)
Riedhauser, S.R.
1994-06-01
A team from the Remote Sensing Laboratory conducted an aerial radiological survey of the area surrounding the Sandia National Laboratories and Kirtland Air Force Base in Albuquerque, New Mexico, during March and April 1993. The survey team measured the terrestrial gamma radiation at the site to determine the levels of natural and man-made radiation. This survey includes the areas covered by a previous survey in 1981. The results of the aerial survey show a background exposure rate which varies between 5 and 18 μR/h plus an approximate 6 μR/h contribution from cosmic rays. The major radioactive isotopes found in this survey were: potassium-40, thallium-208, bismuth-214, and actinium-228, which are all naturally-occurring isotopes, and cobalt-60, cesium-137, and excess amounts of thallium-208 and actinium-228, which are due to human actions in the survey area. In regions away from man-made activity, the exposure rates inferred from this survey's gamma ray measurements agree almost exactly with the exposure rates inferred from the 1981 survey. In addition to the aerial measurements, another survey team conducted in situ and soil sample radiation measurements at three sites within the survey perimeter. These ground-based measurements agree with the aerial measurements within ± 5%
Benedetti, M; De Castro, F; Fanizzi, F P
2017-02-28
An inverse linear relationship between 73 Ge, 119 Sn and 207 Pb NMR chemical shifts and the overall sum of ionic radii of coordinated halido ligands has been discovered in tetrahedral [MX n Y 4-n ] (M = Ge, Sn, Pb; 1 ≤ n ≤ 4; X, Y = Cl, Br, I) coordination compounds. This finding is consistent with a previously reported correlation found in octahedral, pentacoordinate and square planar platinum complexes. The effect of the coordinated halido ligands acting on the metal as shielding conducting rings is therefore confirmed also by 73 Ge, 119 Sn and 207 Pb NMR spectroscopy.
Předpjatý most číslo 207 přes rychlostní komunikaci R2 na Slovensku
Ježek, Rostislav
2015-01-01
V diplomové práci „Předpjatý most číslo 207 přes rychlostní komunikaci R2 na Slovensku“ jsou vypracovány tři varianty řešení přemostění. Cílem práce je zhodnotit navržené varianty a provést podrobný návrh nosné konstrukce vybrané varianty. Součástí práce je zohlednění vlivu výstavby. K podrobné statické analýze byla zvolena varianta komorového mostu s šikmými stěnami o třech polích. Tato dodatečně předpjatá konstrukce je posouzena dle platných Evropských norem. Analýza konstrukce je provedena...
Energy Technology Data Exchange (ETDEWEB)
Pietralla, N., E-mail: pietralla@ikp.tu-darmstadt.d [Institut fuer Kernphysik, Technische Universitaet Darmstadt, 64289 Darmstadt (Germany); Nuclear Structure Laboratory, SUNY at Stony Brook, Stony Brook, NY 11794-3800 (United States); Institut fuer Kernphysik, Universitaet zu Koeln, 50937 Koeln (Germany); Li, T.C. [Nuclear Structure Laboratory, SUNY at Stony Brook, Stony Brook, NY 11794-3800 (United States); Fritzsche, M. [Institut fuer Kernphysik, Technische Universitaet Darmstadt, 64289 Darmstadt (Germany); Ahmed, M.W. [Triangle Universities Nuclear Laboratory (TUNL), Duke University, Durham, NC 27708 (United States); Ahn, T.; Costin, A. [Institut fuer Kernphysik, Technische Universitaet Darmstadt, 64289 Darmstadt (Germany); Nuclear Structure Laboratory, SUNY at Stony Brook, Stony Brook, NY 11794-3800 (United States); Institut fuer Kernphysik, Universitaet zu Koeln, 50937 Koeln (Germany); Enders, J. [Institut fuer Kernphysik, Technische Universitaet Darmstadt, 64289 Darmstadt (Germany); Li, J. [Duke Free Electron Laser Laboratory (DFELL), Duke University, Durham, NC 27708 (United States); Mueller, S.; Neumann-Cosel, P. von [Institut fuer Kernphysik, Technische Universitaet Darmstadt, 64289 Darmstadt (Germany); Pinayev, I.V. [Duke Free Electron Laser Laboratory (DFELL), Duke University, Durham, NC 27708 (United States); Ponomarev, V.Yu.; Savran, D. [Institut fuer Kernphysik, Technische Universitaet Darmstadt, 64289 Darmstadt (Germany); Tonchev, A.P.; Tornow, W.; Weller, H.R. [Triangle Universities Nuclear Laboratory (TUNL), Duke University, Durham, NC 27708 (United States); Werner, V. [A.W. Wright Nuclear Structure Laboratory (WNSL), Yale University, New Haven, CT (United States); Wu, Y.K. [Duke Free Electron Laser Laboratory (DFELL), Duke University, Durham, NC 27708 (United States); Zilges, A. [Institut fuer Kernphysik, Universitaet zu Koeln, 50937 Koeln (Germany)
2009-10-26
The Pb(gamma{sup -}>,gamma{sup '}) photon scattering reaction has been studied with the nearly monochromatic, linearly polarized photon beams at the High Intensity gamma-ray Source (HIgammaS) at the DFELL. Azimuthal scattering intensity asymmetries measured with respect to the polarization plane of the beam have been used for the first time to assign both the spin and parity quantum numbers of dipole excited states of {sup 206,207,208}Pb at excitation energies in the vicinity of 5.5 MeV. Evidence for dominant particle-core coupling is deduced from these results along with information on excitation energies and electromagnetic transition matrix elements. Implications of the existence of weakly coupled states built on highly excited core states in competition with 1homega single particle (hole) excitations at comparable energies are discussed.
Candida Osteomyelitis: Analysis of 207 Pediatric and Adult Cases (1970–2011)
Gamaletsou, Maria N.; Kontoyiannis, Dimitrios P.; Sipsas, Nikolaos V.; Moriyama, Brad; Alexander, Elizabeth; Roilides, Emmanuel; Brause, Barry; Walsh, Thomas J.
2012-01-01
Background. The epidemiology, pathogenesis, clinical manifestations, management, and outcome of Candida osteomyelitis are not well understood. Methods. Cases of Candida osteomyelitis from 1970 through 2011 were reviewed. Underlying conditions, microbiology, mechanisms of infection, clinical manifestations, antifungal therapy, and outcome were studied in 207 evaluable cases. Results. Median age was 30 years (range, ≤ 1 month to 88 years) with a >2:1 male:female ratio. Most patients (90%) were not neutropenic. Localizing pain, tenderness, and/or edema were present in 90% of patients. Mechanisms of bone infection followed a pattern of hematogenous dissemination (67%), direct inoculation (25%), and contiguous infection (9%). Coinciding with hematogenous infection, most patients had ≥2 infected bones. When analyzed by age, the most common distribution of infected sites for adults was vertebra (odds ratio [OR], 0.09; 95% confidence interval [CI], .04–.25), rib, and sternum; for pediatric patients (≤18 years) the pattern was femur (OR, 20.6; 95% CI, 8.4–48.1), humerus, then vertebra/ribs. Non-albicans Candida species caused 35% of cases. Bacteria were recovered concomitantly from 12% of cases, underscoring the need for biopsy and/or culture. Candida septic arthritis occurred concomitantly in 21%. Combined surgery and antifungal therapy were used in 48% of cases. The overall complete response rate of Candida osteomyelitis of 32% reflects the difficulty in treating this infection. Relapsed infection, possibly related to inadequate duration of therapy, occurred among 32% who ultimately achieved complete response. Conclusions. Candida osteomyelitis is being reported with increasing frequency. Localizing symptoms are usually present. Vertebrae are the most common sites in adults vs femora in children. Timely diagnosis of Candida osteomyelitis with extended courses of 6–12 months of antifungal therapy, and surgical intervention, when indicated, may improve
DEFF Research Database (Denmark)
Cavalcante, Lucas Costa Pereira; Silveira, Luiz F. Q.; Rommel, Simon
2016-01-01
Millimeter wave communications based on photonic technologies have gained increased attention to provide optic fiber-like capacity in wireless environments. However, the new hybrid fiber-wireless channel represents new challenges in terms of signal transmission performance analysis. Traditionally......, such systems use diversity schemes in combination with digital signal processing (DSP) techniques to overcome effects such as fading and inter-symbol interference (ISI). Wavelet Channel Coding (WCC) has emerged as a technique to minimize the fading effects of wireless channels, which is a mayor challenge...... in systems operating in the millimeter wave regime. This work takes the WCC one step beyond by performance evaluation in terms of bit error probability, over time-varying, frequency-selective multipath Rayleigh fading channels. The adopted propagation model follows the COST207 norm, the main international...
Energy Technology Data Exchange (ETDEWEB)
Harangozo, M; Toelgyessy, J; Lesny, J; Cik, G [Slovak Technical Univ., Bratislava (Slovakia). Fac. of Chemical Technology, Dept. of Environmental Science
1996-12-31
In this paper the activities of radium-226, actinium-228 and potassium-40 in fly ashes and building materials of Slovakia were determined. Different origin of coals combusted results in significant differences in specific activities of radium-226 and activities-228 of measured fly-ashes and building materials. The knowledge of the specific activity of selected nuclides contained in fly-ashes is, therefore, very important and in specific cases can indicate the possibilities of their further technological use. (J.K.) 1 tab., 3 refs.
A Radium-223 microgenerator from cyclotron-produced trace Actinium-227
International Nuclear Information System (INIS)
Abou, Diane S.; Pickett, Juile; Mattson, John E.; Thorek, Daniel L.J.
2017-01-01
The alpha particle emitter Radium-223 dichloride ("2"2"3RaCl_2) has recently been approved for treatment of late-stage bone metastatic prostate cancer. There is considerable interest in studying this new agent outside of the clinical setting, however the supply of "2"2"3Ra is limited and expensive. We have engineered a "2"2"3Ra microgenerator using traces of "2"2"7Ac previously generated from cyclotron-produced "2"2"5Ac. Radiochemically pure "2"2"3RaCl_2 was made, characterized, evaluated in vivo, and the source was recovered in high yield for regeneration of the microgenerator. - Highlights: • A "2"2"3Ra microgenerator was built using residual "2"2"7Ac from cyclotron-produced "2"2"5Ac. • Following "2"2"5Ac decay, the residual "2"2"7Ac was processed into pure "2"2"3Ra. • "2"2"7Ac and "2"2"7Th were recovered in high yield for a permanent supply of "2"2"3Ra. • Clinically supplied and generator-produced "2"2"3Ra have equivalent in vivo distribution. • Microdose column provides sufficient material for research use.
Energy Technology Data Exchange (ETDEWEB)
Pietralla, N; Fritzsche, M; Savran, D [Institut fuer Kernphysik, Technische Universitaet Darmstadt, 64289 Darmstadt (Germany); Li, T C [Nuclear Structure Laboratory, SUNY at Stony Brook, Stony Brook, NY 11794-3800 (United States); Ahmed, M W; Tonchev, A P; Tornow, W; Weller, H R [Triangle Universities Nuclear Laboratory (TUNL), Duke University, Durham, NC 27708 (United States); Werner, V, E-mail: pietralla@ikp.tu-darmstadt.d [A.W. Wright Nuclear Structure Laboratory (WNSL), Yale University, New Haven, CT (United States)
2010-01-01
Pb({gamma}-vector ,{gamma}') photon scattering reactions were studied [1] with the nearly monochromatic, linearly polarized photon beams at the High Intensity {gamma}-ray Source (HI{gamma}S) at the DFELL. Azimuthal scattering intensity asymmetries measured with respect to the polarization plane of the beam have been used for the first time to assign both the spin and parity quantum numbers of dipole excited states of {sup 206,207,208}Pb at excitation energies in the vicinity of 5.5 MeV. Evidence for dominant particle-core coupling is deduced from these results along with information on excitation energies and electromagnetic transition matrix elements.
Purification of cerium, neodymium and gadolinium for low background experiments
Directory of Open Access Journals (Sweden)
Boiko R.S.
2014-01-01
Full Text Available Cerium, neodymium and gadolinium contain double beta active isotopes. The most interesting are 150Nd and 160Gd (promising for 0ν2β search, 136Ce (2β+ candidate with one of the highest Q2β. The main problem of compounds containing lanthanide elements is their high radioactive contamination by uranium, radium, actinium and thorium. The new generation 2β experiments require development of methods for a deep purification of lanthanides from the radioactive elements. A combination of physical and chemical methods was applied to purify cerium, neodymium and gadolinium. Liquid-liquid extraction technique was used to remove traces of Th and U from neodymium, gadolinium and for purification of cerium from Th, U, Ra and K. Co-precipitation and recrystallization methods were utilized for further reduction of the impurities. The radioactive contamination of the samples before and after the purification was tested by using ultra-low-background HPGe gamma spectrometry. As a result of the purification procedure the radioactive contamination of gadolinium oxide (a similar purification efficiency was reached also with cerium and neodymium oxides was decreased from 0.12 Bq/kg to 0.007 Bq/kg in 228Th, from 0.04 Bq/kg to <0.006 Bq/kg in 226Ra, and from 0.9 Bq/kg to 0.04 Bq/kg in 40K. The purification methods are much less efficient for chemically very similar radioactive elements like actinium, lanthanum and lutetium.
International Nuclear Information System (INIS)
Keller, C.
1988-01-01
Fifty years after the discovery of fission, the scientific community is aware that this type of nuclear reaction could have been discovered more than a decade earlier. Noddack, Tacke and Berg announced in 1925 the discovery of elements Z = 43 (masurium) and rhenium (Z = 75), the first one could be detected only in U-bearing minerals. A recent re-examination by P.H.M. von Assche of the published data clearly showed that the original claim for element Z = 43 of the authors in 1925 was correct and, therefore, they detected not only element Z = 43 but also the first fission product. Because this discovery of element Z = 43 could not be repeated by other authors as that time, the scientific credibility of Noddack-Tacke was very low in order to give credit to her proposal that the 'early' transuranium elements by Enrico Fermi might also be fragments of known (lighter) elements. Enrico Fermi in 1934 obtained these 'early' (and as we today know: wrong) transuranium isotopes by irradiation of uranium with neutrons. A 'wrong' periodic system in the thirties which placed Th, Pa and U as 6d-elements and not as 5f-actinides chemically helped to consider these fission products as transuranium elements Z = 93/94. In 1937/38 I. Curie and P. Savitch discovered an 'actinium-nuclide' with 3,5 h half-life which, however, had properties similar to lanthanium and not to actinium, as they stated. (orig.) [de
Shape of intrinsic alpha pulse height spectra in lanthanide halide scintillators
Wolszczak, W.; Dorenbos, P.
2017-06-01
Internal contamination with actinium-227 and its daughters is a serious drawback in low-background applications of lanthanide-based scintillators. In this work we showed the important role of nuclear γ de-excitations on the shape of the internal alpha spectrum measured in scintillators. We calculated with Bateman equations the activities of contamination isotopes and the time evolution of actinium-227 and its progenies. Next, we measured the intrinsic background spectra of LaBr3(Ce), LaBr3(Ce,Sr) and CeBr3 with a digital spectroscopy technique, and we analyzed them with a pulse shape discrimination method (PSD) and a time-amplitude analysis. Finally, we simulated the α background spectrum with Geant4 tool-kit, consequently taking into account complex α-γ-electron events, the α / β ratio dependence on the α energy, and the electron/γ nonproportionality. We found that α-γ mixed events have higher light yield than expected for alpha particles alone, which leads to overestimation of the α / β ratio when it is measured with internal 227Th and 223Ra isotopes. The time-amplitude analysis showed that the α peaks of 219Rn and 215Po in LaBr3(Ce) and LaBr3(Ce,Sr) are not symmetric. We compared the simulation results with the measured data and provided further evidence of the important role of mixed α-γ-electron events for understanding the shape of the internal α spectrum in scintillators.
International Nuclear Information System (INIS)
Martinot, L.; Fuger, J.
1985-01-01
The oxidation behavior of the actinides is explained on the basis of their electronic structure. The actinide elements, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium, curium, berkelium, californium, einsteinium, fermium, mendelevium, nobelium, and laurencium are included. For all except the last three elements, the points of discussion are oxidation states, Gibbs energies and potentials, and potential diagram for the element in acid solution; and thermodynamic properties of these same elements are tabulated. References are cited following discussion of each element with a total of 97 references being cited. 13 tables
International Nuclear Information System (INIS)
Tekuchev, V.V.; Barashkov, B.I.; Rygalov, L.N.; Dolzhikov, Yu.S.
2001-01-01
For the first time one obtained the polytherms of ultrasound velocity for liquid high-melting metals within wide temperature range. In terms of the rigid sphere model on the basis of the acoustic data one calculated the entropy values for 34 liquid metals at the melting point. The average discrepancy of the calculated values of entropy with the published one constitutes 8.2%. With increase of metal valency the error increases from 2.8 up to 13%. In case of francium, radium, promethium, actinium, hafnium, polonium, rhenium one obtained data for the first time [ru
Status of the lanthanides and actinides in the periodic table
International Nuclear Information System (INIS)
Holden, N.E.
1985-01-01
In extended discussions and correspondence with Ekkehard Fluck, the author was made aware of a problem with the Periodic Table, i.e., which element should be shown in the main table as the representative of the lanthanide series and the actinide series. In earlier discussion, he came to the conclusion that lanthanum and actinium are not the elements which should appear, but rather lutetium and lawrencium are more appropriate for inclusion in their place. This paper will attempt to justify the reasons for the above conclusions. 4 refs
International Nuclear Information System (INIS)
Payne, T.E.
1991-01-01
One way to gain confidence in modelling possible radionuclide releases is to study natural systems which are similar to components of the multibarrier waste repository. Several such analogues are currently under study and these provide useful data about radionuclide behaviour in the natural environment. One such system is the Koongarra uranium deposit in the Northern Territory. In this dissertation, the migration of actinides, primarily uranium and thorium, has been studied as an analogue for the behaviour of transuranics in the far-field of a waste repository. The major findings of this study are: 1. the main process retarding uranium migration in the dispersion fan at Koongarra is sorption, which suppresses dissolved uranium concentrations well below solubility limits, with ferrihydrite being a major sorbing phase; 2. thorium is extremely immobile, with very low dissolved concentrations and corresponding high distribution ratios for 230 Th. Overall, it is estimated that colloids are relatively unimportant in Koongarra groundwater. Uranium migrates mostly as dissolved species, whereas thorium and actinium are mostly adsorbed to larger, relatively immobile particles and the stationary phase. However, of the small amount of 230 Th that passes through a 1μm filter, a significant proportion is associated with colloidal particles. Actinium appears to be slightly more mobile than thorium and is associated with colloids to a greater extent, although generally present in low concentrations. These results support the possibility of colloidal transport of trivalent and tetravalent actinides in the vicinity of a nuclear waste repository. 112 refs., 23 tabs., 32 figs
An eighteen-membered macrocyclic ligand for actinium-225 targeted alpha therapy
International Nuclear Information System (INIS)
Thiele, Nikki A.; MacMillan, Samantha N.; Wilson, Justin J.; Rodriguez-Rodriguez, Cristina
2017-01-01
The 18-membered macrocycle H 2 macropa was investigated for 225 Ac chelation in targeted alpha therapy (TAT). Radiolabeling studies showed that macropa, at submicromolar concentration, complexed all 225 Ac (26 kBq) in 5 min at RT. [ 225 Ac(macropa)] + remained intact over 7 to 8 days when challenged with either excess La 3+ ions or human serum, and did not accumulate in any organ after 5 h in healthy mice. A bifunctional analogue, macropa-NCS, was conjugated to trastuzumab as well as to the prostate-specific membrane antigen-targeting compound RPS-070. Both constructs rapidly radiolabeled 225 Ac in just minutes at RT, and macropa-Tmab retained >99 % of its 225 Ac in human serum after 7 days. In LNCaP xenograft mice, 225 Ac-macropa-RPS-070 was selectively targeted to tumors and did not release free 225 Ac over 96 h. These findings establish macropa to be a highly promising ligand for 225 Ac chelation that will facilitate the clinical development of 225 Ac TAT for the treatment of soft-tissue metastases. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)
An eighteen-membered macrocyclic ligand for actinium-225 targeted alpha therapy
Energy Technology Data Exchange (ETDEWEB)
Thiele, Nikki A.; MacMillan, Samantha N.; Wilson, Justin J. [Cornell Univ., Ithaca, NY (United States). Chemistry and Chemical Biology; Brown, Victoria; Jermilova, Una; Ramogida, Caterina F.; Robertson, Andrew K.H.; Schaffer, Paul; Radchenko, Valery [TRIUMF, Vancouver, BC (Canada). Life Science Div.; Kelly, James M.; Amor-Coarasa, Alejandro; Nikolopoulou, Anastasia; Ponnala, Shashikanth; Williams, Clarence Jr.; Babich, John W. [Radiology, Weill Cornell Medicine, New York, NY (United States); Rodriguez-Rodriguez, Cristina [British Columbia Univ., Vancouver, BC (Canada). Dept. of Physics and Astronomy and Centre for Comparative Medicine
2017-11-13
The 18-membered macrocycle H{sub 2}macropa was investigated for {sup 225}Ac chelation in targeted alpha therapy (TAT). Radiolabeling studies showed that macropa, at submicromolar concentration, complexed all {sup 225}Ac (26 kBq) in 5 min at RT. [{sup 225}Ac(macropa)]{sup +} remained intact over 7 to 8 days when challenged with either excess La{sup 3+} ions or human serum, and did not accumulate in any organ after 5 h in healthy mice. A bifunctional analogue, macropa-NCS, was conjugated to trastuzumab as well as to the prostate-specific membrane antigen-targeting compound RPS-070. Both constructs rapidly radiolabeled {sup 225}Ac in just minutes at RT, and macropa-Tmab retained >99 % of its {sup 225}Ac in human serum after 7 days. In LNCaP xenograft mice, {sup 225}Ac-macropa-RPS-070 was selectively targeted to tumors and did not release free {sup 225}Ac over 96 h. These findings establish macropa to be a highly promising ligand for {sup 225}Ac chelation that will facilitate the clinical development of {sup 225}Ac TAT for the treatment of soft-tissue metastases. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)
Journal of Naval Science. Volume 2. Number 3. July 1976
1976-07-01
supplementary food to the beakers containing stage VI nauplii: cyprids do not feed. The larvae in each beaker were con- fined within a close-fitting plastic...99-274% of Natural U) Uranium-234 (234U) (0-006% of Natural U) 2-48 X 10"’yrs Thorium-230 (230Th) Polonium -218(2I8Po) /through short lived...Natural U) Actinium-227 (--7Ac) FIG. 1. Nuclide chart. 4-51 X 10’Yrs 7 hours P 8 X 10’ Yrs 4 days Lead- 210 (210Pb) (22 yrs,/3"). 1-39 X 10
International Nuclear Information System (INIS)
Han Yinlu; Shen Qingbiao; Zhang Zhengjun; Cai Chonghai
2005-01-01
The quality and reliability of the computational simulation of a macroscopic nuclear device are directly related to the quality of the underlying basic nuclear data. To meet these needs, according to advanced nuclear models that account for details of nuclear structure and the quantum nature of nuclear reaction and the experimental data of total, nonelastic, and elastic scattering cross sections, and elastic scattering angular distributions of Pb and its isotopes, all cross sections of neutron-induced reaction, angular distributions, energy spectra, especially the double-differential cross sections for neutron, proton, deuteron, triton, helium, and alpha emissions are calculated and analyzed for n + 204,206,207,208,nat Pb at incident neutron energies below 20 MeV by using the UNF nuclear model code. At neutron incident energies 20 n ≤ 250 MeV, MEND codes are used. Theoretical calculations are compared with existing experimental data and other evaluated data from ENDF/B-VI and JENDL-3
Energy Technology Data Exchange (ETDEWEB)
Marx, Sebastian Markus
2014-09-23
The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.
Energy Technology Data Exchange (ETDEWEB)
NONE
2006-07-01
In a previous study which concerned the catchment basin of the harbour of Brest, the A.C.R.O. put in evidence a marking by artificial radioelements around the power plant of Brennilis which can be imputed without ambiguities to the nuclear installation. It also put in evidence abnormalities concerning the natural radioactivity which justifies this new study. In the area of the Monts d'Arree, actinium 227 ({sup 227}Ac), non born by its ascendents which are {sup 235}U and {sup 231}Pa is observed. This phenomenon is characterized by mass activities superior to these ones of {sup 235}U and able to reach these ones of {sup 238}U. Its presence corresponds with the drainage of the Ellez river since the former channel of radioactive effluents releases from the nuclear power plant EL-4 up to the reservoir Saint-Herblot situated 6 km downstream. The strongest values of radioactivity are registered near the disused power plant, at this place a relationship exists between the level of actinium 227 and this one of the artificial radioactivity as it exists a relationship with the decay products of radon exhaled from the subsoil ({sup 210}Pb). But its presence is not limited to a part of the Ellez river, it is equally observed in terrestrial medium, in places in priori not influenced by the direct liquid effluents of the power plant. This place is situated at more than 4 km and without any connection with the Ellez waters. At this stage of the study, it is not possible to answer with certainty the question of the origin of this phenomenon. A new reorientation is considered indispensable to clarify definitively the origin of this unknown phenomenon in the scientific publications and the environmental monitoring. (N.C.)
International Nuclear Information System (INIS)
2006-01-01
In a previous study which concerned the catchment basin of the harbour of Brest, the A.C.R.O. put in evidence a marking by artificial radioelements around the power plant of Brennilis which can be imputed without ambiguities to the nuclear installation. It also put in evidence abnormalities concerning the natural radioactivity which justifies this new study. In the area of the Monts d'Arree, actinium 227 ( 227 Ac), non born by its ascendents which are 235 U and 231 Pa is observed. This phenomenon is characterized by mass activities superior to these ones of 235 U and able to reach these ones of 238 U. Its presence corresponds with the drainage of the Ellez river since the former channel of radioactive effluents releases from the nuclear power plant EL-4 up to the reservoir Saint-Herblot situated 6 km downstream. The strongest values of radioactivity are registered near the disused power plant, at this place a relationship exists between the level of actinium 227 and this one of the artificial radioactivity as it exists a relationship with the decay products of radon exhaled from the subsoil ( 210 Pb). But its presence is not limited to a part of the Ellez river, it is equally observed in terrestrial medium, in places in priori not influenced by the direct liquid effluents of the power plant. This place is situated at more than 4 km and without any connection with the Ellez waters. At this stage of the study, it is not possible to answer with certainty the question of the origin of this phenomenon. A new reorientation is considered indispensable to clarify definitively the origin of this unknown phenomenon in the scientific publications and the environmental monitoring. (N.C.)
Valence and inner proton hole states in 207Tl via the (d,3He) reaction at 108 MeV
International Nuclear Information System (INIS)
Langevin-Joliot, H.; Gerlic, E.; Guillot, J.; Van de Wiele, J.
1983-01-01
The excitation energy spectra of the residual nucleus 207 Tl have been investigated up to 14 MeV using the (d, 3 He) reaction at 108 MeV. New groups and high lying structures are first observed up to 8.3 MeV, in addition to the five known low lying levels. Beyond a minimum at 7.13 MeV, weaker structures are observed riding over an asymetric bump located around 9 MeV. DWBA analysis of angular distributions have allowed l attributions and the determination of valence and inner hole spectroscopic factors. It is found that the valence levels at 1.33 MeV, 1.67 MeV and 3.47 MeV exhaust respectively about 65%, 60% and 45% of the 1hsub(11/2), 2dsub(5/2) and 1gsub(7/2) sum rules. The missing strengths are found below 8.3 MeV. The 2dsub(5/2) and 1gsub(7/2) holes contribute mainly to some well concentrated groups, whereas the 1hsub(11/2) strength is distributed more smoothly. Small contributions of 1gsub(9/2) and 2p strengths are tentatively identified below 7.13 MeV. The highest lying energy region up to 14 MeV may approximately account for the 1gsub(9/2) and (1fsub(5/2)) total sum-rule and about 70% of the 2p strength. The 1gsub(9/2) strength gives the largest contribution to the asymetric bump around 9 MeV. The deduced experimental strength functions are compared with theoretical calculations
Energy Technology Data Exchange (ETDEWEB)
Lengemann, F W; Wentworth, R A
1976-01-01
In the past year we have looked at the transfer of some members of the actinide decay series into milk of goats. These were /sup 210/Po, /sup 203/Pb, /sup 201/Tl and /sup 207/Bi. All of these appeared in milk after oral ingestion but at levels less than 1 percent per liter. In addition we have looked at the transfer of /sup 65/Zn into milk of goats after oral and I.V. doses; the experiments are incomplete at this time. In controlled temperature studies it was found that 6.6 times as much radioiodine was secreted into milk when goats were at 33/sup 0/ as opposed to 5/sup 0/C. When radioiodine is put into the mammary gland the transfer from milk to body is rapid; more rapid than is the case for /sup 65/Zn. The analysis of these data indicate the need for a model capable of handling expansion of a compartment.
49 CFR 571.207 - Standard No. 207; Seating systems.
2010-10-01
... standard establishes requirements for seats, their attachment assemblies, and their installation to....2. General performance requirements. When tested in accordance with S5, each occupant seat shall... than a school bus; a passenger seat on a school bus with a GVWR greater than 4,536 kilograms (10,000...
Radionuclide interactions with marine sediments
International Nuclear Information System (INIS)
Higgo, J.J.W.
1987-09-01
A critical review of the literature on the subject of the interactions of radionuclides with marine sediments has been carried out. On the basis of the information available, an attempt has been made to give ranges and 'best estimates' for the distribution ratios between seawater and sediments. These estimates have been based on an understanding of the sediment seawater system and the porewater chemistry and mineralogy. Field measurements, laboratory measurements and estimates based on stable-element geochemical data are all taken into account. Laboratory measurements include distribution-ratio and diffusion-coefficient determinations. The elements reviewed are carbon, chlorine, calcium, nickel, selenium, strontium, zirconium, niobium, technetium, tin, iodine, caesium, lead, radium, actinium, thorium, protactinium, uranium, neptunium, plutonium, americium and curium. (author)
Calculation technique of free and impurity ion electronic structures
International Nuclear Information System (INIS)
Kulagin, N.A.; Sviridov, D.T.
1986-01-01
The monograph deals with calculation technique of free and impurity ion spectra with completed nl N -shell. The principles of the theory of irreducible tensor operators, genealogical coefficients, calculation technique of angular and radial parts of matrix elements operators are stated. The correlation accounting methods in free ions are considered in detail. The principles of the theory of crystal field and ligand field, the method of self-consistent field for impurity ions are reported. The technique efficiency based on example of lanthanum and actinium group ions is shown. Experimental data by nf N -ion spectra are given. The tables of angular coefficients, energy values of X-ray lines of rare earth ions and genealogical coefficients are given in the appendix
International Nuclear Information System (INIS)
Kitamura, Akira; Fujiwara, Kenso; Yui, Mikazu
2010-01-01
Within the scope of the JAEA thermodynamic database project for performance assessment of geological disposal of high-level radioactive and TRU wastes, the refinement of the thermodynamic data for the inorganic compounds and complexes of trivalent actinoids (actinium(III), plutonium(III), americium(III) and curium(III)) and samarium(III) was carried out. Refinement of thermodynamic data for these elements was based on the thermodynamic database for americium published by the Nuclear Energy Agency in the Organisation for Economic Co-operation and Development (OECD/NEA). Based on the similarity of chemical properties among trivalent actinoids and samarium, complementary thermodynamic data for their species expected under the geological disposal conditions were selected to complete the thermodynamic data set for the performance assessment of geological disposal of radioactive wastes. (author)
Energy Technology Data Exchange (ETDEWEB)
None
1979-09-01
Results of two radiological surveys of the St. Louis-Lambert Airport property, formerly known as the Airport Storage Site, St. Louis, Missouri, are presented. Uranium- and radium-bearing waste materials were stored from the 1940's to the late 1960's in this area. The surveys included direct measurements of beta-gamma radiation; determination of uranium, actinium, and radium concentrations in soil samples and from bore holes; determination of radionuclide concentrations in groundwater and surface water; measurement of radon flux from the ground surface; and measurements of /sup 222/Rn in air near the site. Results indicate that some offsite drainage pathways are becoming contaminated, probably by runoff from the site; no migration of /sup 222/Rn from the site was observed.
International Nuclear Information System (INIS)
Leal, Luiz Rogerio Bastos
1998-01-01
The Gaviao Block (GB) in the northern portion of the Sao Francisco Craton-Northeast of Brazil, constitutes one of the oldest Archean fragments of the South American Platform Archean crust. GB underwent several events of juvenile accretion and reworking of continental crust along its evolutionary history, notably between the Archean and the Paleoproterozoic. 207 Pb/ 206 Pb isotopic analyses were carried out in two zircons populations from strongly migmatized TTG terranes found in the proximity of Brumado: the first population (7 crystals) is taken as representative of the crystallization period of the TTG terranes at 3300 ± 45 Ma; the second (2 crystals) represents the age of the first even of metamorphism/migmatization at 2910 ± 10 Ma. 207 Pb/ 206 Pb analyses in zircons from an outcrop of non-migmatized TTG in the area yielded a 3202 ± 15 Ma age (4 crystals), interpreted to be the crystallization period of the gneiss protolith. Sm/Nd analyses on the TTG rocks of the Brumado region yielded T DM model ages varying between 3.26 and 3.36 Ga and ε Nd (t) between -3.5 and +0.7. These data suggest the occurrence of juvenile accretions to the continental crust during the Archean, with differential involvement of crustal materials. The geochemical data of rare earth elements corresponding to the TTG terranes revealed moderate LRRE contents (La N =83,5), low HREE contents (La N =2,5) and a fairly fractionated pattern (La/Yb) N =34, besides lack of negative Eu anomaly, showing that these rocks have similar compositions to those TTG terranes of cratonic continents, as well as some Archean rocks from CSF (e.g. Sete Voltas, Boa Vista). Finally, the youngest ages present in GB rocks (ca. 1.2-0.45 Ga) represent the role played by tectono thermal events, which produced partial or total rejuvenation of the Rb/Sr and K/Ar isotopic systems during the Espinhaco and Brasiliano cycles. In particular, K/Ar ages illustrate the effect of younger regional cooling episodes related to the
Flagmeyer, Uwe
2001-01-01
Hadronic events from the data collected with the DELPHI detector at LEP within an energy range from 89 GeV to 207 GeV are selected and their jet rates are determined. The measurement of jet rates give no indication for an excess of multi jet events at high energies. The four jet rate is compared to next to leading order calculations. Studies on the influence of the renormalisation scale μ are performed confirming previous DELPHI results on optimised scales. Applying scale optimisation methods allows a precise measurement of the strong coupling αs from LEP1 data. The final result is obtained by the CAMBRIDGE algorithm: = 0:1175 ± 0:0010(exp:) ± 0:0017(hadr:) ± 0:0007(scale) . The comparison of αs as measured at the Z and at higher energies gives access to the energy dependence (running) of the strong coupling. The logarithmic energy slope, again obtained from Cambridge, is measured to be = 1:14 ± 0:25(stat:) ± 0:25(sys:) , while the QCD prediction for this quantity is 1.28. The results in are in good ...
Maibam, B.; Goswami, J. N.; Srinivasan, R.
2009-04-01
Dharwar craton is one of the major Archaean crustal blocks in the Indian subcontinent. The craton is comprised of two blocks, western and eastern. The western domain is underlain by orthogneisses and granodiorites (ca. 2.9-3.3 Ga) collectively termed as Peninsular Gneiss [e.g., 1] interspersed with older tracts of metasedimentary and metamorphosed igneous suites (Sargur Group and Dharwar Group; [2]). The eastern part of the craton is dominated by Late Archaean (2.50-2.75 Ga) granitoids and their gneissic equivalents. They are interspersed with schist belts (also of Sargur Group and Dharwar Group), which are lithologically similar to the Dharwar Supergroup in the western block, but are in different metamorphic dress. Here we report 207Pb-206Pb age of zircons separated from the metasedimentary and gneissic samples from the two blocks to constrain the evolution of the Dharwar craton during the early Archaean. Detrital zircons of the metasedimentary rocks from both the blocks show a wide range of overlapping ages between ~2.9 to >3.5 Ga. Zircon ages of the orthogneisses from the two blocks showed that most of the analysed grains of the eastern Dharwar block are found to be of the age as old as the western Dharwar gneisses. Imprints of younger events could be discerned from the presence of overgrowths in zircons from the studied samples throughout the craton. Our data suggest that crust forming cycles in the two blocks of the Dharwar craton occurred contemporaneously during the Archaean. References [1] Beckinsale, R.D., Drury, S.A., Holt, R.W. (1980) Nature 283, 469-470. [2] Swami Nath J., Ramakrishnan M., Viswanatha M.N. (1976) Rec. Geol. Surv. Ind., 107, 149-175.
