WorldWideScience

Sample records for acetoacetyl coa thiolase

  1. Reverse genetic characterization of two paralogous acetoacetyl CoA thiolase genes in Arabidopsis reveals their importance in plant growth and development

    Jin, Huanan; Song, Zhihong; Nikolau, Basil J.

    2012-03-31

    Acetoacetyl CoA thiolase (AACT, EC 2.3.1.9) catalyzes the condensation of two acetyl CoA molecules to form acetoacetyl CoA. Two AACT‐encoding genes, At5g47720 (AACT1) and At5g48230 (AACT2), were functionally identified in the Arabidopsis genome by direct enzymological assays and functional expression in yeast. Promoter::GUS fusion experiments indicated that AACT1 is primarily expressed in the vascular system and AACT2 is highly expressed in root tips, young leaves, top stems and anthers. Characterization of T‐DNA insertion mutant alleles at each AACT locus established that AACT2 function is required for embryogenesis and for normal male gamete transmission. In contrast, plants lacking AACT1 function are completely viable and show no apparent growth phenotypes, indicating that AACT1 is functionally redundant with respect to AACT2 function. RNAi lines that express reduced levels of AACT2 show pleiotropic phenotypes, including reduced apical dominance, elongated life span and flowering duration, sterility, dwarfing, reduced seed yield and shorter root length. Microscopic analysis reveals that the reduced stature is caused by a reduction in cell size and fewer cells, and male sterility is caused by loss of the pollen coat and premature degeneration of the tapetal cells. Biochemical analyses established that the roots of AACT2 RNAi plants show quantitative and qualitative alterations in phytosterol profiles. These phenotypes and biochemical alterations are reversed when AACT2 RNAi plants are grown in the presence of mevalonate, which is consistent with the role of AACT2 in generating the bulk of the acetoacetyl CoA precursor required for the cytosol‐localized, mevalonate‐derived isoprenoid biosynthetic pathway.

  2. Generation of poly-β-hydroxybutyrate from acetate in higher plants: Detection of acetoacetyl CoA reductase- and PHB synthase- activities in rice.

    Tsuda, Hirohisa; Shiraki, Mari; Inoue, Eri; Saito, Terumi

    2016-08-20

    It has been reported that Poly-β-hydroxybutyrate (PHB) is generated from acetate in the rice root. However, no information is available about the biosynthetic pathway of PHB from acetate in plant cells. In the bacterium Ralstonia eutropha H16 (R. eutropha), PHB is synthesized from acetyl CoA by the consecutive reaction of three enzymes: β-ketothiolase (EC: 2.3.1.9), acetoacetyl CoA reductase (EC: 1.1.1.36) and PHB synthase (EC: 2.3.1.-). Thus, in this study, we examined whether the above three enzymatic activities were also detected in rice seedlings. The results clearly showed that the activities of the above three enzymes were all detected in rice. In particular, the PHB synthase activity was detected specifically in the sonicated particulate fractions (2000g 10min precipitate (ppt) and the 8000g 30min ppt) of rice roots and leaves. In addition to these enzyme activities, several new experimental results were obtained on PHB synthesis in higher plants: (a) (14)C-PHB generated from 2-(14)C-acetate was mainly localized in the 2000g 10min ppt and the 8000g 30min ppt of rice root. (b) Addition of acetate (0.1-10mM) to culture medium of rice seedlings did not increase the content of PHB in the rice root or leaf. (c) In addition to C3 plants, PHB was generated from acetate in a C4 plant (corn) and in a CAM plant (Bryophyllum pinnatum). d) Washing with ethylenediaminetetraacetic acid (EDTA) strongly suggested that the PHB synthesized from acetate was of plant origin and was not bacterial contamination. PMID:27372278

  3. Crystal structure of a thiolase from Escherichia coli at 1.8 Å resolution.

    Ithayaraja, M; Janardan, N; Wierenga, Rik K; Savithri, H S; Murthy, M R N

    2016-07-01

    Thiolases catalyze the Claisen condensation of two acetyl-CoA molecules to give acetoacetyl-CoA, as well as the reverse degradative reaction. Four genes coding for thiolases or thiolase-like proteins are found in the Escherichia coli genome. In this communication, the successful cloning, purification, crystallization and structure determination at 1.8 Å resolution of a homotetrameric E. coli thiolase are reported. The structure of E. coli thiolase co-crystallized with acetyl-CoA at 1.9 Å resolution is also reported. As observed in other tetrameric thiolases, the present E. coli thiolase is a dimer of two tight dimers and probably functions as a biodegradative enzyme. Comparison of the structure and biochemical properties of the E. coli enzyme with those of other well studied thiolases reveals certain novel features of this enzyme, such as the modification of a lysine in the dimeric interface, the possible oxidation of the catalytic Cys88 in the structure of the enzyme obtained in the presence of CoA and active-site hydration. The tetrameric enzyme also displays an interesting departure from exact 222 symmetry, which is probably related to the deformation of the tetramerization domain that stabilizes the oligomeric structure of the protein. The current study allows the identification of substrate-binding amino-acid residues and water networks at the active site and provides the structural framework required for understanding the biochemical properties as well as the physiological function of this E. coli thiolase. PMID:27380370

  4. Functional Expression of the Thiolase Gene thl from Clostridium beijerinckii P260 in Lactococcus lactis and Lactobacillus buchneri

    The first step of the butanol pathway involves an acetyl-CoA acetyltransferase (ACoAAT), which controls the key branching point from acetyl-CoA to butanol. ACoAAT, also known as thiolase (EC 2.3.1.9), is encoded by the thl gene and catalyzes ligation of 2 acetyl-CoA into acetoacetyl-CoA. Bioinform...

  5. Crystal structure and biochemical characterization of beta-keto thiolase B from polyhydroxyalkanoate-producing bacterium Ralstonia eutropha H16

    Highlights: • We determined a crystal structure of β-keto thiolase from Ralstonia eutropha H16 (ReBktB). • Distinct substrate binding mode ReBktB was elucidated. • Enzymatic kinetic parameters of ReBktB were revealed. - Abstract: ReBktB is a β-keto thiolase from Ralstonia eutropha H16 that catalyzes condensation reactions between acetyl-CoA with acyl-CoA molecules that contains different numbers of carbon atoms, such as acetyl-CoA, propionyl-CoA, and butyryl-CoA, to produce valuable bioproducts, such as polyhydroxybutyrate, polyhydroxybutyrate-hydroxyvalerate, and hexanoate. We solved a crystal structure of ReBktB at 2.3 Å, and the overall structure has a similar fold to that of type II biosynthetic thiolases, such as PhbA from Zoogloea ramigera (ZrPhbA). The superposition of this structure with that of ZrPhbA complexed with CoA revealed the residues that comprise the catalytic and substrate binding sites of ReBktB. The catalytic site of ReBktB contains three conserved residues, Cys90, His350, and Cys380, which may function as a covalent nucleophile, a general base, and second nucleophile, respectively. For substrate binding, ReBktB stabilized the ADP moiety of CoA in a distinct way compared to ZrPhbA with His219, Arg221, and Asp228 residues, whereas the stabilization of β-mercaptoethyamine and pantothenic acid moieties of CoA was quite similar between these two enzymes. Kinetic study of ReBktB revealed that Km, Vmax, and Kcat values of 11.58 μM, 1.5 μmol/min, and 102.18 s−1, respectively, and the catalytic and substrate binding sites of ReBktB were further confirmed by site-directed mutagenesis experiments

  6. Crystal structure of a monomeric thiolase-like protein type 1 (TLP1 from Mycobacterium smegmatis.

    Neelanjana Janardan

    Full Text Available An analysis of the Mycobacterium smegmatis genome suggests that it codes for several thiolases and thiolase-like proteins. Thiolases are an important family of enzymes that are involved in fatty acid metabolism. They occur as either dimers or tetramers. Thiolases catalyze the Claisen condensation of two acetyl-Coenzyme A molecules in the synthetic direction and the thiolytic cleavage of 3-ketoacyl-Coenzyme A molecules in the degradative direction. Some of the M. smegmatis genes have been annotated as thiolases of the poorly characterized SCP2-thiolase subfamily. The mammalian SCP2-thiolase consists of an N-terminal thiolase domain followed by an additional C-terminal domain called sterol carrier protein-2 or SCP2. The M. smegmatis protein selected in the present study, referred to here as the thiolase-like protein type 1 (MsTLP1, has been biochemically and structurally characterized. Unlike classical thiolases, MsTLP1 is a monomer in solution. Its structure has been determined at 2.7 Å resolution by the single wavelength anomalous dispersion method. The structure of the protomer confirms that the N-terminal domain has the thiolase fold. An extra C-terminal domain is indeed observed. Interestingly, it consists of six β-strands forming an anti-parallel β-barrel which is completely different from the expected SCP2-fold. Detailed sequence and structural comparisons with thiolases show that the residues known to be essential for catalysis are not conserved in MsTLP1. Consistent with this observation, activity measurements show that MsTLP1 does not catalyze the thiolase reaction. This is the first structural report of a monomeric thiolase-like protein from any organism. These studies show that MsTLP1 belongs to a new group of thiolase related proteins of unknown function.

  7. Phylogenetic analysis of the thiolase family. Implications for the evolutionary origin of peroxisomes.

    Igual, J C; González-Bosch, C; Dopazo, J; Pérez-Ortín, J E

    1992-08-01

    The thiolase family is a widespread group of proteins present in prokaryotes and three cellular compartments of eukaryotes. This fact makes this family interesting in order to study the evolutionary process of eukaryotes. Using the sequence of peroxisomal thiolase from Saccharomyces cerevisiae recently obtained by us and the other known thiolase sequences, a phylogenetic analysis has been carried out. It shows that all these proteins derived from a primitive enzyme, present in the common ancestor of eubacteria and eukaryotes, which evolved into different specialized thiolases confined to various cell compartments. The evolutionary tree obtained is compatible with the endosymbiotic theory for the origin of peroxisomes. PMID:1354266

  8. Molecular cloning, gene structure and expression profile of two mouse peroxisomal 3-ketoacyl-CoA thiolase genes

    Latruffe Norbert

    2004-03-01

    Full Text Available Abstract Background In rats, two peroxisomal 3-ketoacyl-CoA thiolase genes (A and B have been cloned, whereas only one thiolase gene is found in humans. The aim of this study was thus to clone the different mouse thiolase genes in order to study both their tissue expression and their associated enzymatic activity. Results In this study, we cloned and characterized two mouse peroxisomal 3-ketoacyl-CoA thiolase genes (termed thiolase A and B. Both thiolase A and B genes contain 12 exons and 11 introns. Using RNA extracted from mouse liver, we cloned the two corresponding cDNAs. Thiolase A and B cDNAs possess an open reading frame of 1272 nucleotides encoding a protein of 424 amino acids. In the coding sequence, the two thiolase genes exhibited ≈97% nucleotide sequence identity and ≈96% identity at the amino acid level. The tissue-specific expression of the two peroxisomal 3-ketoacyl-CoA thiolase genes was studied in mice. Thiolase A mRNA was mainly expressed in liver and intestine, while thiolase B mRNA essentially exhibited hepatic expression and weaker levels in kidney, intestine and white adipose tissue. Thiolase A and B expressions in the other tissues such as brain or muscle were very low though these tissues were chiefly involved in peroxisomal disorders. At the enzymatic level, thiolase activity was detected in liver, kidney, intestine and white adipose tissue but no significant difference was observed between these four tissues. Moreover, thiolase A and B genes were differently induced in liver of mice treated with fenofibrate. Conclusion Two mouse thiolase genes and cDNAs were cloned. Their corresponding transcripts are mostly expressed in the liver of mice and are differently induced by fenofibrate.

  9. Two different subcellular-localized Acetoacetyl-CoA acetyltransferases differentiate diverse functions in Magnaporthe oryzae.

    Zhong, Zhenhui; Norvienyeku, Justice; Yu, Jie; Chen, Meilian; Cai, Renli; Hong, Yonghe; Chen, Liqiong; Zhang, Dongmei; Wang, Baohua; Zhou, Jie; Lu, Guodong; Chen, Xiaofeng; Wang, Zonghua

    2015-10-01

    The mevalonate pathway is an efficient biosynthesis pathway that yields isoprenoids for promoting different crucial cellular functions, including ergosterol synthesis and growth regulation. Acetoacetyl-CoA acetyltransferase (EC2.3.1.9) is the first major catalytic enzyme constituting the mevalonate pathway and catalyzes the transformation of Acetoacetyl-CoA from two molecules of acetyl-CoA enroute ergosterol production in fungi. We identified two homologous genes encoding Acetoacetyl-CoA acetyltransferase (MoAcat1 and MoAcat2) in Magnaporthe oryzae, the rice blast fungus. Phylogenetic analysis indicates these two genes have different evolutionary history. We subsequently, conducted targeted gene deletion using homologous recombination technology to ascertain the unique roles of the two MoAcat homologues during the fungal morphogenesis and pathogenesis. The findings from our investigations showed that the activity of MoAcat1 promoted virulence in the rice blast fungus as such, the ΔMoacat1 mutants generated exhibited defect in virulence, whilst ΔMoacat1 mutants did not portray growth defects. ΔMoacat2 mutants on the other hand were characterized by reduction in growth and virulence. Furthermore, MoAcat1 and MoAcat2 showed different expression patterns and subcellular localizations in M. oryzae. From our investigations we came to the conclusion that, different subcellular localization contributes to the diverse functions of MoAcat1 and MoAcat2, which helps the successful establishment of blast disease by promoting efficient development of cell morphology and effective colonization of host tissue. PMID:26318870

  10. Disease: H01076 [KEGG MEDICUS

    Full Text Available abolism caused by a deficiency of mitochondrial acetoacetyl-CoA thiolase. The patients present with intermit...hemical, and clinical characterization of mitochondrial acetoacetyl-coenzyme A thiolase deficiency in two further patients

  11. Differences among Adult COAs and Adult Non-COAs on Levels of Self-Esteem, Depression, and Anxiety.

    Dodd, David T.; Roberts, Richard L.

    1994-01-01

    Examined self-esteem, depression, and anxiety among 60 adult children of alcoholics (COAs) and 143 adult non-COAs. Subjects completed Children of Alcoholics Screening Test, demographic questionnaire, Beck Depression Inventory, State-Trait Anxiety Inventory, and Coopersmith Self-Esteem Inventory. Found no significant differences between COAs and…

  12. Fatty acid oxidation in brain is limited by the low activity of 3-ketoacyl-CoA thiolase

    In an attempt to establish why the brain is virtually incapable of oxidizing fatty acids, the activities of the β-oxidation enzymes in rat brain and rat heart mitochondria were measured and compared with each other. Although the apparent K/sub m/ values and chain-length specificities of the brain and heart enzymes are similar, the specific activities of all but one brain enzyme are between 4% and 50% of those observed in heart mitochondria. The exception is 3-ketoacyl-CoA thiolase (EC 2.3.1.16) whose specific activity in brain mitochondria is 125-times lower than in heart mitochondria. The partially purified brain 3-ketoacyl-CoA thiolase was shown to be catalytically and immunologically identical with the heart enzyme. The low rate of fatty acid oxidation in brain mitochondria estimated on the basis of palmitoylcarnitine-supported respiration and [1-14C]palmitoylcarnitine degradation may be the consequence of the low activity of 3-ketoacyl-CoA thiolase. Inhibition of [1-14C]palmitoylcarnitine oxidation by 4-bromocrotonic acid proves that the observed oxidation of fatty acids in brain is dependent on 3-ketoacyl-CoA thiolase and thus occurs via β-oxidation. Since the reactions catalyzed by carnitine palmitoyltransferase (EC 2.3.1.21) and acyl-CoA synthetase (EC 6.2.1.3) do not seem to restrict fatty acid oxidation in brain, it is concluded that the oxidation of fatty acids in rat brain is limited by the activity of the mitochondrial 3-ketoacyl-CoA thiolase

  13. Characterisation of Acetyl-CoA Thiolase: The First Enzyme in the Biosynthesis of Terpenic Sex Pheromone Components in the Labial Gland of Bombus terrestris

    Brabcová, Jana; Demianová, Z.; Kindl, Jiří; Pichová, Iva; Valterová, Irena; Zarevúcka, Marie

    2015-01-01

    Roč. 16, č. 7 (2015), s. 1047-1051. ISSN 1439-4227 R&D Projects: GA TA ČR TA01020969 Institutional support: RVO:61388963 Keywords : acetyl-CoA thiolase * biosynthesis * Bombus terrestris * labial gland * pheromones * terpenoids Subject RIV: CE - Biochemistry Impact factor: 3.088, year: 2014

  14. Characterisation of Acetyl-CoA Thiolase: The First Enzyme in the Biosynthesis of Terpenic Sex Pheromone Components in the Labial Gland of Bombus terrestris.

    Brabcová, Jana; Demianová, Zuzana; Kindl, Jiří; Pichová, Iva; Valterová, Irena; Zarevúcka, Marie

    2015-05-01

    Buff-tailed bumblebees, Bombus terrestris, use a male sex pheromone for premating communication. Its main component is a sesquiterpene, 2,3-dihydrofarnesol. This paper reports the isolation of a thiolase (acetyl-CoA thiolase, AACT_BT), the first enzyme involved in the biosynthetic pathway leading to formation of isoprenoids in the B. terrestris male sex pheromone. Characterisation of AACT_BT might contribute to a better understanding of pheromonogenesis in the labial gland of B. terrestris males. The protein was purified to apparent homogeneity by column chromatography with subsequent stepwise treatment. AACT_BT showed optimum acetyltransferase activity at pH 7.1 and was strongly inhibited by iodoacetamide. The enzyme migrated as a band with an apparent mass of 42.9 kDa on SDS-PAGE. MS analysis of an AACT_BT tryptic digest revealed high homology to representatives of the thiolase family. AACT_BT has 96 % amino acid sequence identity with the previously reported Bombus impatiens thiolase. PMID:25801592

  15. COA based robust output feedback UPFC controller design

    In this paper, a novel method for the design of output feedback controller for unified power flow controller (UPFC) using chaotic optimization algorithm (COA) is developed. Chaotic optimization algorithms, which have the features of easy implementation, short execution time and robust mechanisms of escaping from the local optimum, is a promising tool for the engineering applications. The selection of the output feedback gains for the UPFC controllers is converted to an optimization problem with the time domain-based objective function which is solved by a COA based on Lozi map. Since chaotic mapping enjoys certainty, ergodicity and the stochastic property, the proposed chaotic optimization problem introduces chaos mapping using Lozi map chaotic sequences which increases its convergence rate and resulting precision. To ensure the robustness of the proposed stabilizers, the design process takes into account a wide range of operating conditions and system configurations. The effectiveness of the proposed controller for damping low frequency oscillations is tested and demonstrated through non-linear time-domain simulation and some performance indices studies. The results analysis reveals that the designed COA based output feedback UPFC damping controller has an excellent capability in damping power system low frequency oscillations and enhance greatly the dynamic stability of the power systems.

  16. Identification of a novel CoA synthase isoform, which is primarily expressed in Brain

    CoA and its derivatives Acetyl-CoA and Acyl-CoA are important players in cellular metabolism and signal transduction. CoA synthase is a bifunctional enzyme which mediates the final stages of CoA biosynthesis. In previous studies, we have reported molecular cloning, biochemical characterization, and subcellular localization of CoA synthase (CoASy). Here, we describe the existence of a novel CoA synthase isoform, which is the product of alternative splicing and possesses a 29aa extension at the N-terminus. We termed it CoASy β and originally identified CoA synthase, CoASy α. The transcript specific for CoASy β was identified by electronic screening and by RT-PCR analysis of various rat tissues. The existence of this novel isoform was further confirmed by immunoblot analysis with antibodies directed to the N-terminal peptide of CoASy β. In contrast to CoASy α, which shows ubiquitous expression, CoASy β is primarily expressed in Brain. Using confocal microscopy, we demonstrated that both isoforms are localized on mitochondria. The N-terminal extension does not affect the activity of CoA synthase, but possesses a proline-rich sequence which can bring the enzyme into complexes with signalling proteins containing SH3 or WW domains. The role of this novel isoform in CoA biosynthesis, especially in Brain, requires further elucidation

  17. Mosaic Conservation Opportunity Areas - Liberal Model (ECO_RES.COA_MOSAIC33)

    U.S. Environmental Protection Agency — The COA_Mosaic33 layer designates areas with potential for forest/grassland mosaic conservation. These are areas of natural or semi-natural forest/grassland mosaic...

  18. Cryogenic Optical Assembly (COA) cooldown analysis for the Cosmic Background Explorer (COBE)

    Coladonato, Robert J.; Irish, Sandra M.; Mosier, Carol L.

    1990-01-01

    The Cosmic Background Explorer (COBE) spacecraft, developed by Goddard Space Flight Center (GSFC), was successfully launched on November 18, 1989 aboard a Delta expendable launch vehicle. Two of the three instruments for this mission were mounted inside a liquid helium (LHe) dewar which operates at a temperature of 2 K. These two instruments are the Diffuse Infrared Background Experiment (DIRBE) and the Far Infrared Absolute Spectrophotometer (FIRAS). They are mounted to a common Instrument Interface Structure (IIS) and the entire assembly is called the Cryogenic Optical Assembly (COA). As part of the structural verification requirement, it was necessary to show that the entire COA exhibited adequate strength and would be capable of withstanding the launch environment. This requirement presented an unique challenge for COBE because the COA is built and assembled at room temperature (300 K), cooled to 2 K, and then subjected to launch loads. However, strength testing of the entire COA at 2 K could not be done because of facility limitations. Therefore, it was decided to perform the strength verification of the COA by analysis.

  19. Effect of elevated total CoA levels on metabolic pathways in cultured hepatocytes

    Livers from fasted rats have 30% higher total CoA levels than fed rats. To determine whether this increase of total CoA influences metabolism, the rates of gluconeogenesis, fatty acid oxidation and ketogenesis were measured in hepatocytes with cyanamide (CYM) or pantothenate (PA) deficient medium used to vary total CoA levels independently of hormonal status. Primary cultures of rat hepatocytes were incubated 14 hrs with Bt2 cAMP, dexamethasone + theophylline in PA deficient medium or with CYM (500 μM) + PA, rinsed and preincubated 0.5 hr to remove the CYM. Hepatocytes treated with CYM had total CoA levels 10-24% higher than PA deficient cells and lower rates of glucose production from lactate + pyruvate (L/P) or from alanine (0.23 +/- 0.05 and 0.089 +/- 0.02 μm/mg protein, respectively in CYM treated cells compared to 0.33 +/- 0.06 and 0.130 +/- 0.006 in PA deficient cells). This decrease was not due to CYM per se, as the direct addition of CYM stimulated glucose production from L/P. CYM treated cells with 15-40% higher total CoA and 30% higher fatty acyl-CoA levels had the same rates of [14C]-palmitate oxidation as PA deficient cells. However, rates of ketogenesis were lower in CYM treated cells (163 +/- 11 nm/mg compared to 217 +/- 14 nm/mg protein). These results suggest that physiological alterations of hepatic total CoA levels are not necessary for fasting rates of gluconeogenesis, fatty acid oxidation and ketogenesis

  20. The COA360: a tool for assessing the cultural competency of healthcare organizations.

    LaVeist, Thomas A; Relosa, Rachel; Sawaya, Nadia

    2008-01-01

    The U.S. Census Bureau projects that by 2050, non-Hispanic whites will be in the numerical minority. This rapid diversification requires healthcare organizations to pay closer attention to cross-cultural issues if they are to meet the healthcare needs of the nation and continue to maintain a high standard of care. Although scorecards and benchmarking are widely used to gauge healthcare organizations' performance in various areas, these tools have been underused in relation to cultural preparedness or initiatives. The likely reason for this is the lack of a validated tool specifically designed to examine cultural competency. Existing validated cultural competency instruments evaluate individuals, not organizations. In this article, we discuss a study to validate the Cultural Competency Organizational Assessment--360 or the COA360, an instrument designed to appraise a healthcare organization's cultural competence. The Office of Minority Health and the Joint Commission have each developed standards for measuring the cultural competency of organizations. The COA360 is designed to assess adherence to both of these sets of standards. For this validation study, we enlisted a panel of national experts. The panel rated each dimension of the COA360, and the combination of items for each of the scale's 14 dimensions was rated above 4.13 (on 5-point scale). Our conclusion points to the validity of the COA360. As such, it is a valuable tool not only for assessing a healthcare organization's cultural readiness but also for benchmarking its progress in addressing cultural and diversity issues. PMID:18720687

  1. CoaSim: A Flexible Environment for Simulating Genetic Data under Coalescent Models

    Mailund; Schierup, Mikkel Heide; Pedersen, Christian Nørgaard Storm;

    2005-01-01

    get insight into these. Results We have created the CoaSim application as a flexible environment for Monte various types of genetic data under equilibrium and non-equilibrium coalescent variety of applications. Interaction with the tool is through the Guile version scripting language. Scheme scripts...

  2. Liver fatty acid binding protein (LFABP) transfers fatty acids and fatty acyl coas to membranes

    De Gerónimo, Eduardo; Hagan, Robert M; Wilton, David C.; Córsico, Betina

    2010-01-01

    The objective of this work was to analyze LFABP´s capacity to transfer acyl CoAs to artificial membranes and compare it to LCFA transfer employing natural ligands, in order to better understand the specific physiological role of LFABP in the cell.

  3. Kinetic properties and inhibition of Trypanosoma cruzi 3-hydroxy-3-methylglutaryl CoA reductase

    Hurtado-Guerrrero, Ramón; Pena Diaz, Javier; Montalvetti, Andrea; Ruiz-Pérez, Luis M; González-Pacanowska, Dolores

    2002-01-01

    A detailed kinetic analysis of the recombinant soluble enzyme 3-hydroxy-3-methylglutaryl CoA reductase (HMGR) from Trypanosoma cruzi has been performed. The enzyme catalyzes the normal anabolic reaction and the reductant is NADPH. It also catalyzes the oxidation of mevalonate but at a lower propo...

  4. Model simulations of cooking organic aerosol (COA) over the UK using estimates of emissions based on measurements at two sites in London

    Ots, Riinu; Vieno, Massimo; Allan, James D.; Reis, Stefan; Nemitz, Eiko; Young, Dominique E.; Coe, Hugh; Marco, Chiara; Detournay, Anais; MacKenzie, Ian A; Green, David C.; Heal, Mathew R.

    2016-01-01

    Cooking organic aerosol (COA) is currently not included in European emission inventories. However, recent positive matrix factorization (PMF) analyses of aerosol mass spectrometer (AMS) measurements have suggested important contributions of COA in several European cities. In this study, emissions of COA were estimated for the UK, based on hourly AMS measurements of COA made at two sites in London (a kerbside site in central London and an urban background site in a residential area close to ce...

  5. Intracellular signal transduction of PBAN action in the silkworm, Bombyx mori: involvement of acyl CoA reductase.

    Ozawa, R; Matsumoto, S

    1996-03-01

    In the silkworm, Bombyx mori, production of the sex pheromone bombykol is regulated by a neurohormone termed PBAN. We have detected the activity of acyl CoA reductase in the pheromone gland of B. mori by using palmitoyl CoA as a substrate. The acyl CoA reductase requires NADPH, but not NADH, as a proton dono. When the pheromone gland was incubated with the PBAN fragment peptide TKYFSPRLamide, palmitoyl CoA was incorporated and converted into the corresponding C16 alcohols. Radio HPLC analysis revealed that these C16 alcohols were hexadecan-1-ol (81.2%), (Z)-11-hexadecen-1-ol (12.3%), and (E, Z)-10, 12-hexadecadien-1-ol (= bombykol, 6.5%). The production of C16 alcohols in the pheromone gland was inhibited by the known bombykol biosynthesis inhibitors EDTA, LaCl3, W-7, trifluoperazine, p-nitrophenyl phosphate, NaF and compactin. By contrast, when the pheromone gland homogenate was incubated in the presence of palmitoyl CoA and NADPH, production of C16 alcohols was affected by compactin, W-7 and trifluoperazine, but not by EDTA, LaCl3, p-nitrophenyl phosphate and NaF. These results indicate that compactin, W-7 and trifluoperazine directly suppress the step catalyzed by acyl CoA reductase, whereas EDTA, LaCl3, pNPP, and NaF inhibit bombykol production by affecting other biochemical steps in the signal transduction of PBAN action. The present results also imply that PBAN regulates the step catalyzed by acyl CoA reductase and that palmitoyl CoA could be used as a substrate of the acyl CoA reductase that regulates bombykol biosynthesis. PMID:8900596

  6. Treatment with the 3-ketoacyl-CoA thiolase inhibitor trimetazidine does not exacerbate whole-body insulin resistance in obese mice.

    Ussher, John R; Keung, Wendy; Fillmore, Natasha; Koves, Timothy R; Mori, Jun; Zhang, Liyan; Lopaschuk, David G; Ilkayeva, Olga R; Wagg, Cory S; Jaswal, Jagdip S; Muoio, Deborah M; Lopaschuk, Gary D

    2014-06-01

    There is a growing need to understand the underlying mechanisms involved in the progression of cardiovascular disease during obesity and diabetes. Although inhibition of fatty acid oxidation has been proposed as a novel approach to treat ischemic heart disease and heart failure, reduced muscle fatty acid oxidation rates may contribute to the development of obesity-associated insulin resistance. Our aim was to determine whether treatment with the antianginal agent trimetazidine, which inhibits fatty acid oxidation in the heart secondary to inhibition of 3-ketoacyl-CoA thiolase (3-KAT), may have off-target effects on glycemic control in obesity. We fed C57BL/6NCrl mice a high-fat diet (HFD) for 10 weeks before a 22-day treatment with the 3-KAT inhibitor trimetazidine (15 mg/kg per day). Insulin resistance was assessed via glucose/insulin tolerance testing, and lipid metabolite content was assessed in gastrocnemius muscle. Trimetazidine-treatment led to a mild shift in substrate preference toward carbohydrates as an oxidative fuel source in obese mice, evidenced by an increase in the respiratory exchange ratio. This shift in metabolism was accompanied by an accumulation of long-chain acyl-CoA and a trend to an increase in triacylglycerol content in gastrocnemius muscle, but did not exacerbate HFD-induced insulin resistance compared with control-treated mice. It is noteworthy that trimetazidine treatment reduced palmitate oxidation rates in the isolated working mouse heart and neonatal cardiomyocytes but not C2C12 skeletal myotubes. Our findings demonstrate that trimetazidine therapy does not adversely affect HFD-induced insulin resistance, suggesting that treatment with trimetazidine would not worsen glycemic control in obese patients with angina. PMID:24700885

  7. A Chemo-Enzymatic Road Map to the Synthesis of CoA Esters.

    Peter, Dominik M; Vögeli, Bastian; Cortina, Niña Socorro; Erb, Tobias J

    2016-01-01

    Coenzyme A (CoA) is a ubiquitous cofactor present in every known organism. The thioesters of CoA are core intermediates in many metabolic processes, such as the citric acid cycle, fatty acid biosynthesis and secondary metabolism, including polyketide biosynthesis. Synthesis of CoA-thioesters is vital for the study of CoA-dependent enzymes and pathways, but also as standards for metabolomics studies. In this work we systematically tested five chemo-enzymatic methods for the synthesis of the three most abundant acyl-CoA thioester classes in biology; saturated acyl-CoAs, α,β-unsaturated acyl-CoAs (i.e., enoyl-CoA derivatives), and α-carboxylated acyl-CoAs (i.e., malonyl-CoA derivatives). Additionally we report on the substrate promiscuity of three newly described acyl-CoA dehydrogenases that allow the simple conversion of acyl-CoAs into enoyl-CoAs. With these five methods, we synthesized 26 different CoA-thioesters with a yield of 40% or higher. The CoA esters produced range from short- to long-chain, include branched and α,β-unsaturated representatives as well as other functional groups. Based on our results we provide a general guideline to the optimal synthesis method of a given CoA-thioester in respect to its functional group(s) and the commercial availability of the precursor molecule. The proposed synthetic routes can be performed in small scale and do not require special chemical equipment, making them convenient also for biological laboratories. PMID:27104508

  8. A Chemo-Enzymatic Road Map to the Synthesis of CoA Esters

    Dominik M. Peter

    2016-04-01

    Full Text Available Coenzyme A (CoA is a ubiquitous cofactor present in every known organism. The thioesters of CoA are core intermediates in many metabolic processes, such as the citric acid cycle, fatty acid biosynthesis and secondary metabolism, including polyketide biosynthesis. Synthesis of CoA-thioesters is vital for the study of CoA-dependent enzymes and pathways, but also as standards for metabolomics studies. In this work we systematically tested five chemo-enzymatic methods for the synthesis of the three most abundant acyl-CoA thioester classes in biology; saturated acyl-CoAs, α,β-unsaturated acyl-CoAs (i.e., enoyl-CoA derivatives, and α-carboxylated acyl-CoAs (i.e., malonyl-CoA derivatives. Additionally we report on the substrate promiscuity of three newly described acyl-CoA dehydrogenases that allow the simple conversion of acyl-CoAs into enoyl-CoAs. With these five methods, we synthesized 26 different CoA-thioesters with a yield of 40% or higher. The CoA esters produced range from short- to long-chain, include branched and α,β-unsaturated representatives as well as other functional groups. Based on our results we provide a general guideline to the optimal synthesis method of a given CoA-thioester in respect to its functional group(s and the commercial availability of the precursor molecule. The proposed synthetic routes can be performed in small scale and do not require special chemical equipment, making them convenient also for biological laboratories.

  9. Flexible DAQ card for detector systems utilizing the CoaXPress communication standard

    This work concerns the design and construction of a flexible FPGA based data acquisition system aimed for particle detectors. The interface card as presented was designed for large area detectors with millions of individual readout channels. Flexibility was achieved by partitioning the design into multiple PCBs, creating a set of modular blocks, allowing the creation of a wide variety of configurations by simply stacking functional PCBs together. This way the user can easily toggle the polarity of the high voltage bias supply or switch the downstream interface from CoaXPress to PCIe or stream directly HDMI. We addressed the issues of data throughput, data buffering, bias voltage generation, trigger timing and fine tuning of the whole readout chain enabling a smooth data transmission. On the current prototype, we have wire-bonded a MediPix2 MXR quad and connected it to a XILINX FPGA. For the downstream interface, we implemented the CoaXPress communication protocol, which enables us to stream data at 3.125 Gbps to a standard PC

  10. A Clinical Study to Validate the Pupil Rescaling Technique by using COAS Shack Hartmann Aberrometer.

    Kalikivayi, V; Kannan, K; Ganesan, A R

    2015-01-01

    In any optical system, optical aberrations of the imaging system affect the image quality. The human eye is also like an optical system which has optical aberrations influencing the quality of the retinal image. When pupil size exceeds 3 mm, ocular aberrations increase and play a major role on retinal image degradation. Pupil diameter is made constant in commercially available aberrometers by mathematically rescaling it. The aim of this study is to validate the pupil rescaling technique by using COAS (Complete Ophthalmic Analysis System)Shack Hartmann Aberrometer. Five subjects were recruited for this study. The measurements were taken over a moderately large pupil of 5mm in normal room illumination to allow for natural pupil dilation. The analyses diameter is fixed at 5 mm in COAS which means it rescales the aberration data to 5 mm if the pupil diameter recorded was more than 5 mm at the time of measurement. Ocular aberrations for natural and rescaled pupil sizes were analyzed. Estimation of ocular aberrations showed there was no statistical significance between natural pupil and rescaled pupil diameter. PMID:25996727

  11. Purification, gene cloning, and characterization of γ-butyrobetainyl CoA synthetase from Agrobacterium sp. 525a.

    Fujimitsu, Hiroshi; Matsumoto, Akira; Takubo, Sayaka; Fukui, Akiko; Okada, Kazuma; Mohamed Ahmed, Isam A; Arima, Jiro; Mori, Nobuhiro

    2016-08-01

    The report is the first of purification, overproduction, and characterization of a unique γ-butyrobetainyl CoA synthetase from soil-isolated Agrobacterium sp. 525a. The primary structure of the enzyme shares 70-95% identity with those of ATP-dependent microbial acyl-CoA synthetases of the Rhizobiaceae family. As distinctive characteristics of the enzyme of this study, ADP was released in the catalytic reaction process, whereas many acyl CoA synthetases are annotated as an AMP-forming enzyme. The apparent Km values for γ-butyrobetaine, CoA, and ATP were, respectively, 0.69, 0.02, and 0.24 mM. PMID:27125317

  12. Structure of Mycobacterium tuberculosis phosphopantetheine adenylyltransferase in complex with the feedback inhibitor CoA reveals only one active-site conformation

    The X-ray structure of phosphopantetheine adenylyltransferase (PPAT) from M. tuberculosis in complex with its feedback regulator coenzyme A (CoA) was determined to 2.11 Å resolution. Unlike previous X-ray structures of PPAT–CoA complexes from other bacteria, which showed two distinct conformations of bound CoA, only one conformation of bound CoA is observed in the M. tuberculosis PPAT–CoA complex. Phosphopantetheine adenylyltransferase (PPAT) catalyzes the penultimate step in the coenzyme A (CoA) biosynthetic pathway, reversibly transferring an adenylyl group from ATP to 4′-phosphopantetheine to form dephosphocoenzyme A (dPCoA). To complement recent biochemical and structural studies on Mycobacterium tuberculosis PPAT (MtPPAT) and to provide further insight into the feedback regulation of MtPPAT by CoA, the X-ray crystal structure of the MtPPAT enzyme in complex with CoA was determined to 2.11 Å resolution. Unlike previous X-ray crystal structures of PPAT–CoA complexes from other bacteria, which showed two distinct CoA conformations bound to the active site, only one conformation of CoA is observed in the MtPPAT–CoA complex

  13. Structure of Mycobacterium tuberculosis phosphopantetheine adenylyltransferase in complex with the feedback inhibitor CoA reveals only one active-site conformation

    Wubben, T.; Mesecar, A.D. (Purdue); (UIC)

    2014-10-02

    Phosphopantetheine adenylyltransferase (PPAT) catalyzes the penultimate step in the coenzyme A (CoA) biosynthetic pathway, reversibly transferring an adenylyl group from ATP to 4'-phosphopantetheine to form dephosphocoenzyme A (dPCoA). To complement recent biochemical and structural studies on Mycobacterium tuberculosis PPAT (MtPPAT) and to provide further insight into the feedback regulation of MtPPAT by CoA, the X-ray crystal structure of the MtPPAT enzyme in complex with CoA was determined to 2.11 {angstrom} resolution. Unlike previous X-ray crystal structures of PPAT-CoA complexes from other bacteria, which showed two distinct CoA conformations bound to the active site, only one conformation of CoA is observed in the MtPPAT-CoA complex.

  14. COA2帮软件轻松换新家

    Sportsman

    2003-01-01

    Windows体积越来越大,而且在使用中还会不断膨胀自己,大部分软件也会默认安装在 文件夹中,时间一长,原来宽敞的C盘变得拥剂不堪,那么该如给C盘减肥呢?除到除临时文件等方法外,为什么不把原来装在C盘上的软件战略转移到其他分区?而COA2可以让你无需卸载和重装软件,直接将软件目录剪切到其他分区,从而完成快速搬家工程。

  15. Acetyl CoA Carboxylase 2 Is Dispensable for CD8+ T Cell Responses.

    Jang Eun Lee

    Full Text Available Differentiation of T cells is closely associated with dynamic changes in nutrient and energy metabolism. However, the extent to which specific metabolic pathways and molecular components are determinative of CD8+ T cell fate remains unclear. It has been previously established in various tissues that acetyl CoA carboxylase 2 (ACC2 regulates fatty acid oxidation (FAO by inhibiting carnitine palmitoyltransferase 1 (CPT1, a rate-limiting enzyme of FAO in mitochondria. Here, we explore the cell-intrinsic role of ACC2 in T cell immunity in response to infections. We report here that ACC2 deficiency results in a marginal increase of cellular FAO in CD8+ T cells, but does not appear to influence antigen-specific effector and memory CD8+ T cell responses during infection with listeria or lymphocytic choriomeningitis virus. These results suggest that ACC2 is dispensable for CD8+ T cell responses.

  16. SIRT3 deacetylates mitochondrial 3-hydroxy-3-methylglutaryl CoA synthase 2 and regulates ketone body production

    Shimazu, Tadahiro; Hirschey, Matthew D; Hua, Lan; Dittenhafer-Reed, Kristin E; Schwer, Bjoern; Lombard, David B; Li, Yu; Bunkenborg, Jakob; Alt, Frederick W; Denu, John M; Jacobson, Matthew P; Verdin, Eric

    2010-01-01

    The mitochondrial sirtuin SIRT3 regulates metabolic homeostasis during fasting and calorie restriction. We identified mitochondrial 3-hydroxy-3-methylglutaryl CoA synthase 2 (HMGCS2) as an acetylated protein and a possible target of SIRT3 in a proteomics survey in hepatic mitochondria from Sirt3(...

  17. Carnitine palmitoyl transferase activity in Morris Hepatoma 7777 mitochondria and its sensitivity to malonyl CoA inhibition

    Earlier reports in the literature have indicated no detectable Carnitine Palymitoyl Transferase (CPT) activity in homogenates prepared from Morris Hepatoma 7777. In its study CPT activity in isolated mitochondria (mito) was measured by butanol extraction of the [3H]palmitoyl carnitine formed as outlined by Bremer et al. Contrary to the earlier work where no appreciable activity of CPT was observed the authors find significant levels of CPT (2.6 nMol/min/mg protein) in isolated mito from Morris Hepatoma 7777 (MH 7777). The level of CPT activity observed in MH 7777 mito was, however, 36% lower compared to the host liver CPT activity (4.1 nMol/min/mg protein). The enzyme in MH 7777 mito showed 83% inhibition in the presence of 10 μM malonyl CoA, in agreement with the degree of sensitivity observed with the host liver isolated mito. On freeze thawing host mito, total CPT activity increased and the sensitivity of the enzyme to malonyl CoA decreased. Frozen thawed MH 7777 mito showed a similar response to malonyl CoA but no change in the total CPT level was observed. The authors results establish for the first time the presence of a malonyl CoA sensitive CPT in MH 7777 mito, which may have slightly different properties from normal due to the membrane environment of the enzyme

  18. Inhibition of neutral lipase from castor bean lipid bodies by coenzyme A (CoA) and Oleoyl-CoA

    The neutral lipase (EC 3.1.1.3) in lipid body membranes isolated from the endosperm of 4 day old castor (Ricinus communis L.) seedlings catalyzes the hydrolysis of [14C]trioleoylglycerol, releasing [14C]oleic acid for up to 4 hours. However, the addition of Mg-ATP and coenzyme A (CoA), which are present in the cytoplasm of plant cells, caused a progressive inhibition of the neutral lipase such that after 15 minutes, release of [14C]oleic acid was almost undetectable. A fatty acyl CoA synthetase was found in the lipid body membrane which converts [14C]oleic acid produced from the lipase reaction to [14C]oleoyl-CoA under these conditions. The concentration of free oleoyl-CoA in the reaction mixture when the lipase was inhibited by 50% was calculated to be about 21 micromolar. It was found that a mixture of exogenously added oleoyl-CoA and CoA was most effective in causing lipase inhibition. Little inhibition of lipase was detected in the presence of CoA alone. It is possible that this effect is important in vivo in coordinating lipase activity with fatty acid oxidation

  19. Toxicity of Carboxylic Acid-Containing Drugs: The Role of Acyl Migration and CoA Conjugation Investigated.

    Lassila, Toni; Hokkanen, Juho; Aatsinki, Sanna-Mari; Mattila, Sampo; Turpeinen, Miia; Tolonen, Ari

    2015-12-21

    Many carboxylic acid-containing drugs are associated with idiosyncratic drug toxicity (IDT), which may be caused by reactive acyl glucuronide metabolites. The rate of acyl migration has been earlier suggested as a predictor of acyl glucuronide reactivity. Additionally, acyl Coenzyme A (CoA) conjugates are known to be reactive. Here, 13 drugs with a carboxylic acid moiety were incubated with human liver microsomes to produce acyl glucuronide conjugates for the determination of acyl glucuronide half-lives by acyl migration and with HepaRG cells to monitor the formation of acyl CoA conjugates, their further conjugate metabolites, and trans-acylation products with glutathione. Additionally, in vitro cytotoxicity and mitochondrial toxicity experiments were performed with HepaRG cells to compare the predictability of toxicity. Clearly, longer acyl glucuronide half-lives were observed for safe drugs compared to drugs that can cause IDT. Correlation between half-lives and toxicity classification increased when "relative half-lives," taking into account the formation of isomeric AG-forms due to acyl migration and eliminating the effect of hydrolysis, were used instead of plain disappearance of the initial 1-O-β-AG-form. Correlation was improved further when a daily dose of the drug was taken into account. CoA and related conjugates were detected primarily for the drugs that have the capability to cause IDT, although some exceptions to this were observed. Cytotoxicity and mitochondrial toxicity did not correlate to drug safety. On the basis of the results, the short relative half-life of the acyl glucuronide (high acyl migration rate), high daily dose and detection of acyl CoA conjugates, or further metabolites derived from acyl CoA together seem to indicate that carboxylic acid-containing drugs have a higher probability to cause drug-induced liver injury (DILI). PMID:26558897

  20. The development of the 2, 4-dienoyl CoA reductase 1 gene (DECR 1) in pig

    2007-01-01

    2,4-dienoyl CoA reductase gene (DECR 1) is mapped on pig 4 q1.2, includes ten exons and nine introns of variable sizethat span 30 kb. DECR 1 gene participates in the β-oxidation pathway, affects the content of intramuscular fatty acid, especially thepercentage of linoleic acid. The expression of DECR 1 gene has important influence on IMF, the pH, and the meat colour of pork,further affects the meat quality.

  1. Germline Deletion of Pantothenate Kinases 1 and 2 Reveals the Key Roles for CoA in Postnatal Metabolism

    Garcia, Matthew; Leonardi, Roberta; Zhang, Yong-Mei; Rehg, Jerold E.; Jackowski, Suzanne

    2012-01-01

    Pantothenate kinase (PanK) phosphorylates pantothenic acid (vitamin B5) and controls the overall rate of coenzyme A (CoA) biosynthesis. Pank1 gene deletion in mice results in a metabolic phenotype where fatty acid oxidation and gluconeogenesis are impaired in the fasted state, leading to mild hypoglycemia. Inactivating mutations in the human PANK2 gene lead to childhood neurodegeneration, but Pank2 gene inactivation in mice does not elicit a phenotype indicative of the neuromuscular symptoms ...

  2. Exome Sequence Reveals Mutations in CoA Synthase as a Cause of Neurodegeneration with Brain Iron Accumulation

    Dusi, Sabrina; Valletta, Lorella; Haack, Tobias B.; Tsuchiya, Yugo; Venco, Paola; Pasqualato, Sebastiano; Goffrini, Paola; Tigano, Marco; Demchenko, Nikita; Wieland, Thomas; Schwarzmayr, Thomas; Strom, Tim M; Invernizzi, Federica; Garavaglia, Barbara; Gregory, Allison

    2014-01-01

    Neurodegeneration with brain iron accumulation (NBIA) comprises a clinically and genetically heterogeneous group of disorders with progressive extrapyramidal signs and neurological deterioration, characterized by iron accumulation in the basal ganglia. Exome sequencing revealed the presence of recessive missense mutations in COASY, encoding coenzyme A (CoA) synthase in one NBIA-affected subject. A second unrelated individual carrying mutations in COASY was identified by Sanger sequence analys...

  3. Molecular analysis of virulent genes (coa and spa) of staphylococcus aureus involved in natural cases of bovine mastitis

    The present study was undertaken to determine the distribution and genotypic characteristics of Staphylococcus aureus isolates recovered from naturally occurring mastitis in cattle and buffaloes. For this purpose a total of 1445 lactating cattle (653) and buffaloes (792) present at two experimental livestock farms Okara (Bahadarnagar) and Sahiwal (Qadiarabad), in and around district Faisalabad and slaughtered at an abattoir due to low milk yield and were screened for mastitis. California Mastitis Test (CMT) was used to detect sub clinical mastitis. The positive quarter milk samples were collected for culturing of S. aureus isolates. taphylococcus aureus isolates were identified on the basis of growth features, biochemical characteristics, coagulase test and as well as amplification of coagulase (coa) and spa (spa-X) genes specific to its virulence. S. aureus isolates (n=265) were characterized by Polymerase chain reaction to determine the frequency of coagulase (coa) and spa (spa-X) genes. From these isolates the amplification of the coagulase (coa) gene yielded three different PCR products approximately 204bp to 490bp while spa (spa-X) gene produced five different products ranging in size from 190bp to 320bp. PCR revealed that from all the coagulase positive S. aureus isolates 261(98.5%) had spa (spa-X) gene. The results of the present study indicated that S. aureus isolates recovered from bovine mastitis were genetically different within and among the various herds which may provide essential and valuable strategies to control staphylococcal infections in future. (author)

  4. On O(1S) and CO(a3Π) production from electron impact dissociation of CO2

    A novel method is employed to selectively detect O(1S) and CO(a 3Π) fragments following the dissociation of CO2 by electron impact. O(1S) atoms impinging on solid Xe produce a prominent emission feature at 725 nm, and less intense features at 375 and 550 nm. CO(a 3Π) molecules give a single emission feature spanning 250 to 350 nm. Time-of-flight spectra are presented for O(1S) and CO(a 3Π) from electron impact dissociation of CO2. The results for O(1S) production indicate contributions from pre-dissociation of excited states of CO2. Relative cross sections for the production of both species have been obtained. The cross section for O(1S) production has been made absolute by comparison with production of the same species from N2O. It has a threshold at 11.0 ± 0.5 eV and reaches a maximum of 1.69 x 10-17 cm2 at 50 eV. (author)

  5. Intracellular long-chain acyl CoAs activate TRPV1 channels.

    Yi Yu

    Full Text Available TRPV1 channels are an important class of membrane proteins that play an integral role in the regulation of intracellular cations such as calcium in many different tissue types. The anionic phospholipid phosphatidylinositol 4,5-bisphosphate (PIP2 is a known positive modulator of TRPV1 channels and the negatively charged phosphate groups interact with several basic amino acid residues in the proximal C-terminal TRP domain of the TRPV1 channel. We and other groups have shown that physiological sub-micromolar levels of long-chain acyl CoAs (LC-CoAs, another ubiquitous anionic lipid, can also act as positive modulators of ion channels and exchangers. Therefore, we investigated whether TRPV1 channel activity is similarly regulated by LC-CoAs. Our results show that LC-CoAs are potent activators of the TRPV1 channel and interact with the same PIP2-binding residues in TRPV1. In contrast to PIP2, LC-CoA modulation of TRPV1 is independent of Ca2+i, acting in an acyl side-chain saturation and chain-length dependent manner. Elevation of LC-CoAs in intact Jurkat T-cells leads to significant increases in agonist-induced Ca2+i levels. Our novel findings indicate that LC-CoAs represent a new fundamental mechanism for regulation of TRPV1 channel activity that may play a role in diverse cell types under physiological and pathophysiological conditions that alter fatty acid transport and metabolism such as obesity and diabetes.

  6. Software interface for high-speed readout of particle detectors based on the CoaXPress communication standard

    This article is devoted to the software design and development of a high-speed readout application used for interfacing particle detectors via the CoaXPress communication standard. The CoaXPress provides an asymmetric high-speed serial connection over a single coaxial cable. It uses a widely available 75 Ω BNC standard and can operate in various modes with a data throughput ranging from 1.25 Gbps up to 25 Gbps. Moreover, it supports a low speed uplink with a fixed bit rate of 20.833 Mbps, which can be used to control and upload configuration data to the particle detector. The CoaXPress interface is an upcoming standard in medical imaging, therefore its usage promises long-term compatibility and versatility. This work presents an example of how to develop DAQ system for a pixel detector. For this purpose, a flexible DAQ card was developed using the XILINX Spartan 6 FPGA. The DAQ card is connected to the framegrabber FireBird CXP6 Quad, which is plugged in the PCI Express bus of the standard PC. The data transmission was performed between the FPGA and framegrabber card via the standard coaxial cable in communication mode with a bit rate of 3.125 Gbps. Using the Medipix2 Quad pixel detector, the framerate of 100 fps was achieved. The front-end application makes use of the FireBird framegrabber software development kit and is suitable for data acquisition as well as control of the detector through the registers implemented in the FPGA

  7. Software interface for high-speed readout of particle detectors based on the CoaXPress communication standard

    Hejtmánek, M.; Neue, G.; Voleš, P.

    2015-06-01

    This article is devoted to the software design and development of a high-speed readout application used for interfacing particle detectors via the CoaXPress communication standard. The CoaXPress provides an asymmetric high-speed serial connection over a single coaxial cable. It uses a widely available 75 Ω BNC standard and can operate in various modes with a data throughput ranging from 1.25 Gbps up to 25 Gbps. Moreover, it supports a low speed uplink with a fixed bit rate of 20.833 Mbps, which can be used to control and upload configuration data to the particle detector. The CoaXPress interface is an upcoming standard in medical imaging, therefore its usage promises long-term compatibility and versatility. This work presents an example of how to develop DAQ system for a pixel detector. For this purpose, a flexible DAQ card was developed using the XILINX Spartan 6 FPGA. The DAQ card is connected to the framegrabber FireBird CXP6 Quad, which is plugged in the PCI Express bus of the standard PC. The data transmission was performed between the FPGA and framegrabber card via the standard coaxial cable in communication mode with a bit rate of 3.125 Gbps. Using the Medipix2 Quad pixel detector, the framerate of 100 fps was achieved. The front-end application makes use of the FireBird framegrabber software development kit and is suitable for data acquisition as well as control of the detector through the registers implemented in the FPGA.