Dissolved Concentration Limits of Radioactive Elements
Energy Technology Data Exchange (ETDEWEB)
Y. Chen; E.R. Thomas; F.J. Pearson; P.L. Cloke; T.L. Steinborn; P.V. Brady
2003-06-20
The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of radioactive elements under possible repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, and measurements made in laboratory experiments and field work. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 radioactive elements (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium), which are important to calculated dose. Model outputs are mainly in the form of look-up tables plus one or more uncertainty terms. The rest are either in the form of distributions or single values. The results of this analysis are fundamental inputs for total system performance assessment to constrain the release of these elements from waste packages and the engineered barrier system. Solubilities of plutonium, neptunium, uranium, americium, actinium, thorium, protactinium, lead, and radium have been re-evaluated using the newly updated thermodynamic database (Data0.ymp.R2). For all of the actinides, identical modeling approaches and consistent environmental conditions were used to develop solubility models in this revision. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, activity coefficients, and selection of solubility controlling phase have been quantified or otherwise addressed. Moreover, a new blended plutonium solubility model has been developed in this revision, which gives a mean solubility that is three orders of magnitude lower than the plutonium solubility model used for the Total System Performance Assessment for the Site Recommendation. Two alternative neptunium solubility models have also been
Dissolved Concentration Limits of Radioactive Elements
International Nuclear Information System (INIS)
Y. Chen; E.R. Thomas; F.J. Pearson; P.L. Cloke; T.L. Steinborn; P.V. Brady
2003-01-01
The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of radioactive elements under possible repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, and measurements made in laboratory experiments and field work. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 radioactive elements (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium), which are important to calculated dose. Model outputs are mainly in the form of look-up tables plus one or more uncertainty terms. The rest are either in the form of distributions or single values. The results of this analysis are fundamental inputs for total system performance assessment to constrain the release of these elements from waste packages and the engineered barrier system. Solubilities of plutonium, neptunium, uranium, americium, actinium, thorium, protactinium, lead, and radium have been re-evaluated using the newly updated thermodynamic database (Data0.ymp.R2). For all of the actinides, identical modeling approaches and consistent environmental conditions were used to develop solubility models in this revision. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, activity coefficients, and selection of solubility controlling phase have been quantified or otherwise addressed. Moreover, a new blended plutonium solubility model has been developed in this revision, which gives a mean solubility that is three orders of magnitude lower than the plutonium solubility model used for the Total System Performance Assessment for the Site Recommendation. Two alternative neptunium solubility models have also been
International Nuclear Information System (INIS)
Fluegge, S.
1989-01-01
After the great survey of neutron induced radioactivity by Fermi and co-workers, the laboratories in Paris and Berlin-Dahlen tried to disentangle the complex results found in uranium. At that time neutron sources were small, activities low, and equipment very simple. Chemistry beyond uranium still was unknown. Hahn and Meitner believed to have observed three transuranic isomeric chains, a doubtful result even then. Early in 1938, Curie and Savic in Paris found an activity interpreted to be actinium, and Hahn and Meitner another to be radium. Both interpretations seemed impossible from energy considerations. Hahn and Strassmann, therefore, continued this work and succeeded to separate the new activity from radium. There remained no doubt that a barium isotope had been produced, the uranium nucleus splitting in the yet-unknown process we now call fission
Harvey, P J; Handley, H K; Taylor, M P
2015-08-01
This study utilises a range of scientific approaches, including lead isotopic compositions, to differentiate unknown sources of ongoing lead contamination of a drinking water supply in north-eastern Tasmania, Australia. Drinking water lead concentrations are elevated above the Australian Drinking Water Guideline (10 μg/L), reaching 540 μg/L in the supply network. Water lead isotopic compositions from the town of Pioneer ((208)Pb/(207)Pb 2.406, (206)Pb/(207)Pb 1.144 to (208)Pb/(207)Pb 2.360, (206)Pb/(207)Pb 1.094) and Ringarooma ((208)Pb/(207)Pb 2.398, (206)Pb/(207)Pb 1.117) are markedly different from the local bedrock ((208)Pb/(207)Pb 2.496, (206)Pb/(207)Pb 1.237). The data show that the lead in the local waters is sourced from a combination of dilapidated drinking water infrastructure, including lead jointed pipelines, end-of-life polyvinyl chloride pipes and household plumbing. Drinking water is being inadvertently contaminated by aging infrastructure, and it is an issue that warrants investigation to limit the burden of disease from lead exposure.
New method for large scale production of medically applicable Actinium-225 and Radium-223
International Nuclear Information System (INIS)
Aliev, R.A.; Vasilyev, A.N.; Ostapenko, V.; Kalmykov, S.N.; Zhuikov, B.L.; Ermolaev, S.V.; Lapshina, E.V.
2014-01-01
Alpha-emitters ( 211 At, 212 Bi, 213 Bi, 223 Ra, 225 Ac) are promising for targeted radiotherapy of cancer. Only two alpha decays near a cell membrane result in 50% death of cancer cell and only a single decay inside the cell is required for this. 225 Ac may be used either directly or as a mother radionuclide in 213 Bi isotope generator. Production of 225 Ac is provided by three main suppliers - Institute for Transuranium Elements in Germany, Oak Ridge National Laboratory in USA and Institute of Physics and Power Engineering in Obninsk, Russia. The current worldwide production of 225 Ac is approximately 1.7 Ci per year that corresponds to only 100-200 patients that could be treated annually. The common approach for 225 Ac production is separation from mother 229 Th or irradiation of 226 Ra with protons in a cyclotron. Both the methods have some practical limitations to be applied routinely. 225 Ac can be also produced by irradiation of natural thorium with medium energy protons . Cumulative cross sections of 225 Ac, 227 Ac, 227 Th, 228 Th formations have been obtained recently. Thorium targets (1-9 g) were irradiated by 114-91 MeV proton beam (1-50 μA) at INR linear accelerator. After dissolution in 8 M HNO 3 + 0.004 M HF thorium was removed by double LLX by HDEHP in toluene (1:1). Ac and REE were pre-concentrated and separated from Ra and most fission products by DGA-Resin (Triskem). After washing out by 0.01 M HNO 3 Ac was separated from REE by TRU Resin (Triskem) in 3 M HNO 3 media. About 6 mCi 225 Ac were separated in hot cell with chemical yield 85%. The method may be upscaled for production of Ci amounts of the radionuclide. The main impurity is 227 Ac (0.1% at the EOB) but it does not hinder 225 Ac from being used for medical 225 Ac/ 213 Bi generators. (author)
The marine geochemistry of actinium-227: Evidence for its migration through sediment pore water
International Nuclear Information System (INIS)
Nozaki, Yoshiyuki; Yamada, Masatoshi; Nikaido, Hirofumi
1990-01-01
227 Ac with a half life of 21.8 years has a potential utility as a tracer of deep water circulation and mixing studies on time scales less than 100 years. Here the authors present the first measurement of 227 Ac profile in the pore water of Northwest Pacific deep-sea sediment and in the ∼10,000 m long water column of Izu-Ogasawara Trench. The results clearly show that 227 Ac is supplied from the sediment to the overlying water through migration in the pore water. The model calculation indicates that the molecular diffusion alone through sediment porewater can support only a half of the standing crop of excess 227 Ac in the water column and the enhanced supply of 227 Ac by particle mixing is necessary to account for the remainder. Thus, bioturbation in the deep sea plays an important role in controlling the flux of some short-lived radionuclides such as 227 Ac and 228 Ra across the sediment-water interface
Energy Technology Data Exchange (ETDEWEB)
Leal, Luiz Rogerio Bastos
1998-07-01
The Gaviao Block (GB) in the northern portion of the Sao Francisco Craton-Northeast of Brazil, constitutes one of the oldest Archean fragments of the South American Platform Archean crust. GB underwent several events of juvenile accretion and reworking of continental crust along its evolutionary history, notably between the Archean and the Paleoproterozoic. {sup 207}Pb/{sup 206}Pb isotopic analyses were carried out in two zircons populations from strongly migmatized TTG terranes found in the proximity of Brumado: the first population (7 crystals) is taken as representative of the crystallization period of the TTG terranes at 3300 {+-} 45 Ma; the second (2 crystals) represents the age of the first even of metamorphism/migmatization at 2910 {+-} 10 Ma. {sup 207} Pb/{sup 206} Pb analyses in zircons from an outcrop of non-migmatized TTG in the area yielded a 3202 {+-} 15 Ma age (4 crystals), interpreted to be the crystallization period of the gneiss protolith. Sm/Nd analyses on the TTG rocks of the Brumado region yielded T{sub DM} model ages varying between 3.26 and 3.36 Ga and {epsilon}{sub Nd}{sup (t)} between -3.5 and +0.7. These data suggest the occurrence of juvenile accretions to the continental crust during the Archean, with differential involvement of crustal materials. The geochemical data of rare earth elements corresponding to the TTG terranes revealed moderate LRRE contents (La{sub N}=83,5), low HREE contents (La{sub N}=2,5) and a fairly fractionated pattern (La/Yb){sub N}=34, besides lack of negative Eu anomaly, showing that these rocks have similar compositions to those TTG terranes of cratonic continents, as well as some Archean rocks from CSF (e.g. Sete Voltas, Boa Vista). Finally, the youngest ages present in GB rocks (ca. 1.2-0.45 Ga) represent the role played by tectono thermal events, which produced partial or total rejuvenation of the Rb/Sr and K/Ar isotopic systems during the Espinhaco and Brasiliano cycles. In particular, K/Ar ages illustrate the
Brewer, John M; Glover, Claiborne V C; Holland, Michael J; Lebioda, Lukasz
2003-05-01
The hypothesis that His159 in yeast enolase moves on a polypeptide loop to protonate the phosphoryl of 2-phosphoglycerate to initiate its conversion to phosphoenolpyruvate was tested by preparing H159N, H159A, and H159F enolases. These have 0.07%-0.25% of the native activity under standard assay conditions and the pH dependence of maximum velocities of H159A and H159N mutants is markedly altered. Activation by Mg2+ is biphasic, with the smaller Mg2+ activation constant closer to that of the "catalytic" Mg2+ binding site of native enolase and the larger in the mM range in which native enolase is inhibited. A third Mg2+ may bind to the phosphoryl, functionally replacing proton donation by His159. N207A enolase lacks an intersubunit interaction that stabilizes the closed loop(s) conformation when 2-phosphoglycerate binds. It has 21% of the native activity, also exhibits biphasic Mg2+ activation, and its reaction with the aldehyde analogue of the substrate is more strongly inhibited than is its normal enzymatic reaction. Polypeptide loop(s) closure may keep a proton from His159 interacting with the substrate phosphoryl oxygen long enough to stabilize a carbanion intermediate.
African Journals Online (AJOL)
DR. AMIN
2011-12-02
Dec 2, 2011 ... insecticidal activities against the two insect pests of stored grains of maize ... If the plant powders reduce adult longevity and fitness, the number of ... physical contact and caused suffocation among the adult weevils. Powder of ...
African Journals Online (AJOL)
DR. AMIN
2011-12-02
Dec 2, 2011 ... important role in protection of stored grains from insect invasion during storage. Key words: ... for their insecticidal value, but there was no much progress in ... Neem. Dogon-Yaro. Meliaceae. Seeds. 2. Jatropha curcas L.
Process for radioisotope recovery and system for implementing same
Meikrantz, David H [Idaho Falls, ID; Todd, Terry A [Aberdeen, ID; Tranter, Troy J [Idaho Falls, ID; Horwitz, E Philip [Naperville, IL
2009-10-06
A method of recovering daughter isotopes from a radioisotope mixture. The method comprises providing a radioisotope mixture solution comprising at least one parent isotope. The at least one parent isotope is extracted into an organic phase, which comprises an extractant and a solvent. The organic phase is substantially continuously contacted with an aqueous phase to extract at least one daughter isotope into the aqueous phase. The aqueous phase is separated from the organic phase, such as by using an annular centrifugal contactor. The at least one daughter isotope is purified from the aqueous phase, such as by ion exchange chromatography or extraction chromatography. The at least one daughter isotope may include actinium-225, radium-225, bismuth-213, or mixtures thereof. A liquid-liquid extraction system for recovering at least one daughter isotope from a source material is also disclosed.
Energy Technology Data Exchange (ETDEWEB)
NSTec Environmental Restoration
2010-04-28
Well ER-20-7 was drilled for the U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office in support of the Nevada Environmental Restoration Project at the Nevada Test Site, Nye County, Nevada. The well was drilled in June 2009 as part of the Pahute Mesa Phase II drilling program. The primary purpose of the well was to further investigate migration of radionuclides from the nearby, up-gradient TYBO and BENHAM underground nuclear tests, which originally was discovered at Well Cluster ER-20-5. This well also provided detailed hydrogeologic information in the Tertiary volcanic section that will reduce uncertainties within the Pahute Mesa-Oasis Valley hydrostratigraphic framework model. The main 44.45-centimeter hole was drilled to a depth of 681.8 meters and cased with 33.97-centimeter casing to 671.7 meters. The hole diameter was then decreased to 31.12 centimeters, and the well was drilled to total depth of 894.9 meters. The completion string, set to the depth of 890.0 meters, consists of 14.13-centimeter stainless-steel casing hanging from 19.37-centimeter carbon-steel casing. The 14.13-centimeter stainless-steel casing has one continuous slotted interval open to the Topopah Spring aquifer. Data collected during and shortly after hole construction include composite drill cuttings samples collected every 3.0 meters, sidewall core samples from 20 depth intervals, various geophysical logs, water quality (primarily tritium) measurements, and water level measurements. The well penetrated 894.9 meters of Tertiary volcanic rock, including two saturated welded-tuff aquifers. A fluid level measurement was obtained during open-hole geophysical well logging for the upper, Tiva Canyon, aquifer at the depth of 615.7 meters on June 19, 2009. The fluid level measured in the open hole on June 27, 2009,after the total depth was reached and the upper aquifer was cased off, was also at the depth of 615.7 meters. Preliminary field measurements indicated 1
U-234/U-238 ratio: Qualitative estimate of groundwater flow in Rocky Flats monitoring wells
International Nuclear Information System (INIS)
Laul, J.C.
1994-01-01
Groundwater movement through various pathways is the primary mechanism for the transport of radionuclides and trace elements in a water/rock interaction. About three dozen wells, installed in the Rocky Flats Plant (RFP) Solar Evaporation Ponds (SEP) area, are monitored quarterly to evaluate the extent of any lateral and downgradient migration of contaminants from the Solar Evaporation Ponds: 207-A; 207-B North, 207-B Center, and 207-B South; and 207-C. The Solar Ponds are the main source for the various contaminants: radionuclides (U-238, U-234, Pu-239, 240 and Am-241); anions; and trace metals to groundwaters. The U-238 concentrations in Rocky Flats groundwaters vary from 2 (CO 3 ) 2 2- , because of the predominant bicarbonate medium
The chemistry of the actinide elements. Volume I
International Nuclear Information System (INIS)
Katz, J.J.; Seaborg, G.T.; Morss, L.R.
1986-01-01
The Chemistry of the Actinide Elements is a comprehensive, contemporary and authoritative exposition of the chemistry and related properties of the 5f series of elements: actinium, thorium, protactinium, uranium and the first eleven. This second edition has been completely restructured and rewritten to incorporate current research in all areas of actinide chemistry and chemical physics. The descriptions of each element include accounts of their history, separation, metallurgy, solid-state chemistry, solution chemistry, thermo-dynamics and kinetics. Additionally, separate chapters on spectroscopy, magnetochemistry, thermodynamics, solids, the metallic state, complex ions and organometallic compounds emphasize the comparative chemistry and unique properties of the actinide series of elements. Comprehensive lists of properties of all actinide compounds and ions in solution are given, and there are special sections on such topics as biochemistry, superconductivity, radioisotope safety, and waste management, as well as discussion of the transactinides and future elements
A neutron source of variable fluence
International Nuclear Information System (INIS)
Brachet, Guy; Demichel, Pascal; Prigent, Yvon; Riche, J.C.
1975-01-01
The invention concerns a variable fluence neutron source, like those that use in the known way a reaction between a radioactive emitter and a target, particularly of type (α,n). The emitter being in powder form lies in a carrier fluid forming the target, inside a closed containment. Facilities are provided to cause the fluidisation of the emitter by the carrier fluid in the containment. The fluidisation of the emitting powder is carried out by a booster with blades, actuated from outside by a magnetic coupling. The powder emitter is a α emitter selected in the group of curium, plutonium, thorium, actinium and americium oxides and the target fluid is formed of compounds of light elements selected from the group of beryllium, boron, fluorine and oxygen 18. The target fluid is a gas used under pressure or H 2 O water highly enriched in oxygen 18 [fr
Zhou, Miou; Dominguez, Reymundo; Baudry, Michel
2007-12-01
Although oxygen/glucose deprivation (OGD) has been widely used as a model of ischemic brain damage, the mechanisms underlying acute neuronal death in this model are not yet well understood. We used OGD in acute hippocampal slices to investigate the roles of reactive oxygen species and of the mitogen-activated protein kinases (MAPKs) in neuronal death. In particular, we tested the neuroprotective effects of two synthetic superoxide dismutase/catalase mimetics, EUK-189 and EUK-207. Acute hippocampal slices prepared from 2-month-old or postnatal day 10 rats were exposed to oxygen and glucose deprivation for 2 h followed by 2.5 h reoxygenation. Lactate dehydrogenase (LDH) release in the medium and propidium iodide (PI) uptake were used to evaluate cell viability. EUK-189 or EUK-207 applied during the OGD and reoxygenation periods decreased LDH release and PI uptake in slices from 2-month-old rats. EUK-189 or EUK-207 also partly blocked OGD-induced ATP depletion and extracellular signal-regulated kinases 1 and 2 (ERK1/2) dephosphorylation, and completely eliminated reactive oxygen species generation. The MEK inhibitor U0126 applied together with EUK-189 or EUK-207 completely blocked ERK1/2 activation, but had no effect on their protective effects against OGD-induced LDH release. U0126 alone had no effect on OGD-induced LDH release. EUK-207 had no effect on OGD-induced p38 or c-Jun N-terminal kinase dephosphorylation, and when the p38 inhibitor SB203580 was applied together with EUK-207, it had no effect on the protective effects of EUK-207. SB203580 alone had no effect on OGD-induced LDH release either. In slices from p10 rats, OGD also induced high-LDH release that was partly reversed by EUK-207; however, neither OGD nor EUK-207 produced significant changes in ERK1/2 and p38 phosphorylation. OGD-induced spectrin degradation was not modified by EUK-189 or EUK-207 in slices from p10 or 2-month-old rats, suggesting that their protective effects was not mediated through
International Nuclear Information System (INIS)
Marx, Sebastian Markus
2014-01-01
The thesis describes the development of methods for the purification of Ra-226. The objective was to obtain the radionuclide in the quality that is needed to be used as starting material in the manufacturing process for Ac-225 via proton-irradiated Ra-226. The radionuclide has been gained efficiently out of huge excesses of impurities. The high purity of the obtained radium affords its use as staring material in a pharmaceutical manufacturing process.
International Nuclear Information System (INIS)
Ragavan, Anpalaki J.
2006-01-01
Linear free energy relationships for trivalent cations with crystalline M 2 O 3 and, M(OH) 3 phases of lanthanides and actinides were developed from known thermodynamic properties of the aqueous trivalent cations, modifying the Sverjensky and Molling equation. The linear free energy relationship for trivalent cations is as ΔG f,MvX 0 =a MvX ΔG n,M 3+ 0 +b MvX +β MvX r M 3+ , where the coefficients a MvX , b MvX , and β MvX characterize a particular structural family of MvX, r M 3+ is the ionic radius of M 3+ cation, ΔG f,MvX 0 is the standard Gibbs free energy of formation of MvX and ΔG n,M 3+ 0 is the standard non-solvation free energy of the cation. The coefficients for the oxide family are: a MvX =0.2705, b MvX =-1984.75 (kJ/mol), and β MvX =197.24 (kJ/molnm). The coefficients for the hydroxide family are: a MvX =0.1587, b MvX =-1474.09 (kJ/mol), and β MvX =791.70 (kJ/molnm).
Bellis, D; McLeod, C W; Satake, K
2001-02-01
Samples of tree bark, which accumulate airborne material, were collected from seven locations in the UK to provide an indication of the magnitude and source of lead pollution. Measurement of the Pb content and 206/207Pb stable isotope ratio by inductively coupled plasma mass spectrometry revealed significant differences between the sites. The concentration of Pb varied over almost four orders of magnitude from 7.2 to 9,600 micrograms g-1, the maximum values being found near a 'secondary' Pb smelter. The 206/207Pb isotope ratios varied from 1.108 +/- 0.002 to 1.169 +/- 0.001. The lowest Pb concentrations and highest isotope ratios were detected in bark samples from the Scilly Isles, reflecting the low-level of industry and road traffic. In contrast, samples obtained from a city centre (Sheffield) and near a motorway (M1) contained 25-46 micrograms g-1 Pb and recorded the lowest 206/207Pb ratios. Higher concentrations in the vicinity of a coal-fired power station recorded a 206/207Pb ratio of 1.14, suggesting a significant contribution from fly-ash. The relative contribution of lead from petrol (206/207Pb = 1.08) and other sources such as coal (206/207Pb = 1.18) were thus estimated using mass balance equations. Tree bark near the lead smelter recorded an intermediate 206/207Pb ratio of 1.13 reflecting the processing of material of mixed origin.
Development of ion beam sputtering techniques for actinide target preparation
International Nuclear Information System (INIS)
Aaron, W.S.; Zevenbergen, L.A.; Adair, H.L.
1985-01-01
Ion beam sputtering is a routine method for the preparation of thin films used as targets because it allows the use of minimum quantity of starting material, and losses are much lower than most other vacuum deposition techniques. Work is underway in the Isotope Research Materials Laboratory (IRML) at ORNL to develop the techniques that will make the preparation of actinide targets up to 100 μg/cm 2 by ion beam sputtering a routinely available service from IRML. The preparation of the actinide material in a form suitable for sputtering is a key to this technique, as is designing a sputtering system that allows the flexibility required for custom-ordered target production. At present, development work is being conducted on low-activity in a bench-top system. The system will then be installed in a hood or glove box approved for radioactive materials handling where processing of radium, actinium, and plutonium isotopes among others will be performed. (orig.)
Development of ion beam sputtering techniques for actinide target preparation
Aaron, W. S.; Zevenbergen, L. A.; Adair, H. L.
1985-06-01
Ion beam sputtering is a routine method for the preparation of thin films used as targets because it allows the use of a minimum quantity of starting material, and losses are much lower than most other vacuum deposition techniques. Work is underway in the Isotope Research Materials Laboratory (IRML) at ORNL to develop the techniques that will make the preparation of actinide targets up to 100 μg/cm 2 by ion beam sputtering a routinely available service from IRML. The preparation of the actinide material in a form suitable for sputtering is a key to this technique, as is designing a sputtering system that allows the flexibility required for custom-ordered target production. At present, development work is being conducted on low-activity actinides in a bench-top system. The system will then be installed in a hood or glove box approved for radioactive materials handling where processing of radium, actinium, and plutonium isotopes among others will be performed.
International Nuclear Information System (INIS)
Berven, B.A.; Goldsmith, W.A.; Haywood, F.F.; Schiager, K.J.
1979-01-01
Many sites used during the early days of the US atomic energy program are contaminated with radionuclides of the primordial decay chains (uranium, thorium, and actinium series). This contamination consists of residues resulting from refining and processing uranium and thorium. Preparation of these sites for release to unrestricted private use will involve the assistance of construction workers, many of whom have limited knowledge of the hazards associated with radioactive materials. Therefore, there is a need to educate these workers in the fundamentals of radioactive material handling to minimize exposures and possible spread of contamination. This training should disseminate relevant information at an appropriate educational level and should instill a cautious, common-sense attitude toward the handling of radioactive materials. The training should emphasize basic information concerning environmental radiation within a context of relative risk. A multi-media format, including colorful visual aids, demonstration, and discussion, should be used to maximize motivation and retention. A detailed, proposed training program design is presented
International Nuclear Information System (INIS)
Lee, Khanghyun; Hur, Soon Do; Hou, Shugui; Burn-Nunes, Laurie J.; Hong, Sungmin; Barbante, Carlo; Boutron, Claude F.; Rosman, Kevin J.R.
2011-01-01
A long-term record, extending back 800 years (1205 to 2002 AD), of the Pb isotopic composition ( 206 Pb/ 207 Pb and 208 Pb/ 207 Pb) as well as Pb concentrations from high altitude Mt. Everest ice cores has the potential to identify sources and source regions affecting natural and anthropogenic Pb deposition in central Asia. The results show that the regional natural background Pb isotope signature (∼ 1.20 for 206 Pb/ 207 Pb and ∼ 2.50 for 208 Pb/ 207 Pb) in the central Himalayas was dominated by mineral dust over the last ∼ 750 years from 1205 to 1960s, mostly originating from local sources with occasional contributions of long-range transported dust probably from Sahara desert and northwestern India. Since the 1970s, the Pb isotope ratios are characterized by a continuous decline toward less radiogenic ratios with the least mean ratios of 1.178 for 206 Pb/ 207 Pb and 2.471 for 208 Pb/ 207 Pb in the period 1990–1996. The depression of the 206 Pb/ 207 Pb and 208 Pb/ 207 Pb values during the corresponding periods is most likely due to an increasing influence of less radiogenic Pb of anthropogenic origin mainly from leaded gasoline used in South Asia (India as well as possibly Bangladesh and Nepal). From 1997 to 2002, isotopic composition tends to show a shift to slightly more radiogenic signature. This is likely attributed to reducing Pb emissions from leaded gasoline in source regions, coinciding with the nationwide reduction of Pb in gasoline and subsequent phase-out of leaded gasoline in South Asia since 1997. An interesting feature is the relatively high levels of Pb concentrations and enrichment factors (EF) between 1997 and 2002. Although the reason for this feature remains uncertain, it would be probably linked with an increasing influence of anthropogenic Pb emitted from other sources such as fossil fuel combustion and non-ferrous metal production.
Energy Technology Data Exchange (ETDEWEB)
Lee, Khanghyun; Hur, Soon Do [Korea Polar Research Institute, Songdo Techno Park, 7-50, Songdo-dong, Yeonsu-gu, Incheon 406-840 (Korea, Republic of); Hou, Shugui [State Key Laboratory of Cryospheric Science, Cold and Arid Regions Environmental and Engineering Research Institute, Chinese Academy of Science, Lanzhou 730000 (China); School of Geographic and Oceanographic Sciences, Nanjing University, Nanjing 210093 (China); Burn-Nunes, Laurie J. [Department of Imaging and Applied Physics, Curtin University of Technology, GPO Box U1987, Perth, WA 6845 (Australia); Hong, Sungmin, E-mail: smhong@inha.ac.kr [Department of Ocean Sciences, Inha University, 253 Yonghyun-dong, Nam-gu, Incheon, 402-751 (Korea, Republic of); Barbante, Carlo [Department of Environmental Sciences, University Ca' Foscari of Venice, Dorsoduro 2137, 30 123 Venice (Italy); Institute for the Dynamics of Environmental Processes-CNR, University Ca' Foscari of Venice, Dorsoduro 2137, 30 123 Venice (Italy); Boutron, Claude F. [Laboratoire de Glaciologie et Geophysique de l' Environnement (UMR Universite Joseph Fourier/CNRS 5183 ), 54 rue Moliere, BP 96, 38402 Saint Martin d' Heres Cedex (France); Unite de Formation et de Recherche ' Physique, Ingenierie, Terre, Environnement, Mecanique' , Universite Joseph Fourier de Grenoble ( Institut Universitaire de France ), 715 rue de la Houille Blanche, BP 53, 38041 Grenoble Cedex 9 (France); Rosman, Kevin J.R. [Department of Imaging and Applied Physics, Curtin University of Technology, GPO Box U1987, Perth, WA 6845 (Australia)
2011-12-15
A long-term record, extending back 800 years (1205 to 2002 AD), of the Pb isotopic composition ({sup 206}Pb/{sup 207}Pb and {sup 208}Pb/{sup 207}Pb) as well as Pb concentrations from high altitude Mt. Everest ice cores has the potential to identify sources and source regions affecting natural and anthropogenic Pb deposition in central Asia. The results show that the regional natural background Pb isotope signature ({approx} 1.20 for {sup 206}Pb/{sup 207}Pb and {approx} 2.50 for {sup 208}Pb/{sup 207}Pb) in the central Himalayas was dominated by mineral dust over the last {approx} 750 years from 1205 to 1960s, mostly originating from local sources with occasional contributions of long-range transported dust probably from Sahara desert and northwestern India. Since the 1970s, the Pb isotope ratios are characterized by a continuous decline toward less radiogenic ratios with the least mean ratios of 1.178 for {sup 206}Pb/{sup 207}Pb and 2.471 for {sup 208}Pb/{sup 207}Pb in the period 1990-1996. The depression of the {sup 206}Pb/{sup 207}Pb and {sup 208}Pb/{sup 207}Pb values during the corresponding periods is most likely due to an increasing influence of less radiogenic Pb of anthropogenic origin mainly from leaded gasoline used in South Asia (India as well as possibly Bangladesh and Nepal). From 1997 to 2002, isotopic composition tends to show a shift to slightly more radiogenic signature. This is likely attributed to reducing Pb emissions from leaded gasoline in source regions, coinciding with the nationwide reduction of Pb in gasoline and subsequent phase-out of leaded gasoline in South Asia since 1997. An interesting feature is the relatively high levels of Pb concentrations and enrichment factors (EF) between 1997 and 2002. Although the reason for this feature remains uncertain, it would be probably linked with an increasing influence of anthropogenic Pb emitted from other sources such as fossil fuel combustion and non-ferrous metal production.
Yang, Yuqi; Zhou, Hongbo; Shen, Xiaoping
2013-05-01
The asymmetric unit of the title complex, [Fe2Ni(C19H12N3O)2(CN)6(C16H36N4)]·2.07H2O, contains one [Fe(qcq)(CN)3](-) anion, half a [Ni(teta)](2+) cation and two partially occupied inter-stitial water mol-ecules [qcq(-) is the N-(quinolin-8-yl)quinoline-2-carboxamidate anion and teta is 5,5,7,12,12,14-hexa-methyl-1,4,8,11-tetra-aza-cyclo-tetra-deca-ne]. In the complex mol-ecule, two [Fe(qcq)(CN)3](-) anions additionally coordinate the central [Ni(teta)](2+) cation through cyanide groups in a trans mode, resulting in a trinuclear structure with the Ni(2+) cation lying on an inversion centre. The two inter-stitial water mol-ecules are partially occupied, with occupancy factors of 0.528 (10) and 0.506 (9). O-H⋯O and O-H⋯N hydrogen bonding involving the two lattice water molecules and the carbonyl function and a teta N atom in an adjacent cluster leads to the formation of layers extending parallel to (010).
Itahashi, K.; Oyama, K.; Hayano, R. S.; Gilg, H.; Gillitzer, A.; Knülle, M.; Münch, M.; Schott, W.; Kienle, P.; Geissel, H.; Iwasa, N.; Münzenberg, G.; Hirenzaki, S.; Toki, H.; Yamazaki, T.
2000-08-01
We find a remarkable agreement of the excitation energy spectrum of the 208Pb(d,3He) reaction measured at Td=600 MeV near the π- production threshold with its theoretical prediction. Their comparison leads us to assign the distinct narrow peak observed at about 5 MeV below the threshold to the formation of bound pionic states π-⊗207Pb of the quasisubstitutional configurations (2p)π-(3p3/2,3p1/2)-1n. A small bump observed on the tail of the peak is assigned to the pionic 1s state. The binding energies (Bnl) and the widths (Γnl) of the pionic orbitals are deduced to be B2p=5.13+/-0.02 (stat)+/-0.12 (syst) MeV and Γ2p=0.43+/-0.06 (stat)+/-0.06 (syst) MeV by decomposing the experimental spectrum into the pionic 1s and 2p components. While B2p and Γ2p are determined with small ambiguity, B1s and Γ1s are strongly correlated with each other, and are affected by the relative 1s/2p cross section ratio assumed, since the 1s component is observed only as an unresolved bump. Thus, we have to allow large uncertainties 6.6 MeV
Energy Technology Data Exchange (ETDEWEB)
Eades, L.J.; Farmer, J.G. [Environmental Chemistry Unit, Department of Chemistry, University of Edinburgh, West Mains Road, EH9 3JJ, Scotland Edinburgh (United Kingdom); MacKenzie, A.B. [Scottish Universities Research and Reactor Centre, East Kilbride, G75 0QF, Scotland Glasgow (United Kingdom); Kirika, A.; Bailey-Watts, A.E. [NERC Centre for Ecology and Hydrology, EH26 0QB, Scotland Penicuik (United Kingdom)
2002-06-20
Sediment cores from three Scottish freshwater lakes, Loch Ness in the remote north and Loch Lomond and the Lake of Menteith, much closer to the heavily populated and industrialised central belt, were analysed for 210Pb, 137Cs, Pb and stable Pb isotopic composition (206Pb/207Pb). The radionuclide data were used to establish chronologies for the Loch Ness and Loch Lomond cores, but a chronology could not be developed for the Lake of Menteith core, in which the surface sediment had been subject to intense mixing. Although Pb concentrations generally started increasing during the mid-17th Century, a small peak occurred for Loch Ness in the early 16th Century, perhaps attributable to the influence of medieval mining and smelting in mainland Europe. Temporal trends in the pattern of Pb accumulation were similar for Loch Ness and both sites in Loch Lomond, with 40-50% of the anthropogenic Pb deposited prior to the 20th Century. Fluxes of anthropogenic Pb to the lake sediments peaked during the 1950s at all locations where chronologies could be established. The 5-fold increase in anthropogenic Pb inventory for the southern basin of Loch Lomond relative to Loch Ness reflected geographical proximity to the main polluting sources. The 206Pb/207Pb data for anthropogenic Pb in the sediments from Loch Ness and Loch Lomond exhibited largely similar trends related to five different time periods. Pre-1820, the 206Pb/207Pb ratio was close to that for coal (1.181). From 1820 to 1900, a fairly constant 206Pb/207Pb ratio of 1.17 probably resulted from a combination of emissions from the smelting of indigenous Pb ore (1.170) and coal burning (1.181) in Scotland, and industrial activity to the south in England, where Australian Pb of characteristically low 206Pb/207Pb ratio (1.04) was already in use. From 1901 to 1930, the 206Pb/207Pb ratio declined by <0.01, due to the increasing influence of Australian Pb. From 1931 to 1975/1985, the 206Pb/207Pb ratio of anthropogenic Pb declined by a
Eades, L J; Farmer, J G; MacKenzie, A B; Kirika, A; Bailey-Watts, A E
2002-06-20
Sediment cores from three Scottish freshwater lakes, Loch Ness in the remote north and Loch Lomond and the Lake of Menteith, much closer to the heavily populated and industrialised central belt were analysed for 210Pb, 137Cs, Pb and stable Pb isotopic composition (206Pb/207Pb). The radionuclide data were used to establish chronologies for the Loch Ness and Loch Lomond cores, but a chronology could not be developed for the Lake of Menteith core, in which the surface sediment had been subject to intense mixing. Although Pb concentrations generally started increasing during the mid-17th Century, a small peak occurred for Loch Ness in the early 16th Century, perhaps attributable to the influence of medieval mining and smelting in mainland Europe. Temporal trends in the pattern of Pb accumulation were similar for Loch Ness and both sites in Loch Lomond, with 40-50% of the anthropogenic Pb deposited prior to the 20th Century. Fluxes of anthropogenic Pb to the lake sediments peaked during the 1950s at all locations where chronologies could be established. The 5-fold increase in anthropogenic Pb inventory for the southern basin of Loch Lomond relative to Loch Ness reflected geographical proximity to the main polluting sources. The 206Pb/207Pb data for anthropogenic Pb in the sediments from Loch Ness and Loch Lomond exhibited largely similar trends related to five different time periods. Pre-1820, the 206Pb/207Pb ratio was close to that for coal (1.181). From 1820 to 1900, a fairly constant 206Pb/207Pb ratio of approximately 1.17 probably resulted from a combination of emissions from the smelting of indigenous Pb ore (1.170) and coal burning (1.181) in Scotland, and industrial activity to the south in England, where Australian Pb of characteristically low 206Pb/207Pb ratio (1.04) was already in use. From 1901 to 1930, the 206Pb/207Pb ratio declined by <0.01, due to the increasing influence of Australian Pb. From 1931 to 1975/1985, the 206Pb/207Pb ratio of anthropogenic Pb
micrOMEGAs 2.0.7: a program to calculate the relic density of dark matter in a generic model
Bélanger, G.; Boudjema, F.; Pukhov, A.; Semenov, A.