  8. Partial genetic characterization of Stearoyl Coa-Desaturase´s structural region in Bubalus bubalis

    R.B. Thomazine

    2010-02-01

    Full Text Available Conjugated Linoleic Acids (CLAs comprise a family of positional and geometric isomers of linoleic acid. The main form of CLA, cis-9, trans-11-C18:2 show positive effects in cancer prevention and treatment. The major dietary sources of these fatty acids are derived from ruminant animals, in particular dairy products. In these animals, the endogenous synthesis mainly occurs in mammary gland by the action of enzyme Stearoyl CoA Desaturase (SCD. Different levels of expression and activity of SCD in mammary gland can explain partially the variation of CLA levels in fat milk. Considering a great fat concentration in bubaline milk and the benefit of a high and positive correlation between fat milk and CLA production, this study was carried on with the intention of sequencing and characterizing part of the gene that codifies SCD in buffaloes. Genomic DNA was extracted from blood samples of lactating bubaline which begins to the breed Murrah. After the (acho que nao precisa desse the extractions, PCR (Polymerase Chain Reaction reactions were made by using primers Z43D1 and E143F1. The fragments obtained in PCR were cloned into “T” vectors and transformed in competent cells DH10B line. After this, three samples of each fragment were sequenced from 5’ and 3’ extremities using a BigDye kit in an automatic sequencer. Sequences were edited in a consensus of each fragment and were submitted to BLAST-n / NCBI for similarity comparisions among other species. The sequence obtained with Z43D1 primers shows 938 bp enclosing exons 1 and 2 and intron 1. The primers E143F1 show 70 bp corresponding to exon 3 of bubaline SCD gene. Similarities were obtained between 85% and 97% among bubaline sequences and sequences of SCD gene described in human, mouse, rat, swine, bovine, caprine and ovine species. This study has permitted the identification and partial characterization of SCD codifing region in Bubalus bubalis specie.

  9. Broad substrate specificity of phosphotransbutyrylase from Listeria monocytogenes: A potential participant in an alternative pathway for provision of acyl CoA precursors for fatty acid biosynthesis.

    Sirobhushanam, Sirisha; Galva, Charitha; Sen, Suranjana; Wilkinson, Brian J; Gatto, Craig

    2016-09-01

    Listeria monocytogenes, the causative organism of the serious food-borne disease listeriosis, has a membrane abundant in branched-chain fatty acids (BCFAs). BCFAs are normally biosynthesized from branched-chain amino acids via the activity of branched chain α-keto acid dehydrogenase (Bkd), and disruption of this pathway results in reduced BCFA content in the membrane. Short branched-chain carboxylic acids (BCCAs) added as media supplements result in incorporation of BCFAs arising from the supplemented BCCAs in the membrane of L. monocytogenes bkd mutant MOR401. High concentrations of the supplements also effect similar changes in the membrane of the wild type organism with intact bkd. Such carboxylic acids clearly act as fatty acid precursors, and there must be an alternative pathway resulting in the formation of their CoA thioester derivatives. Candidates for this are the enzymes phosphotransbutyrylase (Ptb) and butyrate kinase (Buk), the products of the first two genes of the bkd operon. Ptb from L. monocytogenes exhibited broad substrate specificity, a strong preference for branched-chain substrates, a lack of activity with acetyl CoA and hexanoyl CoA, and strict chain length preference (C3-C5). Ptb catalysis involved ternary complex formation. Additionally, Ptb could utilize unnatural branched-chain substrates such as 2-ethylbutyryl CoA, albeit with lower efficiency, consistent with a potential involvement of this enzyme in the conversion of the carboxylic acid additives into CoA primers for BCFA biosynthesis. PMID:27320015

  10. Biotin augments acetyl CoA carboxylase 2 gene expression in the hypothalamus, leading to the suppression of food intake in mice.

    Sone, Hideyuki; Kamiyama, Shin; Higuchi, Mutsumi; Fujino, Kaho; Kubo, Shizuka; Miyazawa, Masami; Shirato, Saya; Hiroi, Yuka; Shiozawa, Kota

    2016-07-29

    It is known that biotin prevents the development of diabetes by increasing the functions of pancreatic beta-cells and improving insulin sensitivity in the periphery. However, its anti-obesity effects such as anorectic effects remain to be clarified. Acetyl CoA carboxylase (ACC), a biotin-dependent enzyme, has two isoforms (ACC1 and ACC2) and serves to catalyze the reaction of acetyl CoA to malonyl CoA. In the hypothalamus, ACC2 increases the production of malonyl CoA, which acts as a satiety signal. In this study, we investigated whether biotin increases the gene expression of ACC2 in the hypothalamus and suppresses food intake in mice administered excessive biotin. Food intake was significantly decreased by biotin, but plasma regulators of appetite, including glucose, ghrelin, and leptin, were not affected. On the other hand, biotin notably accumulated in the hypothalamus and enhanced ACC2 gene expression there, but it did not change the gene expression of ACC1, malonyl CoA decarboxylase (a malonyl CoA-degrading enzyme), and AMP-activated protein kinase α-2 (an ACC-inhibitory enzyme). These findings strongly suggest that biotin potentiates the suppression of appetite by upregulating ACC2 gene expression in the hypothalamus. This effect of biotin may contribute to the prevention of diabetes by biotin treatment. PMID:27181349

  11. Characterization of the JWST Pathfinder Mirror Dynamics Using the Center of Curvature Optical Assembly (CoCOA)

    Wells, Conrad; Hadaway, James B.; Olczak, Gene; Cosentino, Joseph; Johnston, John D.; Whitman, Tony; Connolly, Mark; Chaney, David; Knight, J. Scott; Telfer, Randal

    2016-01-01

    The JWST (James Webb Space Telescope) Optical Telescope Element (OTE) consists of a 6.6 meter clear aperture, 18-segment primary mirror, all-reflective, three-mirror anastigmat operating at cryogenic temperatures. To verify performance of the primary mirror, a full aperture center of curvature optical null test is performed under cryogenic conditions in Chamber A at NASA Johnson Space Center using an instantaneous phase measuring interferometer. After phasing the mirrors during the JWST Pathfinder testing, the interferometer is utilized to characterize the mirror relative piston and tilt dynamics under different facility configurations. The correlation between the motions seen on detectors at the focal plane and the interferometer validates the use of the interferometer for dynamic investigations. The success of planned test hardware improvements will be characterized by the multi-wavelength interferometer (MWIF) at the Center of Curvature Optical Assembly (CoCOA).

  12. The production of CO+(A 2Π) from dissociative ionization of CO2: a fragment ion-photon coincidence spectroscopic investigation

    Fragment ion-photon coincidence (FIPCO) spectra by 120 eV electron impact on carbon dioxide (CO2) have been observed, in which optical emission in the 250-600 nm region has been detected. There are a dominant CO2+ peak and a weak, broad CO+ peak in the FIPCO spectra. The kinetic energy distribution of CO+ correlated with the CO+(A 2Π-X 2Σ+) emission has been estimated on the basis of the Monte Carlo simulation of the CO+ band shape. This CO+(A 2Π) ion is produced through the dissociation process, CO2+e-→CO2+*[MET I 2Πu] + 2e-→CO+(A 2Π) + O(3P) + 2e-, where MET refers to multiple electron transitions. The production of CO+(B 2Σ+) is negligible compared with that of CO+(A 2Π). The produced CO+(A 2Π) ion is in vibrationally excited levels, and there is little population in the vibrational levels, v'≤3. (author)

  13. A guarda Nacional Republicana no combate à sinistralidade rodoviária, educação ou coação?

    Lopes, Fábio

    2012-01-01

    O presente Trabalho de Investigação Aplicada (TIA) com o tema “A GNR no Combate à Sinistralidade Rodoviária, Educação ou Coação?” tem como objetivo esclarecer o papel da Guarda Nacional Republicana (GNR) no combate à sinistralidade rodoviária, assim como clarificar esse papel no domínio da fiscalização/coação e da educação. No desenvolver do presente estudo foram formuladas hipóteses e questões de investigação subordinadas à questão central: “Qual ...

  14. Intracellular signal transduction of PBAN action in lepidopteran insects: inhibition of sex pheromone production by compactin, an HMG CoA reductase inhibitor.

    Ozawa, R; Matsumoto, S; Kim, G H; Uchiumi, K; Kurihara, M; Shono, T; Mitsui, T

    1995-06-27

    Pheromone biosynthesis activating neuropeptide (PBAN) regulates sex pheromone production in the pheromone glands of many species of female moths. In order to probe the biochemical steps as well as underlying mechanisms regulated by PBAN, we have tested the effect of chemicals on sex pheromone production by using an in vitro assay. Among the chemicals we tested here, compactin, a specific 3-hydroxy-3-methylglutaryl coenzyme A (HMG CoA) reductase inhibitor, clearly inhibited the pheromone biosynthesis in the silkworm, Bombyx mori, and the common cutworm, Spodoptera litura. Since the activation of HMG CoA reductase occurs by dephosphorylation mediated by a specific phosphatase and the biochemical step regulated by PBAN in bombykol biosynthesis is similar to the one catalyzed by HMG-CoA reductase in cholesterol biosynthesis, the present results support the idea that phosphoprotein phosphatase has a significant role to regulate bombykol production in the intracellular transduction of PBAN action in B. mori. PMID:7480881

  15. Inhibition of HMG CoA reductase reveals an unexpected role for cholesterol during PGC migration in the mouse

    Ewing Andrew G

    2008-12-01

    Full Text Available Abstract Background Primordial germ cells (PGCs are the embryonic precursors of the sperm and eggs. Environmental or genetic defects that alter PGC development can impair fertility or cause formation of germ cell tumors. Results We demonstrate a novel role for cholesterol during germ cell migration in mice. Cholesterol was measured in living tissue dissected from mouse embryos and was found to accumulate within the developing gonads as germ cells migrate to colonize these structures. Cholesterol synthesis was blocked in culture by inhibiting the activity of HMG CoA reductase (HMGCR resulting in germ cell survival and migration defects. These defects were rescued by co-addition of isoprenoids and cholesterol, but neither compound alone was sufficient. In contrast, loss of the last or penultimate enzyme in cholesterol biosynthesis did not alter PGC numbers or position in vivo. However embryos that lack these enzymes do not exhibit cholesterol defects at the stage at which PGCs are migrating. This demonstrates that during gestation, the cholesterol required for PGC migration can be supplied maternally. Conclusion In the mouse, cholesterol is required for PGC survival and motility. It may act cell-autonomously by regulating clustering of growth factor receptors within PGCs or non cell-autonomously by controlling release of growth factors required for PGC guidance and survival.

  16. The prenyltransferase UBIAD1 is the target of geranylgeraniol in degradation of HMG CoA reductase.

    Schumacher, Marc M; Elsabrouty, Rania; Seemann, Joachim; Jo, Youngah; DeBose-Boyd, Russell A

    2015-01-01

    Schnyder corneal dystrophy (SCD) is an autosomal dominant disorder in humans characterized by abnormal accumulation of cholesterol in the cornea. SCD-associated mutations have been identified in the gene encoding UBIAD1, a prenyltransferase that synthesizes vitamin K2. Here, we show that sterols stimulate binding of UBIAD1 to the cholesterol biosynthetic enzyme HMG CoA reductase, which is subject to sterol-accelerated, endoplasmic reticulum (ER)-associated degradation augmented by the nonsterol isoprenoid geranylgeraniol through an unknown mechanism. Geranylgeraniol inhibits binding of UBIAD1 to reductase, allowing its degradation and promoting transport of UBIAD1 from the ER to the Golgi. CRISPR-CAS9-mediated knockout of UBIAD1 relieves the geranylgeraniol requirement for reductase degradation. SCD-associated mutations in UBIAD1 block its displacement from reductase in the presence of geranylgeraniol, thereby preventing degradation of reductase. The current results identify UBIAD1 as the elusive target of geranylgeraniol in reductase degradation, the inhibition of which may contribute to accumulation of cholesterol in SCD. PMID:25742604

  17. Feedback regulation of cholesterol synthesis:sterol-accelerated ubiquitination and degradation of HMG CoA reductase

    Russell A DeBose-Boyd

    2008-01-01

    3Hydroxy-3-methylglutaryl coenzyme A (HMG CoA) reductase produces mevalonate,an important intermediate in the synthesis of cholesterol and essential nonsterol isoprenoids.The reductase is subject to an exorbitant amount of feedback control through multiple mechanisms that are mediated by sterol and nonsterol end-products of mevalonate metabolism.Here,Ⅰwill discuss recent advances that shed light on one mechanism for control of reductase,which involves rapid degradation of the enzyme.Accumulation of certain sterols triggers binding of reductase to endoplasmic reticulum (ER) membrane proteins called Insig-1 and Insig-2.Reductase-Insig binding results in recruitment of a membrane-associated ubiquitin ligase called gp78,which initiates ubiquitination of reductase.This ubiquitination is an obligatory reaction for recognition and degradation of reductase from ER membranes by cytosolic 26S proteasomes.Thus,sterol-accelerated degradation of reductase represents an example of how a general cellular process (ER-associated degradation) is used to control an important metabolic pathway (cholesterol synthesis).

  18. Impact of single-dose nandrolone decanoate on gonadotropins, blood lipids and HMG CoA reductase in healthy men.

    Gårevik, N; Börjesson, A; Choong, E; Ekström, L; Lehtihet, M

    2016-06-01

    The aim was to study the effect and time profile of a single dose of nandrolone decanoate (ND) on gonadotropins, blood lipids and HMG CoA reductase [3-hydroxy-3-methyl-glutaryl-CoA reductase (HMGCR)] in healthy men. Eleven healthy male participants aged 29-46 years were given a single dose of 150 mg ND as an intramuscular dose of Deca Durabol®, Organon. Blood samples for sex hormones, lipids and HMGCR mRNA analysis were collected prior to ND administration day 0, 4 and 14. A significant suppression of luteinising hormone (LH) and follicle-stimulating hormone (FSH) was seen after 4 days. Total testosterone and bioavailable testosterone level decreased significantly throughout the observed study period. A small but significant decrease in sexual hormone-binding globulin (SHBG) was seen after 4 days but not after 14 days. Total serum (S)-cholesterol and plasma (P)-apolipoprotein B (ApoB) increased significantly after 14 days. In 80% of the individuals, the HMGCR mRNA level was increased 4 days after the ND administration. Our results show that a single dose of 150 mg ND increases (1) HMGCR mRNA expression, (2) total S-cholesterol and (3) P-ApoB level. The long-term consequences on cardiovascular risk that may appear in users remain to be elucidated. PMID:26370185

  19. Study on the 3-hydroxy-3-methyl-glutaryl CoA reductase inhibitory properties of Agaricus bisporus and extraction of bioactive fractions using pressurised solvent technologies

    Gil-Ramírez, Alicia; Clavijo, Cristina; Palanisamy, Marimuthu; Ruiz-Rodríguez, Alejandro; Navarro-Rubio, María; Pérez, Margarita; Marin, Francisco R.; Reglero, Guillermo; Soler-Rivas, Cristina

    2013-01-01

    [Background]: Agaricus bisporus mushrooms were able to lower cholesterol levels in hypercholesterolaemic rats and it was suggested that dietary fibre might inhibit cholesterol absorption. However, A. bisporus extracts were also able to inhibit the 3-hydroxy-3-methyl-glutaryl CoA reductase (HMGCR, the key enzyme in the cholesterol biosynthetic pathway) and this might also contribute to the observed lowering of cholesterol levels in serum. [Results]: The methanol-water extracts obtained from A....

  20. Studies of Human 2,4-Dienoyl CoA Reductase Shed New Light on Peroxisomal β-Oxidation of Unsaturated Fatty Acids

    Hua, Tian; Wu, Dong; Ding, Wei; Wang, Jiangyun; Shaw, Neil; Liu, Zhi-Jie [Nankai; (Chinese Aca. Sci.)

    2012-10-15

    Peroxisomes play an essential role in maintaining fatty acid homeostasis. Although mitochondria are also known to participate in the catabolism of fatty acids via β-oxidation, differences exist between the peroxisomal and mitochondrial β-oxidation. Only peroxisomes, but not mitochondrion, can shorten very long chain fatty acids. Here, we describe the crystal structure of a ternary complex of peroxisomal 2,4-dienoyl CoA reductases (pDCR) with hexadienoyl CoA and NADP, as a prototype for comparison with the mitochondrial 2,4-dienoyl CoA reductase (mDCR) to shed light on the differences between the enzymes from the two organelles at the molecular level. Unexpectedly, the structure of pDCR refined to 1.84 Å resolution reveals the absence of the tyrosine-serine pair seen in the active site of mDCR, which together with a lysine and an asparagine have been deemed a hallmark of the SDR family of enzymes. Instead, aspartate hydrogen-bonded to the Cα hydroxyl via a water molecule seems to perturb the water molecule for protonation of the substrate. Our studies provide the first structural evidence for participation of water in the DCR-catalyzed reactions. Biochemical studies and structural analysis suggest that pDCRs can catalyze the shortening of six-carbon-long substrates in vitro. However, the Km values of pDCR for short chain acyl CoAs are at least 6-fold higher than those for substrates with 10 or more aliphatic carbons. Unlike mDCR, hinge movements permit pDCR to process very long chain polyunsaturated fatty acids.

  1. Purification, molecular cloning, and expression of 2-hydroxyphytanoyl- CoA lyase, a peroxisomal thiamine pyrophosphate-dependent enzyme that catalyzes the carbon-carbon bond cleavage during à-oxidation of 3- methyl-branched fatty acids

    Foulon, V; Croes, K; Waelkens, E

    1999-01-01

    Purification, molecular cloning, and expression of 2-hydroxyphytanoyl- CoA lyase, a peroxisomal thiamine pyrophosphate-dependent enzyme that catalyzes the carbon-carbon bond cleavage during à-oxidation of 3- methyl-branched fatty acids

  2. [The protective effect of pantothenic acid derivatives and changes in the system of acetyl CoA metabolism in acute ethanol poisoning].

    Moiseenok, A G; Dorofeev, B F; Omel'ianchik, S N

    1988-01-01

    Calcium pantothenate (CaP), calcium 4'-phosphopantothenate (CaPP), pantethine, panthenol, sulfopantetheine and CoA decrease acute toxicity of acetaldehyde in mice. All studied compounds diminish duration of the narcotic action of ethanol--ET (3.5 g/kg intraperitoneally) in mice and rats. In the latter this effect is realized at the expense of "long sleeping" and "middle sleeping" animals. CaP (150 mg/kg subcutaneously) and CaPP (100 mg/kg subcutaneously) prevent hypothermia and a decrease of oxygen consumption in rats induced by ET administration. Combined administration of ET, CaP and CaPP leads to a characteristic increase of acid-soluble CoA fractions in the rat liver and a relative decrease of acetyl CoA synthetase and N-acetyltransferase reactions. The antitoxic effect of preparations of pantothenic acid is not mediated by CoA-dependent reactions of detoxication, but most probably is due to intensification of ET oxidation and perhaps to its elimination from the organism. PMID:2905277

  3. Mutation analysis of methylmalonyl CoA mutase gene exon 2 in Egyptian families: Identification of 25 novel allelic variants

    Dina A. Ghoraba

    2015-02-01

    Full Text Available Methylmalonic aciduria (MMA is an autosomal recessive disorder of methylmalonate and cobalamin (cbl; vitamin B12 metabolism. It is an inborn error of organic acid metabolism which commonly results from a defect in the gene encoding the methylmalonyl-CoA mutase (MCM apoenzyme. Here we report the results of mutation study of exon 2 of the methylmalonyl CoA mutase (MUT gene, coding MCM residues from 1 to 128, in ten unrelated Egyptian families affected with methylmalonic aciduria. Patients were presented with a wide-anion gap metabolic acidosis. The diagnosis has established by the measurement of C3 (propionylcarnitine and C3:C2 (propionylcarnitine/acetylcarnitine in blood by using liquid chromatography–tandem mass spectrometry (LC/MS–MS and was confirmed by the detection of an abnormally elevated level of methylmalonic acid in urine by using gas chromatography–mass spectrometry (GC/MS and isocratic cation exchange high-performance liquid-chromatography (HPLC. Direct sequencing of gDNA of the MUT gene exon 2 has revealed a total of 26 allelic variants: ten of which were intronic, eight were located upstream to the exon 2 coding region, four were novel modifications predicted to affect the splicing region, three were novel mutations within the coding region: c.15G>A (p.K5K, c.165C>A (p.N55K and c.7del (p.R3EfsX14, as well as the previously reported mutation c.323G>A (p.R108H.

  4. 1200 nt rat liver mRNA identified by differential hybridization exhibits coordinate regulation with 3-hydroxy-3-methylglutaryl coenzyme A (HMG CoA) reductase

    Differential hybridization has been used to identify genes in rat liver that encode transcripts which are increased by the drugs cholestyramine and mevinolin and are decreased by dietary cholesterol. This approach should prove useful in isolating and identifying coordinately regulated genes involved in the isoprene biosynthetic pathway. Rat liver poly (A)+ RNA was isolated from animals fed diets supplemented with either cholestyramine and mevinolin or with cholesterol. Radiolabeled cDNAs generated from these two RNA preparations were used to screen a rat cDNAs library. A preliminary screen of 10,000 recombinants has led to the identification of a clone with an insert of 1200 bp that hybridizes to a mRNA species of about 1200 nt. The level of this RNA species in rat liver is elevated by the drugs cholestyramine and mevinolin and is decreased by cholesterol feeding. This RNA species is also decreased by mevalonate administration to rats. The regulation of this 1200 nt mRNA species mirrors that of HMG CoA reductase and HMG CoA synthase. It seems very likely that this 1200 nt mRNA encodes a polypeptide which is involved in the isoprene biosynthetic pathway

  5. Synthesis of O-[11C]acetyl CoA, O-[11C]acetyl-L-carnitine, and L-[11C]carnitine labelled in specific positions, applied in PET studies on rhesus monkey

    The syntheses of L-carnitine, O-acetyl CoA, and O-acetyl-L-carnitine labelled with 11C at the 1- or 2-position of the acetyl group or the N-methyl position of carnitine, using the enzymes acetyl CoA synthetase and carnitine acetyltransferase, are described. With a total synthesis time of 45 min, O-[1-11C]acetyl CoA and O-[2-11C]acetyl CoA was obtained in 60-70% decay-corrected radiochemical yield, and O-[1-11C]acetyl-L-carnitine and O-[2-11C]acetyl-L-carnitine in 70-80% yield, based on [1-11C]acetate or [2-11C]acetate, respectively. By an N-methylation reaction with [11C]methyl iodide, L-[methyl-11C]carnitine was obtained within 30 min, and O-acetyl-L-[methyl-11C]carnitine within 40 min, giving a decay-corrected radiochemical yield of 60% and 40-50%, respectively, based on [11C]methyl iodide. Initial data of the kinetics of the different 11C-labelled L-carnitine and acetyl-L-carnitines in renal cortex of anaesthetized monkey (Macaca mulatta) are presented

  6. Synthesis of O-[{sup 11}C]acetyl CoA, O-[{sup 11}C]acetyl-L-carnitine, and L-[{sup 11}C]carnitine labelled in specific positions, applied in PET studies on rhesus monkey

    Jacobson, Gunilla B.; Watanabe, Yasuyoshi; Valind, Sven; Kuratsune, Hirohiko; Laangstroem, Bengt

    1997-07-01

    The syntheses of L-carnitine, O-acetyl CoA, and O-acetyl-L-carnitine labelled with {sup 11}C at the 1- or 2-position of the acetyl group or the N-methyl position of carnitine, using the enzymes acetyl CoA synthetase and carnitine acetyltransferase, are described. With a total synthesis time of 45 min, O-[1-{sup 11}C]acetyl CoA and O-[2-{sup 11}C]acetyl CoA was obtained in 60-70% decay-corrected radiochemical yield, and O-[1-{sup 11}C]acetyl-L-carnitine and O-[2-{sup 11}C]acetyl-L-carnitine in 70-80% yield, based on [1-{sup 11}C]acetate or [2-{sup 11}C]acetate, respectively. By an N-methylation reaction with [{sup 11}C]methyl iodide, L-[methyl-{sup 11}C]carnitine was obtained within 30 min, and O-acetyl-L-[methyl-{sup 11}C]carnitine within 40 min, giving a decay-corrected radiochemical yield of 60% and 40-50%, respectively, based on [{sup 11}C]methyl iodide. Initial data of the kinetics of the different {sup 11}C-labelled L-carnitine and acetyl-L-carnitines in renal cortex of anaesthetized monkey (Macaca mulatta) are presented.

  7. A propionate CoA-transferase of Ralstonia eutropha H16 with broad substrate specificity catalyzing the CoA thioester formation of various carboxylic acids.

    Lindenkamp, Nicole; Schürmann, Marc; Steinbüchel, Alexander

    2013-09-01

    In this study, we have investigated a propionate CoA-transferase (Pct) homologue encoded in the genome of Ralstonia eutropha H16. The corresponding gene has been cloned into the vector pET-19b to yield a histidine-tagged enzyme which was expressed in Escherichia coli BL21 (DE3). After purification, high-performance liquid chromatography/mass spectrometry (HPLC/MS) analyses revealed that the enzyme exhibits a broad substrate specificity for carboxylic acids. The formation of the corresponding CoA-thioesters of acetate using propionyl-CoA as CoA donor, and of propionate, butyrate, 3-hydroxybutyrate, 3-hydroxypropionate, crotonate, acrylate, lactate, succinate and 4-hydroxybutyrate using acetyl-CoA as CoA donor could be shown. According to the substrate specificity, the enzyme can be allocated in the family I of CoA-transferases. The apparent molecular masses as determined by gel filtration and detected by SDS polyacrylamide gel electrophoresis were 228 and 64 kDa, respectively, and point to a quaternary structure of the native enzyme (α4). The enzyme exhibited similarities in sequence and structure to the well investigated Pct of Clostridium propionicum. It does not contain the typical conserved (S)ENG motif, but the derived motif sequence EXG with glutamate 342 to be, most likely, the catalytic residue. Due to the homo-oligomeric structure and the sequence differences with the subclasses IA-C of family I CoA-transferases, a fourth subclass of family I is proposed, comprising - amongst others - the Pcts of R. eutropha H16 and C. propionicum. A markerless precise-deletion mutant R. eutropha H16∆pct was generated. The growth and accumulation behaviour of this mutant on gluconate, gluconate plus 3,3'-dithiodipropionic acid (DTDP), acetate and propionate was investigated but resulted in no observable phenotype. Both, the wild type and the mutant showed the same growth and storage behaviour with these carbon sources. It is probable that R. eutropha H16 is upregulating

  8. Molecular cloning and characterization of Polygalacturonase-Inhibiting Protein and Cinnamoyl-Coa Reductase genes and their association with fruit storage conditions in blueberry (Vaccinium corymbosum)

    Khraiwesh, Basel

    2013-05-13

    Blueberry is a widely grown and easily perishable fruit crop. An efficient post-harvest handling is critical, and for that purpose gene technology methods have been part of ongoing programmes to improve crops with high food values such as blueberry. Here we report the isolation, cloning, characterization and differential expression levels of two cDNAs encoding Polygalacturonase-Inhibitor Protein (PGIP) and Cinnamoyl-Coa Reductase (CCR) from blueberry fruits in relation to various storage conditions. The open reading frame of PGIP and CCR encodes a polypeptide of 329 and 347 amino acids, respectively. To assess changes in the expression of blueberry PGIP and CCR after harvest, a storage trial was initiated. The northern blots hybridization showed a clear differential expression level of PGIP and CCR between freshly harvested and stored fruits as well as between fruits stored under various storage conditions. Although the prospects of exploiting such a strategy for crop improvement are limited, the results provide further insight into the control of the quality over the storage period at the molecular level.

  9. Effect of various eicosanoid products of arachidonic acid on the acyl CoA: Cholesterol acyl transferase activity in three different mammalian cell lines

    Acylcoenzyme A:cholesterol acyltransferase (ACAT) catalyzes cholesterol ester synthesis intracellularly and has been implicated in the development of atherosclerosis. An in vitro assay has been adapted for determining ACAT activity from rat FU5AH hepatoma, Chinese hamster ovary (CHO) and rat thoracic aortic smooth muscle (RSM) cells. Formation of 14C-labelled cholesteryl oleate at 0 to 60 min ± cholesterol was determined; in the presence of exogenous cholesterol, ACAT activity was approximately linear and surpassed the plateau observed in ACAT activity without cholesterol. Increasing exogenous cholesterol concentration, the amount of oleoyl CoA or the amount of microsomal protein produced a corresponding increase in ACAT activity, while ester formation was slightly increased by decreasing the ratio of Triton WR-1339 to cholesterol. Both the thromboxane A2 (TxA2) mimic, U-44069, and the inflammatory lipoxygenase product, LTB4, decreased optimal in vitro microsomal ACAT activity from RSM, but not form FU5AH, while CHO ACAT activity was suppressed by LTBr only. PGI2, PGE2 and PGF2α had minimal effects for each cell type

  10. Sudden unexpected infant death (SUDI in a newborn due to medium chain acyl CoA dehydrogenase (MCAD deficiency with an unusual severe genotype

    Lovera Cristina

    2012-10-01

    Full Text Available Abstract Medium chain acyl CoA dehydrogenase deficiency (MCAD is the most common inborn error of fatty acid oxidation. This condition may lead to cellular energy shortage and cause severe clinical events such as hypoketotic hypoglycemia, Reye syndrome and sudden death. MCAD deficiency usually presents around three to six months of life, following catabolic stress as intercurrent infections or prolonged fasting, whilst neonatal-onset of the disease is quite rare. We report the case of an apparently healthy newborn who suddenly died at the third day of life, in which the diagnosis of MCAD deficiency was possible through peri-mortem blood-spot acylcarnitine analysis that showed very high concentrations of octanoylcarnitine. Genetic analysis at the ACADM locus confirmed the biochemical findings by demonstrating the presence in homozygosity of the frame-shift c.244dup1 (p.Trp82LeufsX23 mutation, a severe genotype that may explain the unusual and very early fatal outcome in this newborn. This report confirms that inborn errors of fatty acid oxidation represent one of the genetic causes of sudden unexpected deaths in infancy (SUDI and underlines the importance to include systematically specific metabolic screening in any neonatal unexpected death.

  11. 3-Hydroxy-3-methylglutaryl CoA lyase (HL): Mouse and human HL gene (HMGCL) cloning and detection of large gene deletions in two unrelated HL-deficient patients

    Wang, S.P.; Robert, M.F.; Mitchell, G.A. [Hopital Sainte-Justine, Quebec (Canada)] [and others

    1996-04-01

    3-hydroxy-3-methylglutaryl CoA lyase (HL, EC 4.1.3.4) catalyzes the cleavage of 3-hydroxy-3-methylglutaryl CoA to acetoacetic acid and acetyl CoA, the final reaction of both ketogenesis and leucine catabolism. Autosomal-recessive HL deficiency in humans results in episodes of hypoketotic hypoglycemia and coma. Using a mouse HL cDNA as a probe, we isolated a clone containing the full-length mouse HL gene that spans about 15 kb of mouse chromosome 4 and contains nine exons. The promoter region of the mouse HL gene contains elements characteristic of a housekeeping gene: a CpG island containing multiple Sp1 binding sites surrounds exon 1, and neither a TATA nor a CAAT box are present. We identified multiple transcription start sites in the mouse HL gene, 35 to 9 bases upstream of the translation start codon. We also isolated two human HL genomic clones that include HL exons 2 to 9 within 18 kb. The mouse and human HL genes (HGMW-approved symbol HMGCL) are highly homologous, with identical locations of intron-exon junctions. By genomic Southern blot analysis and exonic PCR, was found 2 of 33 HL-deficient probands to be homozygous for large deletions in the HL gene. 26 refs., 4 figs., 2 tabs.

  12. GenBank blastx search result: AK061948 [KOME

    Full Text Available AK061948 001-042-E07 U17226.1 Sinorhizobium meliloti carbon flux regulator (aniA), beta-ketothiolase (phb...A), and acetoacetyl CoA reductase (phbB) genes, complete cds.|BCT BCT 1e-54 +3 ...

  13. GenBank blastx search result: AK059654 [KOME

    Full Text Available AK059654 001-031-C10 U17226.1 Sinorhizobium meliloti carbon flux regulator (aniA), beta-ketothiolase (phb...A), and acetoacetyl CoA reductase (phbB) genes, complete cds.|BCT BCT 2e-69 +1 ...

  14. Walnut oil increases cholesterol efflux through inhibition of stearoyl CoA desaturase 1 in THP-1 macrophage-derived foam cells

    Gillies Peter J

    2011-08-01

    Full Text Available Abstract Background Walnuts significantly decrease total and low-density lipoprotein cholesterol in normo- and hypercholesterolemic individuals. No study to date has evaluated the effects of walnuts on cholesterol efflux, the initial step in reverse cholesterol transport, in macrophage-derived foam cells (MDFC. The present study was conducted to investigate the mechanisms by which walnut oil affects cholesterol efflux. Methods The extract of English walnuts (walnut oil was dissolved in DMSO and applied to cultured THP-1 MDFC cells (0.5 mg/mL. THP-1 MDFC also were treated with human sera (10%, v:v taken from subjects in a walnut feeding study. Cholesterol efflux was examined by liquid scintillation counting. Changes in gene expression were quantified by real time PCR. Results Walnut oil treatment significantly increased cholesterol efflux through decreasing the expression of the lipogenic enzyme stearoyl CoA desaturase 1 (SCD1 in MDFC. Alpha-linolenic acid (ALA, the major n-3 polyunsaturated fatty acids found in walnuts, recaptured SCD1 reduction in MDFC, a mechanism mediated through activation of nuclear receptor farnesoid-X-receptor (FXR. Postprandial serum treatment also increased cholesterol efflux in MDFC. When categorized by baseline C-reactive protein (CRP; cut point of 2 mg/L, subjects in the lower CRP sub-group benefited more from dietary intervention, including a more increase in cholesterol efflux, a greater reduction in SCD1, and a blunted postprandial lipemia. Conclusion In conclusion, walnut oil contains bioactive molecules that significantly improve cholesterol efflux in MDFC. However, the beneficial effects of walnut intake may be reduced by the presence of a pro-inflammatory state. Trial Registration ClinicalTrials.gov: NCT00938340

  15. Human mitochondrial HMG CoA synthase: Liver cDNA and partial genomic cloning, chromosome mapping to 1p12-p13, and possible role in vertebrate evolution

    Boukaftane, Y.; Robert, M.F.; Mitchell, G.A. [Hopital Sainte-Justine, Montreal (Canada)] [and others

    1994-10-01

    Mitochondrial 3-hydroxy-3-methylglutaryl CoA synthase (mHS) is the first enzyme of ketogenesis, whereas the cytoplasmic HS isozyme (cHS) mediates an early step in cholersterol synthesis. We here report the sequence of human and mouse liver mHS cDNAs, the sequence of an HS-like cDNA from Caenorhabditis elegans, the structure of a partial human mHS genomic clone, and the mapping of the human mHS gene to chromosome 1p12-p13. the nucleotide sequence of the human mHS cDNA encodes a mature mHS peptide of 471 residues, with a mean amino acid identity of 66.5% with cHS from mammals and chicken. Comparative analysis of all known mHS and cHS protein and DNA sequences shows a high degree of conservation near the N-terminus that decreases progressively toward the C-terminus and suggests that the two isozymes arose from a common ancestor gene 400-900 million years ago. Comparison of the gene structure of mHS and cHS is also consistant with a recent duplication event. We hypothesize that the physiologic result of the HS gene duplication was the appearance of HS within the mitochondria around the time of emergence of early vertebrates, which linked preexisting pathways of beta oxidation and leucine catabolism and created the HMG CoA pathway of ketogenesis, thus providing a lipid-derived energy source for the vertebrate brain. 56 refs., 4 figs., 2 tabs.

  16. Pesquisa do antígeno circulante de Cryptococcus neoformans em líquido cefalorraqueano pelo teste de coaglutinação Coaglutination test (COA for Cryptococcus neoformans circulating antigen detection in cerebral spinal fluid (CSF

    Maria Isabel Nogueira Cano

    1990-12-01

    Full Text Available Foram utilizadas 82 LCR de transplantados renais (24 pacientes, 43 LCR de pacientes com críptococose comprovada (controles positivos, 35 LCR de pacientes com outras doenças (histoplasmose, paracoccidioidomicose e infecções bacterianas como controles negativos. Os primeiros foram cultivados em ágar Sabouraud com sementes de girassol e juntamente com os demais examinado pelo teste de látex para pesquisa de antígeno circulante de C. neoformans, qualitativamente. O teste de Coaglutinação foi realizado qualitativamente e quantitativamente, encontrando-se títulos até a diluição 1:2048. Não foram detectadas reações falso-positivas ou falso-negativas entre os controles. Como prova de valor diagnóstico demonstrou: sensibilidade - 92,1%; especificidade - 92,6% e eficiência - 92,3%. Provou também ser um teste rápido, exato e econômico, embora sua escolha dependa do pré-tratamento de LCR (80ºC por 3 a 5 minutos e soros (diluição ou álcali-precipitação para evitar autoaglutinação e aumentar a sensibilidade da reação.We tested 82 CSF of 24 renal transplanted patients (RT with cerebral cryptococcosis, 8 CSF of asymptomatic RT patients, 43 CSF of proven cryptococcosis cases (positive control and 35 CSF of patients with other diseases (histoplasmosis, paracoccidioidomycosis and bacterial infections as negative control. The RT CSF were cultured in Sabouraud agar slant added with sunflower seeds and both control and RT CSF were qualitatively examined by cryptococcosis latex test (Crypto-LA test. The COA test was developed both qualitatively and quantitatively. The highest titre encountered was 1:2048. No false reactions appeared among the controls. The diagnostic value demonstrated by Galen and Gambino's method was: sensitivity - 92.1%; specificity - 92.6% and efficiency - 92.3%. Besides that, the COA proved to be quick, exact and cheap, but it depends on CSF and sera pre-treatment, in order to avoid autoagglutination and increase

  17. The effect of charge reversal mutations in the alpha-helical region of liver fatty acid binding protein on the binding of fatty-acyl CoAs, lysophospholipids and bile acids.

    Hagan, Robert M; Davies, Joanna K; Wilton, David C

    2002-10-01

    Liver fatty acid binding protein (LFABP) is unique among the various types of FABPs in that it can bind a variety of ligands in addition to fatty acids. LFABP is able to bind long chain fatty acids with a 2:1 stoichiometry and the crystal structure has identified two fatty acid binding sites in the binding cavity. The presumed primary site (site 1) involves the fatty acid binding with the carboxylate group buried in the cavity whereas the fatty acid at site 2 has the carboxylate group solvent-exposed within the ligand portal region and in the vicinity of alpha-helix II. The alpha-helical region contains three cationic residues, K20, K31, K33 and modelling studies suggest that K31 on alpha-helix II could make an electrostatic contribution to anionic ligands binding to site 2. The preparation of three charge reversal mutants of LFABP, K20E, K31E and K33E has allowed an investigation of the role of site 2 in ligand binding, particularly those ligands with a bulky anionic head group. The binding of oleoyl CoA, lysophosphatidic acid, lysophosphatidylcholine, lithocholic acid and taurolithocholate 3-sulphate to LFABP has been studied using the alpha-helical mutants. The results support the concept that such ligands bind at site 2 of LFABP where solvent exposure allows the accommodation of their bulky anionic group. PMID:12479568

  18. 尾叶桉GLU4肉桂酰-辅酶A还原酶基因克隆及原核表达%Cloning and prokaryotic expression of cinnamoyl Co-A reductase of Eucalyptus urophylla clone GLU4

    陈博雯; 盖颖; 蒋湘宁

    2014-01-01

    肉桂酰-辅酶A还原酶(Cinnamoyl Co-A Reductase,CCR)是木质素合成中的关键酶,根据植物中CCR保守序列设计引物,以尾叶桉GLU4嫩茎为材料克隆到其CCR基因,命名为EuCCR。该基因gDNA长2918 bp,cDNA长1045 bp,CDS区编码336个氨基酸。EuCCR核酸序列与GenBank已登录的桉属植物CCR基因同源性达到96%以上,与伞房属、杯果木属植物CCR的同源性达85%以上,其编码的氨基酸序列经比对发现具有完整FR_SDR_e结构域及NADP结合位点和底物结合位点,与可可树等植物中CCR基因编码序列同源性也在84%以上,确定为CCR基因。对EuCCR蛋白序列理化性质及结构进行生物信息学分析,利用MEGA软件对基因序列进行系统进化树分析。采用pQE30/M15系统对EuCCR进行原核表达,重组质粒成功表达分子量约36 kD的目的蛋白。本研究从尾叶桉GLU4中克隆得到EuCCR基因并原核表达,为该基因的酶学分析以及利用该基因转化调控尾叶桉木质素合成奠定基础。%Cinnamoyl Co-A reductase is a key enzyme in lignin synthesis pathway. A CCR gene was cloned from the immature stem of Eucalyptus urophylla clone GLU4 and named EuCCR by using speciifc primers based on the highly conserved sequences of plant CCR. The gDNA and cDNA sequence of EuCCR were 2918 bp and 1045 bp respectively, which CDS encodes 336 amino acid residues. EuCCR had more than 96%sequence homology with Eucalyptus that had been logged in GenBank, and its homology with Angophora and Corymbia were over 85%. EuCCR encoding sequence was analyzed, the result shows it has an entire FR_SDR_e domain, a NADP binding site and a substrate binding site. The homology with Theobroma cacao and others were over 84%. The physicochemical property, structure of EuCCR and its phylogenetic analysis were analyzed by using bioinformatics tools and MEGA. The SDS-PAGE analysis showed that EuCCR was transformed into pQE30/M15 system and fusion protein with

  19. Main: 1COA [RPSD[Archive

    Full Text Available hymotrypsin Inhibitor 2 Biochemistry V. 32 11259 1993 EMBL; X05404; CAA28988.1; -.|PIR; A01292; EIBH2A.|PDB;..., A.R.Fersht The Effect Of Cavity Creating Mutations In The Hydrophobic Core Of C

  20. Role of acetyl CoA

    Existence of an acetyltransferase, which catalizes acetylation of deacetylcephalosporin C to cephalosporin C, was demonstrated for the first time in cell-free extracts of Cephalosporium acremonium. The pH optimum of the enzyme appeared to be 7.0 to 7.5 and the enzyme required essentially Mg2+ as a cofactor for its reaction. The activity of this enzyme was not observed in the cell-free extracts of deacetylcephalosporin C-producing mutants Nos. 20, 29, 36 and 40, but was recovered in a revertant obtained from the mutant No. 40. These results indicate that deacetylcephalosporin C accumulation by these mutants was due to the lack of the acetyltransferase and made it reasonable that the terminal reaction of cephalosporin C biosynthesis in Cephalosporium acremonium proceeded by the catalytic action of acetyltransferase. (auth.)

  1. COA User's Guide

    Fox, B.; Pautz, J.; Sellers, C.

    1999-01-28

    The Department of Energy (DOE) has one of the largest and most complete collections of information on crude oil composition that is available to the public. The computer program that manages this database of crude oil analyses has recently been rewritten to allow easier access to this information. This report describes how the new system can be accessed and how the information contained in the Crude Oil Analysis Data Bank can be obtained.

  2. Regulation of Isoprenoid Pheromone Biosynthesis in Bumblebee Males.

    Prchalová, Darina; Buček, Aleš; Brabcová, Jana; Žáček, Petr; Kindl, Jiří; Valterová, Irena; Pichová, Iva

    2016-02-01

    Males of the closely related species Bombus terrestris and Bombus lucorum attract conspecific females by completely different marking pheromones. MP of B. terrestris and B. lucorum pheromones contain mainly isoprenoid (ISP) compounds and fatty acid derivatives, respectively. Here, we studied the regulation of ISP biosynthesis in both bumblebees. RNA-seq and qRT-PCR analyses indicated that acetoacetyl-CoA thiolase (AACT), 3-hydroxy-3-methylglutaryl-CoA reductase (HMGR), and farnesyl diphosphate synthase (FPPS) transcripts are abundant in the B. terrestris labial gland. Maximal abundance of these transcripts correlated well with AACT enzymatic activity detected in the LG extracts. In contrast, transcript abundances of AACT, HMGR, and FPPS in B. lucorum were low, and AACT activity was not detected in LGs. These results suggest that transcriptional regulation plays a key role in the control of ISP biosynthetic gene expression and ISP pheromone biosynthesis in bumblebee males. PMID:26632352

  3. Metabolic Engineering of Escherichia coli for Enhanced Production of (R)- and (S)-3-Hydroxybutyrate▿

    Tseng, Hsien-chung; Martin, Collin H.; David R. Nielsen; Prather, Kristala L. Jones

    2009-01-01

    Synthetic metabolic pathways have been constructed for the production of enantiopure (R)- and (S)-3-hydroxybutyrate (3HB) from glucose in recombinant Escherichia coli strains. To promote maximal activity, we profiled three thiolase homologs (BktB, Thl, and PhaA) and two coenzyme A (CoA) removal mechanisms (Ptb-Buk and TesB). Two enantioselective 3HB-CoA dehydrogenases, PhaB, producing the (R)-enantiomer, and Hbd, producing the (S)-enantiomer, were utilized to control the 3HB chirality across ...

  4. 应用聚合酶链式反应快速特异鉴定假单胞菌和伯克霍尔德氏菌(R)-3-羟基酯酰载酯蛋白-辅酶A转酰基酶基因%Specific Identification of ( R )-3-hydroxyacyl-ACP: CoA Transacylase Gene from Pseudomonas and Burkholderia Strains by Polymerase Chain Reaction

    郑重; 陈金春; 田鸿磊; 贝锋锋; 陈国强

    2005-01-01

    聚羟基脂肪酸酯(PHA)是一类具有广泛应用前景的可降解生物塑料.因其可以以葡萄糖等廉价底物直接发酵生产PHA而日益受到重视.目前的研究表明在积累中长链PHA的假单胞菌中,由phaG基因编码的(R)-3-羟基酯酰载酯蛋白-辅酶A转酰基酶(PhaG)起关键作用,但目前为止对该蛋白还知之甚少.通过聚合酶链式反应(PCR)建立了一种快速、特异鉴定phaG基因的方法,应用该方法成功地从两株积累不同PHA的假单胞菌Pseudomonas stutzeri 1317和Pseudomonas nitroreducens0802中分别克隆得到phaG基因,并在phaG基因突变株Pseudomonasputida PHAGN-21中表达成功.同时,还首次报道了从非假单胞菌菌株Burkholderia caryophylli AS 1.2741中鉴定得到phaG基因,提示PhaG介导的中长链PHA合成途径作为一种通用的代谢模式在细菌中广泛存在,为进一步实现从廉价的非相关底物合成中长链PHA提供了必要的分子生物学基础.%Polyhydroxyalkanoates (PHA) were biodegradable thermoplastics. Due to their broad applications, direct biosynthesis of PHA from inexpensive substrates, such as carbohydrates, is actively pursued. It has been recently revealed that (R)-3-hydroxyacyl-ACP: CoA transacylase (PhaG) played an important role in this pathway. In this study, a polymerase chain reaction(PCR) protocol was developed for the rapid and specific identification of phaG gene from various bacteria. Using the PCR strategy, the complete open reading frames of two phaG genes from Pseudomonas stutzeri 1317 and Pseudomonas nitroreducens 0802were cloned from the genomic DNA and functionally expressed in Pseudomonas putida PHAGN-21. Furthermore, this strategy was successful applied in non-Pseudomonas strains, such as Burkholderia. These results suggest that PhaG-mediated pathway of medium-chain-length polyhydroxyalkanoates was widespread among bacteria.

  5. Isotopomer Spectral Analysis: Utilizing Nonlinear Models in Isotopic Flux Studies.

    Kelleher, Joanne K; Nickol, Gary B

    2015-01-01

    We present the principles underlying the isotopomer spectral analysis (ISA) method for evaluating biosynthesis using stable isotopes. ISA addresses a classic conundrum encountered in the use of radioisotopes to estimate biosynthesis rates whereby the information available is insufficient to estimate biosynthesis. ISA overcomes this difficulty capitalizing on the additional information available from the mass isotopomer labeling profile of a polymer. ISA utilizes nonlinear regression to estimate the two unknown parameters of the model. A key parameter estimated by ISA represents the fractional contribution of the tracer to the precursor pool for the biosynthesis, D. By estimating D in cells synthesizing lipids, ISA quantifies the relative importance of two distinct pathways for flux of glutamine to lipid, reductive carboxylation, and glutaminolysis. ISA can also evaluate the competition between different metabolites, such as glucose and acetoacetate, as precursors for lipogenesis and thereby reveal regulatory properties of the biosynthesis pathway. The model is flexible and may be expanded to quantify sterol biosynthesis allowing tracer to enter the pathway at three different positions, acetyl CoA, acetoacetyl CoA, and mevalonate. The nonlinear properties of ISA provide a method of testing for the presence of gradients of precursor enrichment illustrated by in vivo sterol synthesis. A second ISA parameter provides the fraction of the polymer that is newly synthesized over the time course of the experiment. In summary, ISA is a flexible framework for developing models of polymerization biosynthesis providing insight into pools and pathway that are not easily quantified by other techniques. PMID:26358909

  6. Treatment with the 3-Ketoacyl-CoA Thiolase Inhibitor Trimetazidine Does Not Exacerbate Whole-Body Insulin Resistance in Obese Mice

    Ussher, John R.; Keung, Wendy; Fillmore, Natasha; Koves, Timothy R.; Mori, Jun; Zhang, Liyan; Lopaschuk, David G.; Ilkayeva, Olga R.; Wagg, Cory S.; Jaswal, Jagdip S.; Muoio, Deborah M.; Lopaschuk, Gary D.

    2014-01-01

    There is a growing need to understand the underlying mechanisms involved in the progression of cardiovascular disease during obesity and diabetes. Although inhibition of fatty acid oxidation has been proposed as a novel approach to treat ischemic heart disease and heart failure, reduced muscle fatty acid oxidation rates may contribute to the development of obesity-associated insulin resistance. Our aim was to determine whether treatment with the antianginal agent trimetazidine, which inhibits...

  7. Identification of ten mevalonate enzyme-encoding genes and their expression in response to juvenile hormone levels in Leptinotarsa decemlineata (Say).

    Li, Qian; Meng, Qing-Wei; Lü, Feng-Gong; Guo, Wen-Chao; Li, Guo-Qing

    2016-06-15

    The mevalonate pathway is responsible for the biosynthesis of many essential molecules important in insect development, reproduction, chemical communication and defense. Based on Leptinotarsa decemlineata transcriptome and genome data, we identified ten genes that encoded acetoacetyl-CoA thiolase (LdAACT1 and LdAACT2), hydroxymethylglutaryl (HMA)-CoA synthase (LdHMGS), HMG-CoA reductase (LdHMGR1 and LdHMGR2), mevalonate kinase (LdMevK), phospho-mevalonate kinase (LdPMK), mevalonate diphosphate decarboxylase (LdMDD), isopentenyl-diphosphate isomerase (LdIDI) and farnesyl pyrophosphate synthetase (LdFPPS). Nine of these genes (except for LdAACT1) were mainly expressed in the larval brain-corpora cardiaca-corpora allata complex, and adult ovary and testis. The 9 genes were transcribed at high levels right after each ecdysis, and at low levels in the mid instar. Therefore, the 9 genes were indicated to be involved in JH biosynthesis. Moreover, knockdown of a JH biosynthesis gene LdJHAMT to lower JH titer significantly downregulated the transcription of the 9 genes. Ingestion of JH to activate JH signaling also significantly suppressed the expression of the 9 genes. It appears that the accumulation of JH precursors in LdJHAMT RNAi larvae and a high JH titer in JH-fed specimens may cause negative feedbacks to repress the expression of the 9 mevalonate enzyme-encoding genes (excluding LdAACT1) to balance the enzyme quantity in L. decemlineata. PMID:26899871

  8. Preliminary analysis of Stearoyl Co-A Desaturase gene transcripts in River buffalo

    L. Ramunno

    2010-02-01

    Full Text Available Stearoyl-CoA desaturase (SCD is a key enzyme in the biosynthesis of monounsaturated fatty acids (MUFAs. In cattle, SCD gene extends over a DNA segment of ~17.0 Kb, and it is organized in 6 exons and 5 introns. The SCD gene has been indicated as the candidate gene to change the saturated/unsaturated FAs ratio and hence it has been suggested as the gene influencing the fat quality. In cattle, eight SNPs have been identified and one of them, (T→C at 231st nt of 5th exon, is responsible for the Val→Ala amino acid change. The C allele has been associated with higher content of MUFAs in carcasses, and it is positively related to a higher index of desaturation (C18:0/C18:1 and C16:0/C16:1 in the milk. In this study, we report on preliminary results of analysis of transcripts of the SCD encoding gene in river buffalo. The electrophoretic analysis of the RT-PCR products and the subsequent sequencing showed at least five different populations of mRNA. The most represented population is correctly assembled (~1300 bp, followed by the one which is deleted of ~750bp, corresponding to the 3rd, 4th and 5th exon and partially to the 2nd and 6th exon.

  9. Grassland Conservation Opportunity Areas - Liberal Model (ECO_RES.COA_GRASS33)

    U.S. Environmental Protection Agency — This layer designates areas with potential for grassland conservation. These are areas of natural or semi-natural grass land cover patches that are at least 75...

  10. Forest Conservation Opportunity Areas - Liberal Model (ECO_RES.COA_FORREST33)

    U.S. Environmental Protection Agency — This layer designates areas with potential for forest conservation. These are areas of natural or semi-natural forest land cover patches that are at least 75 meters...

  11. Rehabilitation of an old palm-tree plantation in Ivory Coas

    Abodou Ake, N.

    1988-01-01

    Full Text Available In the "Sous-prefecture" of Anyama, South-east of Ivory Coast, an old palm-tree plantation run at village level had to be replaced by another activity such as cassava cultivation or broiler production. The success of such a rehabilitation is closely associated with an adequate choice of the new agricultural activity, with technical competence, with the acceptance of the new techniques and with an appropriate regional extension service. The conjunction of all these factors has made the operation a success. The poultry production is more profitable than cassava to substitute palm-oil plantation in the context concerned.