2007-12-01
micrOMEGAs2.0.7 is a code which calculates the relic density of a stable massive particle in an arbitrary model. The underlying assumption is that there is a conservation law like R-parity in supersymmetry which guarantees the stability of the lightest odd particle. The new physics model must be incorporated in the notation of CalcHEP, a package for the automatic generation of squared matrix elements. Once this is done, all annihilation and coannihilation channels are included automatically in any model. Cross-sections at v=0, relevant for indirect detection of dark matter, are also computed automatically. The package includes three sample models: the minimal supersymmetric standard model (MSSM), the MSSM with complex phases and the NMSSM. Extension to other models, including non supersymmetric models, is described. Program summaryTitle of program:micrOMEGAs2.0.7 Catalogue identifier:ADQR_v2_1 Program summary URL:http://cpc.cs.qub.ac.uk/summaries/ADQR_v2_1.html Program obtainable from: CPC Program Library, Queen's University of Belfast, N. Ireland Licensing provisions:Standard CPC licence, http://cpc.cs.qub.ac.uk/licence/licence.html No. of lines in distributed program, including test data, etc.:216 529 No. of bytes in distributed program, including test data, etc.:1 848 816 Distribution format:tar.gz Programming language used:C and Fortran Computer:PC, Alpha, Mac, Sun Operating system:UNIX (Linux, OSF1, SunOS, Darwin, Cygwin) RAM:17 MB depending on the number of processes required Classification:1.9, 11.6 Catalogue identifier of previous version:ADQR_v2_0 Journal version of previous version:Comput. Phys. Comm. 176 (2007) 367 Does the new version supersede the previous version?:Yes Nature of problem:Calculation of the relic density of the lightest stable particle in a generic new model of particle physics. Solution method:In numerically solving the evolution equation for the density of dark matter, relativistic formulae for the thermal average are used. All tree
Measuring Prefered Services from Cloud Computing Providers ...
African Journals Online (AJOL)
pc
2018, 10(5S), 207-212. 207. Measuring Prefered Services from ... Published online: 22 March 2018 .... and then introduces a general service selection and ranking model with QoS ..... To facilitate add, remove, and prioritize services in election.
Czech Academy of Sciences Publication Activity Database
Kulik, Natallia; Weignerová, L.; Filipi, Tomáš; Pompach, Petr; Novák, Petr; Mrázek, H.; Slámová, Kristýna; Bezouška, K.; Křen, Vladimír; Ettrich, Rüdiger
2010-01-01
Roč. 20, č. 11 (2010), s. 1410-1419 ISSN 0959-6658 R&D Projects: GA MŠk(CZ) LC06010; GA ČR GAP207/10/1934; GA ČR GAP207/10/1040; GA ČR GA303/09/0477; GA ČR GAP207/10/0321 Institutional research plan: CEZ:AV0Z60870520; CEZ:AV0Z50200510; CEZ:AV0Z10750506 Keywords : α-N-acetylgalactosaminidase * α-galactosidase * Aspergillus niger * substrate binding * molecular modeling Subject RIV: CE - Biochemistry Impact factor: 3.791, year: 2010
Case studies of some major oil spills around India
Digital Repository Service at National Institute of Oceanography (India)
SenGupta, R.
stream_size 11 stream_content_type text/plain stream_name I.O_21_Century_Linkage_Networking_1998_207.pdf.txt stream_source_info I.O_21_Century_Linkage_Networking_1998_207.pdf.txt Content-Encoding ISO-8859-1 Content-Type text...
2010-04-01
... the drug, any change in the identity or quantity of the active ingredient(s), any change in the identity or quantity of the inactive ingredient(s) where quantitative listing of all ingredients is.... (7) Establishment means a place of business under one management at one general physical location...
2010-01-01
... to energy and fuels such as corporate structure and proprietary relationships, costs, prices, capital... business purpose, wherever situated, domiciled, or doing business, who directly or through other persons subject to their control does business in any part of the United States. United States, when used in the...
2010-01-01
... Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS CLAIMS COLLECTION STANDARDS... explain why the matter cannot be resolved by review of the documentary evidence alone (4 CFR 102.3(c)). (b... official determines that the matter cannot be resolved by review of documentary evidence alone (e.g., when...
2010-04-01
... filed against the employee in his or her individual capacity as a result of conduct taken within the... to indemnify an employee or to settle a personal damage claim shall be contingent upon the...
Institute of Scientific and Technical Information of China (English)
1993-01-01
930394 A1—10 year follow—up study of 82cases of methamidophos induced delayedpolyneuropathy.Z1HENG Rongyuan (郑荣远),etal.Neurol Dept,Wenzhou Med Coll.325000.Chin J Industr Hyg & Occupat Dis 1992;10(6):344—347.A1—10 year follow—up study of 82 cases ofmethamidophos induced delayed polyneuropathywas reported.82 cases were classified into threetypes:motor (36.6%),sensory—motor (61%)and Guillain-Barre syndrome (2.4%).As awhole,the sensory disturbances disappearedwithin 2—3 months;the autonomic nerve func-tional disorder vanished within 3—6 months;
GPCR Interaction: 207 [GRIPDB[Archive
Lifescience Database Archive (English)
Full Text Available LP2) and secretin (SecR), and interfaces of GLP2 B Glucagon-like peptide Type 2 GLP2 C Secretin ... SecR Experi...ment SecR does not interact with CTR (calcitonin receptor). 18401761 BRET, FRET NP_004237.1 ...
2010-04-01
... INJURY TO DOMESTIC INDUSTRIES RESULTS FROM IMPORTS SOLD AT LESS THAN FAIR VALUE OR FROM SUBSIDIZED... appearance in the panel review. Date of Service means the day a document is deposited in the mail or... holiday, it shall be extended to the next working day; Extraordinary challenge committee means the...
2010-04-01
... inspection and copying from the FHWA Washington Headquarters and all FHWA Division Offices as prescribed in... also mean the utility company inclusive of any substantially owned or controlled subsidiary. For the...
2010-04-01
... laws of the State, district or territory in which the real estate is located, together with the credit.... (d) The term insured mortgage means a mortgage which has been insured by the endorsement of the credit instrument by the Commissioner, or his duly authorized representative. (e) The term contract of...
2010-01-01
... sympathomimetics; hallucinogens; phencyclidine or similarly acting arylcyclohexylamines; cannabis; inhalants; and... person is dependent on a substance, other than tobacco or ordinary xanthine-containing (e.g., caffeine...
2010-04-01
... appropriate circumstances, include such person's partners, associates, employers and employees, for a... facts underlying the prohibited act to the ethics panel or other disciplinary body of the appropriate... partner, associate, employer, and employee described in paragraph (a)(2) of this section is entitled to...
Soligard, Torbjørn; Steffen, Kathrin; Palmer, Debbie; Alonso, Juan Manuel; Bahr, Roald; Lopes, Alexandre Dias; Dvorak, Jiri; Grant, Marie-Elaine; Meeuwisse, Willem; Mountjoy, Margo; Pena Costa, Leonardo Oliveira; Salmina, Natalia; Budgett, Richard; Engebretsen, Lars
2017-09-01
To describe the pattern of injuries and illnesses sustained during the Games of the XXXI Olympiad, hosted by Rio de Janeiro from 5 to 21 August 2016. We recorded the daily incidence of athlete injuries and illnesses (1) through the reporting of all National Olympic Committee (NOC) medical teams and (2) in the polyclinic and medical venues by the Rio 2016 medical staff. In total, 11 274 athletes (5089 women, 45%; 6185 men, 55%) from 207 NOCs participated in the study. NOC and Rio 2016 medical staff reported 1101 injuries and 651 illnesses, equalling 9.8 injuries and 5.4 illnesses per 100 athletes over the 17-day period. Altogether, 8% of the athletes incurred at least one injury and 5% at least one illness. The injury incidence was highest in BMX cycling (38% of the athletes injured), boxing (30%), mountain bike cycling (24%), taekwondo (24%), water polo (19%) and rugby (19%), and lowest in canoe slalom, rowing, shooting, archery, swimming, golf and table tennis (0%-3%). Of the 1101 injuries recorded, 40% and 20% were estimated to lead to ≥1 and >7 days of absence from sport, respectively. Women suffered 40% more illnesses than men. Illness was generally less common than injury, with the highest incidence recorded in diving (12%), open-water marathon (12%), sailing (12%), canoe slalom (11%), equestrian (11%) and synchronised swimming (10%). Illnesses were also less severe; 18% were expected to result in time loss. Of the illnesses, 47% affected the respiratory system and 21% the gastrointestinal system. The anticipated problem of infections in the Rio Olympic Games did not materialise, as the proportion of athletes with infectious diseases mirrored that of recent Olympic Games (3%). Overall, 8% of the athletes incurred at least one injury during the Olympic Games, and 5% an illness, which is slightly lower than in the Olympic Summer Games of 2008 and 2012. © Article author(s) (or their employer(s) unless otherwise stated in the text of the article) 2017. All
International Nuclear Information System (INIS)
Medaglia, R.
1999-08-01
In this work, the spectral functions and the spectroscopic factors of the first five energy levels of the lead 208 nucleus have been measured using the 208 Pb(e,e'p) 207 Tl * reaction. The aim is to characterize the effect of the nuclear environment on pulse and energy distributions of protons. In order to minimize the ejected proton-residual nucleus interactions in the final state, the measurement has been performed at 750 and 570 MeV/c pulse transfers, and thus for proton kinetic energies of 263 MeV and 161 MeV, contrarily to a previous measurement performed at 100 MeV. A kinematics with a transverse electromagnetic coupling, instead of a longitudinal one, has been used because of the important coupling dependence observed for medium nuclei. The experiment has been carried out at the NIKHEF electron accelerator and smoothing ring. The pulse distributions of the first five energy levels for a proton pulse range of 0 to 300 MeV/c have been extracted from the (e,e'p) cross sections. An integration of model-dependent distributions gives the spectroscopic factors which indicate the number of protons of each level. These data rae compared to models that include both the proton interactions in the final state and the coulomb distortions. The Pavie model reproduces well the observed distributions and the transfer dependence, while the Ohio model does not. The spectroscopic factors obtained with the Pavie model are the same for both transfers and are 20% higher as an average than the previous experiment performed at 450 MeV/c. However, they are 30% below the shell model. The uncertain estimation of the reaction mechanisms does not allow to consider this reduction as being due exclusively to nuclear structure effects. (J.S.)
Fishery potential of the Thana - Bassein creek system
Digital Repository Service at National Institute of Oceanography (India)
Jyothi, E.A.; Nair, V.R.
stream_size 4 stream_content_type text/plain stream_name J_Indian_Fish_Assoc_20_7.pdf.txt stream_source_info J_Indian_Fish_Assoc_20_7.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...
Czech Academy of Sciences Publication Activity Database
Butenko, Olena; Benešová, Jana; Mikešová, M.; Honsa, Pavel; Džamba, Dávid; Kriška, Ján; Rusňáková, Vendula; Kubista, Mikael; Anděrová, Miroslava
2013-01-01
Roč. 61, Supplement 1 (2013), S207-S207 ISSN 0894-1491. [European Meeting on Glia l Cell Function in Health and Disease /11./. 03.07.2013-06.07.2013, Berlin] Institutional support: RVO:68378041 Keywords : neuroscience * astrocyte Subject RIV: FH - Neurology
International Nuclear Information System (INIS)
Shiotsuki, Masao; Miyahara, Kaname
2003-01-01
The second draft for R and D of geological disposal (second draft) was arranged in 1999. The idea of security of geological disposal in the second draft is explained. The evaluation results of the uncertainty analysis and an example of evaluation of the effect of separation nuclear transmutation on the geological disposal are shown. The construction of strong engineered barrier is a basic idea of geological disposal system. Three processes such as isolation, engineering countermeasures and safety evaluation are carried out for the security of geological disposal. The security of geological environment for a long time of 12 sites in Japan was studied by data. Provability of production and enforcement of engineered barrier were confirmed by trial of over pack, tests and the present and future technologies developed. By using the conditions of reference case in the second draft, the evaluation results of dose effects in the two cases: 1) 90 to 99% Cs and Sr removed from HLW (High Level radioactive Waste) and 2) high stripping ratio of actinium series are explained. (S.Y.)
Ac, La, and Ce radioimpurities in {sup 225}Ac produced in 40-200 MeV proton irradiations of thorium
Energy Technology Data Exchange (ETDEWEB)
Engle, Jonathan W.; Ballard, Beau D. [Los Alamos National Laboratory, NM (United States); Weidner, John W. [Air Force Institute of Technology, Wright Patterson Air Force Base, OH (United States); and others
2014-10-01
Accelerator production of {sup 225}Ac addresses the global supply deficiency currently inhibiting clinical trials from establishing {sup 225}Ac's therapeutic utility, provided that the accelerator product is of sufficient radionuclidic purity for patient use. Two proton activation experiments utilizing the stacked foil technique between 40 and 200 MeV were employed to study the likely co-formation of radionuclides expected to be especially challenging to separate from {sup 225}Ac. Foils were assayed by nondestructive γ-spectroscopy and by α-spectroscopy of chemically processed target material. Nuclear formation cross sections for the radionuclides {sup 226}Ac and {sup 227}Ac as well as lower lanthanide radioisotopes {sup 139}Ce, {sup 141}Ce, {sup 143}Ce, and {sup 140}La whose elemental ionic radii closely match that of actinium were measured and are reported. The predictions of the latest MCNP6 event generators are compared with measured data, as they permit estimation of the formation rates of other radionuclides whose decay emissions are not clearly discerned in the complex spectra collected from {sup 232}Th(p,x) fission product mixtures. (orig.)
Background radiation and individual dosimetry in the coastal area of Tamil Nadu (India)
International Nuclear Information System (INIS)
Matsuda, N.; Brahmanandhan, G. M.; Yoshida, M.; Takamura, N.; Suyama, A.; Koguchi, Y.; Juto, N.; Raj, Y. L.; Winsley, G.; Selvasekarapandian, S.
2011-01-01
South coast of India is known as the high-level background radiation area (HBRA) mainly due to beach sands that contain natural radionuclides as components of the mineral monazite. The rich deposit of monazite is unevenly distributed along the coastal belt of Tamil Nadu and Kerala. An HBRA site that laid in 2x7 m along the sea was found in the beach of Chinnavillai, Tamil Nadu, where the maximum ambient dose equivalent reached as high as 162.7 mSv y -1 . From the sands collected at the HBRA spot, the high-purity germanium semi-conductor detector identified six nuclides of thorium series, four nuclides of uranium series and two nuclides belonging to actinium series. The highest radioactivity observed was 43.7 Bq g -1 of Th-228. The individual dose of five inhabitants in Chinnavillai, as measured by the radiophotoluminescence glass dosimetry system, demonstrated the average dose of 7.17 mSv y -1 ranging from 2.79 to 14.17 mSv y -1 . (authors)
Soil nuclide distribution coefficients and their statistical distributions
International Nuclear Information System (INIS)
Sheppard, M.I.; Beals, D.I.; Thibault, D.H.; O'Connor, P.
1984-12-01
Environmental assessments of the disposal of nuclear fuel waste in plutonic rock formations require analysis of the migration of nuclides from the disposal vault to the biosphere. Analyses of nuclide migration via groundwater through the disposal vault, the buffer and backfill, the plutonic rock, and the consolidated and unconsolidated overburden use models requiring distribution coefficients (Ksub(d)) to describe the interaction of the nuclides with the geological and man-made materials. This report presents element-specific soil distribution coefficients and their statistical distributions, based on a detailed survey of the literature. Radioactive elements considered were actinium, americium, bismuth, calcium, carbon, cerium, cesium, iodine, lead, molybdenum, neptunium, nickel, niobium, palladium, plutonium, polonium, protactinium, radium, samarium, selenium, silver, strontium, technetium, terbium, thorium, tin, uranium and zirconium. Stable elements considered were antimony, boron, cadmium, tellurium and zinc. Where sufficient data were available, distribution coefficients and their distributions are given for sand, silt, clay and organic soils. Our values are recommended for use in assessments for the Canadian Nuclear Fuel Waste Management Program
Isotopically tailored lead target with reduced polonium and bismuth radio-waste
International Nuclear Information System (INIS)
Khorasanov, G.L.; Ivanov, A.P.; Lunev, V.P.; Blokhin, A.I.
2002-01-01
Residual activity of a lead target after 1 year irradiation with a high power, 0.8 GeV*30 mA, proton beam is studied. It is concluded that the main radiotoxicity of irradiated lead is connected with bismuth isotope, Bi-207, which is produced in natural lead, mix of several stable isotopes, via (p,2n) reaction with Pb-208 nuclei. It is proposed to use, as a target material, lead enriched with another stable isotope, Pb-206, in order to reduce producing Bi-207 and Po-210. Estimation of charges for obtaining large quantities of lead-206 is also given. Accumulation of hazardous radionuclides, Bi-207, Bi-208, and Po-210, in natural lead to be used as a coolant in future fast reactors and accelerator driven reactors is predicted. In accelerator driven systems a large portion of Bi-207 can be produced via Pb-208(p,2n)Bi-207 reaction in a target of natural lead (Pb-208/Pb-207/Pb-206/Pb-204=52.35/22.08/24.14/1.42 %). A new isotopically tailored coolant-converter for ADS consisting of lead isotope, Pb-206, is proposed. By using this material, it is possible to reduce essentially the production of the most radio-toxic isotopes of Bi and Po and to avoid disposing the large amounts of lead. To provide the future fast reactors and accelerator driven systems with low-activation coolant - converter, the new technology of obtaining the large amounts of natural lead enriched with lead isotope, Pb-206, should be developed. (authors)
Energy Technology Data Exchange (ETDEWEB)
Kondo, A.; Shigechi, H.; Abe, M.; Uyama, K. [Dept. of Chemical Science and Engineering, Kobe Univ., Nadaku, Kobe (Japan); Matsumoto, T.; Fukuda, H. [Div. of Molecular Science, Kobe Univ., Nadaku, Kobe (Japan); Takahashi, S.; Ueda, M.; Tanaka, A. [Dept. of Synthetic Chemistry and Biological Chemistry, Kyoto Univ., Sakyoku, Kyoto (Japan); Kishimoto, M. [Dept. of Biotechnology, Osaka Univ., Osaka (Japan)
2002-07-01
A Strain of host yeast YF207, which is a tryptophan auxotroph and shows strong flocculation ability, was obtained from Saccharomyces diastaticus ATCC60712 and S. cerevisiae W303-1B by tetrad analysis. The plasmid pGA11, which is a multicopy plasmid for cell-surface expression of the Rhyzopus oryzae glucoamylase/{alpha}-agglutinin fusion protein, was then introduced into this flocculent yeast strain (YF207/pGA11). Yeast YF207/pGA11 grew rapidly under aerobic condition (dissolved oxygen 2.0 ppm), using soluble starch. The harvested cells were used for batch fermentation of soluble starch to ethanol under anaerobic condition and showed high ethanol production rates (0.71 g h{sup -1} I{sup -1}) without a time lag, because glucoamylase was immobilized on the yeast cell surface. During repeated utilization of cells for fermentation, YF207/pGA11 maintained high ethanol production rates over 300 h. Moreover, in fed-batch fermentation with YF207/pGA11 for approximately 120 h, the ethanol concentration reached up to 50 g I{sup -1}. In conclusion, flocculent yeast cells displaying cell-surface glucoamylase are considered to be very effective for the direct fermentation of soluble starch to ethanol. (orig.)
Lead isotope ratios in tree bark pockets: an indicator of past air pollution in the Czech Republic.
Conkova, M; Kubiznakova, J
2008-10-15
Tree bark pockets were collected at four sites in the Czech Republic with differing levels of lead (Pb) pollution. The samples, spanning 1923-2005, were separated from beech (Fagus sylvatica) and spruce (Picea abies). Elevated Pb content (0.1-42.4 microg g(-1)) reflected air pollution in the city of Prague. The lowest Pb content (0.3-2.6 microg g(-1)) was found at the Kosetice EMEP "background pollution" site. Changes in (206)Pb/(207)Pb and (208)Pb/(206)Pb isotope ratios were in agreement with operation times of the Czech main anthropogenic Pb sources. Shortly after the Second World War, the (206)Pb/(207)Pb isotope ratio in bark pockets decreased from 1.17 to 1.14 and the (208)Pb/(206)Pb isotope ratio increased from 2.12 to 2.16. Two dominant emission sources responsible for these changes, lignite and leaded petrol combustion, contributed to the shifts in Pb isotope ratios. Low-radiogenic petrol Pb ((206)Pb/(207)Pb of 1.11) lead to lower (206)Pb/(207)Pb in bark pockets over time. High-radiogenic lignite-derived Pb ((206)Pb/(207)Pb of 1.18 to 1.19) was detected in areas affected by coal combustion rather than by traffic.
EPA STANDARDS NETWORK FACT SHEET: ISO 14000: INTERNATIONAL ENVIRONMENTAL MANAGEMENT STANDARDS
This flyer provides an overview of the ISO 14000 series of International standards, supplying a brief history, structure of the Technical Committee (TC) 207, structure of the U.S. Technical Advisory Group (TAG) to ISO TC-207, status of the Standards development as of June 1997, w...
Journal of Chemical Sciences | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Journal of Chemical Sciences; Volume 117; Issue 3. Volume 117, Issue 3. May 2005, pages 207-282. Recent Advances in Bio-Inorganic Chemistry. pp 207-218. Underpotential deposition of metals - Progress and prospects in modelling · V Sudha M V Sangaranarayanan · More Details Abstract Fulltext PDF.
18 CFR 292.203 - General requirements for qualification.
2010-04-01
... certification, pursuant to § 292.207(b)(1), that has been granted. (c) Hydroelectric small power production facilities located at a new dam or diversion. (1) A hydroelectric small power production facility that..., pursuant to § 292.207(b)(1), that has been granted. (c) Hydroelectric small power production facilities...
Synthesis, Molecular Structure, and Electrochemistry of 1-Ferrocenyl-1,2-dicarba-closo-dodecaboranes
Czech Academy of Sciences Publication Activity Database
Korotvička, A.; Šnajdr, I.; Štěpnička, P.; Císařová, I.; Janoušek, Zbyněk; Kotora, M.
-, č. 15 (2013), s. 2789-2798 ISSN 1434-1948 Grant - others:GA ČR(CZ) GAP207/11/0338; GAČR(CZ) GAP207/11/0705 Program:GA Institutional support: RVO:61388963 Keywords : carboranes * metallocenes * structure elucidation * electrochemistry * addition Subject RIV: CA - Inorganic Chemistry Impact factor: 2.965, year: 2013
Anvendelse af alternative isoleringsmaterialer
DEFF Research Database (Denmark)
Hansen, Ernst Jan de Place
2003-01-01
Resume af By og Byg Anvisning 207 om anvendelse af alternative isoleringsmaterialer, udarbejdet af Statens Byggeforskningsinstitut under udviklingsprogrammet "Miljø- og arbejdsmiljøvenlig isolering"......Resume af By og Byg Anvisning 207 om anvendelse af alternative isoleringsmaterialer, udarbejdet af Statens Byggeforskningsinstitut under udviklingsprogrammet "Miljø- og arbejdsmiljøvenlig isolering"...
27 CFR 479.101 - Registration of firearms.
2010-04-01
... period established under section 207 of the Gun Control Act of 1968 (82 Stat. 1235). (c) A person shown... the possessors thereof under the provisions of section 207 of the Gun Control Act of 1968. (e) A..., AND EXPLOSIVES, DEPARTMENT OF JUSTICE FIREARMS AND AMMUNITION MACHINE GUNS, DESTRUCTIVE DEVICES, AND...
TRASH TO TREASURE: CONVERTING COLD WAR LEGACY WASTE INTO WEAPONS AGAINST CANCER
International Nuclear Information System (INIS)
Nicholas, R.G.; Lacy, N.H.; Butz, T.R.; Brandon, N.E.
2004-01-01
As part of its commitment to clean up Cold War legacy sites, the U.S. Department of Energy (DOE) has initiated an exciting and unique project to dispose of its inventory of uranium-233 (233U) stored at Oak Ridge National Laboratory (ORNL), and extract isotopes that show great promise in the treatment of deadly cancers. In addition to increasing the supply of potentially useful medical isotopes, the project will rid DOE of a nuclear concern and cut surveillance and security costs. For more than 30 years, DOE's ORNL has stored over 1,200 containers of fissile 233U, originally produced for several defense-related projects, including a pilot study that looked at using 233U as a commercial reactor fuel. This uranium, designated as special nuclear material, requires expensive security, safety, and environmental controls. It has been stored at an ORNL facility, Building 3019A, that dates back to the Manhattan Project. Down-blending the material to a safer form, rather than continuing to store it, will eliminate a $15 million a year financial liability for the DOE and increase the supply of medical isotopes by 5,700 percent. During the down-blending process, thorium-229 (229Th) will be extracted. The thorium will then be used to extract actinium-225 (225Ac), which will ultimately supply its progeny, bismuth-213 (213Bi), for on-going cancer research. The research includes Phase II clinical trials for the treatment of acute myelogenous leukemia at Sloan-Kettering Memorial Cancer Center in New York, as well as other serious cancers of the lungs, pancreas, and kidneys using a technique known as alpha-particle radioimmunotherapy. Alpha-particle radioimmunotherapy is based on the emission of alpha particles by radionuclides. 213Bi is attached to a monoclonal antibody that targets specific cells. The bismuth then delivers a high-powered but short-range radiation dose, effectively killing the cancerous cells but sparing the surrounding tissue. Production of the actinium and
Say ‘no’ to carcinogen as contraception alternative
Directory of Open Access Journals (Sweden)
Karen Malec
2012-07-01
Full Text Available A response to Correspondence to ‘Dienye PO, Gbeneol PK. Contraception as a risk factor for urinary tract infection in Port Harcourt, Nigeria: A case control study. Afr J Prm Health Care Fam Med. 2011;3(1, Art. #207, 4 pages. doi:10.4102/phcfm.v3i1.207
76 FR 82295 - Central Power & Lime LLC; Notice of Filing
2011-12-30
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket Nos. EL12-18-000; QF82-207-007] Central Power & Lime LLC; Notice of Filing December 23, 2011. Take notice that on December 22, 2011, Central Power & Lime LLC, pursuant to sections 18 CFR 292.205(c) and 385.207 of the Federal Energy...
Pribil, Michael J.; Maddaloni, Mark A.; Staiger, Kimberly; Wilson, Eric; Magriples, Nick; Ali, Mustafa; Santella, Dennis
2014-01-01
Lead (Pb) concentration and Pb isotopic composition of surface and subsurface soil samples were used to investigate the potential for off-site air transport of Pb from a former white Pb processing facility to neighboring residential homes in a six block area on Staten Island, NY. Surface and subsurface soil samples collected on the Jewett White Pb site were found to range from 1.122 to 1.138 for 206Pb/207Pb and 2.393 to 2.411 for 208Pb/207Pb. The off-site surface soil samples collected from residential backyards, train trestle, near site grass patches and background areas varied from 1.144 to 1.196 for 206Pb/207Pb and 2.427 to 2.464 for 208Pb/207Pb. Two soil samples collected along Richmond Terrace, where Jewett site soils accumulated after major rain events, varied from 1.136 to 1.147 for 206Pb/207Pb and 2.407 to 2.419 for 208Pb/207Pb. Lead concentration for on-site surface soil samples ranged from 450 to 8000 ug/g, on-site subsurface soil samples ranged from 90,000 to 240,000 ug/g and off-site samples varied from 380 to 3500 ug/g. Lead concentration and isotopic composition for the Staten Island off-site samples were similar to previously published data for other northeastern US cities and reflect re-suspension and re-mobilization of local accumulated Pb. The considerable differences in both the Pb isotopic composition and Pb concentration of on-site and off-site samples resulted in the ability to geochemically trace the transport of particulate Pb. Data in this study indicate minimal off-site surface transport of Pb from the Jewett site into the neighboring residential area.
RF magnetron sputtering of polypropylene
Czech Academy of Sciences Publication Activity Database
Stelmashuk, Vitaliy; Biederman, H.; Slavinská, D.; Trchová, Miroslava; Hlídek, P.
2004-01-01
Roč. 75, č. 3 (2004), s. 207-215 ISSN 0042-207X R&D Projects: GA MŠk ME 553; GA MŠk ME 554 Institutional research plan: CEZ:AV0Z2043910 Keywords : materials science, multidisciplinary, physics, applied Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 0.902, year: 2004
24 CFR 236.253 - Premiums-operating loss loans.
2010-04-01
... Obligations for Mortgage Insurance § 236.253 Premiums—operating loss loans. All of the provisions of § 207.252a of this chapter relating to mortgage insurance premiums on operating loss loans shall apply to... Act the mortgage insurance premiums due in accordance with § 207.252a shall be calculated on the basis...
International Nuclear Information System (INIS)
Ueno, Yori
1976-01-01
The effect of intraperitoneal injection of N 1 -(2'-tetrahydrofuryl)-5-fluorouracil (FT-207) which is metabolized to 5-fluorouracil (5-FU) in vivo, on endogeneous colony forming units in the spleen (endogeneous CFU-s) was observed and compared with that of 5-FU. The 8 x 10 -4 m eqv of FT-207 injected in mice 20 minutes before x-rays irradiation of 450 rads suppressed the endogeneous CFU-s count to about 60% and about 5.5 x 10 -5 m eqv of 5-FU had the same effect. The suppression of FT-207 continued over 120 minutes and increased gradually. The effect of 5-FU was strong shortly after the injection but faded out for 120 minutes. FT-207 had almost no effect on the recovery constant (Blair) of endogeneous CFU-s for 3 days, whereas 5-FU reduced seriously, especially for the first 2 days. The differences in the effects of both compounds could not be explained on the base of the only differences in the metabolism of both compounds. (auth.)
Analysis on complications after intravitreal injection of bevacizumab
Directory of Open Access Journals (Sweden)
Cui-Wei Zhang
2013-08-01
Full Text Available AIM: To observe and analyze on the incidence rate and causes of complications after anintravitreal injection of bevacizumab. METHODS: Totally, 207 cases(207 eyeswith wet age-related macular degeneration were selected randomly. All cases were treated with intravitreal injections of bevacizumab(1.5mg/0.06mLand asked for chief complaints at 1 day, 1 week, 4, 12 weeks after operation, and also examined for routine visual acuity(best corrected visual acuity, BCVA, non-contact tonometer, slit lamp microscope and indirect ophthalmoscope etc.RESULTS: Among 207 cases(207 eyes, visual acuity improved efficiency was 90.8% 12 weeks after treatment, foreign body sensation was found in 7 cases(3.4%, eyelid skin pruritus in 1 case(0.5%, conjunctival congestion in 6 cases(2.9%, subconjunctival hemorrhage in 1 case(0.5%, post-operative intraocular pressure elevation in 2 cases(1.0%. CONCLUSION: The intravitreal injection of bevacizumab is effective with fewer complications. We propose to carry out a further randomized multicenter and larger-sample clinical research and further draw up the clinical application criterion of bevacizumab.
Directory of Open Access Journals (Sweden)
Suziane Nascimento Santos
2012-01-01
Full Text Available Lead analyses in bottom sediments from the hydrographic system of Belem (Para indicated low contents of this metal for the sediments from the Guama river, with no significant anthropogenic contribution. A concentration of 18.1 ± 1.5 mg kg-1 and 206Pb/207Pb isotopic signature of 1.196 ± 0.002 are assigned for Pb from natural sources. On the other hand, the significant increase of Pb contents in the sediments from the Guajará bay, together with the decrease of 206Pb/207Pb ratios (1.172 < 206Pb/207Pb < 1.188 point to an anthropogenic lead contribution, originated by the industrial and urban activities of the city of Belem.
Wavelength switchable high-power diode-side-pumped rod Tm:YAG Laser around 2µm.
Wang, Caili; Du, Shifeng; Niu, Yanxiong; Wang, Zhichao; Zhang, Chao; Bian, Qi; Guo, Chuan; Xu, Jialin; Bo, Yong; Peng, Qinjun; Cui, Dafu; Zhang, Jingyuan; Lei, Wenqiang; Xu, Zuyan
2013-03-25
We report a high-power diode-side-pumped rod Tm:YAG laser operated at either 2.07 or 2.02 µm depending on the transmission of pumped output coupler. The laser yields 115W of continuous-wave output power at 2.07 µm with 5% output coupling, which is the highest output power for all solid-state 2.07 μm cw rod Tm:YAG laser reported so far. With an output coupler of 10% transmission, the center wavelength of the laser is switched to 2.02 μm with an output power of 77.1 W. This is the first observation of high-power wavelength switchable diode-side-pumped rod Tm:YAG laser around 2 µm.
48 CFR 873.110 - Solicitation provisions.
2010-10-01
... techniques, when either of the alternative negotiation techniques described in 873.111(e)(1) will be used... negotiation technique described in 873.111(e)(1)(ii) will be used. (38 U.S.C. 8153) (d) When evaluation... clause at 52.207-3, Right of First Refusal of Employment, and the clause at 852.207-70, Report of...
Lithium - therapeutic tool endowed with multiple beneficiary effects caused by multiple mechanisms
Czech Academy of Sciences Publication Activity Database
Vošahlíková, Miroslava; Svoboda, Petr
2016-01-01
Roč. 76, č. 1 (2016), s. 1-19 ISSN 0065-1400 R&D Projects: GA ČR(CZ) GAP207/12/0919; GA ČR(CZ) GA15-16605S Institutional support: RVO:67985823 Keywords : bipolar disorder * lithium * sodium * magnesium * G protein coupled receptors * Na+-allosteric site Subject RIV: CE - Biochemistry Impact factor: 1.207, year: 2016
Experiments using coincidence methods
International Nuclear Information System (INIS)
Anwar Dhani.
1978-01-01
Experiments on γ spectroscopy using the simple coincidence techniques, including investigation of angular distribution of γ radiation from annihilation process in decay of Na 22 , γ - γ angular correlation technique in decay of Co 60 , decay scheme study of Bi 207 and life time measurement of nuclear Pb 207 excited state have been carried out. (author)
Histopathology confirms White-Nose Syndrome in bats in Europe
Czech Academy of Sciences Publication Activity Database
Pikula, J.; Banďouchová, H.; Novotný, L.; Meteyer, C. U.; Zukal, Jan; Irwin, N. R.; Zima, Jan; Martínková, Natália
2012-01-01
Roč. 48, č. 1 (2012), s. 207-211 ISSN 0090-3558 R&D Projects: GA MŠk LC06073 Institutional research plan: CEZ:AV0Z60930519 Keywords : Geomyces destructans * geomycosis * histopathology * Myotis myotis * whitenose syndrome Subject RIV: EG - Zoology Impact factor: 1.271, year: 2012 http://www.jwildlifedis.org/content/48/1/207.full.pdf
Sadhana | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; Journals; Sadhana; Volume 37; Issue 2. Issue front cover thumbnail. Volume 37, Issue 2. April 2012, pages 207-318. pp 207-222. Enhancement of cell characteristics via baffle blocks in a proton exchange membrane fuel cell · Atilla Biyikoglu Hülya Oztoprak · More Details Abstract Fulltext PDF. In this study, the effects ...
Czech Academy of Sciences Publication Activity Database
Bould, Jonathan; Harrington, R.; Clegg, W.; Kennedy, JD.
2012-01-01
Roč. 721, SI (2012), s. 155-163 ISSN 0022-328X R&D Projects: GA ČR(CZ) GAP207/11/0705; GA ČR(CZ) GAP207/11/1577 Institutional research plan: CEZ:AV0Z40320502 Keywords : Metallaborane * Isocloso * Hypercloso * DFT * Fluxionality * Nine-vertex cluster Subject RIV: CA - Inorganic Chemistry Impact factor: 2.000, year: 2012
A lead isotopic study of the human bioaccessibility of lead in urban soils from Glasgow, Scotland
International Nuclear Information System (INIS)
Farmer, John G.; Broadway, Andrew; Cave, Mark R.; Wragg, Joanna; Fordyce, Fiona M.; Graham, Margaret C.; Ngwenya, Bryne T.; Bewley, Richard J.F.