  12. Earthquake swarm associated with volcanic eruption, CuraCoa Reef Area, Northern Tonga, July 1973

    G. K. SUTTON

    1974-06-01

    Full Text Available A submarine volcanic eruption near Curagoa Reef, first observed on 12 J u l y 1973 (U.T. f r om Tafalii Island, northern Tonga, was associated with an e a r t h q u a k e swarm in t h e same area. The swarm began about 03'1 on I I J u l y and died away gradually about 07'' on 13 J u l y , ft comprised 504 events of magnitude Mi, „2= 3.4, the largest being of magnitude Ml = 5.1. The swarm area for these comparatively low magnitude earthquakes was abnormally large The v a r i a t i o n in r a t e of e a r t h q u a k e occurrence during t h e s w a rm shows two distinct stages, one similar to t h a t in a foresliock sequence, and t h e other like t h a t in a n a f t e r s h o c k sequence, with t h e largest events occurring between t h e two. The average value of b, defining t h e f r e q u e n c y - m a g n i t u d e relationship, was high: 1.77 ± 0.15. Furthermore, this p a r a m e t e r varied during the course of t h e swarm, a decrease in t h e b value f r om 1.8 to 1.1 being followed by a sharp increase to 2.5 a f t e r t h e largest earthquakes and principal volcanic eruption. Values of seismic moment were obtained from A B for 118 e a r t h q u a k es which were well recorded by long-period seismographs. Other source charact e r i s t i c s were determined from the difference between t h e l o g a r i t hm of seismic moment and the local magnitude. The source sizes were found to he u n u s u a l l y large. There was a t i m e variation of source properties during the swarm. The v a r i a t i o n of t h e displacement shows an inverse correlation with t h e variation of the coefficient b. The swarm produced very d i s t i n c t i v e T phases, well recorded at a hydrophone near Wake Island and at seismograph stations s i t u a t e d on t h e oceanic side of the Tonga Trench: these were not recorded at seismograph stations within the island arcs.

  13. Synthesis of hydrazine based novel HMG coA inhibitor and its docking studies

    Saravanan. B

    2013-12-01

    Full Text Available Heart attack is the recent attention to the medical sciences and cardiac low density cholesterol (LDL has a significant role in inhibiting the arrest. Various pathways having the keypoints which can interrupt the synthesis of bad cholesterol. In this study Hydrazine based compound is choosen due to its wide applications, the 1,2-Bis (2-hydroxy-5-methylbenzylidene - hydrazine crystals were synthesized. It was taken as a ligand for molecular docking. The target receptor used for docking is HMG-CoA reductase whose crystal structure is available on the PDB database as PDB ID: 1DQ8. For docking analysis, Autodock tool v4. 2 program used. The synthesized crystals are subjected to single crystal X-ray studies in order to investigate their molecular structure.

  14. How a Plant Lectin Recognizes High Mannose Oligosaccharides1[C][OA

    Garcia-Pino, Abel; Buts, Lieven; Wyns, Lode; Imberty, Anne; Loris, Remy

    2007-01-01

    The crystal structure of Pterocarpus angolensis seed lectin is presented in complex with a series of high mannose (Man) oligosaccharides ranging from Man-5 to Man-9. Despite that several of the nine Man residues of Man-9 have the potential to bind in the monosaccharide-binding site, all oligomannoses are bound in the same unique way, employing the tetrasaccharide sequence Manα(1–2)Manα(1–6)[Manα(1–3)]Manα(1–. Isothermal titration calorimetry titration experiments using Man-5, Man-9, and the Man-9-containing glycoprotein soybean (Glycine max) agglutinin as ligands confirm the monovalence of Man-9 and show a 4-times higher affinity for Man-9 when it is presented to P. angolensis seed lectin in a glycoprotein context. PMID:17556509

  15. Inaugural COA Forum Emphasizes the Importance of U.S. Foreign Policy in Africa

    Naval Postgraduate School Public Affairs Office

    2011-01-01

    The African continent has long been recognized as a vast land with nations in various stages of transition – some nations seek prosperity with planned pathways to it, while others are rife with instability and corruption. Without doubt, however, is that the United States, specifically the U.S. Africa Command (AFRICOM), has a role to play in bridging the gap between volatility, and stability.

  16. New insights into structure-function relationships of oxalyl CoA decarboxylase from Escherichia coli.

    Werther, Tobias; Zimmer, Agnes; Wille, Georg; Golbik, Ralph; Weiss, Manfred S; König, Stephan

    2010-06-01

    The gene yfdU from Escherichia coli encodes a putative oxalyl coenzyme A decarboxylase, a thiamine diphosphate-dependent enzyme that is potentially involved in the degradation of oxalate. The enzyme has been purified to homogeneity. The kinetic constants for conversion of the substrate oxalyl coenzyme A by the enzyme in the absence and presence of the inhibitor coenzyme A, as well as in the absence and presence of the activator adenosine 5'-diphosphate, were determined using a novel continuous optical assay. The effects of these ligands on the solution and crystal structure of the enzyme were studied using small-angle X-ray scattering and X-ray crystal diffraction. Analyses of the obtained crystal structures of the enzyme in complex with the cofactor thiamine diphosphate, the activator adenosine 5'-diphosphate and the inhibitor acetyl coenzyme A, as well as the corresponding solution scattering patterns, allow comparison of the oligomer structures of the enzyme complexes under various experimental conditions, and provide insights into the architecture of substrate and effector binding sites. PMID:20553497

  17. Stearoyl CoA Desaturase Is Required to Produce Active, Lipid-Modified Wnt Proteins

    Jessica Rios-Esteves

    2013-09-01

    Full Text Available Wnt proteins contain palmitoleic acid, an unusual lipid modification. Production of an active Wnt signal requires the acyltransferase Porcupine and depends on the attachment of palmitoleic acid to Wnt. The source of this monounsaturated fatty acid has not been identified, and it is not known how Porcupine recognizes its substrate and whether desaturation occurs before or after fatty acid transfer to Wnt. Here, we show that stearoyl desaturase (SCD generates a monounsaturated fatty acid substrate that is then transferred by Porcupine to Wnt. Treatment of cells with SCD inhibitors blocked incorporation of palmitate analogs into Wnt3a and Wnt5a and reduced Wnt secretion as well as autocrine and paracrine Wnt signaling. The SCD inhibitor effects were rescued by exogenous addition of monounsaturated fatty acids. We propose that SCD is a key molecular player responsible for Wnt biogenesis and processing and that SCD inhibition provides an alternative mechanism for blocking Wnt pathway activation.

  18. Medium consumption reduction measures of sIack coaI processing system in Changping coaI preparation pIant%长平选煤厂末煤系统降低介耗的措施

    马彩雯

    2015-01-01

    In order to decrease medium consumption of slack coal processing system in Changping coal preparation plant,taking each link which consumed medium as research object,the causes of large medium consumption were analyzed from technology level and management level. The results showed that,imperfect medium recovery system of powder coal,poor effects of spraying screen and magnetic separator, nonstandard daily management of magnetite powder led to high medium consumption. The above problems were reformed by installing buff-er board in chute of spraying screen,setting up coal retaining plate at the inlet of spraying screen,adding spraying process in the middle of spraying screen,installing 10 pieces of 2 mm screen mesh in overflow launder,preremoving medium,building concentrated medium storage tank near the mixed medium bucket in the main plant,shortening medium addition pipe,regulating magnetite powder quality and use man-agement. After transformation,the medium consumption reduced from 2. 0 kg/ t to 1. 5 kg/ t,lower the production cost and increased the e-conomic benefits.%针对长平选煤厂末煤系统介耗高的问题,以介质流通各环节为基础,从介质的技术耗损和管理耗损2方面对介耗高的原因进行分析,提出了改造措施。结果表明,末煤介质回收系统不完善,磁选机回收效果差,矸石带走大量介质,脱介筛脱介效果差,磁铁矿粉质量不合格,磁铁矿粉的储运、添加方式不合理等是造成长平选煤厂末煤系统介耗高的主要原因。通过在脱介筛入料溜槽内加装缓冲板,在脱介筛入料端加装挡煤皮,在脱介筛中部加装1道喷水;在溢流方箱内加设10块2 mm 筛网,对物料进行预脱介;在主厂房合介桶旁边建浓介池,缩短加介管路;加强磁铁矿粉管理,严控磁铁矿粉质量等措施对长平选煤厂进行改造,使选煤厂末煤介耗由2.0 kg / t 降至1.5 kg / t,全年节约介质费用90.09万元。

  19. Dinuclear nickel complexes modeling the structure and function of the acetyl CoA synthase active site

    Ito, Mikinao; Kotera, Mai; Matsumoto, Tsuyoshi; Tatsumi, Kazuyuki

    2009-01-01

    A dinuclear nickel complex with methyl and thiolate ligands, Ni(dadtEt)Ni(Me)(SDmp) (2), has been synthesized as a dinuclear Nid–Nip-site model of acetyl-CoA synthase (ACS) (dadtEt is N,N′-diethyl-3,7-diazanonane-1,9-dithiolate; Dmp is 2,6-dimesitylphenyl). Complex 2 was prepared via 2 methods: (i) ligand substitution of a dinuclear Ni(II)–Ni(II) cation complex [Ni(dadtEt) Ni(tmtu)2] (OTf)2(1) with MeMgBr and KSDmp (tmtu is tetramethylthiourea), (ii) methyl transfer from methylcobaloxime Co(d...

  20. Disruption of the acyl-coa binding protein gene delays hepatic adaptation to metabolic changes at weaning

    Neess, Ditte; Bloksgaard, Maria; Sørensen, Signe Bek; Marcher, Ann-Britt; Elle, Ida C; Helledie, Torben; Due, Marianne; Pagmantidis, Vasileios; Finsen, Bente; Wilbertz, Johannes; Kruhoeffer, Mogens; Faergeman, Nils; Mandrup, Susanne

    2011-01-01

    , little is known about the in vivo function in mammalian cells. We have generated mice with targeted disruption of ACBP (ACBP-/-). These mice are viable and fertile and develop normally. However, around weaning the ACBP-/- mice go through a crisis with overall weakness, and a slightly decreased growth...... rate. Using microarray analysis we show that the liver of ACBP-/- mice display a significantly delayed adaptation to weaning with late induction of target genes of the sterol regulatory element binding protein (SREBP) family. As a result, hepatic de novo cholesterogenesis is decreased at weaning. The...... delayed induction of SREBP target genes around weaning is caused by a compromised processing and decreased expression of SREBP precursors leading to reduced binding of SREBP to target sites in chromatin. In conclusion, lack of ACBP interferes with the normal metabolic adaptation to weaning and leads to...

  1. Enzymes in the Mycobacterium tuberculosis MEP and CoA Pathways Targeted for Structure-Based Drug Design

    Björkelid, Christofer

    2012-01-01

    Tuberculosis, caused by the pathogenic bacteria Mycobacterium tuberculosis, is one of the most widespread and deadly infectious diseases today. Treatment of tuberculosis relies on antibiotics that were developed more than 50 years ago. These are now becoming ineffective due to the emergence of antibiotic resistant strains of the bacteria. The aim of the research in this thesis was to develop new antibiotics for tuberculosis treatment. To this end, we targeted enzymes from two essential biosyn...

  2. Mutations in COA3 cause isolated complex IV deficiency associated with neuropathy, exercise intolerance, obesity, and short stature

    Ostergaard, Elsebet; Weraarpachai, Woranontee; Ravn, Kirstine Johanne Theresia; Born, Alfred Peter; Jønson, Lars; Dunø, Morten; Wibrand, Flemming; Shoubridge, Eric A; Vissing, John

    2015-01-01

    BACKGROUND: We investigated a subject with an isolated cytochrome c oxidase (COX) deficiency presenting with an unusual phenotype characterised by neuropathy, exercise intolerance, obesity, and short stature. METHODS AND RESULTS: Blue-native polyacrylamide gel electrophoresis (BN-PAGE) analysis...

  3. Single dose testosterone increases total cholesterol levels and induces the expression of HMG CoA Reductase

    Gårevik Nina

    2012-03-01

    Full Text Available Abstract Background Cholesterol is mainly synthesised in liver and the rate-limiting step is the reduction of 3-hydroxy-3methylglutaryl coenzyme A (HMG-CoA to mevalonate, a reaction catalysed by HMG-CoA reductase (HMGCR. There is a comprehensive body of evidence documenting that anabolic-androgenic steroids are associated with deleterious alterations of lipid profile. In this study we investigated whether a single dose of testosterone enanthate affects the cholesterol biosynthesis and the expression of HMGCR. Methods 39 healthy male volunteers were given 500 mg testosterone enanthate as single intramuscular dose of Testoviron®--Depot. The total cholesterol levels prior to and two days after testosterone administration were analysed. Protein expression of HMGCR in whole blood was investigated by Western blotting. In order to study whether testosterone regulates the mRNA expression of HMGCR, in vitro studies were performed in a human liver cell-line (HepG2. Results The total cholesterol level was significantly increased 15% two days after the testosterone injection (p = 0.007. This is the first time a perturbation in the lipoprotein profile is observed after only a single dose of testosterone. Moreover, the HMGCR mRNA and protein expression was induced by testosterone in vitro and in vivo, respectively. Conclusion Here we provide a molecular explanation how anabolic androgenic steroids may impact on the cholesterol homeostasis, i.e. via an increase of the HMGCR expression. Increasing knowledge and understanding of AAS induced side-effects is important in order to find measures for treatment and care of these abusers.

  4. Underlying Resistance Mechanisms in the Cynosurus echinatus Biotype to Acetyl CoA Carboxylase-Inhibiting Herbicides

    Fernández, Pablo; Alcántara-de la Cruz, Ricardo; Cruz-Hipólito, Hugo; Osuna, María D.; Prado, Rafael

    2016-01-01

    Hedgehog dogtail (Cynosurus echinatus) is an annual grass, native to Europe, but also widely distributed in North and South America, South Africa, and Australia. Two hedgehog dogtail biotypes, one diclofop-methyl (DM)-resistant and one DM-susceptible were studied in detail for experimental dose-response resistance mechanisms. Herbicide rates that inhibited shoot growth by 50% (GR50) were determined for DM, being the resistance factor (GR50R/GR50S) of 43.81. When amitrole (Cyt. P450 inhibitor)...

  5. Underlying Resistance Mechanisms in the Cynosurus echinatus Biotype to Acetyl CoA Carboxylase-Inhibiting Herbicides.

    Fernández, Pablo; Alcántara-de la Cruz, Ricardo; Cruz-Hipólito, Hugo; Osuna, María D; De Prado, Rafael

    2016-01-01

    Hedgehog dogtail (Cynosurus echinatus) is an annual grass, native to Europe, but also widely distributed in North and South America, South Africa, and Australia. Two hedgehog dogtail biotypes, one diclofop-methyl (DM)-resistant and one DM-susceptible were studied in detail for experimental dose-response resistance mechanisms. Herbicide rates that inhibited shoot growth by 50% (GR50) were determined for DM, being the resistance factor (GR50R/GR50S) of 43.81. When amitrole (Cyt. P450 inhibitor) was applied before treatment with DM, the R biotype growth was significantly inhibited (GR50 of 1019.9 g ai ha(-1)) compared with the GR50 (1484.6 g ai ha(-1)) found for the R biotype without pretreatment with amitrole. However, GR50 values for S biotype do not vary with or without amitrole pretreatment. Dose-response experiments carried out to evaluate cross-resistance, showed resistance to aryloxyphenoxypropionate (APP), cyclohexanedione (CHD) and phenylpyrazoline (PPZ) inhibiting herbicides. Both R and S biotypes had a similar (14)C-DM uptake and translocation. The herbicide was poorly distributed among leaves, the rest of the shoot and roots with unappreciable acropetal and/or basipetal DM translocation at 96 h after treatment (HAT). The metabolism of (14)C-DM, D-acid and D-conjugate metabolites were identified by thin-layer chromatography. The results showed that DM resistance in C. echinatus is likely due to enhanced herbicide metabolism, involving Cyt. P450 as was demonstrated by indirect assays (amitrole pretreatment). The ACCase in vitro assays showed that the target site was very sensitive to APP, CHD and PPZ herbicides in the C. echinatus S biotype, while the R biotype was insensitive to the previously mentioned herbicides. DNA sequencing studies confirmed that C. echinatus cross-resistance to ACCase inhibitors has been conferred by specific ACCase double point mutations Ile-2041-Asn and Cys-2088-Arg. PMID:27148285

  6. Engineering of PHB synthesis causes improved elastic properties of flax fibers.

    Wróbel-Kwiatkowska, Magdalena; Zebrowski, Jacek; Starzycki, Michał; Oszmiański, Jan; Szopa, Jan

    2007-01-01

    Flax stem is a source of fiber used by the textile industry. Flax fibers are separated from other parts of stems in the process called retting and are probably the first plant fibers used by man for textile purposes (1). Nowadays flax cultivation is often limited because of its lower elastic property compared to cotton fibers. Thus the goal of this study was to increase the flax fiber quality using a transgenic approach. Expression of three bacterial genes coding for beta-ketothiolase (phb A), acetoacetyl-CoA reductase (phb B), and PHB synthase (phb C) resulted in poly-beta-hydroxybutyrate (PHB) accumulation in the plant stem. PHB is known as a biodegradable thermoplastic displaying chemical and physical properties similar to those of conventional plastics (i.e., polypropylene). The fibers isolated from transgenic flax plants cultivated in the field and synthesizing PHB were then studied for biomechanical properties. All measured parameters, strength, Young's modulus, and energy for failure of flax fibers, were significantly increased. Thus the substantial improvement in elastic properties of fibers from the transgenic line has been achieved. Since the acetyl CoA, substrate for PHB synthesis, is involved not only for energy production but also for synthesis of many cellular constituents, the goal of this study was also the analysis of those metabolites, which interfere with plant physiology and thus fiber quality. The analyzed plants showed that reduction in lignin, pectin, and hemicellulose levels resulted in increased retting efficiency. A significant increase in phenolic acids was also detected, and this was the reason for improved plant resistance to pathogen infection. However, a slight decrease in crop production was detected. PMID:17269698

  7. A single nucleotide polymorphism in the promoter region of river buffalo stearoyl CoA desaturase gene (SCD) is associated with milk yield.

    Pauciullo, Alfredo; Cosenza, Gianfranco; Steri, Roberto; Coletta, Angelo; La Battaglia, Antonio; Di Berardino, Dino; Macciotta, Nicolò P P; Ramunno, Luigi

    2012-11-01

    An association study between the milk yield trait and the stearoyl-CoA desaturase (SCD) polymorphism (g.133A > C) in Italian Mediterranean river buffalo was carried out. A full characterization of the river buffalo SCD promoter region was presented. Genotyping information was provided and a quick method for allelic discrimination was developed. The frequency of the C allele was 0·16. Test-day (TD) records (43 510) of milk production belonging to 226 lactations of 169 buffalo cows were analysed with a mixed linear model in order to estimate the effect of g.133A > C genotype, as well as the effect of parity and calving season. The SCD genotype was significantly associated with milk yield (P = 0·02). The genotype AC showed an over-dominance effect with an average daily milk yield approximately 2 kg/d higher than CC buffaloes. Such a difference represents about 28% more milk/d. The effect of the genotype was constant across lactation stages. The contribution of SCD genotype (r(2)SCD) to the total phenotypic variance in milk yield was equal to 0·12. This report is among the first indications of genetic association between a trait of economic importance in river buffalo. Although such results need to be confirmed with large-scale studies in the same and other buffalo populations, they might offer useful indications for the application of MAS programmes in river buffalo and in the future they might be of great economic interest for the river buffalo dairy industry. PMID:22994977

  8. STEAROYL-COA DESATURASE GENE TRANSCRIPTION, mRNA, AND ACTIVITY IN RESPONSE TO TRANS-VACCENIC ACID AND CONJUGATED LINOLEIC ACID ISOMERS

    Lin, Xiaobo

    2000-01-01

    Studies were conducted to investigate: 1) desaturation of dietary trans-vaccenic acid (TVA, trans11-18:1) to the cis9,trans11-18:2 isomer of conjugated linoleic acid (9/11CLA), 2) effects of two conjugated linoleic acid isomers [9/11CLA or trans10,cis12-18:2 (10/12CLA)] and TVA on enzyme activities and mRNA abundance for lipogenic enzymes, and 3) regulation of stearoyl-CoA desaturase (SCD) gene transcription. In the first study, lactating mice were fed 3% linoleic acid (LA...

  9. Lignin and Fiber digestibility in Caffeic Acid 3-O-Methyltransferase and Caffeoyl CoA 3-O-Methyltransferase Downregulated Alfalfa

    Alfalfa (Medicago sativa L.) is one of the most important forages in the United States. Increasing alfalfa fiber digestibility would improve forage management and ration formulation flexibility. Currently, growers and breeders rely on near infrared spectroscopy (NIRS) to predict forage quality tra...

  10. DISTINCT TRANSCRIPTIONAL REGULATION OF LONG-CHAIN ACYL-COA SYNTHETASE ISOFORMS AND CYTOSOLIC THIOESTERASE 1 IN THE RODENT HEART BY FATTY ACIDS AND INSULIN

    The molecular mechanism(s) responsible for channeling long-chain fatty acids (LCFAs) into oxidative versus nonoxidative pathways is (are) poorly understood in the heart. Intracellular LCFAs are converted to long-chain fatty acyl-CoAs (LCFA-CoAs) by a family of long-chain acyl-CoA synthetases (ACSLs)...

  11. Increased long chain acyl-Coa synthetase activity and fatty acid import is linked to membrane synthesis for development of picornavirus replication organelles.

    Jules A Nchoutmboube

    Full Text Available All positive strand (+RNA viruses of eukaryotes replicate their genomes in association with membranes. The mechanisms of membrane remodeling in infected cells represent attractive targets for designing future therapeutics, but our understanding of this process is very limited. Elements of autophagy and/or the secretory pathway were proposed to be hijacked for building of picornavirus replication organelles. However, even closely related viruses differ significantly in their requirements for components of these pathways. We demonstrate here that infection with diverse picornaviruses rapidly activates import of long chain fatty acids. While in non-infected cells the imported fatty acids are channeled to lipid droplets, in infected cells the synthesis of neutral lipids is shut down and the fatty acids are utilized in highly up-regulated phosphatidylcholine synthesis. Thus the replication organelles are likely built from de novo synthesized membrane material, rather than from the remodeled pre-existing membranes. We show that activation of fatty acid import is linked to the up-regulation of cellular long chain acyl-CoA synthetase activity and identify the long chain acyl-CoA syntheatse3 (Acsl3 as a novel host factor required for polio replication. Poliovirus protein 2A is required to trigger the activation of import of fatty acids independent of its protease activity. Shift in fatty acid import preferences by infected cells results in synthesis of phosphatidylcholines different from those in uninfected cells, arguing that the viral replication organelles possess unique properties compared to the pre-existing membranes. Our data show how poliovirus can change the overall cellular membrane homeostasis by targeting one critical process. They explain earlier observations of increased phospholipid synthesis in infected cells and suggest a simple model of the structural development of the membranous scaffold of replication complexes of picorna-like viruses, that may be relevant for other (+RNA viruses as well.

  12. Transcriptional and Functional Analysis of Oxalyl-Coenzyme A (CoA) Decarboxylase and Formyl-CoA Transferase Genes from Lactobacillus acidophilus

    Azcarate-Peril, M. Andrea; Bruno-Bárcena, Jose M.; Hassan, Hosni M.; Klaenhammer, Todd R.

    2006-01-01

    Oxalic acid is found in dietary sources (such as coffee, tea, and chocolate) or is produced by the intestinal microflora from metabolic precursors, like ascorbic acid. In the human intestine, oxalate may combine with calcium, sodium, magnesium, or potassium to form less soluble salts, which can cause pathological disorders such as hyperoxaluria, urolithiasis, and renal failure in humans. In this study, an operon containing genes homologous to a formyl coenzyme A transferase gene (frc) and an ...

  13. Microbiota-Dependent Hepatic Lipogenesis Mediated by Stearoyl CoA Desaturase 1 (SCD1) Promotes Metabolic Syndrome in TLR5-Deficient Mice.

    Singh, Vishal; Chassaing, Benoit; Zhang, Limin; San Yeoh, Beng; Xiao, Xia; Kumar, Manish; Baker, Mark T; Cai, Jingwei; Walker, Rachel; Borkowski, Kamil; Harvatine, Kevin J; Singh, Nagendra; Shearer, Gregory C; Ntambi, James M; Joe, Bina; Patterson, Andrew D; Gewirtz, Andrew T; Vijay-Kumar, Matam

    2015-12-01

    The gut microbiota plays a key role in host metabolism. Toll-like receptor 5 (TLR5), a flagellin receptor, is required for gut microbiota homeostasis. Accordingly, TLR5-deficient (T5KO) mice are prone to develop microbiota-dependent metabolic syndrome. Here we observed that T5KO mice display elevated neutral lipids with a compositional increase of oleate [C18:1 (n9)] relative to wild-type littermates. Increased oleate contribution to hepatic lipids and liver SCD1 expression were both microbiota dependent. Analysis of short-chain fatty acids (SCFAs) and (13)C-acetate label incorporation revealed elevated SCFA in ceca and hepatic portal blood and increased liver de novo lipogenesis in T5KO mice. Dietary SCFAs further aggravated metabolic syndrome in T5KO mice. Deletion of hepatic SCD1 not only prevented hepatic neutral lipid oleate enrichment but also ameliorated metabolic syndrome in T5KO mice. Collectively, these results underscore the key role of the gut microbiota-liver axis in the pathogenesis of metabolic diseases. PMID:26525535

  14. Association between HMG CoA reductase inhibitors and anxiety: an experimental study using elevated plus maze and light dark arena behavioural models

    Anupama M. Gudadappanavar

    2015-06-01

    Results: Going through the results of this study an evidence for the association between lowered serum cholesterol and symptoms of anxiety can be seen as statins used in the present study failed to show significant anxiolytic effect when compared to standard but in turn showed even more less activity when compared to control, indicating anxiogenic behavior. Conclusions: Our findings support the evidence of the negative effects of statins on psychological outcomes. Its generally understood that having low cholesterol is a good health sign, combined with other factors; it could actually put a person at risk by causing anxiety and stress. Further research comprising a greater number of studies is required to confirm the effects of this agent on psychological outcomes. [Int J Res Med Sci 2015; 3(6.000: 1329-1335

  15. AppIication of fine coaI dry screening process%末煤干法脱粉工艺的应用

    李燕; 李瑞丰; 陶健

    2015-01-01

    为减少进入煤泥水系统的煤泥量,简化煤泥水处理系统,提高产品发热量,提高企业的经济效益。采用增加末煤干法脱粉工艺的方法对海湾选煤厂进行改造。通过比较分析可知,增加末煤干法脱粉工艺可预先脱除原生煤泥,减少煤泥入水量,降低煤泥处理系统负荷,简化煤泥处理工艺,降低煤泥处理费用,同时旁路煤泥可作为产品掺入末煤产品,企业年销售收入增加829.22万元,具有较高的经济效益。%In order to decrease slime content,lower handing capacity of slime treatment system,improve products calorific value and eco-nomic benefits,the original process of Haiwan coal preparation plant was transformed by adding fine coal dry screening process. The results showed that,the newly installed process could remove primary slime in advance,so less slime leaked into circulating water. The slime treat-ment process was simplified and the handing expense was decreased. The slime in the bypass could be mixed in fine coal. The plant in-creased sales revenue by RMB 8. 2922x106 .

  16. Acyl CoA Binding Domain Containing 3 (ACBD3) Protein in Huntington’s Disease 
Human Skin Fibroblasts

    Kratochvílová, H.; Rodinová, M.; Sládková, J.; Klempíř, J.; Lišková, Irena; Motlík, Jan; Zeman, J.; Hansíková, H.; Tesařová, M.

    2015-01-01

    Roč. 78, Suppl. 2 (2015), s. 34-38. ISSN 1210-7859. [Conference on Animal Models for neurodegenerative Diseases /3./. Liblice, 08.11.2015-10.11.2015] R&D Projects: GA MŠk ED2.1.00/03.0124 Institutional support: RVO:67985904 Keywords : Huntington’s disease * Acyl-CoA binding domain containing 3 protein * human skin fibroblasts Subject RIV: FH - Neurology Impact factor: 0.165, year: 2014

  17. HMG CoA Lyase (HL): Mutation detection and development of a bacterial expression system for screening the activity of mutant alleles from HL-deficient patients

    Robert, M.F.; Ashmarina, L.; Poitier, E. [Hospital Ste-Justine, Montreal (Canada)] [and others

    1994-09-01

    HL catalyzes the last step of ketogenesis, and autosomal recessive HL deficiency in humans can cause episodes of hypoglycemia and coma. Structurally, HL is a dimer of identical 325-residue peptides which requires a reducing environment to maintain activity. We cloned the human and mouse HL cDNAs and genes and have performed mutation analysis on cells from 30 HL-deficient probands. Using SSCP and also genomic Southern analysis we have identified putative mutations on 53/60 alleles of these patients (88%). To date, we have found 20 mutations: 3 large deletions, 4 termination mutations, 5 frameshift mutations, and 8 missense mutations which we suspect to be pathogenic based on evolutionary conservation and/or our previous studies on purified HL protein. We have also identified 3 polymorphic variants. In order to directly test the activity of the missense mutations, we established a pGEX-based system, using a glutathione S transferase (GST)-HL fusion protein. Expressed wild-type GST-HL was insoluble. We previously located a reactive Cys at the C-terminus of chicken HL which is conserved in human HL. We produced a mutant HL peptide, C323S, which replaced Cys323 with Ser. Purified C323S is soluble and has similar kinetics to wild-type HL. C323S-containing GST-HL is soluble and enzymatically active. We are cloning and expressing the 8 missense mutations.

  18. Regulation of Polyhydroxybutyrate Synthesis in the Soil Bacterium Bradyrhizobium diazoefficiens.

    Quelas, J I; Mesa, S; Mongiardini, E J; Jendrossek, D; Lodeiro, A R

    2016-07-15

    Polyhydroxybutyrate (PHB) is a carbon and energy reserve polymer in various prokaryotic species. We determined that, when grown with mannitol as the sole carbon source, Bradyrhizobium diazoefficiens produces a homopolymer composed only of 3-hydroxybutyrate units (PHB). Conditions of oxygen limitation (such as microoxia, oxic stationary phase, and bacteroids inside legume nodules) were permissive for the synthesis of PHB, which was observed as cytoplasmic granules. To study the regulation of PHB synthesis, we generated mutations in the regulator gene phaR and the phasin genes phaP1 and phaP4 Under permissive conditions, mutation of phaR impaired PHB accumulation, and a phaP1 phaP4 double mutant produced more PHB than the wild type, which was accumulated in a single, large cytoplasmic granule. Moreover, PhaR negatively regulated the expression of phaP1 and phaP4 as well as the expression of phaA1 and phaA2 (encoding a 3-ketoacyl coenzyme A [CoA] thiolases), phaC1 and phaC2 (encoding PHB synthases), and fixK2 (encoding a cyclic AMP receptor protein [CRP]/fumarate and nitrate reductase regulator [FNR]-type transcription factor of genes for microoxic lifestyle). In addition to the depressed PHB cycling, phaR mutants accumulated more extracellular polysaccharides and promoted higher plant shoot dry weight and competitiveness for nodulation than the wild type, in contrast to the phaC1 mutant strain, which is defective in PHB synthesis. These results suggest that phaR not only regulates PHB granule formation by controlling the expression of phasins and biosynthetic enzymes but also acts as a global regulator of excess carbon allocation and symbiosis by controlling fixK2 IMPORTANCE: In this work, we investigated the regulation of polyhydroxybutyrate synthesis in the soybean-nodulating bacterium Bradyrhizobium diazoefficiens and its influence in bacterial free-living and symbiotic lifestyles. We uncovered a new interplay between the synthesis of this carbon reserve polymer

  19. SYNTHESIS, CROSSLINKING MECHANISM AND PROPERTIES OF A POLYACRYLATE/POLYURETHANE COMPOSITE COATING

    TANG Liming; GUO Wei; ZHOU Qixiang

    1997-01-01

    A polyacrylate/polyurethane (P(A)/P(U)) composite coating has been prepared by crosslinking an acetoacetylated polyacrylate with a vinylic group terminated polyurethane at room temperature. A model Michael reaction between ethyl acetoacetate (EAA) and methyl acrylate (MA) was designed to study the crosslinking mechanism. It was found that the two active hydrogen atoms in acetoacetyl group can both add to vinylic groups and the yield of mono- and bis-adducts are much affected by the molar ratio of acetoacetyl to vinylic groups. Higher crosslinking degree and better properties could be obtained with decreasing the molar ratio of the two active groups from 1/1 to 0.6/1 in the composite coatings.

  20. Approach to Energy Conservation and Consumption Reduction in Power Supply System in Coal Preparation Plan, Yangquan Coa%选煤厂供电系统节能降耗的有效途径

    卢宏龙

    2011-01-01

    In the paper the author discusses several approaches to energy conservation and consumption reduction in coal preparation plant and analyzes the three effective approaches in power supply system in Coal Preparation Plant, Yangquan Coal Group, which can be%讨论选煤厂节能降耗的几种主要途径,并分析了阳煤集团选煤厂供电系统节能降耗的三种有效途径,对选煤厂节能降耗借鉴意义。

  1. AppIication of fIip-fIow screen in deep cIassification of steam coaI%弛张筛在动力煤深度分级中的应用

    刘文统

    2015-01-01

    基于弛张筛对动力煤的深度分级作用,阐述了动力煤深度分级后对生产工艺的优化,提出了分选动力煤的新工艺。对于全级入选的动力煤选煤厂,一是解决了煤泥减量化生产瓶颈,避免大量煤泥造成的后续处理问题,二是实现了末煤可以灵活地选择进入块煤分选系统分选或末煤分选系统分选,三是实现了粉煤可以灵活地选择进入水洗系统分选或直接作为末煤产品;对于仅入选块煤的选煤厂进行原煤深度分级后,降低了块煤分选下限,增加了块煤入选量,解决了动力煤〈25 mm 粒级煤不能进入重介浅槽分选机分选的技术难题。%Based on the application of flip-flow screen in deep classification of steam coal,the optimization of process was introduced. For the coal preparation plants which prepared the whole grade steam coal,the application decreased the slime production,made the fine coal separate in lump coal separation system or fine coal separation system flexibly,let the pulverized coal go into water wash system or be sold as fine coal. For the coal preparation plants which only prepared lump coal,the application reduced the lower limit of separation,increased the separation amount of the lump coal,realized -25 mm steam coal could be separated by dense medium shallow slot cyclone.

  2. Oxalate-Degrading Activity in Bifidobacterium animalis subsp. lactis: Impact of Acidic Conditions on the Transcriptional Levels of the Oxalyl Coenzyme A (CoA) Decarboxylase and Formyl-CoA Transferase Genes ▿

    Turroni, Silvia; Bendazzoli, Claudia; Dipalo, Samuele C. F.; Candela, Marco; Vitali, Beatrice; Gotti, Roberto; Brigidi, Patrizia

    2010-01-01

    Oxalic acid occurs extensively in nature and plays diverse roles, especially in pathological processes. Due to its highly oxidizing effects, hyperabsorption or abnormal synthesis of oxalate can cause serious acute disorders in mammals and can be lethal in extreme cases. Intestinal oxalate-degrading bacteria could therefore be pivotal in maintaining oxalate homeostasis and reducing the risk of kidney stone development. In this study, the oxalate-degrading activities of 14 bifidobacterial strai...

  3. Computational study of the three-dimensional structure of N-acetyltransferase 2-acetyl coenzyme a complex.

    Oda, Akifumi; Kobayashi, Kana; Takahashi, Ohgi

    2010-01-01

    N-Acetyltransferase 2 (NAT2) is one of the most important polymorphic drug-metabolizing enzymes and plays a significant role in individual differences of drug efficacies and/or side effects. Coenzyme A (CoA) is a cofactor in the experimentally determined crystal structure of NAT2, although the acetyl source of acetylation reactions catalyzed by NAT is not CoA, but rather acetyl CoA. In this study, the three-dimensional structure of NAT2, including acetyl CoA, was calculated using molecular dynamics simulation. By substituting acetyl CoA for CoA the amino acid residue Gly286, which is known to transform into a glutamate residue by NAT2*7A and NAT2*7B, comes close to the cofactor binding site. In addition, the binding pocket around the sulfur atom of acetyl CoA expanded in the NAT2-acetyl CoA complex. PMID:20930369

  4. Children of Alcoholics: A School-Based Comparative Study.

    Morey, Connie K.

    1999-01-01

    Examines differences between 4th-6th grade children of alcoholics (COAs) and non-COAs on measures of internalized shame, self-esteem, perceived support, and teacher behavior ratings. No significant differences were found on measures of social support and shame; however self-esteem and teacher ratings for COAs were significantly lower. Gender…

  5. The Basolateral Amygdala Is Necessary for the Encoding and the Expression of Odor Memory

    Sevelinges, Yannick; Desgranges, Bertrand; Ferreira, Guillaume

    2009-01-01

    Conditioned odor avoidance (COA) results from the association between a novel odor and a delayed visceral illness. The present experiments investigated the role of the basolateral amygdala (BLA) in acquisition and retrieval of COA memory. To address this, we used the GABAA agonist muscimol to temporarily inactivate the BLA during COA acquisition…

  6. Sequence Classification: 389172 [

    Full Text Available BLE SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE (BETA SUBUNIT) SCOB (3-OXO-ACID:COA TRANSFERASE) (OXCT B)... (SUCCINYL CoA:3-OXOACID CoA-TRANSFERASE) || http://www.ncbi.nlm.nih.gov/protein/31793683 ...

  7. Sequence Classification: 398926 [

    Full Text Available BLE SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE (BETA SUBUNIT) SCOB (3-OXO-ACID:COA TRANSFERASE) (OXCT B)... (SUCCINYL CoA:3-OXOACID CoA-TRANSFERASE) || http://www.ncbi.nlm.nih.gov/protein/15609640 ...

  8. Sequence Classification: 387888 [

    Full Text Available Non-TMB Non-TMH Non-TMB Non-TMB Non-TMB Non-TMB >gi|31792399|ref|NP_854892.1| PROBABLE FATTY-ACID...-COA LIGASE FADD6 (FATTY-ACID-COA SYNTHETASE) (FATTY-ACID-COA SYNTHASE) || http://www.ncbi.nlm.nih.gov/protein/31792399 ...

  9. Sequence Classification: 387875 [

    Full Text Available TMB Non-TMH Non-TMB TMB Non-TMB Non-TMB >gi|31792386|ref|NP_854879.1| PROBABLE FATTY-ACID...-COA LIGASE FADD36 (FATTY-ACID-COA SYNTHETASE) (FATTY-ACID-COA SYNTHASE) || http://www.ncbi.nlm.nih.gov/protein/31792386 ...

  10. Sequence Classification: 386881 [

    Full Text Available Non-TMB Non-TMH Non-TMB Non-TMB Non-TMB Non-TMB >gi|31791392|ref|NP_853885.1| PROBABLE FATTY-ACID...-COA LIGASE FADD4 (FATTY-ACID-COA SYNTHETASE) (FATTY-ACID-COA SYNTHASE) || http://www.ncbi.nlm.nih.gov/protein/31791392 ...

  11. Sequence Classification: 390489 [

    Full Text Available Non-TMB Non-TMH Non-TMB Non-TMB Non-TMB Non-TMB >gi|31795000|ref|NP_857493.1| PROBABLE FATTY-ACID...-COA LIGASE FADD23 (FATTY-ACID-COA SYNTHETASE) (FATTY-ACID-COA SYNTHASE) || http://www.ncbi.nlm.nih.gov/protein/31795000 ...

  12. Sequence Classification: 386766 [

    Full Text Available Non-TMB Non-TMH Non-TMB Non-TMB Non-TMB Non-TMB >gi|31791277|ref|NP_853770.1| POSSIBLE FATTY-ACID...-COA LIGASE FADD10 (FATTY-ACID-COA SYNTHETASE) (FATTY-ACID-COA SYNTHASE) || http://www.ncbi.nlm.nih.gov/protein/31791277 ...

  13. Sequence Classification: 390226 [

    Full Text Available Non-TMB Non-TMH Non-TMB Non-TMB Non-TMB Non-TMB >gi|31794737|ref|NP_857230.1| PROBABLE FATTY-ACID...-COA LIGASE FADD3 (FATTY-ACID-COA SYNTHETASE) (FATTY-ACID-COA SYNTHASE) || http://www.ncbi.nlm.nih.gov/protein/31794737 ...

  14. Sequence Classification: 390464 [

    Full Text Available Non-TMB Non-TMH Non-TMB Non-TMB Non-TMB Non-TMB >gi|31794975|ref|NP_857468.1| PROBABLE FATTY-ACID...-COA LIGASE FADD32 (FATTY-ACID-COA SYNTHETASE) (FATTY-ACID-COA SYNTHASE || http://www.ncbi.nlm.nih.gov/protein/31794975 ...

  15. Sequence Classification: 387222 [

    Full Text Available Non-TMB Non-TMH Non-TMB Non-TMB Non-TMB Non-TMB >gi|31791733|ref|NP_854226.1| PROBABLE FATTY-ACID...-COA LIGASE FADD8 (FATTY-ACID-COA SYNTHETASE) (FATTY-ACID-COA SYNTHASE) || http://www.ncbi.nlm.nih.gov/protein/31791733 ...

  16. Sequence Classification: 386786 [

    Full Text Available Non-TMB Non-TMH TMB Non-TMB Non-TMB Non-TMB >gi|31791297|ref|NP_853790.1| PROBABLE FATTY-ACID...-COA LIGASE FADD7 (FATTY-ACID-COA SYNTHETASE) (FATTY-ACID-COA SYNTHASE) || http://www.ncbi.nlm.nih.gov/protein/31791297 ...

  17. Sequence Classification: 387070 [

    Full Text Available Non-TMB TMH Non-TMB Non-TMB Non-TMB Non-TMB >gi|31791581|ref|NP_854074.1| PROBABLE FATTY-ACID...-COA LIGASE FADD30 (FATTY-ACID-COA SYNTHETASE) (FATTY-ACID-COA SYNTHASE) || http://www.ncbi.nlm.nih.gov/protein/31791581 ...

  18. Sequence Classification: 390179 [

    Full Text Available Non-TMB TMH Non-TMB Non-TMB Non-TMB Non-TMB >gi|31794690|ref|NP_857183.1| PROBABLE FATTY-ACID...-COA LIGASE FADD19 (FATTY-ACID-COA SYNTHETASE) (FATTY-ACID-COA SYNTHASE) || http://www.ncbi.nlm.nih.gov/protein/31794690 ...

  19. Sequence Classification: 387529 [

    Full Text Available Non-TMB Non-TMH Non-TMB Non-TMB Non-TMB Non-TMB >gi|31792040|ref|NP_854533.1| POSSIBLE FATTY-ACID...-COA LIGASE FADD16 (FATTY-ACID-COA SYNTHETASE) (FATTY-ACID-COA SYNTHASE) || http://www.ncbi.nlm.nih.gov/protein/31792040 ...

  20. Sequence Classification: 389174 [

    Full Text Available Non-TMB Non-TMH Non-TMB Non-TMB Non-TMB Non-TMB >gi|31793685|ref|NP_856178.1| PROBABLE FATTY-ACID...-COA LIGASE FADD35 (FATTY-ACID-COA SYNTHETASE) (FATTY-ACID-COA SYNTHASE) || http://www.ncbi.nlm.nih.gov/protein/31793685 ...

  1. Sequence Classification: 390171 [

    Full Text Available Non-TMB Non-TMH Non-TMB Non-TMB Non-TMB Non-TMB >gi|31794682|ref|NP_857175.1| POSSIBLE FATTY-ACID...-COA SYNTHETASE FADD17 (FATTY-ACID-COA SYNTHASE) (FATTY-ACID-COA LIGASE) || http://www.ncbi.nlm.nih.gov/protein/31794682 ...

  2. Sequence Classification: 388224 [

    Full Text Available Non-TMB Non-TMH Non-TMB Non-TMB Non-TMB Non-TMB >gi|31792735|ref|NP_855228.1| POSSIBLE FATTY-ACID...-COA LIGASE FADD11 (FATTY-ACID-COA SYNTHETASE) (FATTY-ACID-COA SYNTHASE) || http://www.ncbi.nlm.nih.gov/protein/31792735 ...

  3. Sequence Classification: 386701 [

    Full Text Available Non-TMB Non-TMH Non-TMB Non-TMB Non-TMB Non-TMB >gi|31791212|ref|NP_853705.1| PROBABLE FATTY-ACID...-COA LIGASE FADD34 (FATTY-ACID-COA SYNTHETASE) (FATTY-ACID-COA SYNTHASE) || http://www.ncbi.nlm.nih.gov/protein/31791212 ...

  4. Metabolic biology of 3-methylglutaconic acid-uria: a new perspective

    Su, Betty; Ryan, Robert O.

    2014-01-01

    Over the past twenty-five years a growing number of distinct syndromes / mutations associated with compromised mitochondrial function have been identified that share a common feature: urinary excretion of 3-methylglutaconic acid (3MGA). In the leucine degradation pathway, carboxylation of 3-methylcrotonyl CoA leads to formation of 3-methylglutaconyl CoA while 3-methylglutaconyl CoA hydratase converts this metabolite to 3-hydroxy-3-methylglutaryl CoA (HMG CoA). In “primary” 3MGA-uria, mutation...

  5. Generation and characterization of monoclonal antibodies specific to Coenzyme A

    Malanchuk O. M.

    2015-06-01

    Full Text Available Aim. Generation of monoclonal antibodies specific to Coenzyme A. Methods. Hybridoma technique. KLH carrier protein conjugated with CoA was used for immunization. Screening of positive clones was performed with BSA conjugated to CoA. Results. Monoclonal antibody that specifically recognizes CoA and CoA derivatives, but not its precursors ATP and cysteine has been generated. Conclusion. In this study, we describe for the first time the production and characterization of monoclonal antibodies against CoA. The monoclonal antibody 1F10 was shown to recognize specifically CoA in Western blotting, ELISA and immunoprecipitation. These properties make this antiboby a particularly valuable reagent for elucidating CoA function in health and disease.

  6. Characteristics of children of alcoholics: putative risk factors, substance use and abuse, and psychopathology.

    Sher, K J; Walitzer, K S; Wood, P K; Brent, E E

    1991-11-01

    A sample of 253 children of alcoholics (COAs) and 237 children of nonalcoholics (non-COAs) were compared on alcohol and drug use, psychopathology, cognitive ability, and personality. COAs reported more alcohol and drug problems, stronger alcohol expectancies, higher levels of behavioral undercontrol and neuroticism, and more psychiatric distress in relation to non-COAs. They also evidenced lower academic achievement and less verbal ability than non-COAs. COAs were given Diagnostic Interview Schedule alcohol diagnoses more frequently than non-COAs. The relation between paternal alcoholism and offspring alcohol involvement was mediated by behavioral undercontrol and alcohol expectancies. Although gender differences were found, there were few Gender X Family History interactions; the effects of family history of alcoholism were similar for men and women. When gender effects were found, they showed greater family history effects for women. PMID:1757657

  7. Pantethine rescues phosphopantothenoylcysteine synthetase and phosphopantothenoylcysteine decarboxylase deficiency in Escherichia coli but not in Pseudomonas aeruginosa.

    Balibar, Carl J; Hollis-Symynkywicz, Micah F; Tao, Jianshi

    2011-07-01

    Coenzyme A (CoA) plays a central and essential role in all living organisms. The pathway leading to CoA biosynthesis has been considered an attractive target for developing new antimicrobial agents with novel mechanisms of action. By using an arabinose-regulated expression system, the essentiality of coaBC, a single gene encoding a bifunctional protein catalyzing two consecutive steps in the CoA pathway converting 4'-phosphopantothenate to 4'-phosphopantetheine, was confirmed in Escherichia coli. Utilizing this regulated coaBC strain, it was further demonstrated that E. coli can effectively metabolize pantethine to bypass the requirement for coaBC. Interestingly, pantethine cannot be used by Pseudomonas aeruginosa to obviate coaBC. Through reciprocal complementation studies in combination with biochemical characterization, it was demonstrated that the differential characteristics of pantethine utilization in these two microorganisms are due to the different substrate specificities associated with endogenous pantothenate kinase, the first enzyme in the CoA biosynthetic pathway encoded by coaA in E. coli and coaX in P. aeruginosa. PMID:21551303

  8. Pantethine Rescues Phosphopantothenoylcysteine Synthetase and Phosphopantothenoylcysteine Decarboxylase Deficiency in Escherichia coli but Not in Pseudomonas aeruginosa▿†

    Balibar, Carl J.; Hollis-Symynkywicz, Micah F.; Tao, Jianshi

    2011-01-01

    Coenzyme A (CoA) plays a central and essential role in all living organisms. The pathway leading to CoA biosynthesis has been considered an attractive target for developing new antimicrobial agents with novel mechanisms of action. By using an arabinose-regulated expression system, the essentiality of coaBC, a single gene encoding a bifunctional protein catalyzing two consecutive steps in the CoA pathway converting 4′-phosphopantothenate to 4′-phosphopantetheine, was confirmed in Escherichia coli. Utilizing this regulated coaBC strain, it was further demonstrated that E. coli can effectively metabolize pantethine to bypass the requirement for coaBC. Interestingly, pantethine cannot be used by Pseudomonas aeruginosa to obviate coaBC. Through reciprocal complementation studies in combination with biochemical characterization, it was demonstrated that the differential characteristics of pantethine utilization in these two microorganisms are due to the different substrate specificities associated with endogenous pantothenate kinase, the first enzyme in the CoA biosynthetic pathway encoded by coaA in E. coli and coaX in P. aeruginosa. PMID:21551303

  9. Complications of Aortic Stenting in Patients below 20 Years Old: Immediate and Intermediate Follow-Up

    Akbar Molaei

    2011-12-01

    Full Text Available Background: Optimal timing and mode of treatment for patients with coarctation of the aorta (COA remain controversial, particularly in children. Surgery, balloon dilatation, and stent implantation have all proven effective in the treatment of moderate or severe obstruction. The aim of this study was to investigate the complications of COA stenting angioplasty in pediatric patients. Methods: This retrospective, descriptive study was conducted on patients less than 20 years of age who underwent aortic stenting angioplasty because of congenital COA in the pediatric catheterization laboratory of Rajaie cardiovascular, medical and research Center, Tehran between 2005 and 2010. Results: A total of 26 patients (18 [65.4%] males and 9 [34.6%] females with congenital COA who had undergone aortic stenting angioplasty were recruited. Nineteen (73.1% of these patients had native COA and 7 (26.9% had recurrent COA. Most of the early complications were minor and temporary; only one patient developed early major complications. During the follow-up, whereas none of the native group patients developed late complications, in the re-COA group 28.57% of the patients had re-stenosis and 14.28% had chronic systemic hypertension, requiring drug therapy. Conclusion: Our investigation into post-stenting complications in patients with native COA and re-COA showed that endovascular stenting could be an effective and safe method, even in young patients with native COA.

  10. GenBank blastx search result: AK061948 [KOME

    Full Text Available AK061948 001-042-E07 AF267243.2 Azotobacter vinelandii PhbF (phbF), putative phasin protein PhbP (phb...P), putative transcription activator PhbR (phbR), acetoacetyl-CoA reductase (phbB), polyhy...droxybutyrate biosynthetic beta-ketothiolase (phbA), and PHB synthase (phbC) genes, complete cds.|BCT BCT 1e-56 +3 ...

  11. GenBank blastx search result: AK059654 [KOME

    Full Text Available AK059654 001-031-C10 AF267243.2 Azotobacter vinelandii PhbF (phbF), putative phasin protein PhbP (phb...P), putative transcription activator PhbR (phbR), acetoacetyl-CoA reductase (phbB), polyhy...droxybutyrate biosynthetic beta-ketothiolase (phbA), and PHB synthase (phbC) genes, complete cds.|BCT BCT 3e-82 +1 ...

  12. Evaluation of Critical Operating Conditions for a Semi-batch Reactor by Complementary Use of Sensitivity and Divergence Criteria

    De Maria, G.; Stefan, D.-N.

    2011-01-01

    This paper presents a comparison of several effective methods of deriving the critical feeding conditions for the case of a semi-batch catalytic reactor used for the acetoacetylation of pyrrole with diketene in homogeneous liquid phase. The reaction is known to be of high risk due to the very exothermic (polymerisation) side-reactions involving reactive diketene. In order to perform the sensitivity analysis, both the Morbidelli-Varma sensitivity criterion and div-methods were used, the latter...

  13. Fluorescently labelled bovine acyl-CoA-binding protein acting as an acyl-CoA sensor: interaction with CoA and acyl-CoA esters and its use in measuring free acyl-CoA esters and non-esterified fatty acids

    Wadum, M.C.; Villadsen, J.K.; Feddersen, S.;

    2002-01-01

    Long-chain acyl-CoA esters are key metabolites in lipid synthesis and b-oxidation but, at the same time, are important regulators of intermediate metabolism, insulin secretion, vesicular trafficking and gene expression. Key tools in studying the regulatory functions of acyl-CoA esters are reliable...... methods for the determination of free acyl-CoA concentrations. No such method is presently available. In the present study, we describe the synthesis of two acyl-CoA sensors for measuring free acyl-CoA concentrations using acyl-CoA-binding protein as a scaffold. Met24 and Ala53 of bovine acyl......-CoA-binding protein were replaced by cysteine residues, which were covalently modified with 6-bromoacetyl-2-dimethylaminonaphthalene to make the two fluorescent acyl-CoA indicators (FACIs) FACI-24 and FACI-53. FACI-24 and FACI-53 showed fluorescence emission maximum at 510 and 525nm respectively, in the absence of...