2011-01-01
The human bioaccessibility of lead (Pb) in Pb-contaminated soils from the Glasgow area was determined by the Unified Bioaccessibility Research Group of Europe (BARGE) Method (UBM), an in vitro physiologically based extraction scheme that mimics the chemical environment of the human gastrointestinal system and contains both stomach and intestine compartments. For 27 soils ranging in total Pb concentration from 126 to 2160 mg kg -1 (median 539 mg kg -1 ), bioaccessibility as determined by the 'stomach' simulation (pH ∼ 1.5) was 46-1580 mg kg -1 , equivalent to 23-77% (mean 52%) of soil total Pb concentration. The corresponding bioaccessibility data for the 'stomach + intestine' simulation (pH ∼ 6.3) were 6-623 mg kg -1 and 2-42% (mean 22%) of soil Pb concentration. The soil 206 Pb/ 207 Pb ratios ranged from 1.057 to 1.175. Three-isotope plots of 208 Pb/ 206 Pb against 206 Pb/ 207 Pb demonstrated that 206 Pb/ 207 Pb ratios were intermediate between values for source end-member extremes of imported Australian Pb ore (1.04) - used in the manufacture of alkyl Pb compounds (1.06-1.10) formerly added to petrol - and indigenous Pb ores/coal (1.17-1.19). The 206 Pb/ 207 Pb ratios of the UBM 'stomach' extracts were similar ( 206 Pb/ 207 Pb ratio was discernible in the UBM. However, the source of Pb appeared to be less important in determining the extent of UBM-bioaccessible Pb than the overall soil total Pb concentration and the soil phases with which the Pb was associated. The significant phases identified in a subset of samples were carbonates, manganese oxides, iron-aluminium oxyhydroxides and clays. - Highlights: → We determined the human bioaccessibility of Pb in urban soils by in vitro extraction. → We determined the isotopic composition of Pb in soils and simulated stomach extracts. → Soil stable Pb isotope ratios (e.g. 206 Pb/ 207 Pb) indicated a range of sources of Pb. → 206 Pb/ 207 Pb ratios in soils and their simulated stomach extracts were very similar
Martínez Cortizas, Antonio; López-Merino, Lourdes; Bindler, Richard; Mighall, Tim; Kylander, Malin E
2016-03-01
Although archaeological research suggests that mining/metallurgy already started in the Chalcolithic (3rd millennium BC), the earliest atmospheric metal pollution in SW Europe has thus far been dated to ~3500-3200 cal.yr. BP in paleo-environmental archives. A low intensity, non-extensive mining/metallurgy and the lack of appropriately located archives may be responsible for this mismatch. We have analysed the older section (>2100 cal.yr. BP) of a peat record from La Molina (Asturias, Spain), a mire located in the proximity (35-100 km) of mines which were exploited in the Chalcolithic/Bronze Age, with the aim of assessing evidence of this early mining/metallurgy. Analyses included the determination of C as a proxy for organic matter content, lithogenic elements (Si, Al, Ti) as markers of mineral matter, and trace metals (Cr, Cu, Zn, Pb) and stable Pb isotopes as tracers of atmospheric metal pollution. From ~8000 to ~4980 cal.yr. BP the Pb composition is similar to that of the underlying sediments (Pb 15 ± 4 μg g(-1); (206)Pb/(207)Pb 1.204 ± 0.002). A sustained period of low (206)Pb/(207)Pb ratios occurred from ~4980 to ~2470 cal.yr. BP, which can be divided into four phases: Chalcolithic (~4980-3700 cal.yr. BP), (206)Pb/(207)Pb ratios decline to 1.175 and Pb/Al ratios increase; Early Bronze Age (~3700-3500 cal.yr. BP), (206)Pb/(207)Pb increase to 1.192 and metal/Al ratios remain stable; Late Bronze Age (~3500-2800 cal.yr. BP), (206)Pb/(207)Pb decline to their lowest values (1.167) while Pb/Al and Zn/Al increase; and Early Iron Age (~2800-2470 cal.yr. BP), (206)Pb/(207)Pb increase to 1.186, most metal/Al ratios decrease but Zn/Al shows a peak. At the beginning of the Late Iron Age, (206)Pb/(207)Pb ratios and metal enrichments show a rapid return to pre-anthropogenic values. These results provide evidence of regional/local atmospheric metal pollution triggered by the earliest phases of mining/metallurgy in the area, and reconcile paleo-environmental and
Tera, F.
2011-12-01
A Thorogenic-Uranogenic Lead Isotope Plane (TULIP), which entails plotting 206/208 (or its reverse) vs 207/208 (or its reverse), was applied to the Pb data on South of Isua (SOI) by Kamber et al., (1). When the data on 20 samples of these rocks and feldspars are plotted in pairs (each pair is a rock and its feldspar) on TULIP, they fall on 10 mixing lines that converge on a single spot (Fig. 1). This is the end member initial lead (EMIL). The 206/208 & 207/208 so determined are 0.3675 and 0.43525, respectively. From these values one calculates 207/206 = 1.1843 ± 0.0007, for EMIL. This pattern requires either: A) each pair has a singular kappa, K = 232Th/238U, different from others, or B) a pair's in situ decay Pb was homogenized in recent times. On 204/206 vs 207/206 diagram, the whole rocks of SOI define a 3.776 Ga isochron (2). From this and EMIL's 207/206, one obtains: 206/204 = 10.977, 207/204 = 12.974; and 208/204 = 29.756. This singularity of initial Pb contrasts with a deduced variability by the original authors (1). EMIL's radiogenic *(207/206) = 1.6220, gives a single-stage age = 5.9 Ga, indicating inapplicability of its evolution in one stage. Also, the μ calculated from 238U-206Pb for the single stage is different from that inferred from 235U-207Pb, confirming disqualification of this scenario. Reconciliation of the two decay schemes necessitates assumption of EMIL evolution in a minimum of two stages. Starting at 4.563 Ga, five scenarios were assumed: First stage ends and second starts at 4.55, 4.54, 4.53, 4.52 or 4.51 Ga. Second stages end at 3.776 Ga. The calculated μ1 for the first stage are 106, 59.5, 44.6, 36.3 and 30.9 respectively. For μ2 the change is limited, from 5.45 to 5.28. Only an average calculated K for both stages is possible. For the five outlined scenarios it ranges from 1.118 to 1.111. Earlier, Tera (3) observed that initial Pb of the oldest terrestrial reservoir requires evolution in two stages. There too μ1 >> μ2. Data on
International Nuclear Information System (INIS)
Hesketh, K.; Porsch, D.; Rimpault, G.; Taiwo, T.; Worrall, A.
2013-01-01
The actinides (or actinoids) are those elements in the periodic table from actinium upwards. Uranium (U) and plutonium (Pu) are two of the principal elements in nuclear fuel that could be classed as major actinides. The minor actinides are normally taken to be the triad of neptunium (Np), americium (Am) and curium (Cm). The combined masses of the remaining actinides (i.e. actinium, thorium, protactinium, berkelium, californium, einsteinium and fermium) are small enough to be regarded as very minor trace contaminants in nuclear fuel. Those elements above uranium in the periodic table are known collectively as the transuranics (TRUs). The operation of a nuclear reactor produces large quantities of irradiated fuel (sometimes referred to as spent fuel), which is either stored prior to eventual deep geological disposal or reprocessed to enable actinide recycling. A modern light water reactor (LWR) of 1 GWe capacity will typically discharge about 20-25 tonnes of irradiated fuel per year of operation. About 93-94% of the mass of uranium oxide irradiated fuel is comprised of uranium (mostly 238 U), with about 4-5% fission products and ∼1% plutonium. About 0.1-0.2% of the mass is comprised of neptunium, americium and curium. These latter elements accumulate in nuclear fuel because of neutron captures, and they contribute significantly to decay heat loading and neutron output, as well as to the overall radio-toxic hazard of spent fuel. Although the total minor actinide mass is relatively small - approximately 20-25 kg per year from a 1 GWe LWR - it has a disproportionate impact on spent fuel disposal, and thus the longstanding interest in transmuting these actinides either by fission (to fission products) or neutron capture in order to reduce their impact on the back end of the fuel cycle. The combined masses of the trace actinides actinium, thorium, protactinium, berkelium and californium in irradiated LWR fuel are only about 2 parts per billion, which is far too low for
14 CFR 1274.207 - Extended agreements.
2010-01-01
... additional restrictions on the recipient in terms of validating performance and accounting for funds expended... that will exceed $5 million and have a period of performance in excess of 5 years shall require the..., period of performance and funding levels; therefore, new proposals, certifications, and technical...
47 CFR 15.207 - Conducted limits.
2010-10-01
... apply to carrier current systems operating as intentional radiators on frequencies below 30 MHz. In lieu... current system containing their fundamental emission within the frequency band 535-1705 kHz and intended.../50 ohms LISN. (3) Carrier current systems operating below 30 MHz are also subject to the radiated...
7 CFR 1951.207 - State supplements.
2010-01-01
... Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS...) PROGRAM REGULATIONS (CONTINUED) SERVICING AND COLLECTIONS Servicing of Community and Direct Business... (available in any FmHA or its successor agency under Public Law 103-354 office) and applicable State laws and...
12 CFR 207.3 - CRA communications.
2010-01-01
... communication. A CRA communication is any of the following— (1) Any written or oral comment or testimony... contacts with a Federal banking agency. An oral or written communication with a Federal banking agency is... communication; (ii) More than 3 years before the parties entered into the agreement, in the case of any oral...
47 CFR 54.207 - Service areas.
2010-10-01
... company to be other than such company's study area, the Commission will consider that proposed definition... definition of a service area served by a rural telephone company. (2) The Commission shall issue a Public... to consider a definition of a service area served by a rural telephone company that is different from...
Publications | Page 207 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Through books, articles, research publications, and studies, we aim to widen ... in the country consider that starting a business is a desirable career choice. ... some adaptation actions were implemented to enhance urban and rural interactions.
WE-A-207-01: Memorial Lecturer
International Nuclear Information System (INIS)
Muller-Runkel, R
2015-01-01
The Medical Physics community lost one of its early pioneers in radiation oncology physics, Jacques Ovadia, who passed away in April of 2014 at the age of 90. Jacques received his Ph.D. in Nuclear Physics from the University of Illinois at Urbana in 1951. Subsequently, under the guidance of John Laughlin, he was introduced to the field of Medical Physics. When John moved to Memorial Sloan Kettering, Jacques followed him. There he gained clinical experience and expertise in the then cutting-edge field of high energy electron beam therapy. In 1956, Jacques joined Dr. Erich Uhlmann at Michael Reese Hospital in Chicago where one of the country’s first high energy medical linear accelerators had just been installed. During his 35 year tenure, Dr. Ovadia built a strong Medical Physics department that merged in 1984 with that of the University of Chicago. Jacques pioneered the use of high energy electron beams to treat deep seated tumors, multiple-field chest wall irradiation with variable electron energies, and even anticipated the current interest in high energy electron beam grid-therapy. At an early stage, he introduced a simulator, computerized treatment planning and in-house developed record and verify software. He retired in 1990 as Professor emeritus in Radiation and Cellular Biology at the University of Chicago. Dr. Ovadia was an early and strong supporter of AAPM. He was present at the Chicago ROMPS meeting where the decision was made to form an independent professional society for medical physics. He served as AAPM president in 1976. Jacques Ovadia is survived by his wife of 58 years, Florence, their daughter Corinne Graefe and son Marc Ovadia, MD, as well as four grandchildren and one great-grandchild. Jacques’ dynamic and ever enthusiastic personality inspired all who collaborated with him. He will be greatly missed
Publications | Page 207 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Reconstruction of Haiti : Strengthening Argentina's Capacity for Effective Cooperation (Phase II); final technical report, May 2009 - April 2012 (open access). The project produced knowledge through research on the current traits of international cooperation, in particular the meaning and prospects of trends such as ...
TU-AB-207-00: Digital Tomosynthesis
Energy Technology Data Exchange (ETDEWEB)
NONE
2015-06-15
Digital Tomosynthesis (DT) is becoming increasingly common in breast imaging and many other applications. DT is a form of computed tomography in which a limited set of projection images are acquired over a small angular range and reconstructed into a tomographic data set. The angular range and number of projections is determined both by the imaging task and equipment manufacturer. For example, in breast imaging between 9 and 25 projections are acquired over a range of 15° to 60°. It is equally valid to treat DT as the digital analog of classical tomography - for example, linear tomography. In fact, the name “tomosynthesis” is an acronym for “synthetic tomography”. DT shares many common features with classical tomography, including the radiographic appearance, dose, and image quality considerations. As such, both the science and practical physics of DT systems is a hybrid between CT and classical tomographic methods. This lecture will consist of three presentations that will provide a complete overview of DT, including a review of the fundamentals of DT, a discussion of testing methods for DT systems, and a description of the clinical applications of DT. While digital breast tomosynthesis will be emphasized, analogies will be drawn to body imaging to illustrate and compare tomosynthesis methods. Learning Objectives: To understand the fundamental principles behind tomosynthesis, including the determinants of image quality and dose. To learn how to test the performance of tomosynthesis imaging systems. To appreciate the uses of tomosynthesis in the clinic and the future applications of tomosynthesis.
7 CFR 62.207 - Official assessment.
2010-01-01
... Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) REGULATIONS AND STANDARDS UNDER THE AGRICULTURAL MARKETING ACT OF 1946 AND THE EGG PRODUCTS INSPECTION ACT (CONTINUED) LIVESTOCK, MEAT, AND OTHER...
TU-AB-207-00: Digital Tomosynthesis
International Nuclear Information System (INIS)
2015-01-01
Digital Tomosynthesis (DT) is becoming increasingly common in breast imaging and many other applications. DT is a form of computed tomography in which a limited set of projection images are acquired over a small angular range and reconstructed into a tomographic data set. The angular range and number of projections is determined both by the imaging task and equipment manufacturer. For example, in breast imaging between 9 and 25 projections are acquired over a range of 15° to 60°. It is equally valid to treat DT as the digital analog of classical tomography - for example, linear tomography. In fact, the name “tomosynthesis” is an acronym for “synthetic tomography”. DT shares many common features with classical tomography, including the radiographic appearance, dose, and image quality considerations. As such, both the science and practical physics of DT systems is a hybrid between CT and classical tomographic methods. This lecture will consist of three presentations that will provide a complete overview of DT, including a review of the fundamentals of DT, a discussion of testing methods for DT systems, and a description of the clinical applications of DT. While digital breast tomosynthesis will be emphasized, analogies will be drawn to body imaging to illustrate and compare tomosynthesis methods. Learning Objectives: To understand the fundamental principles behind tomosynthesis, including the determinants of image quality and dose. To learn how to test the performance of tomosynthesis imaging systems. To appreciate the uses of tomosynthesis in the clinic and the future applications of tomosynthesis
48 CFR 12.207 - Contract type.
2010-10-01
... fixed-price with economic price adjustment contracts (e.g., by limiting the value or length of the time... when— (i) The prices are established based on a firm-fixed-price or fixed-price with economic price... pricing structure is not practicable. The D&F for this contract shall be approved one level above the...
47 CFR 18.207 - Technical report.
2010-10-01
... applicant filing for the equipment authorization. (d) The FCC Identifier, trade name(s), and/or model number... pertinent operating characteristics. (f) A report of measurements, including a list of the measuring equipment used, and a statement of the date when the measuring equipment was last calibrated and when the...
47 CFR 97.207 - Space station.
2010-10-01
... FCC. (c) The following frequency bands and segments are authorized to space stations: (1) The 17 m, 15... notifications to the International Bureau, FCC, Washington, DC 20554. (1) A pre-space notification within 30... risk of collision and a description of what measures the space station operator plans to take to avoid...
No. 207-Genital Herpes: Gynaecological Aspects.
Money, Deborah; Steben, Marc
2017-07-01
The purpose of this guideline is to provide recommendations to gynaecology health care providers on optimal management of genital herpes. More effective prevention of complications and transmission of genital herpes. Medline was searched for articles published in French and English related to genital herpes and gynaecology. Additional articles were identified through the references of these articles. All study types and recommendation reports were reviewed. Copyright © 2017. Published by Elsevier Inc.
Publications | Page 207 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
IDRC works with developing-country researchers and institutions to build local capacity through funding, knowledge sharing, and training. Through books, articles, research publications, and studies, we aim to widen the impact of our investment and advance development research. We share the results of our funded ...
WE-A-207-01: Memorial Lecturer
Energy Technology Data Exchange (ETDEWEB)
Muller-Runkel, R [St. Margaret Mercy Healthcare Centers, Hammond, IN (United States)
2015-06-15
The Medical Physics community lost one of its early pioneers in radiation oncology physics, Jacques Ovadia, who passed away in April of 2014 at the age of 90. Jacques received his Ph.D. in Nuclear Physics from the University of Illinois at Urbana in 1951. Subsequently, under the guidance of John Laughlin, he was introduced to the field of Medical Physics. When John moved to Memorial Sloan Kettering, Jacques followed him. There he gained clinical experience and expertise in the then cutting-edge field of high energy electron beam therapy. In 1956, Jacques joined Dr. Erich Uhlmann at Michael Reese Hospital in Chicago where one of the country’s first high energy medical linear accelerators had just been installed. During his 35 year tenure, Dr. Ovadia built a strong Medical Physics department that merged in 1984 with that of the University of Chicago. Jacques pioneered the use of high energy electron beams to treat deep seated tumors, multiple-field chest wall irradiation with variable electron energies, and even anticipated the current interest in high energy electron beam grid-therapy. At an early stage, he introduced a simulator, computerized treatment planning and in-house developed record and verify software. He retired in 1990 as Professor emeritus in Radiation and Cellular Biology at the University of Chicago. Dr. Ovadia was an early and strong supporter of AAPM. He was present at the Chicago ROMPS meeting where the decision was made to form an independent professional society for medical physics. He served as AAPM president in 1976. Jacques Ovadia is survived by his wife of 58 years, Florence, their daughter Corinne Graefe and son Marc Ovadia, MD, as well as four grandchildren and one great-grandchild. Jacques’ dynamic and ever enthusiastic personality inspired all who collaborated with him. He will be greatly missed.
Gas-phase studies of copper catalyzed aerobic cross coupling of thiol esters and arylboronic acids
Czech Academy of Sciences Publication Activity Database
Tsybizová, A.; Schröder, Detlef; Roithová, J.; Henke, A.; Šrogl, Jiří
2014-01-01
Roč. 27, č. 3 (2014), s. 198-203 ISSN 0894-3230 R&D Projects: GA ČR GAP207/12/0846 Grant - others:GA ČR(CZ) GAP207/11/0338 Institutional support: RVO:61388963 Keywords : boronic acids * catalysis * copper * cross coupling * electrospray ionization * mass spectrometry * kinetic studies Subject RIV: CC - Organic Chemistry Impact factor: 1.380, year: 2014
Neutron particle-hole electric dipole states in 206207208Pb
International Nuclear Information System (INIS)
Dickey, P.A.
1979-01-01
Inelastic proton scattering on 206 Pb, 207 Pb, and 208 Pb through isobaric analog resonances was used to study neutron particle-hole excitations with large ground-state gamma branches in these Pb isotopes. Relative (p,p') cross sections at 90 0 are extracted for structures selectively excited on the d/sub 5/2/, s/sub 1/2/, and d/sub 3/2/-g/sub 7/2/ resonances. Interpretation of excitations in 206 Pb and 207 Pb in terms of coupling to states in 208 Pb is discussed. Branching ratios for 1 - states in 208 Pb at 4.84, 5.29, 5.94, and 6.31 MeV and the 1/2 + state in 207 Pb at 4.63 MeV are deduced. 15 figures, 4 tables
Electronic structure and dynamics of ordered clusters with ME or RE ions on oxide surface
Energy Technology Data Exchange (ETDEWEB)
Kulagin, N.A., E-mail: nkulagin@bestnet.kharkov.u [Kharkiv National University for Radio Electronics, Avenue Shakespeare 6-48, 61045 Kharkiv (Ukraine)
2011-03-15
Selected data of ab initio simulation of the electronic structure and spectral properties of either cluster with ions of iron, rare earth or actinium group elements have been presented here. Appearance of doped Cr{sup +4} ions in oxides, Cu{sup +2} in HTSC, Nd{sup +2} in solids has been discussed. Analysis of experimental data for plasma created ordered structures of crystallites with size of about 10{sup -9} m on surface of separate oxides are given, too. Change in the spectroscopic properties of clusters and nano-structures on surface of strontium titanate crystals discussed shortly using the X-ray line spectroscopy experimental results. - Research highlights: External influence and variation of technology induce changes in valence of nl ions in compounds. Wave function of cluster presented as anti-symmetrical set of ions wave functions. The main equation describes the self-consistent field depending on state of all electrons of cluster. Level scheme of Cr{sup 4+} ions in octo- and tetra-site corresponds to doped oxides spectra after treatment. Plasma treatment effects in appearance of systems of unit crystallites with size of about 10{sup -6}-10{sup -9} m.
Electronic structure and dynamics of ordered clusters with ME or RE ions on oxide surface
International Nuclear Information System (INIS)
Kulagin, N.A.
2011-01-01
Selected data of ab initio simulation of the electronic structure and spectral properties of either cluster with ions of iron, rare earth or actinium group elements have been presented here. Appearance of doped Cr +4 ions in oxides, Cu +2 in HTSC, Nd +2 in solids has been discussed. Analysis of experimental data for plasma created ordered structures of crystallites with size of about 10 -9 m on surface of separate oxides are given, too. Change in the spectroscopic properties of clusters and nano-structures on surface of strontium titanate crystals discussed shortly using the X-ray line spectroscopy experimental results. - Research highlights: → External influence and variation of technology induce changes in valence of nl ions in compounds. → Wave function of cluster presented as anti-symmetrical set of ions wave functions. → The main equation describes the self-consistent field depending on state of all electrons of cluster. → Level scheme of Cr 4+ ions in octo- and tetra-site corresponds to doped oxides spectra after treatment. → Plasma treatment effects in appearance of systems of unit crystallites with size of about 10 -6 -10 -9 m.
Review of radionuclide source terms used for performance-assessment analyses
International Nuclear Information System (INIS)
Barnard, R.W.
1993-06-01
Two aspects of the radionuclide source terms used for total-system performance assessment (TSPA) analyses have been reviewed. First, a detailed radionuclide inventory (i.e., one in which the reactor type, decay, and burnup are specified) is compared with the standard source-term inventory used in prior analyses. The latter assumes a fixed ratio of pressurized-water reactor (PWR) to boiling-water reactor (BWR) spent fuel, at specific amounts of burnup and at 10-year decay. TSPA analyses have been used to compare the simplified source term with the detailed one. The TSPA-91 analyses did not show a significant difference between the source terms. Second, the radionuclides used in source terms for TSPA aqueous-transport analyses have been reviewed to select ones that are representative of the entire inventory. It is recommended that two actinide decay chains be included (the 4n+2 ''uranium'' and 4n+3 ''actinium'' decay series), since these include several radionuclides that have potentially important release and dose characteristics. In addition, several fission products are recommended for the same reason. The choice of radionuclides should be influenced by other parameter assumptions, such as the solubility and retardation of the radionuclides
Ding, Junzhou; Yang, Tewu; Feng, Hao; Dong, Mengyi; Slavin, Margaret; Xiong, Shanbai; Zhao, Siming
2016-02-10
Biofortification of staple grains with high contents of essential micronutrients is an important strategy to overcome micronutrient malnutrition. However, few attempts have targeted at γ-aminobutyric acid (GABA), a functional nutrient for aging populations. In this study, two rice cultivars, Heinuo and Xianhui 207, were used to investigate changes in GABA and other nutritional compounds of dehulled rice after germination under normoxic and hypoxic conditions. Forty-one metabolites were identified in both cultivars treated by normoxic germination, whereas the germinated dehulled rice of Heinuo and Xianhui 207 under hypoxic treatment had 43 and 41 metabolites identified, respectively. GABA increased in dehulled rice after germination, especially under hypoxia. Meanwhile, a number of other health-beneficial and/or flavor-related compounds such as lysine and d-mannose increased after the hypoxic treatment. The accumulation of GABA exhibited genotype-specific modes in both normoxic and hypoxic treatments. With regard to GABA production, Xianhui 207 was more responsive to the germination process than Heinuo, whereas Heinuo was more responsive to hypoxia than Xianhui 207. This study provides a promising approach to biofortify dehulled rice with increased GABA and other nutrients through metabolomic-based regulation.
Probable alpha and 14C cluster emission from hyper Ac nuclei
International Nuclear Information System (INIS)
Santhosh, K.P.
2013-01-01
A systematic study on the probability for the emission of 4 He and 14 C cluster from hyper Λ 207-234 Ac and non-strange normal 207-234 Ac nuclei are performed for the first time using our fission model, the Coulomb and proximity potential model (CPPM). The predicted half lives show that hyper Λ 207-234 Ac nuclei are unstable against 4 He emission and 14 C emission from hyper Λ 217-228 Ac are favorable for measurement. Our study also show that hyper Λ 207-234 Ac are stable against hyper Λ 4 He and Λ 14 C emission. The role of neutron shell closure (N = 126) in hyper Λ 214 Fr daughter and role of proton/neutron shell closure (Z ∼ 82, N = 126) in hyper Λ 210 Bi daughter are also revealed. As hyper-nuclei decays to normal nuclei by mesonic/non-mesonic decay and since most of the predicted half lives for 4 He and 14 C emission from normal Ac nuclei are favourable for measurement, we presume that alpha and 14 C cluster emission from hyper Ac nuclei can be detected in laboratory in a cascade (two-step) process. (orig.)
Contribution of lead in wine to the total dietary intake of lead in humans with and without a meal
International Nuclear Information System (INIS)
Gulson, B.L.; Gray, B.; Mizon, K.J.; Patison, N.
2000-01-01
We have undertaken a case-control study using high precision lead isotopes to evaluate the contribution to blood lead when a normal quantity of wine is consumed with a meal and compared this with consumption under fasting conditions. White wine dosed with a 207 Pb tracer was consumed with a meal by a male subject and blood, urine and faeces monitored for up to four months. In addition to the spiked wine, the male subject and a female control subject residing in the same household consumed approximately equal proportions of unspiked red and white wine from the same vintage and vineyard over the four months. On a succeeding occasion, the male subject consumed 207 Pb-spiked wine under fasting conditions. As the 207 Pb/ 204 Pb ratio in blood and urine prior to the experiment was 15.48 compared with a value of 355 in the doped wine, changes in the 207 Pb/ 204 Pb ratio would be easily discernible. Over the four months of the trial, the results confirmed that there is a minimal uptake of lead from vine when consumed with food
Energy Technology Data Exchange (ETDEWEB)
Schwartz, J; O' Donoghue, J A; Humm, J L [Department of Medical Physics, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); Jaggi, J S [Bristol-Myers Squibb, Plainsboro, NJ (United States); Ruan, S; Larson, S M [Nuclear Medicine Service Department of Radiology, Memorial Sloan-Kettering Cancer Center, 1275 York Avenue, New York, NY 10065 (United States); McDevitt, M; Scheinberg, D A, E-mail: schwarj1@mskcc.org [Molecular Pharmacology and Chemistry, Sloan-Kettering Institute, 1275 York Avenue, New York, NY 10065 (United States)
2011-02-07
Clinical therapeutic studies using {sup 225}Ac-labeled antibodies have begun. Of major concern is renal toxicity that may result from the three alpha-emitting progeny generated following the decay of {sup 225}Ac. The purpose of this study was to determine the amount of {sup 225}Ac and non-equilibrium progeny in the mouse kidney after the injection of {sup 225}Ac-huM195 antibody and examine the dosimetric consequences. Groups of mice were sacrificed at 24, 96 and 144 h after injection with {sup 225}Ac-huM195 antibody and kidneys excised. One kidney was used for gamma ray spectroscopic measurements by a high-purity germanium (HPGe) detector. The second kidney was used to generate frozen tissue sections which were examined by digital autoradiography (DAR). Two measurements were performed on each kidney specimen: (1) immediately post-resection and (2) after sufficient time for any non-equilibrium excess {sup 213}Bi to decay completely. Comparison of these measurements enabled estimation of the amount of excess {sup 213}Bi reaching the kidney ({gamma}-ray spectroscopy) and its sub-regional distribution (DAR). The average absorbed dose to whole kidney, determined by spectroscopy, was 0.77 (SD 0.21) Gy kBq{sup -1}, of which 0.46 (SD 0.16) Gy kBq{sup -1} (i.e. 60%) was due to non-equilibrium excess {sup 213}Bi. The relative contributions to renal cortex and medulla were determined by DAR. The estimated dose to the cortex from non-equilibrium excess {sup 213}Bi (0.31 (SD 0.11) Gy kBq{sup -1}) represented {approx}46% of the total. For the medulla the dose contribution from excess {sup 213}Bi (0.81 (SD 0.28) Gy kBq{sup -1}) was {approx}80% of the total. Based on these estimates, for human patients we project a kidney-absorbed dose of 0.28 Gy MBq{sup -1} following administration of {sup 225}Ac-huM195 with non-equilibrium excess {sup 213}Bi responsible for approximately 60% of the total. Methods to reduce renal accumulation of radioactive progeny appear to be necessary for the success of {sup 225}Ac radioimmunotherapy.
International Nuclear Information System (INIS)
Koyama, Mutsuo
1989-01-01
Distribution profiles of trace elements in land plants were studied by neutron activation analysis and radioactivity measurements without activation. Number of botanical samples analyzed were more than three thousand in which more than three hundred botanical species were included. New accumulator plants of Co, Cr, Zn, Cd, rare earth elements, Ac, U, etc., were found. Capabilities of accumulating trace elements can be related to the botanical taxonomy. Discussions are given from view points of inorganic chemistry as well as from botanical physiology
International Development Research Centre (IDRC) Digital Library (Canada)
Technical Support. 160,675. 171,256. 207,675. 207,675. 141,535. 66,140. A dvisory Board. 57,072. 57,734. 70,000. 70,000. 55,325. 14,675. O ther. 734,691. 811,433. 933,149. 933,149. 830,396. 102,753. Dissemination/ C ommunications. 0 1. 90,835. 130,000. 130,000. 83,250. 46,750. 1,579,479. 2,144,928. 2,591,259.
Czech Academy of Sciences Publication Activity Database
Nakamura, H.; Koziolová, Eva; Etrych, Tomáš; Chytil, Petr; Fang, J.; Ulbrich, Karel; Maeda, H.
2015-01-01
Roč. 90, February (2015), s. 90-96 ISSN 0939-6411 R&D Projects: GA ČR(CZ) GCP207/12/J030; GA ČR GPP207/11/P551; GA MŠk(CZ) ED1.1.00/02.0109 Institutional support: RVO:61389013 Keywords : HPMA polymer conjugate * pirarubicin (THP) * acid-cleavable linkage Subject RIV: CD - Macromolecular Chemistry Impact factor: 3.975, year: 2015
Measurement on the emission of charge exchange recombination in HT-6M tokamak
International Nuclear Information System (INIS)
Xu Wei; Wan Baonian
1999-01-01
The distribution of C VI line (at 207.1 nm) and the time behavior has been measured with Optical Spectroscope Multichannel Analyzer and single channel near ultra-violet system in HT-6M Tokamak. The result of the analysis of line shape and the time behavior show that C VI line (at 207.1 nm) stemmed from the emission of charge exchange recombination processes
Lead and stable Pb-isotope characteristics of tropical soils in north-eastern Brazil
International Nuclear Information System (INIS)
Schucknecht, Anne; Matschullat, Jörg; Reimann, Clemens
2011-01-01
Stable Pb-isotope ratios are widely used as tracers for Pb-sources in the environment. Recently, a few publications have challenged the predominating view of environmental applications of Pb-isotopes. Present applications of Pb-isotopic tracers in soils largely represent the northern hemisphere. This study focuses on tropical soils from Paraíba, north-eastern Brazil. Lead concentrations and Pb-isotopic signatures (both 7N HNO 3 ) were determined at 30 sites along a 327 km E–W-transect, from the Atlantic coast at João Pessoa to some kilometers west of Patos, to identify possible processes for the observed (and anticipated) distribution pattern. Thirty samples each of litter (ORG) and top mineral soil (TOP) were taken on pasture land at suitable distance from roads or other potential contamination sources. Lead-content was determined by inductively-coupled plasma atomic emission spectrometry (ICP-AES) and the ratios of 206 Pb/ 207 Pb, 206 Pb/ 208 Pb, and 208 Pb/ 207 Pb by ICP-sector field mass spectrometry (ICP-SFMS). Both sample materials show similarly low Pb-concentrations with a lower median in the ORG samples (ORG 3.4 mg kg −1 versus TOP 6.9 mg kg −1 ). The 206 Pb/ 207 Pb ratios revealed a large spread along the transect with median 206 Pb/ 207 Pb ratios of 1.160 (ORG) and 1.175 (TOP). The 206 Pb/ 207 Pb ratios differ noticeably between sample sites located in the Atlantic Forest biome along the coast and sample sites in the inland Caatinga biome. The “forest” sites were characterised by a significant lower median and a lower spread in the 206 Pb/ 207 Pb and 206 Pb/ 208 Pb ratios compared to the Caatinga sites. Results indicate a very restricted influence of anthropogenic activities (individual sites only). The main process influencing the spatial variability of Pb-isotope ratios is supposed to be precipitation-dependent bioproductivity and weathering.
Taylor, M. P.; Kristensen, L.; Liqin, W.; Harvey, P. J.; Dong, C.; Rouillon, M.
2015-12-01
The use of lead in automobile gasoline resulted in more than 240,000 tonnes of lead being emitted to the Australian environment over its 70-year period of use starting in 1932. The consequences of the emissions and subsequent depositions have resulted in marked contamination of urban and peri-urban aerosols, soils, plants and humans. This paper charts these effects and examines the extent of recovery from one of the most pervasive and persistent environmental pollutants. Lead isotopic composition of Adelaide and Sydney aerosol filters show that air lead composition shifts from values that approximate Broken Hill type ores, the predominant lead source used in gasoline (1.04 206Pb/207Pb and 2.31 208Pb/207Pb), towards ratios that more closely match local uncontaminated soil and bedrock values (Adelaide ~1.19 206Pb/207Pb and ~2.50 208Pb/207Pb; Sydney ~1.15 206Pb/207Pb and 2.48 208Pb/207Pb). Proxy atmospheric measurements from historic wine, lichen and fungi samples extending over 120 years show how both concentration and composition values shifted in the middle to late 20th century to reflect petrol emissions and then recovered rapidly at the end of the century as leaded gasoline consumption declined. For example, lead in wine from South Australia fell from >100 μg/L in the 1960s and 1970s to < 5 μg/L in the 2010s due to the removal of the primary source of atmospheric lead - gasoline. However, measurement of contemporary surface soils, ash produced from wildfires and air filters demonstrate that the effect of depositions persists and industrial lead and other toxic metals (including arsenic, cadmium and nickel) are subject to frequent remobilization. Predicted increases in wildfires and the generation of lead, arsenic and cadmium toxic particulates warrants greater consideration of the risk for vulnerable populations and firefighters who are most exposed.