  14. Cloning and sequence analysis of α-succinyl CoA synthetase B gene from Trichomonas vaginalis%阴道毛滴虫琥珀酰辅酶A合成酶基因的克隆与序列分析

    张昕鑫; 张西臣; 李建华; 宫鹏涛; 张国才; 杨举

    2008-01-01

    目的 获取阴道毛滴虫琥珀酰辅酶A合成酶(α-SCSB)全基因,并对其进行序列分析. 方法 利用PCR技术扩增阴道毛滴虫琥珀酰辅酶A合成酶(α-SCSB)全基因,并将其插入pMD18-T载体,酶切鉴定后进行序列测定及分析. 结果 PCR扩增获得α-SCSB全长基因,大小为1 381 bp,与国外发表的阴道毛滴虫琥珀酰辅酶A合成酶(α-SCSB)的基因同源性为100%. 结论 本研究获得了阴道毛滴虫琥珀酰辅酶A合成酶(α-SCSB)启动子,为下一步研究α-SCSB启动子的功能及构建阴道毛滴虫DNA稳定转染载体奠定了基础.

  15. His-234是毛白杨对香豆酸∶CoA连接酶的重要酶催化活性残基%His-234 is an Essential Residue for Populus tomentosa 4-coumarate ∶ CoA Ligase Enzymatic Mechanisms

    任百光; 李德峰; 郑彩霞; 盖颖; 蒋湘宁; 胡永林

    2013-01-01

    对香豆酸∶CoA连接酶(4-coumarate∶ coenzyme A ligase,4CL)是植物苯丙烷类代谢途径中的一个重要的酶.4CL以肉桂酸衍生物(香豆酸、咖啡酸、阿魏酸等)、ATP和CoA为底物合成相应的酰基-CoA酯,这些酰基-CoA酯是一系列重要化合物(如木质素)的前体.4CL的酶催化反应分两步进行:第一步以肉桂酸衍生物和Mg2+-ATP为底物合成酰基-AMP,第二步用CoA取代AMP,产生酰基-CoA酯,催化过程中酶的构象产生明显的变化.因为4CL在木质素的合成中所起的作用,这个酶是通过蛋白质工程方法改进林产品质量的重要靶标.我们通过X射线衍射技术,解析了毛白杨对香豆酸∶CoA连接酶l(Pt4CLl)与其中间产物对香豆酰-AMP的复合物晶体结构,与同家族成员结构比对,确定所获得的蛋白质结构为Pt4CL1催化第二步反应,即酰基-CoA酯合成的构象.结构分析表明:His-234残基在Pt4CL1的酶催化机理中起着多重作用,即通过侧链与AMP磷酸基团形成氢键,降低磷酸基团的负电荷,催化CoA的亲核取代反应;侧链可以采取两种不同的构象以调节CoA进入Pt4CL1的催化中心;His-234的侧链还可能夺取CoA巯基的质子,从而增强CoA的亲核反应活性.突变体酶活数据结果也显示His-234对Pt4CL1的活性非常重要,是Pt4CL1催化中心的活性残基.

  16. GETDB: 113367 [GETDB

    Full Text Available 113367 Link to Original w[*]; P{GawB}NP3604 / CyO, P{UAS-lacZ.UW14}UW14 60A6 Link t...o DGRC Genome Viewer: 113367 Thiolase ken 297{}879 3604 2 FlyBase Insertion: P{GawB}NP3604 NP line. Received... - - - d1 - - - Show 113367 DGRC Number 113367 Link to Original Genotype w[*]; P{GawB}NP3604 / CyO, P{UAS-la...cZ.UW14}UW14 Insertion Site 60A6 Map Viewer Link to DGRC Genome Viewer: 113367 Related Genes Thiolase ken 29...uest - AS ubiquitous wing pouch, epi, tr, gut, mt ubiquitous. strong in bristles.

  17. Deregulated Coenzyme A, Loss of Metabolic Flexibility and Diabetes

    Jackowski, Suzanne; Leonardi, Roberta

    2016-01-01

    Coenzyme A (CoA) is an essential cofactor that is emerging as a global regulator of energy metabolism. Tissue CoA levels are tightly regulated and vary in response to different conditions including nutritional state and diabetes. Recent studies reveal the ability of this cofactor to control the output of key metabolic pathways. CoA regulation is important for the maintenance of metabolic flexibility and glucose homeostasis. PMID:25110012

  18. SCREENING OF HMG CO A REDUCTASE INHIBITOR PRODUCING MARINE ACTINOMYCETES

    SRINU, PHANI BHUSHAN,MOGES, SRILAKSHMI, SANKAR, PRABHAKAR,LAKSHMINARAYANA

    2013-01-01

    The objective of the present study was screening of 3-hydroxy-3- methyl glutaryl Co A (HMG CoA) reductase inhibitor producing marine actinomycetes. A total of 65 morphologically different actinomycetes were screened for HMG CoA reductase inhibitor production in a two stage submerged fermentation and evaluated for HMG CoA reductase inhibitor activity by agar diffusion and thin layer chromatography technique using lovostatin as a control. Among 65 marine Actinomycete strains, only one strain pr...

  19. Identification of mitochondrial coenzyme a transporters from maize and Arabidopsis.

    Zallot, Rémi; Agrimi, Gennaro; Lerma-Ortiz, Claudia; Teresinski, Howard J; Frelin, Océane; Ellens, Kenneth W; Castegna, Alessandra; Russo, Annamaria; de Crécy-Lagard, Valérie; Mullen, Robert T; Palmieri, Ferdinando; Hanson, Andrew D

    2013-06-01

    Plants make coenzyme A (CoA) in the cytoplasm but use it for reactions in mitochondria, chloroplasts, and peroxisomes, implying that these organelles have CoA transporters. A plant peroxisomal CoA transporter is already known, but plant mitochondrial or chloroplastic CoA transporters are not. Mitochondrial CoA transporters belonging to the mitochondrial carrier family, however, have been identified in yeast (Saccharomyces cerevisiae; Leu-5p) and mammals (SLC25A42). Comparative genomic analysis indicated that angiosperms have two distinct homologs of these mitochondrial CoA transporters, whereas nonflowering plants have only one. The homologs from maize (Zea mays; GRMZM2G161299 and GRMZM2G420119) and Arabidopsis (Arabidopsis thaliana; At1g14560 and At4g26180) all complemented the growth defect of the yeast leu5Δ mitochondrial CoA carrier mutant and substantially restored its mitochondrial CoA level, confirming that these proteins have CoA transport activity. Dual-import assays with purified pea (Pisum sativum) mitochondria and chloroplasts, and subcellular localization of green fluorescent protein fusions in transiently transformed tobacco (Nicotiana tabacum) Bright Yellow-2 cells, showed that the maize and Arabidopsis proteins are targeted to mitochondria. Consistent with the ubiquitous importance of CoA, the maize and Arabidopsis mitochondrial CoA transporter genes are expressed at similar levels throughout the plant. These data show that representatives of both monocotyledons and eudicotyledons have twin, mitochondrially located mitochondrial carrier family carriers for CoA. The highly conserved nature of these carriers makes possible their reliable annotation in other angiosperm genomes. PMID:23590975

  20. Pantethine Rescues Phosphopantothenoylcysteine Synthetase and Phosphopantothenoylcysteine Decarboxylase Deficiency in Escherichia coli but Not in Pseudomonas aeruginosa▿†

    Balibar, Carl J.; Hollis-Symynkywicz, Micah F.; Tao, Jianshi

    2011-01-01

    Coenzyme A (CoA) plays a central and essential role in all living organisms. The pathway leading to CoA biosynthesis has been considered an attractive target for developing new antimicrobial agents with novel mechanisms of action. By using an arabinose-regulated expression system, the essentiality of coaBC, a single gene encoding a bifunctional protein catalyzing two consecutive steps in the CoA pathway converting 4′-phosphopantothenate to 4′-phosphopantetheine, was confirmed in Escherichia c...

  1. Main: 1W07 [RPSD[Archive

    Full Text Available 1; Arabidopsis Thaliana Molecule: Acyl-Coa Oxidase; Chain: A, B; Mutation: Yes; Engineered: Yes Oxidoreducta...AGSRHAFEVSDRIARLVASDPVFEKSNRARLSRKELFKSTLRKCAHAFKRIIELRLNEEEAGRLRHFIDQPAYVDLHWGMFVPAI...YLWCSGLPELFAVYVPACTYEGDNVVLQLQVARFLMKTVAQLGSGKVPVGTTAYMGRAAHLLQCRSGVQKAEDWLNPDVVLEAFEARALRMAVTCAKNLSKFENQEQGFQELLADLVEAAI

  2. Changes in the size and composition of intracellular pools of nonesterified coenzyme A and coenzyme A thioesters in aerobic and facultatively anaerobic bacteria.

    Chohnan, S; FURUKAWA, H.; Fujio, T; Nishihara, H.; Takamura, Y

    1997-01-01

    Intracellular levels of three coenzyme A (CoA) molecular species, i.e., nonesterified CoA (CoASH), acetyl-CoA, and malonyl-CoA, in a variety of aerobic and facultatively anaerobic bacteria were analyzed by the acyl-CoA cycling method developed by us. It was demonstrated that there was an intrinsic difference between aerobes and facultative anaerobes in the changes in the size and composition of CoA pools. The CoA pools in the aerobic bacteria hardly changed and were significantly smaller than...

  3. Effect of coarctation of the aorta and bicuspid aortic valve on flow dynamics and turbulence in the aorta using particle image velocimetry

    Keshavarz-Motamed, Zahra; Garcia, Julio; Gaillard, Emmanuel; Maftoon, Nima; Di Labbio, Giuseppe; Cloutier, Guy; Kadem, Lyes

    2014-03-01

    Blood flow in the aorta has been of particular interest from both fluid dynamics and physiology perspectives. Coarctation of the aorta (COA) is a congenital heart disease corresponding to a severe narrowing in the aortic arch. Up to 85 % of patients with COA have a pathological aortic valve, leading to a narrowing at the valve level. The aim of the present work was to advance the state of understanding of flow through a COA to investigate how narrowing in the aorta (COA) affects the characteristics of the velocity field and, in particular, turbulence development. For this purpose, particle image velocimetry measurements were conducted at physiological flow and pressure conditions, with three different aorta configurations: (1) normal case: normal aorta + normal aortic valve; (2) isolated COA: COA (with 75 % reduction in aortic cross-sectional area) + normal aortic valve and (3) complex COA: COA (with 75 % reduction in aortic cross-sectional area) + pathological aortic valve. Viscous shear stress (VSS), representing the physical shear stress, Reynolds shear stress (RSS), representing the turbulent shear stress, and turbulent kinetic energy (TKE), representing the intensity of fluctuations in the fluid flow environment, were calculated for all cases. Results show that, compared with a healthy aorta, the instantaneous velocity streamlines and vortices were deeply changed in the presence of the COA. The normal aorta did not display any regions of elevated VSS, RSS and TKE at any moment of the cardiac cycle. The magnitudes of these parameters were elevated for both isolated COA and complex COA, with their maximum values mainly being located inside the eccentric jet downstream of the COA. However, the presence of a pathologic aortic valve, in complex COA, amplifies VSS (e.g., average absolute peak value in the entire aorta for a total flow of 5 L/min: complex COA: = 36 N/m2; isolated COA = 19 N/m2), RSS (e.g., average peak value in the entire aorta for a total flow of 5

  4. 76 FR 78706 - Self-Regulatory Organizations; C2 Options Exchange, Incorporated; Notice of Filing and Immediate...

    2011-12-19

    ... Effectiveness of Proposed Rule Change Related to a Complex Order Auction Feature December 12, 2011. Pursuant to... electronic complex order book (``COB''). Paragraph (c) of Rule 6.13 describes the COA process. Interpretation.... The Exchange is proposing to amend the rule to describe a COA feature for complex orders resting...

  5. The prevalence of type A personality in the children of alcoholics.

    Manning, D T; Balson, P M; Xenakis, S

    1986-01-01

    Three studies are reported which investigate the prevalency of an excess risk of type A personality in the children of alcoholics (COAs). Reports in the clinical literature suggest there is an excess risk of type A in COAs, but this has never been empirically demonstrated. The Matthews Youth Test for Health (MYTH) was administered to nonalcoholic mothers of 46 COAs and 65 matched controls to measure children's type A competitiveness and impatience-aggression. Results were significant only for greater impatience-aggression in COAs. In a second study, 104 COAs and controls matched for age, sex, race, and father's occupational status were rated by military fathers of intact families using MYTH. The results of the first study were not replicated for COAs, and there was no correlation between a father's Jenkins Activity Scale (JAS) score and his child's type A personality. A third study of 70 matched COAs and controls used the Hunter-Wolf A-B Rating scale, a self-rating scale for children and found no significant differences in children's type A personalities based on membership in an alcoholic family, sex, or birth order. It was concluded that the discrepancy between clinical reports and the present data may have been due to misperceptions about successful, hardworking COAs who, particularly in contrast to their more notorious siblings, may be viewed as "workaholics" and improperly labeled as type A personalities. PMID:3521376

  6. Extracellular 4 '-phosphopantetheine is a source for intracellular coenzyme A synthesis

    Srinivasan, Balaji; Baratashvili, Madina; van der Zwaag, Marianne; Kanon, Bart; Colombelli, Cristina; Lambrechts, Roald A.; Schaap, Onno; Nollen, Ellen A.; Podgorsek, Ajda; Kosec, Gregor; Petkovic, Hrvoje; Hayflick, Susan; Tiranti, Valeria; Reijngoud, Dirk-Jan; Grzeschik, Nicola A.; Sibon, Ody C. M.

    2015-01-01

    The metabolic cofactor coenzyme A (CoA) gained renewed attention because of its roles in neurodegeneration, protein acetylation, autophagy and signal transduction. The long-standing dogma is that eukaryotic cells obtain CoA exclusively via the uptake of extracellular precursors, especially vitamin B

  7. Responding to the Charge of Alchemy: Strategies for Evaluating the Reliability and Validity of Costing-Out Research

    Duncombe, William

    2006-01-01

    Reforming school finance systems to support performance standards entails estimating the cost of an adequate education. Cost of adequacy (COA) studies have been done in more than 30 states. Recently Eric Hanushek challenged the legitimacy of COA research, calling it alchemy and pseudoscience. The objectives of this study are to present reliability…

  8. Coenzyme A and its derivatives : renaissance of a textbook classic

    Theodoulou, Frederica L.; Sibon, Ody C. M.; Jackowski, Suzanne; Gout, Ivan

    2014-01-01

    In 1945, Fritz Lipmann discovered a heat-stable cofactor required for many enzyme-catalysed acetylation reactions. He later determined the structure for this acetylation coenzyme, or coenzyme A (CoA), an achievement for which he was awarded the Nobel Prize in 1953. CoA is now firmly embedded in the

  9. Grief-Processing-Based Psychological Intervention for Children Orphaned by AIDS in Central China: A Pilot Study

    Lin, Xiuyun; Fang, Xiaoyi; Chi, Peilian; Li, Xiaoming; Chen, Wenrui; Heath, Melissa Allen

    2014-01-01

    A group of 124 children orphaned by AIDS (COA), who resided in two orphanages funded by the Chinese government, participated in a study investigating the efficacy of a grief-processing-based psychological group intervention. This psychological intervention program was designed to specifically help COA process their grief and reduce their…

  10. Sequence Classification: 389949 [

    Full Text Available Non-TMB Non-TMH Non-TMB Non-TMB Non-TMB Non-TMB >gi|31794460|ref|NP_856953.1| PROBABLE PROPIONYL-COA CARB...OXYLASE BETA CHAIN 5 ACCD5 (PCCASE) (PROPANOYL-COA:CARBON DIOXIDE LIGASE) || http://www.ncbi.nlm.nih.gov/protein/31794460 ...

  11. Sequence Classification: 390462 [

    Full Text Available Non-TMB Non-TMH Non-TMB Non-TMB Non-TMB Non-TMB >gi|31794973|ref|NP_857466.1| PROBABLE PROPIONYL-COA CARB...OXYLASE BETA CHAIN 4 ACCD4 (PCCASE) (PROPANOYL-COA:CARBON DIOXIDE LIGASE) || http://www.ncbi.nlm.nih.gov/protein/31794973 ...

  12. InterProScan Result: CK523618 [KAIKOcDNA[Archive

    Full Text Available CK523618 CK523618_6_ORF1 9340A0F489CFC86C PANTHER PTHR18866 CARBOXYLASE:PYRUVATE/AC...ETYL-COA/PROPIONYL-COA CARBOXYLASE 2.1e-14 T IPR005482 unintegrated Molecular Function: ligase activity (GO:0016874) ...

  13. Sequence Classification: 389173 [

    Full Text Available BLE SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE (ALPHA SUBUNIT) SCOA (3-OXO ACID:CoA TRANSFERASE) (OXCT A...) (SUCCINYL-COA:3-OXOACID-COENZYME A TRANSFERASE) || http://www.ncbi.nlm.nih.gov/protein/31793684 ...

  14. Sequence Classification: 398927 [

    Full Text Available BLE SUCCINYL-COA:3-KETOACID-COENZYME A TRANSFERASE (ALPHA SUBUNIT) SCOA (3-OXO ACID:CoA TRANSFERASE) (OXCT A...) (SUCCINYL-COA:3-OXOACID-COENZYME A TRANSFERASE) || http://www.ncbi.nlm.nih.gov/protein/15609641 ...

  15. Sequence Classification: 389263 [

    Full Text Available Non-TMB Non-TMH Non-TMB Non-TMB Non-TMB Non-TMB >gi|31793774|ref|NP_856267.1| PROBABLE FATTY-ACID...-CoA LIGASE FADD9 (FATTY-ACID-COA SYNTHETASE) (FATTY-ACID-COA SYNTHASE) || http://www.ncbi.nlm.nih.gov/protein/31793774 ...

  16. Coagulase gene polymorphisms detected by PCR in Staphylococcus aureus isolated from subclinical bovine mastitis in Turkey.

    Karahan, Murat; Cetinkaya, Burhan

    2007-09-01

    The genetic relatedness of coagulase (coa) positive Staphylococcus aureus isolated from cows with subclinical mastitis in Turkey was investigated by polymerase chain reaction (PCR)-based restriction fragment length polymorphism (RFLP) analysis. Among 700 milk samples positive in the California Mastitis Test (CMT), species specific PCR identified 200 (28.6%) isolates as S. aureus and 161 (80.5%) of these isolates were positive for the 3' end of the coa gene by PCR. Most isolates (n=135, 83.9%) produced a single band on coa PCR, with molecular sizes ranging from 500 to 1400bp, whereas a small number of isolates (n=26, 16.1%) yielded two amplification products. Coa RFLP analysis using AluI and Hin6I revealed 23 and 22 band patterns, respectively. The detection of double bands by coa PCR, previously reported in human isolates, suggests that milking personnel can play a role in the transmission of S. aureus. PMID:16901735

  17. Scoliosis in patients with aortic coarctation and patent ductus arteriosus: does standard posterolateral thoracotomy play a role in the development of the lateral curve of the spine?

    Roclawski, Marek; Sabiniewicz, Robert; Potaz, Piotr; Smoczynski, Andrzej; Pankowski, Rafal; Mazurek, Tomasz; Daibo, Bawo

    2009-10-01

    The aim of this study was to determine the influence of lateral thoracotomy on the development of scoliosis in subjects undergoing repair of coarctation of the aorta (CoA) and patent ductus arteriosus (PDA). A group of 133 patients with CoA and PDA was evaluated. Forty-five patients with CoA and 38 with PDA underwent surgery using standard posterolateral thoracotomy (operative group), whereas 12 patients with CoA and 31 with PDA were treated using balloon dilatation and stent or coil implantation (nonoperative group). A spinal examination, together with the evaluation of chest and spinal roentgenograms, was conducted. Among the operated patients, 62% of those with CoA and 55% of those with PDA had clinical scoliosis. In the nonoperated patients, scoliosis was present in only 25% of those with CoA and 16% of those with PDA. Scoliosis ranged between 10 degrees and 42 degrees . In 89% of the operated patients with CoA and 76% of those with PDA the curve was thoracic; in 46% of the CoA group and 57% of the PDA group the curve was left-sided. All curves were right-sided in nonoperated subjects. Scoliosis in the operated group was higher in male than in female subjects (63% vs. 60% in CoA and 86% vs. 37% in PDA). The prevalence of scoliosis after standard posterolateral thoracotomy was significantly higher than after nonsurgical treatment methods in the CoA and PDA groups as well as in the general population. The rate of single thoracic and the rate of left-sided thoracic curves in patients after thoracotomy is higher than in nonoperated patients or in those with idiopathic scoliosis. The rate of scoliosis after thoracotomy is higher in male than female patients, especially after thoracotomy for PDA. PMID:19597861

  18. Induction of Neuron-Specific Degradation of Coenzyme A Models Pantothenate Kinase-Associated Neurodegeneration by Reducing Motor Coordination in Mice.

    Stephanie A Shumar

    Full Text Available Pantothenate kinase-associated neurodegeneration, PKAN, is an inherited disorder characterized by progressive impairment in motor coordination and caused by mutations in PANK2, a human gene that encodes one of four pantothenate kinase (PanK isoforms. PanK initiates the synthesis of coenzyme A (CoA, an essential cofactor that plays a key role in energy metabolism and lipid synthesis. Most of the mutations in PANK2 reduce or abolish the activity of the enzyme. This evidence has led to the hypothesis that lower CoA might be the underlying cause of the neurodegeneration in PKAN patients; however, no mouse model of the disease is currently available to investigate the connection between neuronal CoA levels and neurodegeneration. Indeed, genetic and/or dietary manipulations aimed at reducing whole-body CoA synthesis have not produced a desirable PKAN model, and this has greatly hindered the discovery of a treatment for the disease.Cellular CoA levels are tightly regulated by a balance between synthesis and degradation. CoA degradation is catalyzed by two peroxisomal nudix hydrolases, Nudt7 and Nudt19. In this study we sought to reduce neuronal CoA in mice through the alternative approach of increasing Nudt7-mediated CoA degradation. This was achieved by combining the use of an adeno-associated virus-based expression system with the synapsin (Syn promoter. We show that mice with neuronal overexpression of a cytosolic version of Nudt7 (scAAV9-Syn-Nudt7cyt exhibit a significant decrease in brain CoA levels in conjunction with a reduction in motor coordination. These results strongly support the existence of a link between CoA levels and neuronal function and show that scAAV9-Syn-Nudt7cyt mice can be used to model PKAN.

  19. Holographic Weapons Sight as Crew Optical Alignment Sight

    Merancy, Nujoud; Dehmlow, Brian; Brazzel, Jack P.

    2011-01-01

    Crew Optical Alignment Sights (COAS) are used by spacecraft pilots to provide a visual reference to a target spacecraft for lateral relative position during rendezvous and docking operations. NASA s Orion vehicle, which is currently under development, has not included a COAS in favor of automated sensors, but the crew office has requested such a device be added for situational awareness and contingency support. The current Space Shuttle COAS was adopted from Apollo heritage, weighs several pounds, and is no longer available for procurement which would make re-use difficult. In response, a study was conducted to examine the possibility of converting a commercially available weapons sight to a COAS for the Orion spacecraft. The device used in this study was the XPS series Holographic Weapon Sight (HWS) procured from L-3 EOTech. This device was selected because the targeting reticule can subtend several degrees, and display a graphic pattern tailored to rendezvous and docking operations. Evaluations of the COAS were performed in both the Orion low-fidelity mockup and rendezvous simulations in the Reconfigurable Operational Cockpit (ROC) by crewmembers, rendezvous engineering experts, and flight controllers at Johnson Space Center. These evaluations determined that this unit s size and mounting options can support proper operation and that the reticule visual qualities are as good as or better than the current Space Shuttle COAS. The results positively indicate that the device could be used as a functional COAS and supports a low-cost technology conversion solution.

  20. Pantothenate kinase 1 is required to support the metabolic transition from the fed to the fasted state.

    Roberta Leonardi

    Full Text Available Coenzyme A (CoA biosynthesis is regulated by the pantothenate kinases (PanK, of which there are four active isoforms. The PanK1 isoform is selectively expressed in liver and accounted for 40% of the total PanK activity in this organ. CoA synthesis was limited using a Pank1(-/- knockout mouse model to determine whether the regulation of CoA levels was critical to liver function. The elimination of PanK1 reduced hepatic CoA levels, and fasting triggered a substantial increase in total hepatic CoA in both Pank1(-/- and wild-type mice. The increase in hepatic CoA during fasting was blunted in the Pank1(-/- mouse, and resulted in reduced fatty acid oxidation as evidenced by abnormally high accumulation of long-chain acyl-CoAs, acyl-carnitines, and triglycerides in the form of lipid droplets. The Pank1(-/- mice became hypoglycemic during a fast due to impaired gluconeogenesis, although ketogenesis was normal. These data illustrate the importance of PanK1 and elevated liver CoA levels during fasting to support the metabolic transition from glucose utilization and fatty acid synthesis to gluconeogenesis and fatty acid oxidation. The findings also suggest that PanK1 may be a suitable target for therapeutic intervention in metabolic disorders that feature hyperglycemia and hypertriglyceridemia.

  1. Analysis of Leigh syndrome mutations in the yeast SURF1 homolog reveals a new member of the cytochrome oxidase assembly factor family.

    Bestwick, Megan; Jeong, Mi-Young; Khalimonchuk, Oleh; Kim, Hyung; Winge, Dennis R

    2010-09-01

    Three missense SURF1 mutations identified in patients with Leigh syndrome (LS) were evaluated in the yeast homolog Shy1 protein. Introduction of two of the Leigh mutations, F(249)T and Y(344)D, in Shy1 failed to significantly attenuate the function of Shy1 in cytochrome c oxidase (CcO) biogenesis as seen with the human mutations. In contrast, a G(137)E substitution in Shy1 results in a nonfunctional protein conferring a CcO deficiency. The G(137)E Shy1 mutant phenocopied shy1Delta cells in impaired Cox1 hemylation and low mitochondrial copper. A genetic screen for allele-specific suppressors of the G(137)E Shy1 mutant revealed Coa2, Cox10, and a novel factor designated Coa4. Coa2 and Cox10 are previously characterized CcO assembly factors. Coa4 is a twin CX(9)C motif mitochondrial protein localized in the intermembrane space and associated with the inner membrane. Cells lacking Coa4 are depressed in CcO activity but show no impairment in Cox1 maturation or formation of the Shy1-stabilized Cox1 assembly intermediate. To glean insights into the functional role of Coa4 in CcO biogenesis, an unbiased suppressor screen of coa4Delta cells was conducted. Respiratory function of coa4Delta cells was restored by the overexpression of CYC1 encoding cytochrome c. Cyc1 is known to be important at an ill-defined step in the assembly and/or stability of CcO. This new link to Coa4 may begin to further elucidate the role of Cyc1 in CcO biogenesis. PMID:20624914

  2. A liquid crystal of ascorbyl palmitate, used as vaccine platform, provides sustained release of antigen and has intrinsic pro-inflammatory and adjuvant activities which are dependent on MyD88 adaptor protein.