Energy Technology Data Exchange (ETDEWEB)
Martínez Cortizas, Antonio, E-mail: antonio.martinez.cortizas@usc.es [Departamento de Edafoloxía e Química Agrícola, Facultade de Bioloxía, Universidade de Santiago de Compostela, Campus Sur s/n, Santiago de Compostela (Spain); López-Merino, Lourdes, E-mail: lourdes.lopez-merino@brunel.ac.uk [Institute of Environment, Health and Societies, Brunel University London, UB8 3PH Uxbridge (United Kingdom); Bindler, Richard, E-mail: richard.bindler@umu.se [Department of Ecology and Environmental Science, Umeå University, Umeå (Sweden); Mighall, Tim, E-mail: t.mighall@abdn.ac.uk [Department of Geography & Environment, School of Geosciences, University of Aberdeen, Elphinstone Road, Aberdeen AB24 3UF (United Kingdom); Kylander, Malin E., E-mail: malin.kylander@geo.su.se [Department of Geological Sciences and the Bolin Centre for Climate Research, Stockholm University, SE-10691, Stockholm (Sweden)
2016-03-01
Although archaeological research suggests that mining/metallurgy already started in the Chalcolithic (3rd millennium BC), the earliest atmospheric metal pollution in SW Europe has thus far been dated to ~ 3500–3200 cal. yr. BP in paleo-environmental archives. A low intensity, non-extensive mining/metallurgy and the lack of appropriately located archives may be responsible for this mismatch. We have analysed the older section (> 2100 cal. yr. BP) of a peat record from La Molina (Asturias, Spain), a mire located in the proximity (35–100 km) of mines which were exploited in the Chalcolithic/Bronze Age, with the aim of assessing evidence of this early mining/metallurgy. Analyses included the determination of C as a proxy for organic matter content, lithogenic elements (Si, Al, Ti) as markers of mineral matter, and trace metals (Cr, Cu, Zn, Pb) and stable Pb isotopes as tracers of atmospheric metal pollution. From ~ 8000 to ~ 4980 cal. yr. BP the Pb composition is similar to that of the underlying sediments (Pb 15 ± 4 μg g{sup −1}; {sup 206}Pb/{sup 207}Pb 1.204 ± 0.002). A sustained period of low {sup 206}Pb/{sup 207}Pb ratios occurred from ~ 4980 to ~ 2470 cal. yr. BP, which can be divided into four phases: Chalcolithic (~ 4980–3700 cal. yr. BP), {sup 206}Pb/{sup 207}Pb ratios decline to 1.175 and Pb/Al ratios increase; Early Bronze Age (~ 3700–3500 cal. yr. BP), {sup 206}Pb/{sup 207}Pb increase to 1.192 and metal/Al ratios remain stable; Late Bronze Age (~ 3500–2800 cal. yr. BP), {sup 206}Pb/{sup 207}Pb decline to their lowest values (1.167) while Pb/Al and Zn/Al increase; and Early Iron Age (~ 2800–2470 cal. yr. BP), {sup 206}Pb/{sup 207}Pb increase to 1.186, most metal/Al ratios decrease but Zn/Al shows a peak. At the beginning of the Late Iron Age, {sup 206}Pb/{sup 207}Pb ratios and metal enrichments show a rapid return to pre-anthropogenic values. These results provide evidence of regional/local atmospheric metal pollution triggered by the
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLC489 (Link to dictyBase) - - - Contig-U16255-1 SLC489P (Link to Original site) SLC4...89F 628 SLC489Z 172 SLC489P 800 - - Show SLC489 Library SL (Link to library) Clone ID SLC4... URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-D/SLC489Q.Seq.d/ Representative seq. ID SLC4...89P (Link to Original site) Representative DNA sequence >SLC489 (SLC489Q) /CSM/SL/SLC4-D/SLC4...SSD212Q.Seq.d/ 1001 0.0 SLE207 (SLE207Q) /CSM/SL/SLE2-A/SLE207Q.Seq.d/ 1001 0.0 SLC489 (SLC489Q) /CSM/SL/SLC4-D/SLC4
Yang, Yuqi; Zhou, Hongbo; Shen, Xiaoping
2013-01-01
The asymmetric unit of the title complex, [Fe2Ni(C19H12N3O)2(CN)6(C16H36N4)]·2.07H2O, contains one [Fe(qcq)(CN)3]− anion, half a [Ni(teta)]2+ cation and two partially occupied interstitial water molecules [qcq− is the N-(quinolin-8-yl)quinoline-2-carboxamidate anion and teta is 5,5,7,12,12,14-hexamethyl-1,4,8,11-tetraazacyclotetradecane]. In the complex molecule, two [Fe(qcq)(CN)3]− anions additionally coordinate the central [Ni(teta)]2+ cation through cyanide groups in a trans mode, resulting in a trinuclear structure with the Ni2+ cation lying on an inversion centre. The two interstitial water molecules are partially occupied, with occupancy factors of 0.528 (10) and 0.506 (9). O—H⋯O and O—H⋯N hydrogen bonding involving the two lattice water molecules and the carbonyl function and a teta N atom in an adjacent cluster leads to the formation of layers extending parallel to (010). PMID:23723777
Isonitrile ligand effects on small-molecule-sequestering in bimetalladodecaborane clusters
Czech Academy of Sciences Publication Activity Database
Bould, Jonathan; Londesborough, Michael Geoffrey Stephen; Kennedy, JD.; Macias, R.; Winter, REK.; Císařová, I.; Kubát, Pavel; Lang, Kamil
2013-01-01
Roč. 747, december (2013), s. 76-84 ISSN 0022-328X R&D Projects: GA ČR GAP207/11/1577; GA ČR GAP208/10/1678; GA ČR GAP207/11/0705 Institutional support: RVO:61388980 ; RVO:61388955 Keywords : Metallaboranes * Small molecule * Sequestration * DFT * Isonitrile * Carbon monoxide Subject RIV: CA - Inorganic Chemistry; CF - Physical ; Theoretical Chemistry (UFCH-W) Impact factor: 2.302, year: 2013
Characterization of the part of N-terminal PIP2 binding site of the TRPM1 channel
Czech Academy of Sciences Publication Activity Database
Jirků, Michaela; Bumba, Ladislav; Bednárová, Lucie; Kubala, M.; Šulc, Miroslav; Franěk, M.; Vyklický ml., Ladislav; Vondrášek, Jiří; Teisinger, Jan; Boušová, Kristýna
2015-01-01
Roč. 207, Dec (2015), s. 135-142 ISSN 0301-4622 R&D Projects: GA ČR(CZ) GAP207/11/0717; GA ČR(CZ) GA15-11851S; GA ČR(CZ) GBP304/12/G069 Institutional support: RVO:67985823 ; RVO:61388971 ; RVO:61388963 Keywords : TRPM1 channel * binding site * PIP2 * surface plasmon resonance * FRET * circular dichroism Subject RIV: CE - Biochemistry Impact factor: 2.363, year: 2015
Energy Technology Data Exchange (ETDEWEB)
Mahmood, Javed [Ontario Cancer Institute and the Campbell Family Institute for Cancer Research, Princess Margaret Cancer Centre, University Health Network, Toronto, Ontario (Canada); Radiation Medicine Program, STTARR Innovation Centre, Princess Margaret Cancer Centre, Toronto, Ontario (Canada); Jelveh, Salomeh [Radiation Medicine Program, STTARR Innovation Centre, Princess Margaret Cancer Centre, Toronto, Ontario (Canada); Zaidi, Asif [Ontario Cancer Institute and the Campbell Family Institute for Cancer Research, Princess Margaret Cancer Centre, University Health Network, Toronto, Ontario (Canada); Doctrow, Susan R. [Pulmonary Center, Department of Medicine, Boston University, Boston, Massachusetts (United States); Medhora, Meetha [Department of Radiation Oncology, Medical College of Wisconsin, Milwaukee, Wisconsin (United States); Hill, Richard P., E-mail: hill@uhnres.utoronto.ca [Ontario Cancer Institute and the Campbell Family Institute for Cancer Research, Princess Margaret Cancer Centre, University Health Network, Toronto, Ontario (Canada); Departments of Medical Biophysics and Radiation Oncology, University of Toronto, Toronto, Ontario (Canada)
2014-07-15
Purpose: To investigate the outcome of suppression of the renin angiotensin system using captopril combined with an antioxidant (Eukarion [EUK]-207) for mitigation of radiation-induced lung damage in rats. Methods and Materials: The thoracic cavity of female Sprague-Dawley rats was irradiated with a single dose of 11 Gy. Treatment with captopril at a dose of 40 mg/kg/d in drinking water and EUK-207 given by subcutaneous injection (8 mg/kg daily) was started 1 week after irradiation (PI) and continuing until 14 weeks PI. Breathing rate was monitored until the rats were killed at 32 weeks PI, when lung fibrosis was assessed by lung hydroxyproline content. Lung levels of the cytokine transforming growth factor-β1 and macrophage activation were analyzed by immunohistochemistry. Oxidative DNA damage was assessed by 8-hydroxy-2-deoxyguanosine levels, and lipid peroxidation was measured by a T-BARS assay. Results: The increase in breathing rate in the irradiated rats was significantly reduced by the drug treatments. The drug treatment also significantly decreased the hydroxyproline content, 8-hydroxy-2-deoxyguanosine and malondialdehyde levels, and levels of activated macrophages and the cytokine transforming growth factor-β1 at 32 weeks. Almost complete mitigation of these radiation effects was observed by combining captopril and EUK-207. Conclusion: Captopril and EUK-207 can provide mitigation of radiation-induced lung damage out to at least 32 weeks PI after treatment given 1-14 weeks PI. Overall the combination of captopril and EUK-207 was more effective than the individual drugs used alone.
Bone lead levels and lead isotope ratios in red grouse from Scottish and Yorkshire moors
Energy Technology Data Exchange (ETDEWEB)
Thomas, Vernon G., E-mail: vthomas@uoguelph.ca [Department of Integrative Biology, College of Biological Science, University of Guelph, Guelph, Ontario, N1G 2W1 (Canada); Scheuhammer, Anton M.; Bond, Della E. [Metals Toxicology Laboratory, National Wildlife Research Centre, Carleton University, Ottawa, Ontario, K1A 0H3 (Canada)
2009-05-15
Leg and foot bones of adult and juvenile red grouse (Lagopus lagopus scoticus) were collected from hunter-shot birds on two Scottish estates (Glendye and Invermark) and one Yorkshire estate in September, 2003. The lead content of bones was measured by atomic absorption spectrophotometry, and corresponding stable lead isotopes (Pb204, 206, 207, 208) by inductively coupled plasma mass spectrometry. At the Glendye (N = 111) and Invermark (N = 85) estates, relatively few birds (5.4% and 3.5%, respectively) had highly elevated bone lead concentrations (> 20 mug/g dry weight). In bones of these highly exposed birds, a combination of Pb206:Pb207 and Pb208:Pb207ratios was consistent with ingestion of lead gunshot available in Europe. By contrast, Yorkshire grouse experienced a high incidence (65.8%) of bone lead > 20 mug/g. The Pb206:Pb207 and Pb208:Pb207ratios in bones of these highly exposed birds were consistent with a combined exposure to ingested lead gunshot and lead from galena mining in the region. Lead isotope ratios also indicated that lead from UK gasoline combustion and fallout from atmospheric particles was not a likely source of elevated lead in bones of either Scottish or Yorkshire grouse. Suggested management options for the three moors include adopting nontoxic shot for all game shooting on the estates, allowing heather (Calluna vulgaris) vegetation to grow tall in lead shot fall-out zones to reduce physical access to high densities of lead shot already present, and provision of calcareous grit across moors to reduce lead assimilation from all ingested sources of lead.
Bone lead levels and lead isotope ratios in red grouse from Scottish and Yorkshire moors
International Nuclear Information System (INIS)
Thomas, Vernon G.; Scheuhammer, Anton M.; Bond, Della E.
2009-01-01
Leg and foot bones of adult and juvenile red grouse (Lagopus lagopus scoticus) were collected from hunter-shot birds on two Scottish estates (Glendye and Invermark) and one Yorkshire estate in September, 2003. The lead content of bones was measured by atomic absorption spectrophotometry, and corresponding stable lead isotopes (Pb204, 206, 207, 208) by inductively coupled plasma mass spectrometry. At the Glendye (N = 111) and Invermark (N = 85) estates, relatively few birds (5.4% and 3.5%, respectively) had highly elevated bone lead concentrations (> 20 mug/g dry weight). In bones of these highly exposed birds, a combination of Pb206:Pb207 and Pb208:Pb207ratios was consistent with ingestion of lead gunshot available in Europe. By contrast, Yorkshire grouse experienced a high incidence (65.8%) of bone lead > 20 mug/g. The Pb206:Pb207 and Pb208:Pb207ratios in bones of these highly exposed birds were consistent with a combined exposure to ingested lead gunshot and lead from galena mining in the region. Lead isotope ratios also indicated that lead from UK gasoline combustion and fallout from atmospheric particles was not a likely source of elevated lead in bones of either Scottish or Yorkshire grouse. Suggested management options for the three moors include adopting nontoxic shot for all game shooting on the estates, allowing heather (Calluna vulgaris) vegetation to grow tall in lead shot fall-out zones to reduce physical access to high densities of lead shot already present, and provision of calcareous grit across moors to reduce lead assimilation from all ingested sources of lead.
International Nuclear Information System (INIS)
1991-06-01
The Department of Energy (DOE) has prepared an Environmental Assessment (DOE/EA-0487) on its proposal to partially close five solar evaporation ponds at the Rocky Flats Plant (RFP) pursuant to the requirements of the Resource Conservation and Recovery Act (RCRA). This proposal would be known as a RCRA partial closure and would be accomplished by dewatering the ponds, where necessary, and converting any remaining sludge or evaporator concentrate to a solid wasteform (pondcrete and saltcrete). The pond sites would be stabilized to prevent erosion or other disturbance to the soil and to prevent infiltration of rain or snowmelt. The solid wasteform would be transported offsite for disposal. The five solar ponds (designated 207-A, 207-B (north, center, and south), and 207-C), are the only solar evaporation ponds that exist at the RFP. A finding of no significant impact is included
International Nuclear Information System (INIS)
Kylander, M.E.; Weiss, D.J.; Jeffries, T.E.; Kober, B.; Dolgopolova, A.; Garcia-Sanchez, R.; Coles, B.J.
2007-01-01
An analytical protocol for rapid and reliable laser ablation-quadrupole (LA-Q)- and multi-collector (MC-) inductively coupled plasma-mass spectrometry (ICP-MS) analysis of Pb isotope ratios ( 207 Pb/ 206 Pb and 208 Pb/ 206 Pb) in peats and lichens is developed. This technique is applicable to source tracing atmospheric Pb deposition in biomonitoring studies and sample screening. Reference materials and environmental samples were dry ashed and pressed into pellets for introduction by laser ablation. No binder was used to reduce contamination. LA-MC-ICP-MS internal and external precisions were 207 Pb/ 206 Pb and 208 Pb/ 206 Pb ratios. LA-Q-ICP-MS internal precisions on 207 Pb/ 206 Pb and 208 Pb/ 206 Pb ratios were lower with values for the different sample sets 208 Pb by Q-ICP-MS are identified as sources of reduced analytical performance
Sun, Guo-Xin; Wang, Xin-Jun; Hu, Qin-Hong
2011-12-01
Lead isotopes and heavy metal concentrations were measured in two sediment cores sampled in estuaries of Xiangjiang and Lishui Rivers in Hunan province, China. The presence of anthropogenic contribution was observed in both sediments, especially in Xiangjiang sediment. In the Xiangjiang sediment, the lower (206)Pb/(207)Pb and higher (208)Pb/(206)Pb ratio, than natural Pb isotope signature (1.198 and 2.075 for (206)Pb/(207)Pb and (208)Pb/(206)Pb, respectively), indicated a significant input of non-indigenous Pb with low (206)Pb/(207)Pb and high (208)Pb/(206)Pb. The corresponding concentrations of heavy metals (As, Cd, Zn, Mn and Pb) were much higher than natural values, suggesting the contaminations of heavy metals from extensive ore-mining activities in the region. Copyright © 2011 Elsevier Ltd. All rights reserved.
McCombie, Roberta L.; Finkelstein, Richard A.; Woods, Donald E.
2006-01-01
A collection of 207 historically relevant Burkholderia pseudomallei isolates was analyzed by multilocus sequence typing (MLST). The strain collection contains environmental isolates obtained from a geographical distribution survey of B. pseudomallei isolates in Thailand (1964 to 1967), as well as stock cultures and colony variants from the U.S. Army Medical Research Unit (Malaysia), the Walter Reed Army Institute for Research, and the Pasteur Institute (Vietnam). The 207 isolates of the colle...
Graphic and algebraic solutions of the discordant lead-uranium age problem
Stieff, L.R.; Stern, T.W.
1961-01-01
Uranium-bearing minerals that give lead-uranium and lead-lead ages that are essentially in agreement, i.e. concordant, generally are considered to have had a relatively simple geologic history and to have been unaltered since their deposition. The concordant ages obtained on such materials are, therefore, assumed to approach closely the actual age of the minerals. Many uranium-bearing samples, particularly uranium ores, give the following discordant age sequences; Pb206 U238 generation of radiogenic lead. The evaluation of discordant lead isotope age data may be separated into two operations. The first operation, with which this paper is concerned, is mechanical in nature and involves the calculation of the different possible concordant ages corresponding to the various processes assumed to have produced the discordant ages. The second operation is more difficult to define and requires, in part, some personal judgement. It includes a synthesis of the possible concordant age solutions with other independent geologic and isotopic evidence. The concordant age ultimately chosen as most acceptable should be consistent not only with the known events in the geologic history of the area, the age relations of the enclosing rocks, and the mineralogic and paragenetic evidence, but also with other independent age measurements and the isotopic data obtained on the lead in related or associated non-radioactive minerals. The calculation of the possible concordant ages from discordant age data has been greatly simplified by Wetherill's graphical method of plotting the mole ratios of radiogenic Pb206 U238 ( N206 N238) vs. radiogenic Pb207 U235 ( N207 N235) after correcting for the contaminating common Pb206 and Pb207. The linear relationships noted in this graphical procedure have been extended to plots of the mole ratios of total Pb206 U238 ( tN206 N238) vs. total Pb207 U235 ( tN207 N235). This modification permits the calculation of concordant ages for unaltered samples using
International Nuclear Information System (INIS)
Patrick, Gavin J.; Farmer, John G.
2006-01-01
The validity of the use of sycamore (Acer pseudoplatanus) tree-rings for the reconstruction of atmospheric lead pollution histories was investigated. Tree cores spanning 1892-2003 were collected from several sycamores from the eastern shore of Loch Lomond, Scotland, an area with no local point sources of lead emission. The lead concentration and 206 Pb/ 207 Pb profiles of the Loch Lomond region cores were compared with corresponding data for the 21 Pb-dated loch sediment, and also with data for moss of known age from a Scottish herbarium collection. Two of the seven sycamore cores showed the same lead concentration trend as the lead flux to the loch, the rest having no similarity to either each other or the loch sediment record. Two further sycamore cores showed some similarity in their temporal 206 Pb/ 207 Pb trends to those seen in the sediment and moss records, but only in part of their profiles, whilst the 206 Pb/ 207 Pb ratios of the other sycamore cores remained relatively unchanged for the majority of the time covered, or exhibited an opposite trend. The 206 Pb/ 207 Pb ratios of the tree cores were also mostly higher than those of the previously established records for any given time period. Tree cores covering 1878-2002 were also collected along transects from Wanlockhead and Tyndrum, two areas of former lead mining and smelting associated with distinct 206 Pb/ 207 Pb ratios of 1.170 and 1.144, respectively. The Wanlockhead tree cores exhibited a generally decreasing trend in lead concentration with both time and distance from the lead mine. The characteristic 206 Pb/ 207 Pb ratio of 1.170 was observed in samples close to the mine but a decrease in the influence of the mine-derived lead was observed in more distant samples. The tree sampled at Tyndrum showed elevated lead concentrations, which decreased with time, and a fairly constant 206 Pb/ 207 Pb ratio of ∼ 1.15 reflecting input from the mine, features not observed in any other trees along the
A lead isotopic study of the human bioaccessibility of lead in urban soils from Glasgow, Scotland
Energy Technology Data Exchange (ETDEWEB)
Farmer, John G., E-mail: J.G.Farmer@ed.ac.uk [School of GeoSciences, University of Edinburgh, Edinburgh, EH9 3JN, Scotland (United Kingdom); Broadway, Andrew [School of GeoSciences, University of Edinburgh, Edinburgh, EH9 3JN, Scotland (United Kingdom); Cave, Mark R.; Wragg, Joanna [British Geological Survey, Keyworth, Nottingham NG12 5GG, England (United Kingdom); Fordyce, Fiona M. [British Geological Survey, Edinburgh, EH9 3LA, Scotland (United Kingdom); Graham, Margaret C.; Ngwenya, Bryne T. [School of GeoSciences, University of Edinburgh, Edinburgh, EH9 3JN, Scotland (United Kingdom); Bewley, Richard J.F. [URS Corporation Ltd, Manchester, M1 6HS, England (United Kingdom)
2011-11-01
The human bioaccessibility of lead (Pb) in Pb-contaminated soils from the Glasgow area was determined by the Unified Bioaccessibility Research Group of Europe (BARGE) Method (UBM), an in vitro physiologically based extraction scheme that mimics the chemical environment of the human gastrointestinal system and contains both stomach and intestine compartments. For 27 soils ranging in total Pb concentration from 126 to 2160 mg kg{sup -1} (median 539 mg kg{sup -1}), bioaccessibility as determined by the 'stomach' simulation (pH {approx} 1.5) was 46-1580 mg kg{sup -1}, equivalent to 23-77% (mean 52%) of soil total Pb concentration. The corresponding bioaccessibility data for the 'stomach + intestine' simulation (pH {approx} 6.3) were 6-623 mg kg{sup -1} and 2-42% (mean 22%) of soil Pb concentration. The soil {sup 206}Pb/{sup 207}Pb ratios ranged from 1.057 to 1.175. Three-isotope plots of {sup 208}Pb/{sup 206}Pb against {sup 206}Pb/{sup 207}Pb demonstrated that {sup 206}Pb/{sup 207}Pb ratios were intermediate between values for source end-member extremes of imported Australian Pb ore (1.04) - used in the manufacture of alkyl Pb compounds (1.06-1.10) formerly added to petrol - and indigenous Pb ores/coal (1.17-1.19). The {sup 206}Pb/{sup 207}Pb ratios of the UBM 'stomach' extracts were similar (< 0.01 difference) to those of the soil for 26 of the 27 samples (r = 0.993, p < 0.001) and lower in 24 of them. A slight preference for lower {sup 206}Pb/{sup 207}Pb ratio was discernible in the UBM. However, the source of Pb appeared to be less important in determining the extent of UBM-bioaccessible Pb than the overall soil total Pb concentration and the soil phases with which the Pb was associated. The significant phases identified in a subset of samples were carbonates, manganese oxides, iron-aluminium oxyhydroxides and clays. - Highlights: {yields} We determined the human bioaccessibility of Pb in urban soils by in vitro extraction. {yields} We
Energy Technology Data Exchange (ETDEWEB)
Farmer, John G., E-mail: J.G.Farmer@ed.ac.uk [School of GeoSciences, The University of Edinburgh, Crew Building, Alexander Crum Brown Road, Edinburgh, EH9 3FF Scotland (United Kingdom); Graham, Margaret C. [School of GeoSciences, The University of Edinburgh, Crew Building, Alexander Crum Brown Road, Edinburgh, EH9 3FF Scotland (United Kingdom); Eades, Lorna J. [School of Chemistry, The University of Edinburgh, Joseph Black Building, David Brewster Road, Edinburgh, EH9 3FJ Scotland (United Kingdom); Lilly, Allan; Bacon, Jeffrey R. [James Hutton Institute, Craigiebuckler, Aberdeen, AB15 8QH Scotland (United Kingdom)
2016-02-15
Some 644 individual soil horizons from 169 sites in Scotland were analyzed for Pb concentration and isotopic composition. There were three scenarios: (i) 36 sites where both top and bottom (i.e. lowest sampled) soil horizons were classified as organic in nature, (ii) 67 with an organic top but mineral bottom soil horizon, and (iii) 66 where both top and bottom soil horizons were mineral. Lead concentrations were greater in the top horizon relative to the bottom horizon in all but a few cases. The top horizon {sup 206}Pb/{sup 207}Pb ratio was lesser (outside analytical error) than the corresponding bottom horizon {sup 206}Pb/{sup 207}Pb ratio at (i) 64%, (ii) 94% and (iii) 73% of sites, and greater at only (i) 8%, (ii) 3% and (iii) 8% of sites. A plot of {sup 208}Pb/{sup 207}Pb vs. {sup 208}Pb/{sup 206}Pb ratios showed that the Pb in organic top (i, ii) and bottom (i) horizons was consistent with atmospherically deposited Pb of anthropogenic origin. The {sup 206}Pb/{sup 207}Pb ratio of the organic top horizon in (ii) was unrelated to the {sup 206}Pb/{sup 207}Pb ratio of the mineral bottom horizon as demonstrated by the geographical variation in the negative shift in the ratio, a result of differences in the mineral horizon values arising from the greater influence of radiogenic Pb in the north. In (iii), the lesser values of the {sup 206}Pb/{sup 207}Pb ratio for the mineral top horizon relative to the mineral bottom horizon were consistent with the presence of anthropogenic Pb, in addition to indigenous Pb, in the former. Mean anthropogenic Pb inventories of 1.5 and 4.5 g m{sup −2} were obtained for the northern and southern halves of Scotland, respectively, consistent with long-range atmospheric transport of anthropogenic Pb (mean {sup 206}Pb/{sup 207}Pb ratio ~ 1.16). For cultivated agricultural soils (Ap), this corresponded to about half of the total Pb inventory in the top 30 cm of the soil column. - Highlights: • Pb isotope ratios were determined for 644
Bridgestock, Luke; Rehkämper, Mark; van de Flierdt, Tina; Paul, Maxence; Milne, Angela; Lohan, Maeve C.; Achterberg, Eric P.
2018-03-01
Anthropogenic emissions have dominated marine Pb sources during the past century. Here we present Pb concentrations and isotope compositions for ocean depth profiles collected in the eastern Tropical Atlantic Ocean (GEOTRACES section GA06), to trace the transfer of anthropogenic Pb into the ocean interior. Variations in Pb concentration and isotope composition were associated with changes in hydrography. Water masses ventilated in the southern hemisphere generally featured lower 206Pb/207Pb and 208Pb/207Pb ratios than those ventilated in the northern hemisphere, in accordance with Pb isotope data of historic anthropogenic Pb emissions. The distributions of Pb concentrations and isotope compositions in northern sourced waters were consistent with differences in their ventilation timescales. For example, a Pb concentration maximum at intermediate depth (600-900 m, 35 pmol kg-1) in waters sourced from the Irminger/Labrador Seas, is associated with Pb isotope compositions (206Pb/207Pb = 1.1818-1.1824, 208Pb/207Pb = 2.4472-2.4483) indicative of northern hemispheric emissions during the 1950s and 1960s close to peak leaded petrol usage, and a transit time of ∼50-60 years. In contrast, North Atlantic Deep Water (2000-4000 m water depth) featured lower Pb concentrations and isotope compositions (206Pb/207Pb = 1.1762-1.184, 208Pb/207Pb = 2.4482-2.4545) indicative of northern hemispheric emissions during the 1910s and 1930s and a transit time of ∼80-100 years. This supports the notion that transient anthropogenic Pb inputs are predominantly transferred into the ocean interior by water mass transport. However, the interpretation of Pb concentration and isotope composition distributions in terms of ventilation timescales and pathways is complicated by (1) the chemical reactivity of Pb in the ocean, and (2) mixing of waters ventilated during different time periods. The complex effects of water mass mixing on Pb distributions is particularly apparent in seawater in the
Statistical decay of giant monopole resonance in 208Pb
International Nuclear Information System (INIS)
Dias, H.; Wolynec, E.
1984-01-01
The neutron spectrum from the decay of the monopole giant resonance in 208 Pb is calculated using the known energy levels of 207 Pb. The particle vibrator model is used to assign spins parities to the measured 207 Pb levels, where these were not avaliable from experiments. The results of the Hauser-Feshbach calculation is in excellent agreement with the experimental spectrum, showing that the observed fast neutrons can be completely explained assuming a statistical decay. (Author) [pt
76 FR 798 - Ball Bearings From Japan and the United Kingdom
2011-01-06
...The U.S. International Trade Commission (``Commission'') hereby gives notice of its fourth remand proceeding with respect to its affirmative determination in the five-year review of the antidumping duty order on ball bearings from Japan. For further information concerning the conduct of this proceeding and rules of general application, consult the Commission's Rules of Practice and Procedure, part 201, subparts A through E (19 CFR part 201), and part 207, subpart A (19 CFR part 207).
Czech Academy of Sciences Publication Activity Database
Chytil, Petr; Koziolová, Eva; Janoušková, Olga; Kostka, Libor; Ulbrich, Karel; Etrych, Tomáš
2015-01-01
Roč. 15, č. 6 (2015), s. 839-850 ISSN 1616-5187 R&D Projects: GA ČR GPP207/11/P551; GA ČR(CZ) GCP207/12/J030; GA MŠk(CZ) EE2.3.30.0029; GA MŠk(CZ) ED1.1.00/02.0109 Institutional support: RVO:61389013 Keywords : drug delivery systems * HPMA copolymers * pH-controlled release Subject RIV: CD - Macromolecular Chemistry Impact factor: 3.680, year: 2015
International Nuclear Information System (INIS)
Svanberg, Fredrik; Mateo, Rafael; Hillstroem, Lars; Green, Andy J.; Taggart, Mark A.; Raab, Andrea; Meharg, Andy A.
2006-01-01
Lead isotope ratios ( 206 Pb/ 207 Pb and 208 Pb/ 207 Pb) and concentrations in the livers and bones of marbled teal and white-headed duck found dead or moribund were determined in order to establish the main lead source in these waterfowl species. Lead concentrations in bone (dry weight) and liver (wet weight) were found to be very high in many of the white-headed ducks (bone: geometric mean = 88.9 ppm, maximum = 419 ppm; liver: geometric mean = 16.8 ppm, maximum = 57.0 ppm). Some of the marbled teal had high lead levels in the bones but liver lead levels were all low (bone: geometric mean = 6.13 ppm, maximum = 112 ppm; liver: geometric mean = 0.581 ppm, maximum = 4.77 ppm). Ingested lead shot were found in 71% of the white-headed duck and 20% of the marbled teal. The 206 Pb/ 207 Pb ratio in livers and bones of white-headed ducks and marbled teals showed no significant differences compared to the ratios obtained from lead shot. The 206 Pb/ 207 Pb ratio in bones of marbled teal ducklings with the highest lead concentrations tended to resemble the ratios of lead shot, which supports our hypothesis that the lead was derived from the hens. We also found that the lead ratios of lead shot and lead ratios described for soils in the area overlapped, but also that the isotopic ratio 206 Pb/ 207 Pb in lead shot used in Spain has a narrow range compared with those used in North America. The principal source of lead in many of these birds was, however, most likely lead shot, as supported by the similar isotopic ratios, high lead concentrations in tissues and evidence of ingested shot
Energy Technology Data Exchange (ETDEWEB)
Svanberg, Fredrik [Department of Environmental Toxicology, Evolutionary Biology Centre, Uppsala University, Norbyvaegen 18A, SE-752 36 Uppsala (Sweden)]. E-mail: fredriksvanberg@hotmail.com; Mateo, Rafael [Instituto de Investigacion en Recursos Cinegeticos, IREC (CSIC-UCLM-JCCM), Ronda de Toledo s/n, 13071 Ciudad Real (Spain); Hillstroem, Lars [Institute of Maths, Natural and Computer Science, University of Gaevle, SE-801 76 Gaevle (Sweden); Green, Andy J. [Wetland Ecology Group, Estacion Biologica de Donana-CSIC, Pabellon del Peru, Avenida Maria Luisa s/n, E-40013 Seville (Spain); Taggart, Mark A. [School of Biological Sciences, University of Aberdeen, Cruickshank Bld, St Machar Dr, Aberdeen, Scotland, AB24 3UU (United Kingdom); Raab, Andrea [School of Biological Sciences, University of Aberdeen, Cruickshank Bld, St Machar Dr, Aberdeen, Scotland, AB24 3UU (United Kingdom); Meharg, Andy A. [School of Biological Sciences, University of Aberdeen, Cruickshank Bld, St Machar Dr, Aberdeen, Scotland, AB24 3UU (United Kingdom)
2006-11-01
Lead isotope ratios ({sup 206}Pb/{sup 207}Pb and {sup 208}Pb/{sup 207}Pb) and concentrations in the livers and bones of marbled teal and white-headed duck found dead or moribund were determined in order to establish the main lead source in these waterfowl species. Lead concentrations in bone (dry weight) and liver (wet weight) were found to be very high in many of the white-headed ducks (bone: geometric mean = 88.9 ppm, maximum = 419 ppm; liver: geometric mean = 16.8 ppm, maximum = 57.0 ppm). Some of the marbled teal had high lead levels in the bones but liver lead levels were all low (bone: geometric mean = 6.13 ppm, maximum = 112 ppm; liver: geometric mean = 0.581 ppm, maximum = 4.77 ppm). Ingested lead shot were found in 71% of the white-headed duck and 20% of the marbled teal. The {sup 206}Pb/{sup 207}Pb ratio in livers and bones of white-headed ducks and marbled teals showed no significant differences compared to the ratios obtained from lead shot. The {sup 206}Pb/{sup 207}Pb ratio in bones of marbled teal ducklings with the highest lead concentrations tended to resemble the ratios of lead shot, which supports our hypothesis that the lead was derived from the hens. We also found that the lead ratios of lead shot and lead ratios described for soils in the area overlapped, but also that the isotopic ratio {sup 206}Pb/{sup 207}Pb in lead shot used in Spain has a narrow range compared with those used in North America. The principal source of lead in many of these birds was, however, most likely lead shot, as supported by the similar isotopic ratios, high lead concentrations in tissues and evidence of ingested shot.
47 CFR 13.207 - Preparing an examination.
2010-10-01
... consist of a plain language text or code group message sent in the international Morse code at no less... examination. Each five letters of the alphabet must be counted as one word or one code group. Each numeral...
29 CFR 2200.207 - Pre-hearing conference.
2010-07-01
... Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH REVIEW COMMISSION RULES OF PROCEDURE... parties will discuss the following: settlement of the case; the narrowing of issues; an agreed statement of issues and facts; defenses; witnesses and exhibits; motions; and any other pertinent matter...
14 CFR 91.207 - Emergency locator transmitters.
2010-01-01
... incident to design and testing; (5) New aircraft while engaged in flight operations incident to their... Administrator for research and development purposes; (8) Aircraft while used for showing compliance with... view of the pilot to show “ELT not installed.” (ii) No person may operate the aircraft more than 90...
47 CFR 80.207 - Classes of emission.
2010-10-01
... communications employing a modulated carrier the carrier must be keyed and modulated by an audio frequency. (c..., 16, 17 A1A, J2A, J2B, J2D. DSC 6 F1B, J2B. NB-DP 14, 16 F1B, J2B, J2D. Facsimile F1C, F3C, J2C, J3C. 156-162 MHz 2 F1B, F2B, F2C, F3C, F1D, F2D. DSC G2B. 216-220 MHz 3 F1B, F2B, F2C, F3C. 1626.5-1646.5...
24 CFR 207.258 - Insurance claim requirements.
2010-04-01
... in 24 CFR part 200, subpart B, of its intention to file an insurance claim and of its election either..., ledger cards, documents, books, papers, and accounts relating to the mortgage transaction. (iv) All...
33 CFR 207.460 - Fox River, Wis.
2010-07-01
... all boats, vessels, tows, rafts and floating things, both powered and nonpowered, in the canals and... the purpose desired. Applicants will be required to establish over their signature the fact that due...
5 CFR 330.207 - Selection from RPL.
2010-01-01
... employees enrolled on the RPL. (b) Retention standing order. For each vacancy to be filled, the agency shall.... Within a subgroup, an agency may select an individual without regard to order of retention standing. A... be filled, the agency rates qualified individuals according to their job experience and education. To...
TU-AB-207-03: Tomosynthesis: Clinical Applications
Energy Technology Data Exchange (ETDEWEB)
Maidment, A. [Univ Pennsylvania (United States)
2015-06-15
Digital Tomosynthesis (DT) is becoming increasingly common in breast imaging and many other applications. DT is a form of computed tomography in which a limited set of projection images are acquired over a small angular range and reconstructed into a tomographic data set. The angular range and number of projections is determined both by the imaging task and equipment manufacturer. For example, in breast imaging between 9 and 25 projections are acquired over a range of 15° to 60°. It is equally valid to treat DT as the digital analog of classical tomography - for example, linear tomography. In fact, the name “tomosynthesis” is an acronym for “synthetic tomography”. DT shares many common features with classical tomography, including the radiographic appearance, dose, and image quality considerations. As such, both the science and practical physics of DT systems is a hybrid between CT and classical tomographic methods. This lecture will consist of three presentations that will provide a complete overview of DT, including a review of the fundamentals of DT, a discussion of testing methods for DT systems, and a description of the clinical applications of DT. While digital breast tomosynthesis will be emphasized, analogies will be drawn to body imaging to illustrate and compare tomosynthesis methods. Learning Objectives: To understand the fundamental principles behind tomosynthesis, including the determinants of image quality and dose. To learn how to test the performance of tomosynthesis imaging systems. To appreciate the uses of tomosynthesis in the clinic and the future applications of tomosynthesis.
TU-AB-207-01: Introduction to Tomosynthesis
Energy Technology Data Exchange (ETDEWEB)
Sechopoulos, I. [Emory University (United States)
2015-06-15
Digital Tomosynthesis (DT) is becoming increasingly common in breast imaging and many other applications. DT is a form of computed tomography in which a limited set of projection images are acquired over a small angular range and reconstructed into a tomographic data set. The angular range and number of projections is determined both by the imaging task and equipment manufacturer. For example, in breast imaging between 9 and 25 projections are acquired over a range of 15° to 60°. It is equally valid to treat DT as the digital analog of classical tomography - for example, linear tomography. In fact, the name “tomosynthesis” is an acronym for “synthetic tomography”. DT shares many common features with classical tomography, including the radiographic appearance, dose, and image quality considerations. As such, both the science and practical physics of DT systems is a hybrid between CT and classical tomographic methods. This lecture will consist of three presentations that will provide a complete overview of DT, including a review of the fundamentals of DT, a discussion of testing methods for DT systems, and a description of the clinical applications of DT. While digital breast tomosynthesis will be emphasized, analogies will be drawn to body imaging to illustrate and compare tomosynthesis methods. Learning Objectives: To understand the fundamental principles behind tomosynthesis, including the determinants of image quality and dose. To learn how to test the performance of tomosynthesis imaging systems. To appreciate the uses of tomosynthesis in the clinic and the future applications of tomosynthesis.
24 CFR 207.258a - Title requirements.
2010-04-01
... MULTIFAMILY HOUSING MORTGAGE INSURANCE Contract Rights and Obligations Rights and Duties of Mortgagee Under... the mortgage was filed for record, with the exception of such liens or other matters affecting the...
TU-AB-207-01: Introduction to Tomosynthesis
International Nuclear Information System (INIS)
Sechopoulos, I.
2015-01-01
Digital Tomosynthesis (DT) is becoming increasingly common in breast imaging and many other applications. DT is a form of computed tomography in which a limited set of projection images are acquired over a small angular range and reconstructed into a tomographic data set. The angular range and number of projections is determined both by the imaging task and equipment manufacturer. For example, in breast imaging between 9 and 25 projections are acquired over a range of 15° to 60°. It is equally valid to treat DT as the digital analog of classical tomography - for example, linear tomography. In fact, the name “tomosynthesis” is an acronym for “synthetic tomography”. DT shares many common features with classical tomography, including the radiographic appearance, dose, and image quality considerations. As such, both the science and practical physics of DT systems is a hybrid between CT and classical tomographic methods. This lecture will consist of three presentations that will provide a complete overview of DT, including a review of the fundamentals of DT, a discussion of testing methods for DT systems, and a description of the clinical applications of DT. While digital breast tomosynthesis will be emphasized, analogies will be drawn to body imaging to illustrate and compare tomosynthesis methods. Learning Objectives: To understand the fundamental principles behind tomosynthesis, including the determinants of image quality and dose. To learn how to test the performance of tomosynthesis imaging systems. To appreciate the uses of tomosynthesis in the clinic and the future applications of tomosynthesis
TU-AB-207-03: Tomosynthesis: Clinical Applications
International Nuclear Information System (INIS)
Maidment, A.
2015-01-01
Digital Tomosynthesis (DT) is becoming increasingly common in breast imaging and many other applications. DT is a form of computed tomography in which a limited set of projection images are acquired over a small angular range and reconstructed into a tomographic data set. The angular range and number of projections is determined both by the imaging task and equipment manufacturer. For example, in breast imaging between 9 and 25 projections are acquired over a range of 15° to 60°. It is equally valid to treat DT as the digital analog of classical tomography - for example, linear tomography. In fact, the name “tomosynthesis” is an acronym for “synthetic tomography”. DT shares many common features with classical tomography, including the radiographic appearance, dose, and image quality considerations. As such, both the science and practical physics of DT systems is a hybrid between CT and classical tomographic methods. This lecture will consist of three presentations that will provide a complete overview of DT, including a review of the fundamentals of DT, a discussion of testing methods for DT systems, and a description of the clinical applications of DT. While digital breast tomosynthesis will be emphasized, analogies will be drawn to body imaging to illustrate and compare tomosynthesis methods. Learning Objectives: To understand the fundamental principles behind tomosynthesis, including the determinants of image quality and dose. To learn how to test the performance of tomosynthesis imaging systems. To appreciate the uses of tomosynthesis in the clinic and the future applications of tomosynthesis
48 CFR 207.103 - Agency-head responsibilities.
2010-10-01
... agency. (ii) Written plans are not required in acquisitions for a final buy out or one-time buy. The terms “final buy out” and “one-time buy” refer to a single contract that covers all known present and future requirements. This exception does not apply to a multiyear contract or a contract with options or...
19 CFR 207.30 - Comment on information.
2010-04-01
..., reliability, or probative value of such information by reference to information elsewhere in the record, in... OF WHETHER INJURY TO DOMESTIC INDUSTRIES RESULTS FROM IMPORTS SOLD AT LESS THAN FAIR VALUE OR FROM...
77 FR 207 - National Mentoring Month, 2012
2012-01-03
... mentoring programs that pair children with positive role models, foster leadership skills, and put them on... mentor's steady and dependable support can inspire a child to strive for success and instill in them the... members and their loved ones, we are funding new mentorship opportunities for children from military...
33 CFR 135.207 - Insurance as evidence.
2010-07-01
...) MARINE POLLUTION FINANCIAL RESPONSIBILITY AND COMPENSATION OFFSHORE OIL POLLUTION COMPENSATION FUND... the Fund Administrator as evidence of financial responsibility shall be issued by an insurer that is acceptable to the Fund Administrator. Those insurers may include domestic and foreign insurance companies...
Energy Technology Data Exchange (ETDEWEB)
NONE
2016-06-15
In recent years, steady progress has been made towards the implementation of MRI in external beam radiation therapy for processes ranging from treatment simulation to in-room guidance. Novel procedures relying mostly on MR data are currently implemented in the clinic. This session will cover topics such as (a) commissioning and quality control of the MR in-room imagers and simulators specific to RT, (b) treatment planning requirements, constraints and challenges when dealing with various MR data, (c) quantification of organ motion with an emphasis on treatment delivery guidance, and (d) MR-driven strategies for adaptive RT workflows. The content of the session was chosen to address both educational and practical key aspects of MR guidance. Learning Objectives: Good understanding of MR testing recommended for in-room MR imaging as well as image data validation for RT chain (e.g. image transfer, filtering for consistency, spatial accuracy, manipulation for task specific); Familiarity with MR-based planning procedures: motivation, core workflow requirements, current status, challenges; Overview of the current methods for the quantification of organ motion; Discussion on approaches for adaptive treatment planning and delivery. T. Stanescu - License agreement with Modus Medical Devices to develop a phantom for the quantification of MR image system-related distortions.; T. Stanescu, N/A.
10 CFR 26.207 - Waivers and exceptions.
2010-01-01
... determination; and (ii) A supervisor assesses the individual face to face and determines that there is... potential for circadian degradations in alertness and performance considering the time of day for which the... controlled; (3) Licensees shall ensure that the timing of the face-to-face supervisory assessment that is...
21 CFR 207.10 - Exemptions for establishments.
2010-04-01
... regulating dispensing of prescription drugs and that do not manufacture or process drugs for sale other than... drugs at retail. The supplying of prescription drugs by these pharmacies to a practitioner licensed to... laws regulating the practices of pharmacy or medicine and that regularly engage in dispensing...
International Nuclear Information System (INIS)
2016-01-01
In recent years, steady progress has been made towards the implementation of MRI in external beam radiation therapy for processes ranging from treatment simulation to in-room guidance. Novel procedures relying mostly on MR data are currently implemented in the clinic. This session will cover topics such as (a) commissioning and quality control of the MR in-room imagers and simulators specific to RT, (b) treatment planning requirements, constraints and challenges when dealing with various MR data, (c) quantification of organ motion with an emphasis on treatment delivery guidance, and (d) MR-driven strategies for adaptive RT workflows. The content of the session was chosen to address both educational and practical key aspects of MR guidance. Learning Objectives: Good understanding of MR testing recommended for in-room MR imaging as well as image data validation for RT chain (e.g. image transfer, filtering for consistency, spatial accuracy, manipulation for task specific); Familiarity with MR-based planning procedures: motivation, core workflow requirements, current status, challenges; Overview of the current methods for the quantification of organ motion; Discussion on approaches for adaptive treatment planning and delivery. T. Stanescu - License agreement with Modus Medical Devices to develop a phantom for the quantification of MR image system-related distortions.; T. Stanescu, N/A
Iranian Dietary Patterns and Risk of Colorectal Cancer
Azizi, Hosein; Asadollahi, Khairollah; Davtalab Esmaeili, Elham; Mirzapoor, Mohammad
2015-01-01
Background: Role of diet on colorectal cancer (CRC) has been considered in terms of single foods and nutrients, but less frequently in terms of dietary patterns in Iran. The objective of this study was to determine the association between Iranian dietary patterns and CRC.Methods: This case–control study was conducted in four hospitals in Tabriz City of Iran including 414 participants aged 35–75 years:207 cases with CRC confirmed by pathology and colonoscopy findings were selected and 207 cont...
Nance-Horan syndrome: linkage analysis in a family from The Netherlands.
Bergen, A A; ten Brink, J; Schuurman, E J; Bleeker-Wagemakers, E M
1994-05-01
Linkage analysis was carried out in a Dutch family with Nance-Horan (NH) syndrome. Close linkage without recombination between NH and the Xp loci DXS207, DXS43, and DXS365 (zmax = 3.23) was observed. Multipoint linkage analysis and the analysis of recombinations in multiple informative meioses suggest the genetic order Xcen-DMD (exon 49)-DXS451-(NH, DXS207, DXS365, DXS43)-(STS, DXF30)-Xpter. These data refine the localization of the NH locus on the distal Xp.
Emanations and 'induced' radioactivity: from mystery to (mis)use
International Nuclear Information System (INIS)
Kolar, Z.I.
1999-01-01
The natural Rn isotopes were discovered within the period 1899-1902 and at that time referred to as emanations because they came out (emanated) of sources/materials containing actinium, thorium and radium, respectively. The (somewhat mysterious) emanations appeared to disintegrate into radioactive decay products which by depositing at solid surfaces gave rise to 'induced' radioactivity i.e. radioactive substances with various half-lives. Following the discovery of the emanations the volume of the research involving them and their disintegration products grew steeply. The identity of a number of these radioactive products was soon established. Radium emanation was soon used as a source of RaD ( 210 Pb) to be applied as an 'indicator' (radiotracer) for lead in a study on the solubility of lead sulphide and lead chromate. Moreover, radium and its emanation were introduced into the medical practice. Inhaling radon and drinking radon-containing water became an accepted medicinal use (or misuse?) of that gas. Shortly after the turn of the century, the healing (?) action of natural springs (spas) was attributed to their radium emanation, i.e. radon. Bathing in radioactive spring water and drinking it became very popular. Even today, bathing in radon-containing water is still a common medical treatment in Jachymov, Czech Republic. (author)
Study of Soil Decontamination Method Using Supercritical Carbon Dioxide and TBP
International Nuclear Information System (INIS)
Park, Jihye; Park, Kwangheon; Jung, Wonyoung
2014-01-01
The result of this study means that we have a possible new method for cheap and less wasteful nuclear waste decontamination. When severe accidents such as the incident at the Fukushima nuclear site occur, the soil near the power plant is contaminated with fission products or the activation metal structure of the power plant. The soil pollution form depends on the environment and soil characteristics of the contaminated areas. Thus, a- single-decontamination method is not effective for site cleanup. In addition, some soil decontamination methods are expensive and large amounts of secondary waste are generated. Therefore, we need new soil decontamination methods. In this study, instead of using a conventional solvent method that generates secondary waste, supercritical carbon dioxide was used to remove metal ions from the soil. Supercritical carbon dioxide is known for good permeation characteristics. We expect that we will reduce the cost of soil pollution management. Supercritical carbon dioxide can decontaminate soil easily, as it has the ability to penetrate even narrow gaps with very good moisture permeability. We used TBP, which is a known for extractant of actinium metal. TBP is usually used for uranium and strontium extraction. Using TBP-HNO 3 complex and supercritical carbon dioxide, we did extraction experiments for several heavy metals in contaminated soil
Study of Soil Decontamination Method Using Supercritical Carbon Dioxide and TBP
Energy Technology Data Exchange (ETDEWEB)
Park, Jihye; Park, Kwangheon; Jung, Wonyoung [Kyunghee Univ., Yongin (Korea, Republic of)
2014-05-15
The result of this study means that we have a possible new method for cheap and less wasteful nuclear waste decontamination. When severe accidents such as the incident at the Fukushima nuclear site occur, the soil near the power plant is contaminated with fission products or the activation metal structure of the power plant. The soil pollution form depends on the environment and soil characteristics of the contaminated areas. Thus, a- single-decontamination method is not effective for site cleanup. In addition, some soil decontamination methods are expensive and large amounts of secondary waste are generated. Therefore, we need new soil decontamination methods. In this study, instead of using a conventional solvent method that generates secondary waste, supercritical carbon dioxide was used to remove metal ions from the soil. Supercritical carbon dioxide is known for good permeation characteristics. We expect that we will reduce the cost of soil pollution management. Supercritical carbon dioxide can decontaminate soil easily, as it has the ability to penetrate even narrow gaps with very good moisture permeability. We used TBP, which is a known for extractant of actinium metal. TBP is usually used for uranium and strontium extraction. Using TBP-HNO{sub 3} complex and supercritical carbon dioxide, we did extraction experiments for several heavy metals in contaminated soil.
ORF Alignment: NC_005125 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available 8 GKVREQGAMDIMADLACPLPAIVIARLIGVPAADYARLGHLSDELARIFDPVISLEGYLH 207 ... GKVREQGAMDIMADLACPLPAIVIARLIGVPAADYARLGHLSDELARIFD...PVISLEGYLH Sbjct: 121 GKVREQGAMDIMADLACPLPAIVIARLIGVPAADYARLGHLSDELARIFD
Energy Technology Data Exchange (ETDEWEB)
Gorayeb, Paulo Sergio de Sousa; Moura, Candido Augusto Veloso [Para Univ., Belem, PA (Brazil). Centro de Geociencias]. E-mail: gorayebp@ufpa.br; c_moura@ufpa.br; Barros, Gisele Ribeiro de [Para Univ., Belem, PA (Brazil). Programa Institucional de Bolsas de Iniciacao Cientifica (PIBIC)]. E-mail: agbarros@amazon.com.br
2000-03-01
Single zircon Pb-evaporation ages were determined for a mafic granulite, two enderbites and a kinzigite of the Porto Nacional High-Grade Metamorphic Terrain (PNHGT) in the Goias massif. Zircons from mafic granulites and one of the enderbites of yielded average {sup 207} Pb/{sup 206} Pb ages of 2125{+-}3 Ma and 2153{+-}1 Ma, respectively, being interpreted as minimum ages of the igneous protoliths. The other enderbite, whose zircons presented round terminations, yielded an average {sup 207} Pb/{sup 206} Pb age of 2097 {+-} 2 Ma. Zircons from the kinzigite, displaying cores and rims overgrowth, presented {sup 207} Pb/{sup 206} Pb ages ranging between 2027 and 2115 Ma. However, a very homogeneous zircon crystal without overgrowth yielded age of 2100 {+-} 2 Ma, with a distinctive low Th/U value (0.02). This zircon is interpreted as a metamorphic crystal and its age probably sets the age of the granulite facies metamorphism, indicating that the PNHGT is a result of the Transamazonian thermotectonic event. (author)
International Nuclear Information System (INIS)
Gill, J.B.
1984-01-01
Twenty-eight new Pb, 20 Sr, and 9 Nd isotopic compositions are presented for 32 rocks and one galena from Fiji and the South Fiji (back-arc) Basin. The Fijian rocks range in age from 35 to 143 Nd/ 144 Nd and low 206 Pb/ 204 Pb). Nearly constant 207 Pb/ 204 Pb, and an OIB source component lying within the conventional Sr-Nd-Pb mantle array. In later calc-alkaline and shoshonitic series rocks, these same trace element and isotopic ratios are more like those of OIB. The change was not accompanied by an increase in 207 Pb/ 204 Pb or Cs/K, indeed, 207 Pb/ 204 Pb is closer to the mantle array in these later series. Consequently, the change indicates a greater contribution from OIB sources, rather than from recycled ocean crust. These interpretations require that both MORB and OIB sources coexist in the uppermost mantle above subducted lithosphere. (orig./WB)
Neutron scattering investigations of frustated magnets
Fennell, Tom
This thesis describes the experimental investigation of frustrated magnetic systems based on the pyrochlore lattice of corner-sharing tetrahedra. Ho2Ti207 and Dy2Ti207 are examples of spin ices, in which the manifold of disordered magnetic groundstates maps onto that of the proton positions in ice. Using single crystal neutron scattering to measure Bragg and diffuse scattering, the effect of applying magnetic fields along different directions in the crystal was investigated. Different schemes of degeneracy removal were observed for different directions. Long and short range order, and the coexistence of both could be observed by this technique.The field and temperature dependence of magnetic ordering was studied in Ho2Ti207 and Dy2Ti207. Ho2Ti2()7 has been more extensively investigated. The field was applied on [00l], [hh0], [hhh] and [hh2h]. Dy2Ti207 was studied with the field applied on [00l] and [hho] but more detailed information about the evolution of the scattering pattern across a large area of reciprocal space was obtained.With the field applied on [00l] both materials showed complete degeneracy removal. A long range ordered structure was formed. Any magnetic diffuse scattering vanished and was entirely replaced by strong magnetic Bragg scattering. At T =0.05 K both materials show unusual magnetization curves, with a prominent step and hysteresis. This was attributed to the extremely slow dynamics of spin ice materials at this temperature.Both materials were studied in greatest detail with the field applied on [hh0]. The coexistence of long and short range order was observed when the field was raised at T = 0.05 K. The application of a field in this direction separated the spin system into two populations. One could be ordered by the field, and one remained disordered. However, via spin-spin interactions, the field restricted the degeneracy of the disordered spin population. The neutron scattering pattern of Dy2Ti207 shows that the spin system was separated
Energy Technology Data Exchange (ETDEWEB)
Patrick, Gavin J. [School of GeoSciences, University of Edinburgh, West Mains Road, Edinburgh, EH9 3JJ, Scotland (United Kingdom); Farmer, John G. [School of GeoSciences, University of Edinburgh, West Mains Road, Edinburgh, EH9 3JJ, Scotland (United Kingdom)]. E-mail: J.G.Farmer@ed.ac.uk
2006-06-01
The validity of the use of sycamore (Acer pseudoplatanus) tree-rings for the reconstruction of atmospheric lead pollution histories was investigated. Tree cores spanning 1892-2003 were collected from several sycamores from the eastern shore of Loch Lomond, Scotland, an area with no local point sources of lead emission. The lead concentration and {sup 206}Pb/{sup 207}Pb profiles of the Loch Lomond region cores were compared with corresponding data for the {sup 21}Pb-dated loch sediment, and also with data for moss of known age from a Scottish herbarium collection. Two of the seven sycamore cores showed the same lead concentration trend as the lead flux to the loch, the rest having no similarity to either each other or the loch sediment record. Two further sycamore cores showed some similarity in their temporal {sup 206}Pb/{sup 207}Pb trends to those seen in the sediment and moss records, but only in part of their profiles, whilst the {sup 206}Pb/{sup 207}Pb ratios of the other sycamore cores remained relatively unchanged for the majority of the time covered, or exhibited an opposite trend. The {sup 206}Pb/{sup 207}Pb ratios of the tree cores were also mostly higher than those of the previously established records for any given time period. Tree cores covering 1878-2002 were also collected along transects from Wanlockhead and Tyndrum, two areas of former lead mining and smelting associated with distinct {sup 206}Pb/{sup 207}Pb ratios of 1.170 and 1.144, respectively. The Wanlockhead tree cores exhibited a generally decreasing trend in lead concentration with both time and distance from the lead mine. The characteristic {sup 206}Pb/{sup 207}Pb ratio of 1.170 was observed in samples close to the mine but a decrease in the influence of the mine-derived lead was observed in more distant samples. The tree sampled at Tyndrum showed elevated lead concentrations, which decreased with time, and a fairly constant {sup 206}Pb/{sup 207}Pb ratio of {approx} 1.15 reflecting input
Energy Technology Data Exchange (ETDEWEB)
Sucharova, Julie; Suchara, Ivan [Silva Tarouca Research Institute for Landscape and Ornamental Gardening, Kvetnove namesti 391, 252 43 Pruhonice (Czech Republic); Reimann, Clemens, E-mail: Clemens.Reimann@ngu.no [Geological Survey of Norway, P.O. Box 6315 Sluppen, 7491 Trondheim (Norway); Boyd, Rognvald [Geological Survey of Norway, P.O. Box 6315 Sluppen, 7491 Trondheim (Norway); Filzmoser, Peter [Institute for Statistics and Probability Theory, Vienna University of Technology, Wiedner Hauptstrasse 8-10, 1040 Wien (Austria); Englmaier, Peter [Faculty of Life Science, University of Vienna, Althanstr. 14, A-1090 Vienna (Austria)
2011-07-15
Highlights: > Pb-concentrations and {sup 206}Pb/{sup 207}Pb isotope ratios are provided for four different sample materials for the Czech Republic. > The paper demonstrates the local impact of a number of different contamination sources. > The data provide clear evidence that traffic emissions are no major source of Pb to the Czech environment. > The data demonstrate that the B-horizon provides no valid 'background' for Pb-concentration or the {sup 206}Pb/{sup 207}Pb isotope ratio. > Pb isotope ratios change during soil weathering and at the interface biosphere/pedosphere. - Abstract: Lead concentrations were determined in samples of soil B-horizon (N = 258), forest-floor humus (O-horizon, N = 259), grass (Avenella flexuosa, N = 251) and spruce (Picea abies, N = 253) needles (2nd year) collected at the same locations evenly spread over the territory of the Czech Republic at an average density of 1 site/300 km{sup 2}. Median Pb concentrations differ widely in the four materials: soil B-horizon: 27 mg/kg (3.3-220 mg/kg), humus: 78 mg/kg (19-1863 mg/kg), grass: 0.37 mg/kg (0.08-8 mg/kg) and spruce needles: 0.23 mg/kg (0.07-3 mg/kg). In the Pb distribution maps for humus, grass and spruce a number of well-known Pb-contamination sources are indicated by unusually high concentrations (e.g., the Pb smelter at Pribram, the metallurgical industry in the NE of the Czech Republic and along the Polish border, as well as the metallurgical industry in Upper Silesia and Europe's largest coal-fired power plant at Bogatynia, Poland). The ratio {sup 206}Pb/{sup 207}Pb was determined in all four materials. The median value of the {sup 206}Pb/{sup 207}Pb isotope ratio in the soil B-horizon is 1.184 (variation: 1.145-1.337). In both humus and grass the median value for the {sup 206}Pb/{sup 207}Pb isotope ratio is 1.162 (variation: 1.130-1.182), in spruce needles the median ratio is 1.159 (variation: 1.116-1.186). In humus, grass and spruce needles the known contamination
Liu, Shen; Feng, Caixia; Santosh, M.; Feng, Guangying; Coulson, Ian M.; Xu, Mengjing; Guo, Zhuang; Guo, Xiaolei; Peng, Hao; Feng, Qiang
2018-02-01
Evolution of the lithospheric mantle beneath the North China Craton (NCC) from its Precambrian cratonic architecture until Paleozoic, and the transformation to an oceanic realm during Mesozoic, with implications on the destruction of cratonic root have attracted global attention. Here we present geochemical and isotopic data on a suite of newly identified Mesozoic mafic dyke swarms from the Longwangmiao, Weijiazhuang, Mengjiazhuang, Jiayou, Huangmi, and Xiahonghe areas (Qianhuai Block) along the eastern NCC with an attempt to gain further insights on the lithospheric evolution of the region. The Longwangmiao dykes are alkaline with LILE (Ba and K)- and LREE-enrichment ((La/Yb) N > 4.3) and EM1-like Sr-Nd-Pb-Hf isotopic signature ((87Sr/86Sr) i > 0.706; ε Nd (t) 16.6, (207Pb/204Pb) i > 15.4, (208Pb/204Pb) i > 36.8, ε Hf (t) 3.7), and display similar EM1-like isotopic features ((87Sr/86Sr) i > 0.706; ε Nd (t) 16.7, (207Pb/204Pb) i > 15.4, (208Pb/204Pb) i > 36.9, ε Hf (t) 2.4) and EM1-like isotopic features((87Sr/86Sr) i > 0.706; ε Nd (t) 16.7, (207Pb/204Pb) i > 15.4, (208Pb/204Pb) i > 36.9, ε Hf (t) 3.7) and EM1-like Sr-Nd-Pb-Hf isotopic features ((87Sr/86Sr) i > 0.706; ε Nd(t) 16.7, (207Pb/204Pb) i > 15.4, (208Pb/204Pb) i > 36.9, ε Hf (t) 9.3) and EM1-like isotopic composition ((87Sr/86Sr) i > 0.705; ε Nd (t) 16.9, (207Pb/204Pb) i > 15.5, (208Pb/204Pb) i > 36.9, ε Hf (t) 0.705; ε Nd (t) 16.9, (207Pb/204Pb) i > 15.5, (208Pb/204Pb) i > 36.9, ε Hf (t) < -8.6). Our data from the various mafic dyke suites suggest that the magmas were derived from EM1-like lithospheric mantle, corresponding to lithospheric mantle modified by the previously foundered lower crust beneath the eastern NCC. Our results suggest contrasting lithospheric evolution from Triassic (212 Ma) to Cretaceous (123 Ma) beneath the NCC. These mafic dykes mark an important phase of lithospheric thinning in the eastern North China Craton.
Francová, Anna; Chrastný, Vladislav; Šillerová, Hana; Kocourková, Jana; Komárek, Michael
2017-08-29
This study is a continuation of our preceding research identifying suitable environmental samples for the tracing of atmospheric pollution in industrial areas. Three additional types of environmental samples were used to characterise contamination sources in the industrial area of Ostrava city, Czech Republic. The region is known for its extensive metallurgical and mining activities. Fingerprinting of stable Pb isotopes was applied to distinguish individual sources of anthropogenic Pb. A wide range of 206 Pb/ 207 Pb ratios was observed in the investigated samples: 206 Pb/ 207 Pb = 1.168-1.198 in mosses; 206 Pb/ 207 Pb = 1.167-1.215 in soils and 206 Pb/ 207 Pb = 1.158-1.184 in tree cores. Black and brown coal combustion, as well as metallurgical activities, is the two main sources of pollution in the area. Fossil fuel burning in industry and households seems to be a stronger source of Pb emissions than from the metallurgical industry. Concentration analyses of tree rings showed that a significant increase in As concentrations occurred between 1999 and 2016 (from 0.38 mg kg -1 to 13.8 mg kg -1 ). This shift corresponds to the use of brown coal from Bílina, Czech Republic, with an increased As concentration. The burning of low-quality fuels in households remains a problem in the area, as small ground sources have a greater influence on the air quality than do industrial sources.
Klaminder, Jonatan; Bindler, Richard; Laudon, Hjalmar; Bishop, Kevin; Emteryd, Ove; Renberg, Ingemar
2006-08-01
It is not well-known how the accumulated pool of atmospheric lead pollution in the boreal forest soil will affect the groundwater and surface water chemistry in the future as this lead migrates through the soil profile. This study uses stable lead isotopes (206Pb/207Pb and 208Pb/ 207Pb ratios) to trace the transport of atmospheric lead pollution within the soil of a small catchment and predict future lead level changes in a stream draining the catchment. Low 206Pb/207Pb and 208Pb/207Pb ratios for the lead in the soil water (1.16 +/- 0.02; 2.43 +/- 0.03) and streamwater (1.18 +/- 0.03; 2.42 +/- 0.03) in comparison to that of the mineral soil (>1.4; >2.5) suggest that atmospheric pollution contributes by about 90% (65-100%) to the lead pool found in these matrixes. Calculated transport rates of atmospheric lead along a soil transect indicate that the mean residence time of lead in organic and mineral soil layers is at a centennial to millennial time scale. A maximum release of the present pool of lead pollution in the soil to the stream is predicted to occur within 200-800 years. Even though the uncertainty of the prediction is large, it emphasizes the magnitude of the time lag between the accumulation of atmospheric lead pollution in soils and the subsequent response in streamwater quality.
Lead contamination in cocoa and cocoa products: isotopic evidence of global contamination.
Rankin, Charley W; Nriagu, Jerome O; Aggarwal, Jugdeep K; Arowolo, Toyin A; Adebayo, Kola; Flegal, A Russell
2005-10-01
In this article we present lead concentrations and isotopic compositions from analyses of cocoa beans, their shells, and soils from six Nigerian cocoa farms, and analyses of manufactured cocoa and chocolate products. The average lead concentration of cocoa beans was cocoa and chocolate products were as high as 230 and 70 ng/g, respectively, which are consistent with market-basket surveys that have repeatedly listed lead concentrations in chocolate products among the highest reported for all foods. One source of contamination of the finished products is tentatively attributed to atmospheric emissions of leaded gasoline, which is still being used in Nigeria. Because of the high capacity of cocoa bean shells to adsorb lead, contamination from leaded gasoline emissions may occur during the fermentation and sun-drying of unshelled beans at cocoa farms. This mechanism is supported by similarities in lead isotopic compositions of cocoa bean shells from the different farms (206Pb/207Pb = 1.1548-1.1581; 208Pb/207Pb = 2.4344-2.4394) with those of finished cocoa products (206Pb/207Pb = 1.1475-1.1977; 208Pb/207Pb = 2.4234-2.4673). However, the much higher lead concentrations and larger variability in lead isotopic composition of finished cocoa products, which falls within the global range of industrial lead aerosols, indicate that most contamination occurs during shipping and/or processing of the cocoa beans and the manufacture of cocoa and chocolate products.
ORF Alignment: NC_006582 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available MRLCSARYSGYLPELDHIDVFEHIRLGDAGDVD 60 ... Query: 148 DNLPHHEGDPFARCSPFKRLYELEGVRNESIVHAGIHGPRNKPESGRNAKEAGAVTITI...N 207 ... DNLPHHEGDPFARCSPFKRLYELEGVRNESIVHAGIHGPRNKPESGRNAKEAGAVTITIN Sbjct: 121 DNLPHHEGDPFARCSPFKR
ORF Alignment: NC_003063 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available = 70 ... Query: 207 LGRLRSTIEAEREFTANSAHELRTPIAGALAQAQRLRVDIPPELAPRVENIEKSLQHLAH 266 ... LGRLRSTIEAEREFTANSAHEL...RTPIAGALAQAQRLRVDIPPELAPRVENIEKSLQHLAH Sbjct: 1 ... LGRLRSTIEAEREFTANSAHELRTPIAGALAQAQRLRVDIPPELAPRVENIEKSLQHLAH 60 ...
International Nuclear Information System (INIS)
Allsopp, H.L.; Welke, H.J.; Armstrong, R.A.; Clough, W.; Evans, I.B.
1984-01-01
Preliminary investigations have been carried out, using the uranium-lead isotopic method, on the uranium mineralisation that occurs within the Karoo sediments. Two occurences were studied, namely the lower Beaufort sediments (Adelaide Subgroup) in the Beaufort West area and the Molteno Formation sediments in the Ficksburg area. The objective were to determine the age of the mineralisation and to study the mode of formation of the ores. The pattern of U-Pb apparent ages for all the Karoo samples is 207 Pb/ 206 Pb age >> 207 Pb* 235 U age > 206 Pb* 238 U age
International Nuclear Information System (INIS)
Reimann, C.; Fabian, K.; Flem, B.; Schilling, J.; Roberts, D.; Englmaier, P.
2016-01-01
Soil O and C horizon samples (N = 752) were collected at a sample density of 1 site/36 km"2 in Nord-Trøndelag and parts of Sør-Trøndelag (c. 25,000 km"2), and analysed for Pb and three of the four naturally occurring Pb isotopes ("2"0"6Pb, "2"0"7Pb and "2"0"8Pb) in a HNO_3/HCl extraction. Soil O and C horizons are decoupled in terms of both Pb concentrations and Pb isotope ratios. In the soil C horizon the Grong-Olden Culmination, a continuous exposure of the Precambrian crystalline basement across the general grain of the Caledonian orogen, is marked by a distinct "2"0"6Pb/"2"0"7Pb isotope ratio anomaly. No clear regional or even local patterns are detected when mapping the Pb isotope ratios in the soil O horizon samples. Variation in the isotope ratios declines significantly from the soil C to the O horizon. On average, Pb concentrations in the O horizon are four times higher and the "2"0"6Pb/"2"0"7Pb isotope ratio is shifted towards a median of 1.15 in comparison to 1.27 in the C horizon. It is demonstrated that natural processes like weathering in combination with plant uptake need to be taken into account in order to distinguish anthropogenic input from natural influences on Pb concentration and the "2"0"6Pb/"2"0"7Pb isotope ratio in the soil O horizon. - Highlights: • Lead concentrations are on average higher by a factor of 4 in the soil O than in the C horizon. • The "2"0"6Pb/"2"0"7Pb isotope ratio is considerably lower in the soil O than in the C horizon. • The observed shifts are in conflict with exclusive anthropogenic input of Pb. • The hypothesis of natural Pb-isotope invariance can not be hold.
Boyle, E. A.; Chen, M.; Zurbrick, C.; Carrasco, G. G.
2015-12-01
Observations from annually-banded corals and seawater samples show that marine lead (Pb) in the coastal waters of Singapore has an isotopic composition that does not match that of the anthropogenic aerosols in this region, unlike what is seen in most parts of the open ocean. The 206Pb/207Pb composition of Singaporean marine Pb is 1.18-1.20 whereas the local aerosols are 1.14-1.16. In order to explore this discrepancy further, we collected a large volume water from the Johor River estuary (flowing from Malaysia to the northern border of Singapore), added a distinct isotope spike (NBS981, 206Pb/207Pb =1.093) to an unfiltered sample, and followed the dissolved isotope composition of the mixture during the following two months. The initial dissolved Pb concentration was 18.3 pmol/kg with 206Pb/207Pb of 1.200. "Total dissolvable" Pb released after acidification of the in the unfiltered sample was 373 pmol/kg with 206Pb/207Pb of 1.199, indicating that there is a large particulate Pb reservoir with an isotopic composition comparable to regional crustal natural Pb. The isotope spike should have brought the dissolved 206Pb/207Pb to 1.162, but less than a day after isotope spiking, the dissolved Pb had risen to 1.181 and continued a slow increase to 1.197 over the next two months. This experiment demonstrates that Johor estuary particulate matter contains a large reservoir of exchangeable Pb that will modify the isotopic composition of deposited aeolian aerosol anthropogenic Pb. We have modeled the evolution of Pb and Pb isotopes in this experiment with a single Kd -type model that assumes that there are two or three different Pb reservoirs with different exchange time constants. This observation has implications for isotope equilibrium between high Pb/210Pb continental particles and low Pb/210Pb ocean waters - what is merely isotope equilibration may appear to be 210Pb scavenging.
Recurrent respiratory papillomatosis: HPV genotypes and risk of high-grade laryngeal neoplasia.
Directory of Open Access Journals (Sweden)
Turid Omland
Full Text Available Patients with recurrent respiratory papillomatosis (RRP in Norway treated between 1987 and 2009 were recruited to this cohort study. They were followed from disease onset and data recorded until January 2012. Here, we describe the distribution of human papillomavirus (HPV genotypes, the prevalence of multiple HPV infections, and the risk of high-grade laryngeal neoplasia and respiratory tract invasive carcinoma in a large cohort of patients with RRP. We also examined whether HPV genotype, gender, age or clinical course are risk factors for this development. Clinical records and histological specimens were reviewed. Using formalin-fixed paraffin-embedded biopsies, HPV genotyping were performed by quantitative polymerase chain reaction assays identifying 15 HPV types. HPV-negative specimens were analyzed by metagenomic sequencing. Paraffin blocks were available in 224/238 patients. The DNA quality was approved in 221/224 cases. HPV DNA was detected in 207/221 patients and all were HPV 6 or HPV 11 positive, comprising HPV 6 in 133/207, HPV 11 in 40/207 cases and HPV 6/11 in 15/207 cases. Co-infection with one or two high-risk HPV types together with HPV 6 or HPV 11 was present in 19/207 patients. Metagenomic sequencing of 14 HPV-negative specimens revealed HPV 8 in one case. In total, 39/221 patients developed high-grade laryngeal neoplasia. 8/221 patients developed carcinoma of the respiratory tract (six patients with laryngeal carcinoma and two patients with lung carcinoma. High-grade laryngeal neoplasias were found more frequently in HPV-negative versus HPV-positive patients, (RR = 2.35, 95% CI 1.1, 4.99, as well as respiratory tract carcinomas (RR = 48, 95% CI 10.72, 214.91. In summary, the majority of RRP were associated with HPV 6 and/or 11. HPV-negative RRP biopsies occurred more frequently in adult-onset patients, and were associated with an increased risk of laryngeal neoplasia and carcinoma in the respiratory tract.
International Nuclear Information System (INIS)
Zolotarev, K.I.
2010-11-01
Evaluations of cross sections and their associated covariance matrices have been carried out for five dosimetry reactions: excitation functions were re-evaluated for the 89 Y(n,2n) 88 Y, 93 Nb(n,2n) 92 mNb and 169 Tm(n,2n) 168 Tm reactions over the neutron energy range from threshold up to 40 MeV; excitation functions were re-evaluated for the 59 Co(n,3n) 57 Co and 209 Bi(n,3n) 207 Bi reactions over the neutron energy range from threshold to 85 and 45 MeV, respectively. Uncertainties in the cross sections for all of those reactions were also derived in the form of relative covariance matrices. Benchmark calculations performed for 235 U thermal fission and 252 Cf spontaneous fission neutron spectra show that the integral cross sections calculated from the newly evaluated excitation functions exhibit improved agreement with related experimental data when compared with the equivalent data from the IRDF-2002 library. (author)
Willson, Robert F.; Lang, Kenneth R.; Klein, Karl-Ludwig; Kerdraon, Alain; Trottet, Gerard
1990-01-01
Collaborative solar investigations by Tufts University and the Observatoire de Paris have resulted in simultaneous radio observations with the Very Large Array (VLA) and the Nancay Radioheliograph (NR), comparisons of this radio data with X-ray observations, and theoretical interpretations of the dominant radiation mechanisms during a weak impulsive solar flare observed on May 28, 1988. The VLA has mapped the flaring structures at time intervals of 3.3 s, showing that the preflash and flash-phase components of the impulsive emission originate in spatially separated sources. The 20.7 cm preflash source is ascribed to thermal gyroresonance emission from coronal loops with typical magnetic field strengths of up to 270 G; this emission is associated with heating and exhibits no detectable hard X-ray radiation above 30 keV. The flash-phase 20.7 cm source and the hard X-ray emission are attributed to nonthermal electrons in the coronal and chromospheric portions of a magnetic loop. The combination of imaging observations at 20.7 and 91.6 cm excludes emission from a confined hot plasma during the flash phase.
International Nuclear Information System (INIS)
Watmough, Shaun A.; Hutchinson, Thomas C.
2004-01-01
Lead concentrations and Pb isotope ratios were measured in the forest floor, mineral soil and vegetation at a white pine and a sugar maple stand in a woodland in south central Ontario. Lead concentrations decreased and 206 Pb/ 207 Pb ratios increased with mineral soil depth reflecting the mixing of pollution and natural Pb sources. Lead concentrations and 206 Pb/ 207 Pb ratios at 20-30 cm depth were ∼6-7 mg/kg and 1.31-1.32, respectively. Assuming an integrated 206 Pb/ 207 Pb ratio in deposition over time of 1.18, estimated from lichen measurements and published data for the region, approximately 65% of Pb in the surface (0-1 cm) mineral soil is from anthropogenic sources. Approximately 90% of pollution Pb is found in the 0-10 cm soil layer (Ah) and less than 3% of the pollution Pb is present in the forest biomass and mull-type forest floor combined. Despite low Pb concentrations in vegetation ( 2 , respectively. - The distribution of pollution lead was determined at a woodland through the use of stable leads isotopes
Calculation of the atomic electric dipole moment of Pb2+ induced by nuclear Schiff moment
Ramachandran, S. M.; Latha, K. V. P.; Meenakshisundaram, N.
2017-07-01
We report the atomic electric dipole moment induced by the P, T violating interactions in the nuclear/sub-nuclear level, for 207Pb2+ and 207Pb, owing to the recent interest in the ferroelectric crystal PbTiO3 as one of the candidates for investigating macroscopic P, T-odd effects. In this paper, we calculate the atomic electric dipole moments of 207Pb and Pb2+, parametrized in terms of the P, T-odd coupling parameter, the nuclear Schiff moment (NSM), S, in the frame-work of the coupled-perturbed Hartree-Fock theory. We estimate the Schiff moment of Pb2+ using the experimental result of a system, which is electronically similar to the Pb2+ ion. We present the dominant contributions of the electric dipole moment (EDM) matrix elements and the important correlation effects contributing to the atomic EDM of Pb2+. Our results provide the first ever calculated EDM of the Pb2+ ion, and an estimate of its NSM from which the P, T-odd energy shift in a PbTiO3 crystal can be evaluated.
International Nuclear Information System (INIS)
Bacon, Jeffrey R.; Farmer, John G.; Dunn, Sarah M.; Graham, Margaret C.; Vinogradoff, Susan I.
2006-01-01
Sequential extraction (modified BCR procedure) combined with isotope analysis has been investigated as a tool for assessing mobilisation of lead into streams at an upland catchment in NE Scotland. The maximum lead concentrations (up to 110 mg kg -1 in air-dried soil) occurred not at the surface but at about 10 cm depth. The lowest 206 Pb/ 207 Pb ratios in any profile occurred, with one exception, at 2.5-5 cm depth. In the one exception, closest to the only road in the area, significantly lower 206 Pb/ 207 Pb ratios in the surface soil together with much increased chloride concentrations (in comparison to other surface waters) indicated the possible mobilisation of roadside lead and transfer to the stream. The 206 Pb/ 207 Pb ratios in extractable fractions tended at depth towards the ratio measured in the residual phase but the ratios in the oxidizable fraction increased to a value higher than that of the residual phase. - Sequential extraction combined with isotope analysis was used as a tool to assess mobilisation of lead into streams
ORF Alignment: NC_005785 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available 60 ... Query: 168 AESARVTLHVDCLRGTNDHHRSESAFKAVAVALGDALTRT 207 ... AESARVTLHVDCLRGTNDHHRSESAFKAVAVALGDALTRT Sbjct: 121 AESARVTLHVDCLRGTNDHHRSESAFKAVAVALGDALTRT 160 ...HSGWSLIVECVGDLHIDDHHTTEDCGLALGQALREA Sbjct: 1 ... SSSQVINVQTGVGFLDHMIHALAKHSGWSLIVECVGDLHIDDHHTTEDCGLALGQALREA
1976-08-01
of the motoring public. "The design should balance and optimize characteristics serving environmental, safety, and conservation goals " (McDonald...59 9,738 165 Datsun 610 58 4,766 82 Buick Century 55 5,558 101 Mazda RX4 54 5,207 96 Volkswagen Rabbit 54 4,353 81 AMC Matador 53 4,837 91 Toyota...53 Ford Maverick 8 92 4,229 46 ANMC Hornet 6 94 4,127 44 A’X Pacer 95 4,569 48 Audi Fox 96 5,678 59 Mazda RX4 96 5,207 54 Toyota Corona MIK II 98
ORF Alignment: NC_001136 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available iae] ... Length = 207 ... Query: 2 ... FTPIDQAIEHFKQNKFVIVMDDAGRENEGDLICAAENVSTEQMAFLVRHSSGYVCAPMTN 61 ... ... ... FTPIDQAIEHFKQNKFVIVMDDAGRENEGDLICAAENVSTEQMAFLVRHSSGYVCAPMTN Sbjct: 1 ... FTPIDQAIEHFKQNKFVIVMDDAGRENE...GDLICAAENVSTEQMAFLVRHSSGYVCAPMTN 60 ... Query: 122 TPKSFLKPGHICPLRAADGGVLQRRGHTEAGVD
48 CFR 47.207-1 - Qualifications of offerors.
2010-10-01
... clause at 52.247-2, Permits, Authorities, or Franchises, when regulated transportation is involved. The... that it is in the Government's interest not to apply the requirement for holding or obtaining State... interest not to apply the requirements for holding or obtaining State authority to operate within the State...
Lifescience Database Archive (English)
Full Text Available GYSLNNNFYISETPFSLASTTHIDKTFISTNKE AIIVDTIKKAEDGTSFVVRVYESFGGATTFNFTSSILPIPFKSIIECNGLEEVNQSSKSY KFNDTIKINPFEIKTFRFISN*klkiklinky...DTIKINPFEIKTFRFISN*klkiklinkyknkf Translated Amino Acid sequence (All Frames) Frame A: ---*hklgfrki*scrt*mgr...ASTTHIDKTFISTNKE AIIVDTIKKAEDGTSFVVRVYESFGGATTFNFTSSILPIPFKSIIECNGLEEVNQSSKSY KFN
7 CFR 400.207 - Representative licensing and certification.
2010-01-01
... insurance; (5) Liability insurance; or (6) Fire insurance and allied lines. The Contractor must submit... INSURANCE CORPORATION, DEPARTMENT OF AGRICULTURE GENERAL ADMINISTRATIVE REGULATIONS Agency Sales and Service... policies are issued, which license authorizes the sales of insurance in any one or more of the following...
MO-AB-207-04: ACR Update in Mammography
International Nuclear Information System (INIS)
Berns, E.
2015-01-01
A goal of an imaging accreditation program is to ensure adequate image quality, verify appropriate staff qualifications, and to assure patient and personnel safety. Currently, more than 35,000 facilities in 10 modalities have been accredited by the American College of Radiology (ACR), making the ACR program one of the most prolific accreditation options in the U.S. In addition, ACR is one of the accepted accreditations required by some state laws, CMS/MIPPA insurance and others. Familiarity with the ACR accreditation process is therefore essential to clinical diagnostic medical physicists. Maintaining sufficient knowledge of the ACR program must include keeping up-to-date as the various modality requirements are refined to better serve the goals of the program and to accommodate newer technologies and practices. This session consists of presentations from authorities in four ACR accreditation modality programs, including magnetic resonance imaging, computed tomography, nuclear medicine, and mammography. Each speaker will discuss the general components of the modality program and address any recent changes to the requirements. Learning Objectives: To understand the requirements of the ACR MR Accreditation program. The discussion will include accreditation of whole-body general purpose magnets, dedicated extremity systems well as breast MRI accreditation. Anticipated updates to the ACR MRI Quality Control Manual will also be reviewed. To understand the requirements of the ACR CT accreditation program, including updates to the QC manual as well as updates through the FAQ process. To understand the requirements of the ACR nuclear medicine accreditation program, and the role of the physicist in annual equipment surveys and the set up and supervision of the routine QC program. To understand the current ACR MAP Accreditation requirement and present the concepts and structure of the forthcoming ACR Digital Mammography QC Manual and Program
MO-AB-207-02: ACR Update in MR
International Nuclear Information System (INIS)
Price, R.
2015-01-01
A goal of an imaging accreditation program is to ensure adequate image quality, verify appropriate staff qualifications, and to assure patient and personnel safety. Currently, more than 35,000 facilities in 10 modalities have been accredited by the American College of Radiology (ACR), making the ACR program one of the most prolific accreditation options in the U.S. In addition, ACR is one of the accepted accreditations required by some state laws, CMS/MIPPA insurance and others. Familiarity with the ACR accreditation process is therefore essential to clinical diagnostic medical physicists. Maintaining sufficient knowledge of the ACR program must include keeping up-to-date as the various modality requirements are refined to better serve the goals of the program and to accommodate newer technologies and practices. This session consists of presentations from authorities in four ACR accreditation modality programs, including magnetic resonance imaging, computed tomography, nuclear medicine, and mammography. Each speaker will discuss the general components of the modality program and address any recent changes to the requirements. Learning Objectives: To understand the requirements of the ACR MR Accreditation program. The discussion will include accreditation of whole-body general purpose magnets, dedicated extremity systems well as breast MRI accreditation. Anticipated updates to the ACR MRI Quality Control Manual will also be reviewed. To understand the requirements of the ACR CT accreditation program, including updates to the QC manual as well as updates through the FAQ process. To understand the requirements of the ACR nuclear medicine accreditation program, and the role of the physicist in annual equipment surveys and the set up and supervision of the routine QC program. To understand the current ACR MAP Accreditation requirement and present the concepts and structure of the forthcoming ACR Digital Mammography QC Manual and Program
19 CFR 207.15 - Written briefs and conference.
2010-04-01
... INVESTIGATIONS OF WHETHER INJURY TO DOMESTIC INDUSTRIES RESULTS FROM IMPORTS SOLD AT LESS THAN FAIR VALUE OR FROM... in connection with its presentation a party may file witness testimony with the Secretary no later...
RCT: Module 2.07, Respiratory Protection, Course 8773
Energy Technology Data Exchange (ETDEWEB)
Hillmer, Kurt T. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)
2017-08-10
Internal dosimetry controls require the use of engineering controls to prevent the internal deposition of radioactive and nonradiological contaminants. However, when engineering and administrative controls are not available or feasible, respiratory protection may be necessary. The radiation control technician (RCT) should know and apply the considerations used in determining the respiratory protection equipment that is most appropriate for the job. The inappropriate use of or the use of the wrong respiratory protection equipment may result in undesirable health effects. This course will prepare the student with the skills necessary for RCT qualification by passing quizzes, tests, and the RCT Comprehensive Phase 1, Unit 2 Examination (TEST 27566) and will provide in-the-field skills.
29 CFR 1952.207 - Changes to approved plans.
2010-07-01
... 1910.142) in agriculture (except for agricultural temporary labor camps associated with egg, poultry or red meat production, or the post-harvest processing of agricultural or horticultural commodities). The... Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH ADMINISTRATION, DEPARTMENT OF LABOR...
MO-AB-207-04: ACR Update in Mammography
Energy Technology Data Exchange (ETDEWEB)
Berns, E. [University of Colorado Health Science (United States)
2015-06-15
A goal of an imaging accreditation program is to ensure adequate image quality, verify appropriate staff qualifications, and to assure patient and personnel safety. Currently, more than 35,000 facilities in 10 modalities have been accredited by the American College of Radiology (ACR), making the ACR program one of the most prolific accreditation options in the U.S. In addition, ACR is one of the accepted accreditations required by some state laws, CMS/MIPPA insurance and others. Familiarity with the ACR accreditation process is therefore essential to clinical diagnostic medical physicists. Maintaining sufficient knowledge of the ACR program must include keeping up-to-date as the various modality requirements are refined to better serve the goals of the program and to accommodate newer technologies and practices. This session consists of presentations from authorities in four ACR accreditation modality programs, including magnetic resonance imaging, computed tomography, nuclear medicine, and mammography. Each speaker will discuss the general components of the modality program and address any recent changes to the requirements. Learning Objectives: To understand the requirements of the ACR MR Accreditation program. The discussion will include accreditation of whole-body general purpose magnets, dedicated extremity systems well as breast MRI accreditation. Anticipated updates to the ACR MRI Quality Control Manual will also be reviewed. To understand the requirements of the ACR CT accreditation program, including updates to the QC manual as well as updates through the FAQ process. To understand the requirements of the ACR nuclear medicine accreditation program, and the role of the physicist in annual equipment surveys and the set up and supervision of the routine QC program. To understand the current ACR MAP Accreditation requirement and present the concepts and structure of the forthcoming ACR Digital Mammography QC Manual and Program.
MO-AB-207-02: ACR Update in MR
Energy Technology Data Exchange (ETDEWEB)
Price, R. [Vanderbilt Medical Center (United States)
2015-06-15
A goal of an imaging accreditation program is to ensure adequate image quality, verify appropriate staff qualifications, and to assure patient and personnel safety. Currently, more than 35,000 facilities in 10 modalities have been accredited by the American College of Radiology (ACR), making the ACR program one of the most prolific accreditation options in the U.S. In addition, ACR is one of the accepted accreditations required by some state laws, CMS/MIPPA insurance and others. Familiarity with the ACR accreditation process is therefore essential to clinical diagnostic medical physicists. Maintaining sufficient knowledge of the ACR program must include keeping up-to-date as the various modality requirements are refined to better serve the goals of the program and to accommodate newer technologies and practices. This session consists of presentations from authorities in four ACR accreditation modality programs, including magnetic resonance imaging, computed tomography, nuclear medicine, and mammography. Each speaker will discuss the general components of the modality program and address any recent changes to the requirements. Learning Objectives: To understand the requirements of the ACR MR Accreditation program. The discussion will include accreditation of whole-body general purpose magnets, dedicated extremity systems well as breast MRI accreditation. Anticipated updates to the ACR MRI Quality Control Manual will also be reviewed. To understand the requirements of the ACR CT accreditation program, including updates to the QC manual as well as updates through the FAQ process. To understand the requirements of the ACR nuclear medicine accreditation program, and the role of the physicist in annual equipment surveys and the set up and supervision of the routine QC program. To understand the current ACR MAP Accreditation requirement and present the concepts and structure of the forthcoming ACR Digital Mammography QC Manual and Program.
MO-AB-207-01: ACR Update in CT
Energy Technology Data Exchange (ETDEWEB)
McNitt-Gray, M. [UCLA School of Medicine (United States)
2015-06-15
A goal of an imaging accreditation program is to ensure adequate image quality, verify appropriate staff qualifications, and to assure patient and personnel safety. Currently, more than 35,000 facilities in 10 modalities have been accredited by the American College of Radiology (ACR), making the ACR program one of the most prolific accreditation options in the U.S. In addition, ACR is one of the accepted accreditations required by some state laws, CMS/MIPPA insurance and others. Familiarity with the ACR accreditation process is therefore essential to clinical diagnostic medical physicists. Maintaining sufficient knowledge of the ACR program must include keeping up-to-date as the various modality requirements are refined to better serve the goals of the program and to accommodate newer technologies and practices. This session consists of presentations from authorities in four ACR accreditation modality programs, including magnetic resonance imaging, computed tomography, nuclear medicine, and mammography. Each speaker will discuss the general components of the modality program and address any recent changes to the requirements. Learning Objectives: To understand the requirements of the ACR MR Accreditation program. The discussion will include accreditation of whole-body general purpose magnets, dedicated extremity systems well as breast MRI accreditation. Anticipated updates to the ACR MRI Quality Control Manual will also be reviewed. To understand the requirements of the ACR CT accreditation program, including updates to the QC manual as well as updates through the FAQ process. To understand the requirements of the ACR nuclear medicine accreditation program, and the role of the physicist in annual equipment surveys and the set up and supervision of the routine QC program. To understand the current ACR MAP Accreditation requirement and present the concepts and structure of the forthcoming ACR Digital Mammography QC Manual and Program.
TU-EF-207-00: Advances in Breast Imaging
Energy Technology Data Exchange (ETDEWEB)
NONE
2015-06-15
Breast imaging technology is advancing on several fronts. In digital mammography, the major technological trend has been on optimization of approaches for performing combined mammography and tomosynthesis using the same system. In parallel, photon-counting slot-scan mammography is now in clinical use and more efforts are directed towards further development of this approach for spectral imaging. Spectral imaging refers to simultaneous acquisition of two or more energy-windowed images. Depending on the detector and associated electronics, there are a number of ways this can be accomplished. Spectral mammography using photon-counting detectors can suppress electronic noise and importantly, it enables decomposition of the image into various material compositions of interest facilitating quantitative imaging. Spectral imaging can be particularly important in intravenously injected contrast mammography and eventually tomosynthesis. The various approaches and applications of spectral mammography are discussed. Digital breast tomosynthesis relies on the mechanical movement of the x-ray tube to acquire a number of projections in a predefined arc, typically from 9 to 25 projections over a scan angle of +/−7.5 to 25 degrees depending on the particular system. The mechanical x-ray tube motion requires relatively long acquisition time, typically between 3.7 to 25 seconds depending on the system. Moreover, mechanical scanning may have an effect on the spatial resolution due to internal x-ray filament or external mechanical vibrations. New x-ray source arrays have been developed and they are aimed at replacing the scanned x-ray tube for improved acquisition time and potentially for higher spatial resolution. The potential advantages and challenges of this approach are described. Combination of digital mammography and tomosynthesis in a single system places increased demands on certain functional aspects of the detector and overall performance, particularly in the tomosynthesis mode due to lower photon fluence per projection. This may require fast-frame acquisition and symmetric or asymmetric pixel binning in some systems. Recent studies investigated the performance of increased conversion layer thickness for contrast-enhanced imaging of the breast in dual-energy acquisition mode. In other direct conversion detectors operating in the avalanche mode, sensitivities close to the single photon response are also explored for mammography and breast tomosynthesis. The potential advantages and challenges of this approach are described. Dedicated breast CT brings x-ray imaging of the breast to true tomographic 3D imaging. It can eliminate the tissue superposition problem and does not require physical compression of the breast. Using cone beam geometry and a flat-panel detector, several hundred projections are acquired and reconstructed to near isotropic voxels. Multiplanar reconstruction facilitates viewing the breast volume in any desired orientation. Ongoing clinical studies, the current state-of-the art, and research to advance the technology are described. Learning Objectives: To understand the ongoing developments in x-ray imaging of the breast To understand the approaches and applications of spectral mammography To understand the potential advantages of distributed x-ray source arrays for digital breast tomosynthesis To understand the ongoing developments in detector technology for digital mammography and breast tomosynthesis To understand the current state-of-the-art for dedicated cone-beam breast CT and research to advance the technology. Research collaboration with Koning Corporation.
33 CFR 207.800 - Collection of navigation statistics.
2010-07-01
... of time and/or for a specified remuneration from the lessee. Commercial movements on an affreightment... remuneration for the movement of vessels or for the transportation of goods or passengers on the navigable... to the Director of the Water Resources Support Center, Casey Building, Fort Belvoir, Virginia 22060...
19 CFR 207.68 - Final comments on information.
2010-04-01
... comment may address the accuracy, reliability, or probative value of such information by reference to... INVESTIGATIONS OF WHETHER INJURY TO DOMESTIC INDUSTRIES RESULTS FROM IMPORTS SOLD AT LESS THAN FAIR VALUE OR FROM...
24 CFR 941.207 - Displacement, relocation, and acquisition.
2010-04-01
..., the PHA shall issue a general information notice (described in 49 CFR 24.203(a)) to each occupant of... section), the PHA shall issue an appropriate written notice to each person occupying the property. Those... demonstrate compliance with this section, including data indicating the race, ethnic, gender and disability...
WE-H-207B-01: Commissioning and QC
Energy Technology Data Exchange (ETDEWEB)
Stanescu, T. [Princess Margaret Cancer Centre, Toronto, ON (Canada)
2016-06-15
In recent years, steady progress has been made towards the implementation of MRI in external beam radiation therapy for processes ranging from treatment simulation to in-room guidance. Novel procedures relying mostly on MR data are currently implemented in the clinic. This session will cover topics such as (a) commissioning and quality control of the MR in-room imagers and simulators specific to RT, (b) treatment planning requirements, constraints and challenges when dealing with various MR data, (c) quantification of organ motion with an emphasis on treatment delivery guidance, and (d) MR-driven strategies for adaptive RT workflows. The content of the session was chosen to address both educational and practical key aspects of MR guidance. Learning Objectives: Good understanding of MR testing recommended for in-room MR imaging as well as image data validation for RT chain (e.g. image transfer, filtering for consistency, spatial accuracy, manipulation for task specific); Familiarity with MR-based planning procedures: motivation, core workflow requirements, current status, challenges; Overview of the current methods for the quantification of organ motion; Discussion on approaches for adaptive treatment planning and delivery. T. Stanescu - License agreement with Modus Medical Devices to develop a phantom for the quantification of MR image system-related distortions.; T. Stanescu, N/A.
40 CFR 180.207 - Trifluralin; tolerances for residues.
2010-07-01
...-dipropyl-p-toluidine, in or on the following raw agricultural commodities: Commodity Parts per million... Barley, straw 0.05 Bean, mung, sprouts 2.0 Carrot, roots 1.0 Celery 0.05 Corn, field, forage 0.05 Corn..., group 8 0.05 Vegetable, leaves of root and tuber, group 2 0.05 Vegetable, legume, group 6 0.05 Vegetable...
38 CFR 3.207 - Void or annulled marriage.
2010-07-01
... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Void or annulled marriage... Void or annulled marriage. Proof that a marriage was void or has been annulled should consist of: (a... marriage void, together with such other evidence as may be required for a determination. (b) Annulled. A...
Lifescience Database Archive (English)
Full Text Available GFYYINQAGRNARFHLDEFIYNSL YGNNSYEYATNSTLACASNMATYMCSYTFVGTTPPCNALW*xhvqmdllmevklfhlhlf qtvnxkvqvhpdcsainmkglm...LAEEYIVRDVVGGFYYINQAGRNARFHLDEFIYNSL YGNNSYEYATNSTLACASNMATYMCSYTFVGTTPPCNALW*xhvqmdllmevklfhlhlf qtvnxkvqvh
12 CFR 207.2 - Definition of covered agreement.
2010-01-01
... the interest rate on the loan or whether the organization intends or is authorized to re-loan the... understanding that meets all of the following criteria— (1) The agreement is in writing. (2) The parties to the... concerning written arrangements or understandings—(1) Example 1. A NGEP meets with an insured depository...
33 CFR 207.750 - Puget Sound Area, Wash.
2010-07-01
... fastened with tight-fitting covers. To preclude a concentration of potentially explosive vapors, no paint... permitted aboard vessels with cargoes of fuel or explosives. (ix) All vessels carrying hazardous cargoes... walls, or over the piers or grounds forming a part of the canal or its appurtenances. All persons in...
WE-H-207B-01: Commissioning and QC
International Nuclear Information System (INIS)
Stanescu, T.
2016-01-01
In recent years, steady progress has been made towards the implementation of MRI in external beam radiation therapy for processes ranging from treatment simulation to in-room guidance. Novel procedures relying mostly on MR data are currently implemented in the clinic. This session will cover topics such as (a) commissioning and quality control of the MR in-room imagers and simulators specific to RT, (b) treatment planning requirements, constraints and challenges when dealing with various MR data, (c) quantification of organ motion with an emphasis on treatment delivery guidance, and (d) MR-driven strategies for adaptive RT workflows. The content of the session was chosen to address both educational and practical key aspects of MR guidance. Learning Objectives: Good understanding of MR testing recommended for in-room MR imaging as well as image data validation for RT chain (e.g. image transfer, filtering for consistency, spatial accuracy, manipulation for task specific); Familiarity with MR-based planning procedures: motivation, core workflow requirements, current status, challenges; Overview of the current methods for the quantification of organ motion; Discussion on approaches for adaptive treatment planning and delivery. T. Stanescu - License agreement with Modus Medical Devices to develop a phantom for the quantification of MR image system-related distortions.; T. Stanescu, N/A
Lifescience Database Archive (English)
Full Text Available 0.005 1 AB022770 |AB022770.1 Human rotavirus mRNA for NSP2, complete cds. 52 0.005 1 X57944 |X57944.1 Human rotavirus...clone RP11-291E21 from 4, complete sequence. 42 0.011 5 Z21640 |Z21640.1 Bovine rotavirus (Strain RF) mRNA f
DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS
Energy Technology Data Exchange (ETDEWEB)
NA
2004-11-22
The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) important to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are in the form of tabulated functions with pH and log (line integral) CO{sub 2} as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. The output data from this report are fundamental inputs for Total System Performance Assessment for the License Application (TSPA-LA) to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for all of the actinides. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or otherwise addressed.
International Nuclear Information System (INIS)
Johansson, B.; Rosengren, A.
1975-01-01
A ''generalized'' phase diagram is constructed empirically for the lanthanides. This diagram makes it possible, not only in one picture, to assemble a lot of information but also to predict phase transitions not yet experimentally accessible. Further, it clearly illustrates the close relation between the members of the lanthanide group. To account for some of its features, the pseudopotential method is applied. The trend in crystal structure through the lanthanide series can thereby be qualitatively accounted for, as can the trend in crystal structure for an individual element, when compressed. A scaling procedure makes it possible to extend the treatment to elements neighboring the lanthanides in the Periodic Table. In total 25 elements are considered. An atomic parameter f (relatable to the pseudopotential) is introduced, by means of which different phase transitions, both for an individual rare-earth element and intra-rare-earth alloys, can be correlated to certain critical values of this parameter. A nonmagnetic rare-earth series (Sc, Lu, Y, La, and Ac) is introduced and the occurrence of superconductivity is discussed with special emphasis on the pressure dependence of the transition temperature. This temperature can be correlated to the above-mentioned parameter f, both for intra-rare-earth alloys and pure elements at different pressures. The correlation implies that actinium is a superconductor with a critical temperature which could be as high as (11--12) degree K
ORF Alignment: NC_003070 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... [Arabidopsis thaliana] ... Length = 156 ... Query: 148 IKTSCNITLYKTICYNSLSPYASTIRSNPQKLAVIALNLTLSSAK...SASKFVKNISHGGGL 207 ... IKTSCNITLYKTICYNSLSPYASTIRSNPQKLAVIALNLTLSSAKSASKF...VKNISHGGGL Sbjct: 1 ... IKTSCNITLYKTICYNSLSPYASTIRSNPQKLAVIALNLTLSSAKSASKFVKNISHGGGL 60 ... Query: 268 CMDGFSLVKT
Knudsen, T.-L.; Andersen, T.; Whitehouse, M. J.; Vestin, J.
An ion-microprobe (SIMS) U-Pb zircon dating study on four samples of Precambrian metasediments from the high-grade Bamble Sector, southern Norway, gives the first information on the timing of discrete crust-forming events in the SW part of the Baltic Shield. Recent Nd and Pb studies have indicated that the sources of the clastic metasediments in this area have crustal histories extending back to 1.7 to 2.1Ga, although there is no record of rocks older than 1.6Ga in southern Norway. The analysed metasediments are from a sequence of intercalated, centimetre to 10-metre wide units of quartzites, semi-metapelites, metapelites and mafic granulites. The zircons can be grouped in two morphological populations: (1) long prismatic; (2) rounded, often flattened. The BSE images reveal that both populations consist of oscillatory zoned, rounded and corroded cores (detrital grains of magmatic origin), surrounded by homogeneous rims (metamorphic overgrowths). The detrital zircons have 207Pb/206Pb ages between 1367 and 1939Ma, with frequency maxima in the range 1.85 to 1.70Ga and 1.60 to 1.50Ga. There is no correlation between crystal habit and age of the zircon. One resorbed, inner zircon core in a detrital grain is strongly discordant and gives a composite inner core-magmatic outer core 207Pb/206Pb age of 2383 Ma. Two discrete, unzoned zircons have 207Pb/206Pb ages of 1122 and 1133Ma, representing zircon growth during the Sveconorwegian high-grade metamorphism. Also the μm wide overgrowths, embayments in the detrital cores and apparent ``inner cores'' which represent secondary metamorphic zircon growth in deep embayments in detrital grains, are of Sveconorwegian age. The composite-detrital-metamorphic zircon analyses give generally discordant 206Pb/238U versus 207Pb/235U ratios and maximum 207Pb/206Pb ages of 1438Ma. These data demonstrate the existence of a protocrust of 1.7 to 2.0Ga in the southwestern part of the Baltic Shield, implying a break in the overall westward
Porphyrin Interactions with Wild Type and Mutant Mouse Ferrochelatase
Energy Technology Data Exchange (ETDEWEB)
Ferreira, Gloria C.; Franco, Ricardo; Lu, Yi; Ma, Jian-Guo; Shelnutt, John A.
1999-05-19
Ferrochelatase (EC 4.99.1.1), the terminal enzyme of the heme biosynthetic pathway, catalyzes Fe2+ chelation into protoporphyrin IX. Resonance Raman and W-visible absorbance spectroscopes of wild type and engineered variants of murine ferrochelatase were used to examine the proposed structural mechanism for iron insertion into protoporphyrin by ferrochelatase. The recombinant variants (i.e., H207N and E287Q) are enzymes in which the conserved amino acids histidine-207 and glutamate-287 of murine ferrochelatase were substituted with asparagine and glutamine, respectively. Both of these residues are at the active site of the enzyme as deduced from the Bacillus subtilis ferrochelatase three-dimensional structure. Addition of free base or metalated porphyrins to wild type ferrochelatase and H207N variant yields a quasi 1:1 complex, possibly a monomeric protein-bound species. In contrast, the addition of porphyrin (either free base or metalated) to E287Q is sub-stoichiometric, as this variant retains bound porphyrin in the active site during isolation and purification. The specificity of porphyrin binding is confirmed by the narrowing of the structure-sensitive resonance Raman lines and the vinyl vibrational mode. Resonance Raman spectra of free base and metalated porphyrins bound to the wild type ferrochelatase indicate a nonplanar distortion of the porphyrin macrocycle, although the magnitude of the distortion cannot be determined without first defining the specific type of deformation. Significantly, the extent of the nonplanar distortion varies in the case of H207N- and E287Q-bound porphyrins. In fact, resonance Raman spectral decomposition indicates a homogeneous ruffled distortion for the nickel protoporphyrin bound to the wild type ferrochelatase, whereas both a planar and ruffled conformations are present for the H207N-bound porphyrin. Perhaps more revealing is the unusual resonance , 3 Raman spectrum of the endogenous E287Q-bound porphyrin, which has
International Nuclear Information System (INIS)
Klaminder, Jonatan; Farmer, John G.; MacKenzie, Angus B.
2011-01-01
Knowledge of the anthropogenic contribution to lead (Pb) concentrations in surface soils in high latitude ecosystems is central to our understanding of the extent of atmospheric Pb contamination. In this study, we reconstructed fallout of Pb at a remote sub-arctic region by using two ombrotrophic peat cores and assessed the extent to which this airborne Pb is able to explain the isotopic composition ( 206 Pb/ 207 Pb ratio) in the O-horizon of tundra soils. In the peat cores, long-range atmospheric fallout appeared to be the main source of Pb as indicated by temporal trends that followed the known European pollution history, i.e. accelerated fallout at the onset of industrialization and peak fallout around the 1960s-70s. The Pb isotopic composition of the O-horizon of podzolic tundra soil ( 206 Pb/ 207 Pb = 1.170 ± 0.002; mean ± SD) overlapped with that of the peat ( 206 Pb/ 207 Pb = 1.16 ± 0.01) representing a proxy for atmospheric aerosols, but was clearly different from that of the parent soil material ( 206 Pb/ 207 Pb = 1.22-1.30). This finding indicated that long-range fallout of atmospheric Pb is the main driver of Pb accumulation in podzolic tundra soil. In O-horizons of tundra soil weakly affected by cryoturbation (cryosols) however, the input of Pb from the underlying mineral soil increased as indicated by 206 Pb/ 207 Pb ratios of up to 1.20, a value closer to that of local soil minerals. Nevertheless, atmospheric Pb appeared to be the dominant source in this soil compartment. We conclude that Pb concentrations in the O-horizon of studied tundra soils - despite being much lower than in boreal soils and representative for one of the least exposed sites to atmospheric Pb contaminants in Europe - are mainly controlled by atmospheric inputs from distant anthropogenic sources. - Highlights: → We used Pb isotopic composition to aid interpretation of Pb profiles in tundra soils. → Ombrotrophic peat cores were used as records of atmospheric inputs of Pb.
Durability of Compressed Earth Bricks: Assessing Erosion Resistance Using the Modified Spray Testing
Directory of Open Access Journals (Sweden)
Malarvizhi Baskaran
2010-11-01
Full Text Available The discussion in this paper is part of research directed at establishing optimal stabilization strategy for compressed bricks. The deployment context for the use of the compressed bricks was Dar es Salaam (Tanzania where manually fabricated bricks are increasingly being used in low cost housing units. This discussion specifically focuses on strategies that can be used to counter deterioration due to wind-driven rain erosion. The impact of using cement, lime, fiber and a commercial stabilizing fluid was assessed. Factory-produced bricks were used for benchmarking. The durability of the bricks was assessed using the “modified” Bulletin 5 Spray Test. The different brick specimens were sprayed with water at 2.07 MPa and 4.14 MPa over one-hour time period while measuring the depth of erosion every 15 minutes. Factory-produced bricks hardly eroded at both 2.07 MPa and 4.14 MPa pressure levels. The maximum depth of erosion for Soil-Cement bricks ranged from a maximum of 0.5 mm at 2.07 MPa water pressure to 0.8 mm at 4.14 MPa. The maximum and minimum depths of erosion for Soil-Cement-Lime bricks were 25mm and 17 mm respectively. The inclusion of natural fiber in the bricks resulted in a sharp increase of the erosion depth to a maximum of 40 mm at 2.07 MPa and 55 mm at 4.14 Mpa. As the use of natural fibers and lime enhances some physio-mechanical properties, further research is necessary to determine ways of achieving this goal while maintaining acceptable levels of erosion resistance.
International Nuclear Information System (INIS)
Zaborska, Agata
2014-01-01
Highlights: • Pb concentrations reach even 147 μg/g at Gdansk Basin sediments. • Marine sediments deposited before 1860 are not contaminated by Pb. • Contemporary inventories of anthropogenic Pb in marine sediments was of 0.5–11 g for m 2 . • The lowest 206 Pb/ 207 Pb (1.165) were measured in sediments deposited between 1970s–90s. • Coal burning was always the most important Pb source in Poland. - Abstract: The Gulf of Gdańsk is influenced by heavy metals of anthropogenic origin. In this study, temporal concentration changes of Pb, Zn, Cd, and Cu were studied in six, 50 cm long sediment cores. The main aim of the study was to concentrate on the history of Pb fluxes and Pb isotopic composition ( 206 Pb/ 207 Pb and 208 Pb/ 206 Pb) to trace Pb sources. The lowest Pb concentrations (19 μg g −1 ) were measured in sediments deposited circa 1860, while the highest Pb concentrations (63–147 μg g −1 ) were measured in sediments deposited between 1960s and 70s. Pre-industrial Pb fluxes were 7 Pb m 2 year −1 , while after WWII they reached 199 Pb m 2 year −1 . Highest 206 Pb/ 207 Pb ratios (∼1.22) were measured in the oldest sediment layers, and the lowest 206 Pb/ 207 Pb ratios (∼1.165) were measured in the sediments deposited in 1970s–90s. During the period of highest Pb contamination, the anthropogenic Pb fraction reached up to 93%. A general discussion of the Pb sources, emissions, and loads for Poland is included
Dipeptidyl peptidase-4 greatly contributes to the hydrolysis of vildagliptin in human liver.
Asakura, Mitsutoshi; Fujii, Hideaki; Atsuda, Koichiro; Itoh, Tomoo; Fujiwara, Ryoichi
2015-04-01
The major metabolic pathway of vildagliptin in mice, rats, dogs, and humans is hydrolysis at the cyano group to produce a carboxylic acid metabolite M20.7 (LAY151), whereas the major metabolic enzyme of vildagliptin has not been identified. In the present study, we determined the contribution rate of dipeptidyl peptidase-4 (DPP-4) to the hydrolysis of vildagliptin in the liver. We performed hydrolysis assay of the cyano group of vildagliptin using mouse, rat, and human liver samples. Additionally, DPP-4 activities in each liver sample were assessed by DPP-4 activity assay using the synthetic substrate H-glycyl-prolyl-7-amino-4-methylcoumarin (Gly-Pro-AMC). M20.7 formation rates in liver microsomes were higher than those in liver cytosol. M20.7 formation rate was significantly positively correlated with the DPP-4 activity using Gly-Pro-AMC in liver samples (r = 0.917, P vildagliptin hydrolysis in the liver. Additionally, we established stable single expression systems of human DPP-4 and its R623Q mutant, which is the nonsynonymous single-nucleotide polymorphism of human DPP-4, in human embryonic kidney 293 (HEK293) cells to investigate the effect of R623Q mutant on vildagliptin-hydrolyzing activity. M20.7 formation rate in HEK293 cells expressing human DPP-4 was significantly higher than that in control HEK293 cells. Interestingly, R623Q mutation resulted in a decrease of the vildagliptin-hydrolyzing activity. Our findings might be useful for the prediction of interindividual variability in vildagliptin pharmacokinetics. Copyright © 2015 by The American Society for Pharmacology and Experimental Therapeutics.
Chen, M.; Boyle, E. A.; Zurbrick, C.; Carrasco, G. G.; Switzer, A.; Zhao, N.
2016-02-01
Two independent studies on anthropogenic Pb and Pb isotopes in coastal corals from the northern Arabian Gulf and the Singapore Straits have shown an isotopic excursion where the main Pb sources discharging to the water move to more crustal-like values, indicating that the Pb in coastal waters might exchange isotopically with crustal particulates without propotional change in concentration. To investigate this issue, Pb isotope exchange is assessed through a closed-system exchange experiment using estuarine waters collected at the Johor River mouth (discharging to the Singapore Straits). During the experiment, a known amount of NBS-981 (206Pb/207Pb=1.093) was spiked into the unfiltered Johor water (dissolved 206Pb/207Pb = 1.199) and the changing isotopic composition of the dissolved Pb was monitored. Shortly after the spike addition, dissolved Pb exhibited 206Pb/207Pb=1.178, reflecting the influence of the spike. Within the following few days, the 206Pb/207Pb in the water increased to >1.190 with limited changes of the dissolved Pb concentration. The observations in closed-system experiment agree with the isotope difference between Singapore aerosol and seawater in our 2-year-long field observations. The kinetics of isotope exchange were assessed using a simple model, which reproduced >70% of the observed Pb isotope variance. Both the close-system experiment and field measurements imply that isotope exchange can be an important mechanism for regulating the Pb and Pb isotopes in coastal waters. Investigations on the distribution of Pb and Pb isotope in estuaries and coastal waters should further assess the role of isotope exchange in ocean Pb chemistry.
Number of Langerhans cells is decreased in premalignant keratosis and skin cancers.
Shevchuk, Z; Filip, A; Shevchuk, V; Kashuba, E
2014-03-01
It was shown earlier that a number of CD207 positive Langerhans cells was lower in basal cell carcinomas than in the normal epidermis. Moreover, benign skin lesions presented a higher number of Langerhans cells when they were compared to malignant tumors. To count Langerhans cells, assessing expression levels of CD1A and CD207 markers in actinic keratosis, basal and squamous cell carcinomas, compared with the normal skin. Comparison of Langerhans cells might give a valuable prognostic marker for skin cancer. Immunohistochemistry and methods of statistics were used. Expression of CD1A and CD207 markers was assessed in tumor samples of actinic keratosis, cutaneous basal and squamous cell carcinomas, in comparison with the normal skin. In each cohort there were 40 patients (and 11 healthy individuals). We have shown that the number of Langerhans cells is considerably lower in cutaneous basal and squamous cell carcinomas, compared with their number in the normal skin (p keratosis, basal and squamous cell carcinoma. This may suggest an alteration of Langerhans cells phenotype in skin neoplastic diseases, making the number of Langerhans cells a valuable prognostic factor for skin tumors.
International Nuclear Information System (INIS)
Wang Wan; Liu Xiande; Zhao Liwei; Guo, Dongfa; Tian Xiaodan; Adams, Freddy
2006-01-01
The phase-out of leaded petrol has been a measure widely used to reduce atmospheric lead pollution. Since the 1980s, China began to promote unleaded petrol. In order to assess the effectiveness of the measure an isotope fingerprint technique was applied for aerosol samples in the city of Tianjin. After dilute acid leaching, the lead concentration and isotope abundance ratios were determined for 123 samples collected in Tianjin during eight years (1994-2001). The 206 Pb / 207 Pb ratio was lower in summer, when coal combustion emission was low and vehicle exhaust became more important, indicating that the 206 Pb / 207 Pb ratio of leaded petrol in Tianjin is lower than that of aerosol samples. The 206 Pb / 207 Pb ratio gradually increased from 1994 to 2001, a trend that suggests that the contribution from vehicle exhaust was diminishing. Overall, the measurements matched well with national statistical data of leaded and unleaded petrol production. After the nationwide switch to unleaded gasoline, comprehensive control measures are urgently needed to reduce air lead pollution in China, as aerosol lead reduced slightly but remains at a relatively high level
Comparison of the concentrations of metal elements and isotopes of lead found in rice and rice bran.
Dai, Shouhui; Yang, Hui; Yang, Lan; Wang, Fuhua; Du, Ruiying; Wen, Dian
2014-08-01
Very few studies have investigated the difference in the distribution of metal elements between rice and rice bran samples. In this study, the concentrations of 27 metal elements (Li, Be, Na, Mg, Al, K, Ca, V, Cr, Mn, Fe, Co, Ni, Cu, Zn, Ga, As, Se, Rb, Sr, Ag, Cd, Cs, Ba, Tl, Pb, and U) in 56 polished rice and their corresponding bran samples were determined. A significant difference in concentrations of all elements except Ag and Cd was found between rice and bran (P rice ratios of 1.21 to 36.3. High concentrations of metal elements, especially that of the heavy metal Cr, in bran samples present a potential safety issue for bran products, such as food and feed containing bran. Pb isotope ((204)Pb, (206)Pb, (207)Pb, and (208)Pb) ratios also were determined. The (206)Pb/(207)Pb and (208)Pb/(207)Pb ratios in bran were generally higher than those in rice (P rice and bran samples were distinctly different from each other, indicating that Pb isotope composition is an effective for discriminating between bran and rice samples.
ORF Alignment: NC_004460 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ining ... protein [Vibrio vulnificus YJ016] ... Length = 77 ... Query: 148 RFNDASLSISDLTAREQETLFL...LLYGRKPQYIANIMGISIKTVEGHVARLRTKFAANSKN 207 ... RFNDASLSISDLTAREQETLFLLLYGR...KPQYIANIMGISIKTVEGHVARLRTKFAANSKN Sbjct: 1 ... RFNDASLSISDLTAREQETLFLLLYGRKPQYIANIMGISIKTVEGHVARLRTKFAANSKN 60 ...
International Nuclear Information System (INIS)
Rahn, T.; Wahlen, M.; Zhang Hui; Blake, G.
2002-01-01
Nitrous oxide plays an important role in greenhouse forcing and stratospheric ozone regulation. It is destructed in the stratosphere mainly by UV photolysis. Laboratory studies of N 2 O-N 2 mixtures irradiated at 193 and 207 nm reveal a significant enrichment of the residual heavy nitrous oxide isotopomers. The isotopic signatures are well described by an irreversible Rayleigh distillation process, with large enrichment factors of ε 15,18 (193 nm) = -18.4, -14.5 per mil and ε 15,18 (207 nm) = -48.7, -46.0 per mil. These results, when combined with diffusive mixing processes might help to explain the stratospheric enrichments previously observed. (author)
Beta-decay half-lives and level ordering of sup 1 sup 0 sup 2 sup m sup , sup g Rh
Shibata, M; Itoh, S; Itoh, S; Yamamoto, H; Kawade, K; Kasugai, Y; Ikeda, Y
1998-01-01
Beta-decay half-lives of the ground state and an isomer of sup 1 sup 0 sup 2 Rh have been determined 207.3(17) d and 3.742(10) y, respectively, by gamma-ray decay curves following each beta-decay. It has been found that a state (2 sup -) which has a shorter half-life (207.3 d) is the ground state from the result that the half-life of the 41.9 keV isomeric gamma-transition was equal to 3.742 y. It has also been confirmed that the 41.9 keV transition is certainly an isomeric transition with X-gamma coincidence measurement.
ORF Alignment: NC_002678 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available m ... loti MAFF303099] ... Length = 207 ... Query: 10 ... KLILVSHPLCPYVQRAAISLTEKGVPFERIDIDLADKPDWFK...AISPLGKVPLLRVQRNGD 69 ... KLILVSHPLCPYVQRAAISLTEKGVPFERIDIDLADKPDWFKAISPLG...KVPLLRVQRNGD Sbjct: 1 ... KLILVSHPLCPYVQRAAISLTEKGVPFERIDIDLADKPDWFKAISPLGKVPLLRVQRNGD 60 ... Query: 130 AESRALTG
Concentrations of radionuclides in fish collected from Bikini Atoll between 1977 and 1984
International Nuclear Information System (INIS)
Noshkin, V.E.; Wong, K.M.; Eagle, R.J.; Jokela, T.A.; Brunk, J.A.
1986-07-01
This report summarizes all available data on the concentrations of radionuclides in fish from Bikini Atoll between 1977 and 1984. As found in other global studies, 137 Cs is most highly accumulated in edible flesh of all species of fish, the lowest fractions are found in the bone or liver. The mean concentration of 137 Cs in muscle of reef fish from the southern part of the atoll is comparable to the global fallout concentration measured in market samples of fish collected from Chicago, Illinois, in 1982. 90 Sr is generally associated with non-edible parts of fish, such as bone or viscera. Twenty-five to fifty percent of the total body burden of 60 Co is accumulated in the muscle tissue; the remainder is distributed among the liver, skin, and viscera. The mean concentration of 60 Co in fish has been decreasing at a rate faster than radiological decay alone. Most striking is the range of 207 Bi concentrations among different species of fish collected at the same time and place. Highest concentrations of 207 Bi were consistently detected in the muscle (and other tissues) of goatfish and some of the pelagic lagoon fish. In other reef fish, such as mullet, surgeonfish, and parrotfish, 207 Bi was usually below detection limits by gamma spectrometry. Over 70% of the whole-body activity of 207 Bi in goatfish is associated with the muscle tissue, whereas less than 5% is found in the muscle of mullet and surgeonfish. Neither 239+240 Pu nor 241 Am is significantly accumulated in the muscle tissue of any species of fish. Apparently, 238 Pu is in a more readily available form for accumulation by fishes than 239+240 Pu. Based on a daily ingestion rate of 200 q of fish flesh, dose rates to individuals through the fish-food ingestion pathway are well below current Federal guidelines
Radionuclide concentrations in fish and invertebrates from Bikini Atoll
International Nuclear Information System (INIS)
Noshkin, V.E.; Wong, K.M.; Eagle, R.J.; Jokela, T.A.; Brunk, J.A.
1988-01-01
As in other global studies, 137 Cs was found in the highest concentrations in edible flesh of all species of fish and in the lowest concentrations in the bone or liver. The mean concentration of 137 Cs in muscle of reef fish from the southern part of the atoll is comparable to the global-fallout concentration measured in market samples of fish collected from Chicago, IL, USA, in 1982. Strontium-90 is associated generally with non-edible parts of fish, such as bone or viscera. Twenty-five to fifty percent of the total body burden of 60 Co is accumulated in the muscle tissue; the remainder is distributed among the liver, skin, and viscera. The mean concentration of 60 Co in fish has been decreasing at a rate faster than radiological decay alone. Most striking is the range of 207 Bi concentrations among different species of fish collected at the same time and place. Highest concentrations of 207 Bi were consistently detected in the muscle and other tissues of goatfish and some of the pelagic lagoon fish. In other reef fish, such as mullet, surgeonfish, and parrotfish, 207 Bi was usually below detection limits by gamma spectrometry. Over 70% of the whole-body activity of 207 Bi in goatfish is associated with the muscle tissue, whereas less than 5% is found in the muscle of mullet and surgeonfish. Neither 239+240 Pu nor 241 Am is accumulated significantly in the muscle tissue of any species of fish. Apparently, 238 Pu is in a more readily available form for accumulation by fishes than 239+240 Pu. Based on a daily ingestion rate of 200 g of fish flesh, dose rates to individuals through the fish-food ingestion pathway are well below current Federal guidelines. 24 refs., 1 fig., 27 tabs
Lee, Celine S. L.; Li, Xiang-Dong; Zhang, Gan; Li, Jun; Ding, Ai-Jun; Wang, Tao
Rapid urbanization and industrialization in South China has placed great strain on the environment and on human health. In the present study, the total suspended particulate matter (TSP) in the urban and suburban areas of Hong Kong and Guangzhou, the two largest urban centres in South China, was sampled from December 2003 to January 2005. The samples were analysed for the concentrations of major elements (Al, Fe, Mg and Mn) and trace metals (Cd, Cr, Cu, Pb, V and Zn), and for Pb isotopic composition. Elevated concentrations of metals, especially Cd, Pb, V and Zn, were observed in the urban and suburban areas of Guangzhou, showing significant atmospheric trace element pollution. Distinct seasonal patterns were observed in the heavy metal concentrations of aerosols in Hong Kong, with higher metal concentrations during the winter monsoon period, and lower concentrations during summertime. The seasonal variations in the metal concentrations of the aerosols in Guangzhou were less distinct, suggesting the dominance of local sources of pollution around the city. The Pb isotopic composition in the aerosols of Hong Kong had higher 206Pb/ 207Pb and 208Pb/ 207Pb ratios in winter, showing the influence of Pb from the northern inland areas of China and the Pearl River Delta (PRD) region, and lower 206Pb/ 207Pb and 208Pb/ 207Pb ratios in summer, indicating the influence of Pb from the South Asian region and from marine sources. The back trajectory analysis showed that the enrichment of heavy metals in Hong Kong and Guangzhou was closely associated with the air mass from the north and northeast that originated from northern China, reflecting the long-range transport of heavy metal contaminants from the northern inland areas of China to the South China coast.
Walraven, N; van Os, B J H; Klaver, G Th; Middelburg, J J; Davies, G R
2014-02-15
In this study the origin, behaviour and fate of anthropogenic Pb in sandy roadside soils were assessed by measuring soil characteristics, Pb isotope composition and content. In 1991 and 2003 samples were taken at different depth intervals at approximately 8 and 75 m from two highways in The Netherlands. The Pb isotope composition of the litter layer ((206)Pb/(207)Pb=1.12-1.14) differs from the deeper soil samples ((206)Pb/(207)Pb=1.20-1.21). Based on a mixing model it is concluded that the samples contain two Pb sources: natural Pb and anthropogenic Pb, the latter mainly derived from gasoline. (206)Pb/(207)Pb ratios demonstrate that the roadside soils were polluted to a depth of ~15 cm. Within this depth interval, anthropogenic Pb content is associated with organic matter. Although Pb pollution only reached a depth of ~15 cm, this does not mean that the topsoils retain all anthropogenic Pb. Due to the low pH and negligible binding capacity of soils at depths >15 cm, anthropogenic Pb migrated towards groundwater after reaching depths of >15 cm. The Pb isotope composition of the groundwater ((206)Pb/(207)Pb=1.135-1.185) establishes that groundwater is polluted with anthropogenic Pb. The contribution of anthropogenic Pb to the groundwater varies between ~30 and 100%. Based on the difference in soil Pb content and Pb isotope compositions over a period of 12 years, downward Pb migration is calculated to vary from 72 ± 95 to 324 ± 279 mg m(-2)y(-1). Assuming that the downward Pb flux is constant over time, it is calculated that 35-90% of the atmospherically delivered Pb has migrated to the groundwater. Copyright © 2013 Elsevier B.V. All rights reserved.
Constraining recent lead pollution sources in the North Pacific using ice core stable lead isotopes
Gross, B. H.; Kreutz, K. J.; Osterberg, E. C.; McConnell, J. R.; Handley, M.; Wake, C. P.; Yalcin, K.
2012-08-01
Trends and sources of lead (Pb) aerosol pollution in the North Pacific rim of North America from 1850 to 2001 are investigated using a high-resolution (subannual to annual) ice core record recovered from Eclipse Icefield (3017 masl; St. Elias Mountains, Canada). Beginning in the early 1940s, increasing Pb concentration at Eclipse Icefield occurs coevally with anthropogenic Pb deposition in central Greenland, suggesting that North American Pb pollution may have been in part or wholly responsible in both regions. Isotopic ratios (208Pb/207Pb and 206Pb/207Pb) from 1970 to 2001 confirm that a portion of the Pb deposited at Eclipse Icefield is anthropogenic, and that it represents a variable mixture of East Asian (Chinese and Japanese) emissions transported eastward across the Pacific Ocean and a North American component resulting from transient meridional atmospheric flow. Based on comparison with source material Pb isotope ratios, Chinese and North American coal combustion have likely been the primary sources of Eclipse Icefield Pb over the 1970-2001 time period. The Eclipse Icefield Pb isotope composition also implies that the North Pacific mid-troposphere is not directly impacted by transpolar atmospheric flow from Europe. Annually averaged Pb concentrations in the Eclipse Icefield ice core record show no long-term trend during 1970-2001; however, increasing208Pb/207Pb and decreasing 206Pb/207Pb ratios reflect the progressive East Asian industrialization and increase in Asian pollutant outflow. The post-1970 decrease in North American Pb emissions is likely necessary to explain the Eclipse Icefield Pb concentration time series. When compared with low (lichen) and high (Mt. Logan ice core) elevation Pb data, the Eclipse ice core record suggests a gradual increase in pollutant deposition and stronger trans-Pacific Asian contribution with rising elevation in the mountains of the North Pacific rim.
Liu, Dongying; Liu, Yi; Men, Xuehui; Guo, Qunqun; Guo, Rongbo; Qiu, Yanling
2012-08-04
To cultivate various yet-to-be cultured heterotrophs from anaerobic granule sludge, we used a selective culture medium with low concentrations of substrates supplemented a variety of antibiotics. An obligate anaerobic, thermophilic, hydrogen-producing bacterium, strain VM20-7(T), was isolated from an upflow anaerobic sludge blanket (UASB) reactor treating high-strength organic wastewater from isomerized sugar production processes. Cells of strain VM20-7(T) are non-motile, spherical, pear or teardrop shaped, occurring singly(o)r as aggregates (0.7 - 2.0 microm x 0.7 - 2.0 microm). Spore formation was not observed. Growth temperature ranges from 35 - 50 degrees C (optimum 45 degrees C), pH ranges from 6.0 - 8.3 (optimum 7.0 - 7.5) , NaCl tolerant concentration ranges from 0% - 0.5% (w/v, optimum 0% ). Nitrate, sulfate, thiosulfate, sulfite, elemental sulfur and Fe (III)-NTA were not used as terminal electron acceptors. Strain VM20-7(T) utilizes a wide range of carbohydrates, including glucose, maltose, ribose, xylose, sucrose, galactose, mannose, raffinose, pectin, yeast extract and xylan. Acetate and H2 are the main end products of glucose fermentation. The G + C content of the genomic DNA was 60.9 mol%. 16S rRNA gene sequence analysis revealed that it is related to the Pirellula-Rhodopirellula-Blastopirellula (PRB) clade within the order Planctomycetales (82.7 - 84.3% similarity with 16S rRNA genes of other known related species). The first obligate anaerobic bacterium within the phylum Planctomycetes was isolated with low concentration of carbohydrates and antibiotics. On the basis of the physiological and phylogenetic data, the name Thermopirellula anaerolimosa gen. nov. , sp. nov. is proposed for strain VM20-7(T) (= CGMCC 1.5169(T) = JCM 17478(T) = DSM 24165(T)).
Refined localization of the Escherichia coli F4ab/F4ac receptor locus on pig chromosome 13
DEFF Research Database (Denmark)
Joller, D.; Jørgensen, Claus Bøttcher; Bertschinger, H.U.
2009-01-01
Diarrhoea in newborn and weaned pigs caused by enterotoxigenic Escherichia coli (ETEC) expressing F4 fimbriae leads to considerable losses in pig production. In this study, we refined the mapping of the receptor locus for ETEC F4ab/F4ac adhesion (F4bcR) by joint analysis of Nordic and Swiss data...... (MUC4-8227) were used to create the linkage map. The region for F4bcR was refined to the interval SW207-S0075 on pig chromosome 13. The most probable position of F4bcR was in the SW207-MUC4 region. The order of six markers was supported by physical mapping on the BAC fingerprint contig from...
International Nuclear Information System (INIS)
Yoo, One; Song, M. S.; Kim, I. Y.; Park, S. H.; Lee, B. S.
2010-01-01
Nuclear components categorized as ASME Code Class 1 shall be evaluated for the fatigue and satisfy the fatigue acceptance criteria, CUF(cumulative usage factor) < 1 in accordance with ASME Code. However, recent studies have shown the fatigue evaluation procedure may not give conservative results when the components operate in the water environment. NRC issued Regulatory Guide 1.207 which enforces the new fatigue evaluation method or Fen(environmental fatigue correction factor) method to nuclear plants to be newly constructed. This paper describes the characteristics of the behavior of low alloy and austenitic stainless steel straight pipe related to environmental fatigue, which are obtained by using the method suggested by Regulatory Guide 1.207 and simplified plant transients
Polanyi Evaluation of Adsorptive Capacities of Commercial Activated Carbons
Monje, Oscar; Surma, Jan M.
2017-01-01
Commercial activated carbons from Calgon (207C and OVC) and Cabot Norit (RB2 and GCA 48) were evaluated for use in spacecraft trace contaminant control filters. The Polanyi potential plots of the activated carbons were compared using to those of Barnebey-Cheney Type BD, an untreated activated carbon with similar properties as the acid-treated Barnebey-Sutcliffe Type 3032 utilized in the TCCS. Their adsorptive capacities under dry conditions were measured in a closed loop system and the sorbents were ranked for their ability to remove common VOCs found in spacecraft cabin air. This comparison suggests that these sorbents can be ranked as GCA 48 207C, OVC RB2 for the compounds evaluated.
International Nuclear Information System (INIS)
Khorasanov, G.L.; Blokhin, A.I.
2002-01-01
The purpose of this paper is to study the prospects of new coolants for fast reactors and accelerator driven systems. The main focus is on their improvement using the isotopic tailoring technique to reduce post-irradiation activity. Calculations using the FISPACT-3 code show that irradiating natural lead (Pb-nat) for 30 years leads to the accumulation of long-lived toxic radionuclides, 207 Bi, 208 Bi and 210 Pb, which extends the cooling down period to the clearance level. This time can be shortened by using the lead isotope 206 Pb instead of Pb-nat. This substantially decreases the concentration of the most toxic polonium isotope, 210 Po. Calculations for lead activation in the hard proton-neutron ADS spectrum were performed using the CASCADE/SNT code. The time-dependent activity of the 207 Bi produced in Pb-nat and 206 Pb after irradiation for one year with a proton beam having an energy of 0.8 GeV and a current of 30 mA is given. The activity of 207 Bi is decreased by four orders of magnitude when 206 Pb is used instead of natural lead as a coolant for ADS targets. The production of such radiotoxic nuclides as 210 Po is also substantially diminished. (author)
Variable sources for Cretaceous to recent HIMU and HIMU-like intraplate magmatism in New Zealand
DEFF Research Database (Denmark)
van der Meer, Quinten; Waight, Tod Earle; Scott, James
2017-01-01
–100Ma) calc-alkaline lamprophyres are compositionally similar to the preceding arc-magmatism (206Pb/204Pb(i)=18.6, 207Pb/204Pb(i)=15.62, 208Pb/204Pb(i)=38.6, 87Sr/86Sr(i)=0.7063–0.7074, εNd(i)=−2.1 −+0.1 and εHf(i)=−0.2 −+2.3) and are interpreted as melts originating from subduction-modified lithosphere....... Alkaline dikes erupted on the inboard Gondwana margin shortly after cessation of subduction (92–84Ma) have heterogeneous isotopic properties: 206Pb/204Pb(i)=18.7 to 19.4, 207Pb/204Pb(i)=15.60 to 15.65, 208Pb/204Pb(i)=38.6 to 39.4, 87Sr/86Sr(i)=0.7031 to 0.7068, εNd(i)=+4.5 to +8.0 and εHf(i)=+5.1 to +8...... from the complex local subduction history. A coeval episode of alkaline magmatism (mainly 98–82Ma) occurred outboard of Gondwana’s former active margin and on the Hikurangi oceanic plateau (accreted to Zealandia in the Early Cretaceous) with compositions closer to true HIMU (206Pb/204Pb(i)≈20.5, 207Pb...
Energy Technology Data Exchange (ETDEWEB)
Klaminder, Jonatan, E-mail: jonatan.klaminder@emg.umu.se [Department of Ecology and Environmental Science, Umea University, 90187 Umea (Sweden); Farmer, John G. [School of GeoSciences, University of Edinburgh, Edinburgh, EH9 3JN, Scotland (United Kingdom); MacKenzie, Angus B. [Scottish Universities Environmental Research Centre, East Kilbride, G75 0QF, Scotland (United Kingdom)
2011-09-15
Knowledge of the anthropogenic contribution to lead (Pb) concentrations in surface soils in high latitude ecosystems is central to our understanding of the extent of atmospheric Pb contamination. In this study, we reconstructed fallout of Pb at a remote sub-arctic region by using two ombrotrophic peat cores and assessed the extent to which this airborne Pb is able to explain the isotopic composition ({sup 206}Pb/{sup 207}Pb ratio) in the O-horizon of tundra soils. In the peat cores, long-range atmospheric fallout appeared to be the main source of Pb as indicated by temporal trends that followed the known European pollution history, i.e. accelerated fallout at the onset of industrialization and peak fallout around the 1960s-70s. The Pb isotopic composition of the O-horizon of podzolic tundra soil ({sup 206}Pb/{sup 207}Pb = 1.170 {+-} 0.002; mean {+-} SD) overlapped with that of the peat ({sup 206}Pb/{sup 207}Pb = 1.16 {+-} 0.01) representing a proxy for atmospheric aerosols, but was clearly different from that of the parent soil material ({sup 206}Pb/{sup 207}Pb = 1.22-1.30). This finding indicated that long-range fallout of atmospheric Pb is the main driver of Pb accumulation in podzolic tundra soil. In O-horizons of tundra soil weakly affected by cryoturbation (cryosols) however, the input of Pb from the underlying mineral soil increased as indicated by {sup 206}Pb/{sup 207}Pb ratios of up to 1.20, a value closer to that of local soil minerals. Nevertheless, atmospheric Pb appeared to be the dominant source in this soil compartment. We conclude that Pb concentrations in the O-horizon of studied tundra soils - despite being much lower than in boreal soils and representative for one of the least exposed sites to atmospheric Pb contaminants in Europe - are mainly controlled by atmospheric inputs from distant anthropogenic sources. - Highlights: {yields} We used Pb isotopic composition to aid interpretation of Pb profiles in tundra soils. {yields} Ombrotrophic peat
ORF Alignment: NC_004463 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available um USDA ... 110] ... Length = 128 ... Query: 207 MRLGDRPVGAVMTPRTEVDEIDLNDTPEAIQQIIAKSPHSRFPASDGERD...KPIGVLQAKD 266 ... MRLGDRPVGAVMTPRTEVDEIDLNDTPEAIQQIIAKSPHSRFPASDGERDKPI...GVLQAKD Sbjct: 1 ... MRLGDRPVGAVMTPRTEVDEIDLNDTPEAIQQIIAKSPHSRFPASDGERDKPIGVLQAKD 60 ... Query: 327 DILESIVG 334 ... DILESIVG Sbjct: 121 DILESIVG 128
K problému sekundárního (nepřímého) tlumočení v moderním českém biblickém překladu
Czech Academy of Sciences Publication Activity Database
Bartoň, Josef
2013-01-01
Roč. 5, č. 2 (2013), s. 207-216 ISSN 1804-1132 Institutional support: RVO:67985955 Keywords : Czech Biblical translation * indirect translation * second-hand translation Subject RIV: AI - Linguistics
TU-EF-207-05: Dedicated Cone-beam Breast CT
International Nuclear Information System (INIS)
Vedantham, S.
2015-01-01
Breast imaging technology is advancing on several fronts. In digital mammography, the major technological trend has been on optimization of approaches for performing combined mammography and tomosynthesis using the same system. In parallel, photon-counting slot-scan mammography is now in clinical use and more efforts are directed towards further development of this approach for spectral imaging. Spectral imaging refers to simultaneous acquisition of two or more energy-windowed images. Depending on the detector and associated electronics, there are a number of ways this can be accomplished. Spectral mammography using photon-counting detectors can suppress electronic noise and importantly, it enables decomposition of the image into various material compositions of interest facilitating quantitative imaging. Spectral imaging can be particularly important in intravenously injected contrast mammography and eventually tomosynthesis. The various approaches and applications of spectral mammography are discussed. Digital breast tomosynthesis relies on the mechanical movement of the x-ray tube to acquire a number of projections in a predefined arc, typically from 9 to 25 projections over a scan angle of +/−7.5 to 25 degrees depending on the particular system. The mechanical x-ray tube motion requires relatively long acquisition time, typically between 3.7 to 25 seconds depending on the system. Moreover, mechanical scanning may have an effect on the spatial resolution due to internal x-ray filament or external mechanical vibrations. New x-ray source arrays have been developed and they are aimed at replacing the scanned x-ray tube for improved acquisition time and potentially for higher spatial resolution. The potential advantages and challenges of this approach are described. Combination of digital mammography and tomosynthesis in a single system places increased demands on certain functional aspects of the detector and overall performance, particularly in the tomosynthesis mode due to lower photon fluence per projection. This may require fast-frame acquisition and symmetric or asymmetric pixel binning in some systems. Recent studies investigated the performance of increased conversion layer thickness for contrast-enhanced imaging of the breast in dual-energy acquisition mode. In other direct conversion detectors operating in the avalanche mode, sensitivities close to the single photon response are also explored for mammography and breast tomosynthesis. The potential advantages and challenges of this approach are described. Dedicated breast CT brings x-ray imaging of the breast to true tomographic 3D imaging. It can eliminate the tissue superposition problem and does not require physical compression of the breast. Using cone beam geometry and a flat-panel detector, several hundred projections are acquired and reconstructed to near isotropic voxels. Multiplanar reconstruction facilitates viewing the breast volume in any desired orientation. Ongoing clinical studies, the current state-of-the art, and research to advance the technology are described. Learning Objectives: To understand the ongoing developments in x-ray imaging of the breast To understand the approaches and applications of spectral mammography To understand the potential advantages of distributed x-ray source arrays for digital breast tomosynthesis To understand the ongoing developments in detector technology for digital mammography and breast tomosynthesis To understand the current state-of-the-art for dedicated cone-beam breast CT and research to advance the technology. Research collaboration with Koning Corporation
207 EFFECTS OF HOT AND COLD WATER PRE- TREATMENTS ...
African Journals Online (AJOL)
The treatments used were immersion of the seeds in cold water (at room o temperature) for 8, 12 and ... goat, sheep and cattle in the semi arid regions due to the palatability of its ... visible signs of infestation were selected out of the total seeds ...
TU-EF-207-05: Dedicated Cone-beam Breast CT
Energy Technology Data Exchange (ETDEWEB)
Vedantham, S. [Univ. of Massachusetts Medical School (United States)
2015-06-15
Breast imaging technology is advancing on several fronts. In digital mammography, the major technological trend has been on optimization of approaches for performing combined mammography and tomosynthesis using the same system. In parallel, photon-counting slot-scan mammography is now in clinical use and more efforts are directed towards further development of this approach for spectral imaging. Spectral imaging refers to simultaneous acquisition of two or more energy-windowed images. Depending on the detector and associated electronics, there are a number of ways this can be accomplished. Spectral mammography using photon-counting detectors can suppress electronic noise and importantly, it enables decomposition of the image into various material compositions of interest facilitating quantitative imaging. Spectral imaging can be particularly important in intravenously injected contrast mammography and eventually tomosynthesis. The various approaches and applications of spectral mammography are discussed. Digital breast tomosynthesis relies on the mechanical movement of the x-ray tube to acquire a number of projections in a predefined arc, typically from 9 to 25 projections over a scan angle of +/−7.5 to 25 degrees depending on the particular system. The mechanical x-ray tube motion requires relatively long acquisition time, typically between 3.7 to 25 seconds depending on the system. Moreover, mechanical scanning may have an effect on the spatial resolution due to internal x-ray filament or external mechanical vibrations. New x-ray source arrays have been developed and they are aimed at replacing the scanned x-ray tube for improved acquisition time and potentially for higher spatial resolution. The potential advantages and challenges of this approach are described. Combination of digital mammography and tomosynthesis in a single system places increased demands on certain functional aspects of the detector and overall performance, particularly in the tomosynthesis mode due to lower photon fluence per projection. This may require fast-frame acquisition and symmetric or asymmetric pixel binning in some systems. Recent studies investigated the performance of increased conversion layer thickness for contrast-enhanced imaging of the breast in dual-energy acquisition mode. In other direct conversion detectors operating in the avalanche mode, sensitivities close to the single photon response are also explored for mammography and breast tomosynthesis. The potential advantages and challenges of this approach are described. Dedicated breast CT brings x-ray imaging of the breast to true tomographic 3D imaging. It can eliminate the tissue superposition problem and does not require physical compression of the breast. Using cone beam geometry and a flat-panel detector, several hundred projections are acquired and reconstructed to near isotropic voxels. Multiplanar reconstruction facilitates viewing the breast volume in any desired orientation. Ongoing clinical studies, the current state-of-the art, and research to advance the technology are described. Learning Objectives: To understand the ongoing developments in x-ray imaging of the breast To understand the approaches and applications of spectral mammography To understand the potential advantages of distributed x-ray source arrays for digital breast tomosynthesis To understand the ongoing developments in detector technology for digital mammography and breast tomosynthesis To understand the current state-of-the-art for dedicated cone-beam breast CT and research to advance the technology. Research collaboration with Koning Corporation.
Translating cultural transition in Kgebetli Moele’s Room 207
Directory of Open Access Journals (Sweden)
S.S. Ibinga
2010-07-01
Full Text Available This article deals with the issue of cultural translation in a postapartheid text through the analysis of language, setting and discourse to highlight cultural transition in a society where socio-political mutations elicit new literary codes and symbols. The discussion is developed around concepts such as gender and ethnic identity or citizenship in a geographical environment where multi- and transcultural identities are endlessly being contested. The concept of translation is explored to show how Moele’s text represents cultural transition within a postapartheid urban context by analysing the authorial transposition of everyday experience into the textual fabric. The article also examines how the narrative voice negotiates across the current multicultural divide in order to highlight cultural change both in South African literature and in society as a whole. This article addresses in the discussion the controversial debate raised by Michael Titlestad’s (2007 review of the book published in the “Sunday times” on 25 March in which the critic evinces a negative reception of the book. This is used as a point of departure in order to explore a wide range of possibilities that fiction can offer by means of textual representation of the daily experience of black people in a postapartheid urban context.
48 CFR 1415.207-71 - Confidentiality of proposal evaluation.
2010-10-01
... THE INTERIOR CONTRACTING METHODS AND CONTRACT TYPES CONTRACTING BY NEGOTIATION Solicitation and... evaluators and advisors shall sign a Conflict of Interest Certificate and a Confidentiality Certificate in a... outside the Government shall take into consideration requirements for avoiding individual conflicts of...
19 CFR 207.45 - Investigation to review outstanding determination.
2010-04-01
... FAIR VALUE OR FROM SUBSIDIZED EXPORTS TO THE UNITED STATES Terminated, Suspended, and Continued... description of changed circumstances sufficient to warrant the institution of a review investigation by the... of the receipt of a request, the Commission shall determine whether the request shows changed...
48 CFR 871.207 - Payment of tuition or fees.
2010-10-01
... prorated on the basis of attendance, regardless of the refund policy. (3) If an institution customarily charges for the amount of credit or number of hours of attendance for which a trainee enrolls, payment may... policy providing for a graduated scale of charges for purposes of determining refunds may be paid part or...
29 CFR 779.207 - Related activities in retail operations.
2010-07-01
... ACT AS APPLIED TO RETAILERS OF GOODS OR SERVICES Employment to Which the Act May Apply; Enterprise... store are “related activities,” even if the store sells a great variety of different types of goods and... of goods or services, of any type, are related activities and they will be considered one enterprise...
48 CFR 5.207 - Preparation and transmittal of synopses.
2010-10-01
... the World Trade Organization Government Procurement Agreement and Free Trade Agreements.” (iii) If the... the synopsis: “One or more of the items under this acquisition is subject to the World Trade Organization Government Procurement Agreement and Free Trade Agreements.” (14) In the case of noncompetitive...
30 CFR 207.5 - Contract and sales agreement retention.
2010-07-01
... production are to be maintained by the lessee and made available upon request during normal working hours to... Accounting Office, or other persons authorized to receive such documents, or shall be submitted to MMS within...
MO-AB-207-03: ACR Update in Nuclear Medicine
International Nuclear Information System (INIS)
Harkness, B.
2015-01-01
A goal of an imaging accreditation program is to ensure adequate image quality, verify appropriate staff qualifications, and to assure patient and personnel safety. Currently, more than 35,000 facilities in 10 modalities have been accredited by the American College of Radiology (ACR), making the ACR program one of the most prolific accreditation options in the U.S. In addition, ACR is one of the accepted accreditations required by some state laws, CMS/MIPPA insurance and others. Familiarity with the ACR accreditation process is therefore essential to clinical diagnostic medical physicists. Maintaining sufficient knowledge of the ACR program must include keeping up-to-date as the various modality requirements are refined to better serve the goals of the program and to accommodate newer technologies and practices. This session consists of presentations from authorities in four ACR accreditation modality programs, including magnetic resonance imaging, computed tomography, nuclear medicine, and mammography. Each speaker will discuss the general components of the modality program and address any recent changes to the requirements. Learning Objectives: To understand the requirements of the ACR MR Accreditation program. The discussion will include accreditation of whole-body general purpose magnets, dedicated extremity systems well as breast MRI accreditation. Anticipated updates to the ACR MRI Quality Control Manual will also be reviewed. To understand the requirements of the ACR CT accreditation program, including updates to the QC manual as well as updates through the FAQ process. To understand the requirements of the ACR nuclear medicine accreditation program, and the role of the physicist in annual equipment surveys and the set up and supervision of the routine QC program. To understand the current ACR MAP Accreditation requirement and present the concepts and structure of the forthcoming ACR Digital Mammography QC Manual and Program