    Sánchez Vallecillo, María F; Minguito de la Escalera, María M; Aguirre, María V; Ullio Gamboa, Gabriela V; Palma, Santiago D; González-Cintado, Leticia; Chiodetti, Ana L; Soldano, Germán; Morón, Gabriel; Allemandi, Daniel A; Ardavín, Carlos; Pistoresi-Palencia, María C; Maletto, Belkys A

    2015-09-28

    Modern subunit vaccines require the development of new adjuvant strategies. Recently, we showed that CpG-ODN formulated with a liquid crystal nanostructure formed by self-assembly of 6-O-ascorbyl palmitate (Coa-ASC16) is an attractive system for promoting an antigen-specific immune response to weak antigens. Here, we showed that after subcutaneous injection of mice with near-infrared fluorescent dye-labeled OVA antigen formulated with Coa-ASC16, the dye-OVA was retained at the injection site for a longer period than when soluble dye-OVA was administered. Coa-ASC16 alone elicited a local inflammation, but how this material triggers this response has not been described yet. Although it is known that some materials used as a platform are not immunologically inert, very few studies have directly focused on this topic. In this study, we explored the underlying mechanisms concerning the interaction between Coa-ASC16 and the immune system and we found that the whole inflammatory response elicited by Coa-ASC16 (leukocyte recruitment and IL-1β, IL-6 and IL-12 production) was dependent on the MyD88 protein. TLR2, TLR4, TLR7 and NLRP3-inflammasome signaling were not required for induction of this inflammatory response. Coa-ASC16 induced local release of self-DNA, and in TLR9-deficient mice IL-6 production was absent. In addition, Coa-ASC16 revealed an intrinsic adjuvant activity which was affected by MyD88 and IL-6 absence. Taken together these results indicate that Coa-ASC16 used as a vaccine platform is effective due to the combination of the controlled release of antigen and its intrinsic pro-inflammatory activity. Understanding how Coa-ASC16 works might have significant implications for rational vaccine design. PMID:26188153

  3. Purification to homogeneity and characterization of acyl coenzyme A:6-aminopenicillanic acid acyltransferase of Penicillium chrysogenum.

    E. Alvarez; Cantoral, J M; Barredo, J L; Díez, B; Martín, J F

    1987-01-01

    The acyl coenzyme A (CoA):6-aminopenicillanic acid (6-APA) acyltransferase of Penicillium chrysogenum AS-P-78 was purified to homogeneity, as concluded by sodium dodecyl sulfate-polyacrylamide gel electrophoresis and isoelectric focusing. The enzyme is a monomer with a molecular weight of 30,000 +/- 1,000 and a pI of about 5.5. The optimal pH and temperature were 8.0 and 25 degrees C, respectively. This enzyme converts 6-APA into penicillin by using phenylacetyl CoA or phenoxyacetyl CoA as ac...

  4. Production of Coenzyme A by a Mutant of Brevibacterium ammoniagenes Resistant to Oxypantetheine

    Shimizu, Sakayu; Esumi, Akihiko; Komaki, Ryohei; Yamada, Hideaki

    1984-01-01

    For improved production of coenzyme A (CoA), a mutant of Brevibacterium ammoniagenes IFO127071 resistant to oxypantetheine, the corresponding oxygen analog of pantetheine, was obtained. In the mutant, activity of pantothenate kinase (EC 2.7.1.33), the first-step enzyme for the biosynthesis of CoA from pantothenic acid, l-cysteine, and ATP, was about threefold higher than that in the parent strain. As the main regulation mechanism of CoA biosynthesis in this bacterium is negative feedback inhi...

  5. Untersuchungen zur Produktion von Vanillin durch Amycolatopsis sp. HR167, Ferulasäurekatabolismus und Etablierung eines Transformationssystems

    Achterholt, S. (Sandra)

    2002-01-01

    Die Arbeit befaßt sich mit dem Gram-positiven Bakterium Amycolatopsis sp. HR167, welcher von der Firma Haarmann und Reimer (Holzminden) für die biotechnologische Produktion von Vanillin aus Ferulasäure eingesetzt wird. Es wurden die an dieser Umsetzung beteiligten Gene (Ferulasäure-CoA-Thiolase und Enoyl-CoA-Hydratase/Aldolase) identifiziert und molekularbiologisch charakterisiert. Desweiteren wurde ein Transformationssystem für den Stamm entwickelt, um Fremd-DNA in den Stamm einzubringen. Hi...

  6. Trimetazidine therapy prevents obesity-induced cardiomyopathy in mice.

    Ussher, John R; Fillmore, Natasha; Keung, Wendy; Mori, Jun; Beker, Donna L; Wagg, Cory S; Jaswal, Jagdip S; Lopaschuk, Gary D

    2014-08-01

    Obesity is a significant risk factor for the development of cardiovascular disease. Inhibiting fatty acid oxidation has emerged as a novel approach for the treatment of ischemic heart disease. Our aim was to determine whether pharmacologic inhibition of 3-ketoacyl-coenzyme A thiolase (3-KAT), which catalyzes the final step of fatty acid oxidation, could improve obesity-induced cardiomyopathy. A 3-week treatment with the 3-KAT inhibitor trimetazidine prevented obesity-induced reduction in both systolic and diastolic function. Therefore, targeting cardiac fatty acid oxidation may be a novel therapeutic approach to alleviate the growing burden of obesity-related cardiomyopathy. PMID:25064584

  7. USCG MARPOL Servicing Facilities

    Department of Homeland Security — Datasets containing a listing of U.S. Ports and Terminals holding valid MARPOL Certificates of Adequacy (COAs). U.S. Ports and Terminals are issued Certificates of...

  8. Synthesis and transformations of 4-chromene 4-hydroxy-2-pyran-2-one and 4-chromene 4-hydroxycoumarin conjugates

    H Surya Prakash Rao; Venkata Swamy Tangeti

    2013-07-01

    The reaction of -methyl-4-(methylthio)-3-nitro-4-chromen-2-amine and its derivatives with 4-hydroxy-6-methyl-2-pyran-2-one in EtOH reflux for 5 min furnish 4-hydroxy-6-methyl-3-(2-(methylamino)-3-nitro-4-chromen-4-yl)-2-pyran-2-ones in quantitative yield. By extending EtOH reflux for 2 h, the 4-chromene 4-hydroxy-2-pyranone conjugates get converted into acetoacetyl coumarins. Similar reaction of -methyl-4-(methylthio)-3-nitro-4-chromen-2-amine and its derivatives with 4-hydroxycoumarin in EtOH reflux furnish 4-hydroxy-2'-(methylamino)-3'-nitro-2,4'-3,4'-bichromen-2-ones. In contrast to earlier system, prolonging reflux in EtOH or in -PrOH reflux the product gets transformed into trans-ethyl 3-(2-hydroxyaryl)-4-oxo-3,4-dihydro-2-furo[3,2-c]chromene-2-carboxylates. Thus, facile synthesis and characterization of 4-chromene 4-hydroxy-2-pyrone, 4-chromene 4-hydroxycoumarin conjugates, acetoacetyl coumarins and trans2,3-disubstituted dihydrofuro[3,2-c]coumarins is described.

  9. In Vitro Enzymatic Synthesis of New Penicillins Containing Keto Acids as Side Chains

    Ferrero, Miguel A.; Reglero, Angel; Martínez-Blanco, Honorina; Fernández-Valverde, Martiniano; Luengo, Jose M.

    1991-01-01

    Seven different penicillins containing α-ketobutyric, β-ketobutyric, γ-ketovaleric, α-ketohexanoic, δ-ketohexanoic, ε-ketoheptanoic, and α-ketooctanoic acids as side chains have been synthesized in vitro by incubating the enzymes phenylacetyl coenzyme A (CoA) ligase from Pseudomonas putida and acyl-CoA:6-aminopenicillanic acid acyltransferase from Penicillium chrysogenum with CoA, ATP, Mg2+, dithiothreitol, 6-aminopenicillanic acid, and the corresponding side chain precursor.

  10. Determination of bacterial meningitis: a retrospective study of 80 cerebrospinal fluid specimens evaluated by four in vitro methods.

    Wasilauskas, B L; Hampton, K D

    1982-01-01

    A total of 80 cerebrospinal fluid specimens were analyzed for bacterial meningitis by four procedures readily available to most laboratories. These tests included routine culturing. Gram staining, countercurrent immunoelectrophoresis, staphylococcal coagglutination (CoA) with laboratory-prepared reagents, and CoA with Pharmacia Diagnostics reagents. A total of 56 specimens were positive for bacterial agents by routine culturing: Gram stain results were positive for 64% of all specimens positi...

  11. Integrated Electroosmotic Perfusion of Tissue with Online Microfluidic Analysis to Track the Metabolism of Cystamine, Pantethine and Coenzyme A

    Wu, Juanfang; Sandberg, Mats; Weber, Stephen G.

    2013-01-01

    We have developed an approach that integrates electroosmotic perfusion of tissue with a substrate-containing solution and online microfluidic analysis of products, in this case thiols. Using this approach we have tracked the metabolism of cystamine, pantethine and CoA in the extracellular space of organotypic hippocampal slice cultures (OHSCs). Currently, little is known about coenzyme A (CoA) biodegradation and even less is known about the regulation and kinetic characteristics for this sequ...

  12. The STM4195 Gene Product (PanS) Transports Coenzyme A Precursors in Salmonella enterica

    Ernst, Dustin C.; Downs, Diana M.

    2015-01-01

    Coenzyme A (CoA) is a ubiquitous coenzyme involved in fundamental metabolic processes. CoA is synthesized from pantothenic acid by a pathway that is largely conserved among bacteria and eukaryotes and consists of five enzymatic steps. While higher organisms, including humans, must scavenge pantothenate from the environment, most bacteria and plants are capable of de novo pantothenate biosynthesis. In Salmonella enterica, precursors to pantothenate can be salvaged, but subsequent intermediates...

  13. The Hypolipidemic Activity of Metal Complexes of Amine Carboxyboranes in Rodents

    Hall, Iris H.; Spielvogel, Bernard F.; Sood, Anup; Morse, Karan W.; Norwood III, Verrill M.; Wong, Oi. T.

    1994-01-01

    The metal complexes of amine-carboxyborane including copper, chromium, zinc, calcium amd cobalt were effective hypolipidemic agents lowering both serum cholesterol and triglyceride levels significantly in mice at 8 mg/kg/day, I.P. after 16 days. The agents reduced acetyl CoA synthetase, ATP-dependent citrate lyase, acyl CoA cholesterol acyl transferase, sn¯-glycerol-3-phosphate acyl transferase activities of rat liver and small intestinal mucosa after 14 days treatment. The neutral cholestero...

  14. Biochemical characterization and substrate specificity of jojoba fatty acyl-CoA reductase and jojoba wax synthase.

    Miklaszewska, Magdalena; Banaś, Antoni

    2016-08-01

    Wax esters are used in industry for production of lubricants, pharmaceuticals and cosmetics. The only natural source of wax esters is jojoba oil. A much wider variety of industrial wax esters-containing oils can be generated through genetic engineering. Biotechnological production of tailor-made wax esters requires, however, a detailed substrate specificity of fatty acyl-CoA reductases (FAR) and wax synthases (WS), the two enzymes involved in wax esters synthesis. In this study we have successfully characterized the substrate specificity of jojoba FAR and jojoba WS. The genes encoding both enzymes were expressed heterologously in Saccharomyces cerevisiae and the activity of tested enzymes was confirmed by in vivo studies and in vitro assays using microsomal preparations from transgenic yeast. Jojoba FAR exhibited the highest in vitro activity toward 18:0-CoA followed by 20:1-CoA and 22:1-CoA. The activity toward other 11 tested acyl-CoAs was low or undetectable as with 18:2-CoA and 18:3-CoA. In assays characterizing jojoba WS combinations of 17 fatty alcohols with 14 acyl-CoAs were tested. The enzyme displayed the highest activity toward 14:0-CoA and 16:0-CoA in combination with C16-C20 alcohols as well as toward C18 acyl-CoAs in combination with C12-C16 alcohols. 20:1-CoA was efficiently utilized in combination with most of the tested alcohols. PMID:27297992

  15. Drug: D07474 [KEGG MEDICUS

    Full Text Available D07474 Drug Atorvastatin ... (INN); Lipitor (TN); Sortis (TN) C33H35FN2O5 558.253 558.6398 D07474.gi ... , PLAIN C10AA HMG CoA reductase inhibitors C10AA05 Atorvastatin ... D07474 Atorvastatin ... (INN) USP drug classification ... Agents Dyslipidemics, HMG CoA Reductase Inhibitors Atorvastatin ... D07474 Atorvastatin ... (INN) Target-based classificat ...

  16. Role of Subcellular Differentiation in Plant Disease Resistance

    Lang, Saara Susanna

    1997-01-01

    3-Hydroxy-3-methylglutaryl CoA reductase (HMGR, EC 1.1.1.34) catalyzes the reaction from hydroxymethylglutaryl CoA to mevalonate in the isoprenoid pathway. In solanaceous plants, one class of endproducts of the pathway are sesquiterpenoid phytoalexins, antibiotic compounds produced by plants in response to pathogens. We are interested in the role of the defense-inducible isoforms of HMGR in phytoalexin production and disease resistance. Transgenic tobacco, ...

  17. Inhibitors of Fatty Acid Synthesis Induce PPAR α -Regulated Fatty Acid β -Oxidative Genes: Synergistic Roles of L-FABP and Glucose

    Huan Huang; McIntosh, Avery L.; Martin, Gregory G.; Petrescu, Anca D.; Landrock, Kerstin K.; Danilo Landrock; Kier, Ann B.; Friedhelm Schroeder

    2013-01-01

    While TOFA (acetyl CoA carboxylase inhibitor) and C75 (fatty acid synthase inhibitor) prevent lipid accumulation by inhibiting fatty acid synthesis, the mechanism of action is not simply accounted for by inhibition of the enzymes alone. Liver fatty acid binding protein (L-FABP), a mediator of long chain fatty acid signaling to peroxisome proliferator-activated receptor-α (PPARα) in the nucleus, was found to bind TOFA and its activated CoA th...

  18. Contribution of Staphylococcus aureus Coagulases and Clumping Factor A to Abscess Formation in a Rabbit Model of Skin and Soft Tissue Infection

    Malachowa, Natalia; Kobayashi, Scott D.; Porter, Adeline R.; Braughton, Kevin R.; Scott, Dana P.; Gardner, Donald J.; Missiakas, Dominique M.; Schneewind, Olaf; DeLeo, Frank R.

    2016-01-01

    Staphylococcus aureus produces numerous factors that facilitate survival in the human host. S. aureus coagulase (Coa) and von Willebrand factor-binding protein (vWbp) are known to clot plasma through activation of prothrombin and conversion of fibrinogen to fibrin. In addition, S. aureus clumping factor A (ClfA) binds fibrinogen and contributes to platelet aggregation via a fibrinogen- or complement-dependent mechanism. Here, we evaluated the contribution of Coa, vWbp and ClfA to S. aureus pathogenesis in a rabbit model of skin and soft tissue infection. Compared to skin abscesses caused by the Newman wild-type strain, those caused by isogenic coa, vwb, or clfA deletion strains, or a strain deficient in coa and vwb, were significantly smaller following subcutaneous inoculation in rabbits. Unexpectedly, we found that fibrin deposition and abscess capsule formation appear to be independent of S. aureus coagulase activity in the rabbit infection model. Similarities notwithstanding, S. aureus strains deficient in coa and vwb elicited reduced levels of several proinflammatory molecules in human blood in vitro. Although a specific mechanism remains to be determined, we conclude that S. aureus Coa, vWbp and ClfA contribute to abscess formation in rabbits. PMID:27336691

  19. Simulation-based planning for peacekeeping operations: selection of robust plans

    Cekova, Cvetelina; Chandrasekaran, B.; Josephson, John; Pantaleev, Aleksandar

    2006-05-01

    This research is part of a proposed shift in emphasis in decision support from optimality to robustness. Computer simulation is emerging as a useful tool in planning courses of action (COAs). Simulations require domain models, but there is an inevitable gap between models and reality - some aspects of reality are not represented at all, and what is represented may contain errors. As models are aggregated from multiple sources, the decision maker is further insulated from even an awareness of model weaknesses. To realize the full power of computer simluations to support decision making, decision support systems should support the planner in exporing the robustness of COAs in the face of potential weaknesses in simulation models. This paper demonstrates a method of exploring the robustness of a COA with respect to specific model assumptions about whose accuracy the decision maker might have concerns. The domain is that of peacekeeping in a country where three differenct demographic groups co-exist in tension. An external peacekeeping force strives to achieve stability, an improved economy, and a higher degree of democracy in the country. A proposed COA for such a force is simluated multiple times while varying the assumptions. A visual data analysis tool is used to explore COA robustness. The aim is to help the decision maker choose a COA that is likely to be successful even in the face of potential errors in the assumptions in the models.

  20. Mild coarctation of the aorta: to touch or not to touch the patient?

    Keshavarz-Motamed, Zahra; Randles, Amanda; Rikhtegar Nezami, Farhad; Partida, Ramon; Nakamura, Kenta; Staziaki, Pedro V.; Ghoshhajra, Brian; Bhatt, Ami; Edelman, Elazer R.

    2015-11-01

    Coarctation of the aorta (COA) is an aortic obstruction. A peak-to-peak trans-coarctation pressure gradient (PKdP) of greater than 20 mmHg warns severe COA and the need for interventional/surgical repair. The optimal method and timing of intervention remain uncertain especially for mild COA (PKdP treatment strategies for mild COA may need to be redefined as transcatheter interventions emerge, benefits of such interventions are unclear. We investigated the effects of transcatheter interventions on the aorta and left ventricle (LV) hemodynamics in 11 patients with mild COA using a developed computational fluid dynamics and lumped parameter modeling framework along with particle image velocimetry and clinical measurements. Such interventions can improve aortic hemodynamics to some extent (e.g., time-averaged wall shear stress and kinetic energy were reduced by about 20%). However there is no concomitant effect on the LV hemodynamics (e.g., stroke work and LV pressure were reduced by only less than 4%). Our computational approach can effectively predict clinical conditions. Herein one must question intervention for mild COA, as it has limited utility in reducing myocardial strain.

  1. Peroxisomal beta-oxidation defect with detectable peroxisomes: a case with neonatal onset and progressive course.

    Barth, P G; Wanders, R J; Schutgens, R B; Bleeker-Wagemakers, E M; van Heemstra, D

    1990-07-01

    A progressive demyelinating cerebral disorder is described in a normally-appearing female infant with neonatal seizures, progressive psychomotor deterioration, deafness, retinopathy, peripheral neuropathy and loss of myelin observed on magnetic resonance imaging (MRI) scanning. MRI also showed the absence of macroscopic neocortical dysplasia which is usually found in Zellweger syndrome (ZS). Adrenal cortical function was normal. The patient died at the age of 37 months. Extensive biochemical investigations of peroxisomal functions in the patient revealed an impairment of peroxisomal beta-oxidation resulting in elevated levels of very long (greater than C22) chain fatty acids in plasma and fibroblasts. Moreover, elevated plasma levels of intermediates of bile acid biosynthesis such as tri- and dihydroxycholestanoic acid were found. Other peroxisomal functions were normal. Immunoblotting of the peroxisomal beta-oxidation enzyme proteins in liver from the patient revealed normal responses with antisera against acyl-CoA oxidase, bifunctional protein and thiolase respectively. From these data we conclude that the patient had a deficiency of a single peroxisomal beta-oxidation enzyme at the level of either the bifunctional protein or peroxisomal thiolase with retained immunoreactivity against these enzymes. PMID:2209666

  2. The role of UPF0157 in the folding of M. tuberculosis dephosphocoenzyme A kinase and the regulation of the latter by CTP.

    Guneet Walia

    Full Text Available BACKGROUND: Targeting the biosynthetic pathway of Coenzyme A (CoA for drug development will compromise multiple cellular functions of the tubercular pathogen simultaneously. Structural divergence in the organization of the penultimate and final enzymes of CoA biosynthesis in the host and pathogen and the differences in their regulation mark out the final enzyme, dephosphocoenzyme A kinase (CoaE as a potential drug target. METHODOLOGY/PRINCIPAL FINDINGS: We report here a complete biochemical and biophysical characterization of the M. tuberculosis CoaE, an enzyme essential for the pathogen's survival, elucidating for the first time the interactions of a dephosphocoenzyme A kinase with its substrates, dephosphocoenzyme A and ATP; its product, CoA and an intrinsic yet novel inhibitor, CTP, which helps modulate the enzyme's kinetic capabilities providing interesting insights into the regulation of CoaE activity. We show that the mycobacterial enzyme is almost 21 times more catalytically proficient than its counterparts in other prokaryotes. ITC measurements illustrate that the enzyme follows an ordered mechanism of substrate addition with DCoA as the leading substrate and ATP following in tow. Kinetic and ITC experiments demonstrate that though CTP binds strongly to the enzyme, it is unable to participate in DCoA phosphorylation. We report that CTP actually inhibits the enzyme by decreasing its Vmax. Not surprisingly, a structural homology search for the modeled mycobacterial CoaE picks up cytidylmonophosphate kinases, deoxycytidine kinases, and cytidylate kinases as close homologs. Docking of DCoA and CTP to CoaE shows that both ligands bind at the same site, their interactions being stabilized by 26 and 28 hydrogen bonds respectively. We have also assigned a role for the universal Unknown Protein Family 0157 (UPF0157 domain in the mycobacterial CoaE in the proper folding of the full length enzyme. CONCLUSIONS/SIGNIFICANCE: In view of the evidence

  3. Electrical/thermal transport and electronic structure of the binary cobalt pnictides CoPn2 (Pn = As and Sb)

    We demonstrate the electrical and thermal transport properties of polycrystalline CoPn2 (Pn = As and Sb) between 300 and 900 K. CoAs2 shows semiconducting electrical transport up to 900 K, while CoSb2 exhibits degenerate conduction. Sign inversion of the Seebeck coefficient is observed at ∼310 and ∼400 K for CoAs2 and CoSb2, respectively. Thermal conductivity at 300 K is 11.7 Wm−1K−1 for CoAs2 and 9.4 Wm−1K−1 for CoSb2. The thermoelectric power factor of CoAs2 is ∼10 μWcm−1K−2, although the dimensionless figure of merit is limited to ∼0.1 due to relatively high thermal conductivity. Using electronic structure calculations, the band gap value is calculated to be 0.55 eV for CoAs2 and 0.26 eV for CoSb2

  4. Cyberwar XXI: quantifying the unquantifiable: adaptive AI for next-generation conflict simulations

    Miranda, Joseph; von Kleinsmid, Peter; Zalewski, Tony

    2004-08-01

    The era of the "Revolution in Military Affairs," "4th Generation Warfare" and "Asymmetric War" requires novel approaches to modeling warfare at the operational and strategic level of modern conflict. For example, "What if, in response to our planned actions, the adversary reacts in such-and-such a manner? What will our response be? What are the possible unintended consequences?" Next generation conflict simulation tools are required to help create and test novel courses of action (COA's) in support of real-world operations. Conflict simulations allow non-lethal and cost-effective exploration of the "what-if" of COA development. The challenge has been to develop an automated decision-support software tool which allows competing COA"s to be compared in simulated dynamic environments. Principal Investigator Joseph Miranda's research is based on modeling an integrated military, economic, social, infrastructure and information (PMESII) environment. The main effort was to develop an adaptive AI engine which models agents operating within an operational-strategic conflict environment. This was implemented in Cyberwar XXI - a simulation which models COA selection in a PMESII environment. Within this framework, agents simulate decision-making processes and provide predictive capability of the potential behavior of Command Entities. The 2003 Iraq is the first scenario ready for V&V testing.

  5. Inhibition of 3-Hydroxy-3-methylglutaryl Coenzyme A Reductase (Ex Vivo by Morus indica (Mulberry

    Vanitha Reddy Palvai

    2014-01-01

    Full Text Available Phytochemicals are the bioactive components that contribute to the prevention of cardiovascular and other degenerative diseases. Inhibition of 3-hydroxy-3-methylglutaryl coenzyme A (HMG CoA reductase would be an effective means of lowering plasma cholesterol in humans. The present study explores the HMG CoA reductase inhibitory effect of extracts from leaves of Morus indica varieties, M5, V1, and S36, compared with the statin, using an ex vivo method. The assay is based on the stoichiometric formation of coenzyme A during the reduction of microsomal HMG CoA to mevalonate. Dechlorophyllised extract of three varieties was studied at 300 µg. The coenzyme A released at the end of assay in control (100.31 nmoles and statins (94.46 nm was higher than the dechlorphyllised extracts of the samples. The coenzyme A released during the reduction of HMG CoA to mevalonate in dechlorophyllised extracts of the samples was as follows: S36 < M5 < V1. The results indicated that the samples were highly effective in inhibiting the enzyme compared to statins (standard drug. The results indicate the role of Morus varieties extracts in modulating the cholesterol metabolism by inhibiting the activity of HMG CoA reductase. These results provide scope for designing in vivo animal studies to confirm their effect.

  6. Chaos optimization algorithms based on chaotic maps with different probability distribution and search speed for global optimization

    Yang, Dixiong; Liu, Zhenjun; Zhou, Jilei

    2014-04-01

    Chaos optimization algorithms (COAs) usually utilize the chaotic map like Logistic map to generate the pseudo-random numbers mapped as the design variables for global optimization. Many existing researches indicated that COA can more easily escape from the local minima than classical stochastic optimization algorithms. This paper reveals the inherent mechanism of high efficiency and superior performance of COA, from a new perspective of both the probability distribution property and search speed of chaotic sequences generated by different chaotic maps. The statistical property and search speed of chaotic sequences are represented by the probability density function (PDF) and the Lyapunov exponent, respectively. Meanwhile, the computational performances of hybrid chaos-BFGS algorithms based on eight one-dimensional chaotic maps with different PDF and Lyapunov exponents are compared, in which BFGS is a quasi-Newton method for local optimization. Moreover, several multimodal benchmark examples illustrate that, the probability distribution property and search speed of chaotic sequences from different chaotic maps significantly affect the global searching capability and optimization efficiency of COA. To achieve the high efficiency of COA, it is recommended to adopt the appropriate chaotic map generating the desired chaotic sequences with uniform or nearly uniform probability distribution and large Lyapunov exponent.

  7. Myocardial hypertrophy and the maturation of fatty acid oxidation in the newborn human heart.

    Yatscoff, Michael A; Jaswal, Jagdip S; Grant, Meghan R; Greenwood, Rachel; Lukat, Trish; Beker, Donna L; Rebeyka, Ivan M; Lopaschuk, Gary D

    2008-12-01

    After birth dramatic decreases in cardiac malonyl CoA levels result in the rapid maturation of fatty acid oxidation. We have previously demonstrated that the decrease in malonyl CoA is due to increased activity of malonyl CoA decarboxylase (MCD), and decreased activity of acetyl CoA carboxylase (ACC), enzymes which degrade and synthesize malonyl CoA, respectively. Decreased ACC activity corresponds to an increase in the activity of 5'-AMP activated protein kinase (AMPK), which phosphorylates and inhibits ACC. These alterations are delayed by myocardial hypertrophy. As rates of fatty acid oxidation can influence the ability of the heart to withstand an ischemic insult, we examined the expression of MCD, ACC, and AMPK in the newborn human heart. Ventricular biopsies were obtained from infants undergoing cardiac surgery. Immunoblot analysis showed a positive correlation between MCD expression and age. In contrast, a negative correlation in both ACC and AMPK expression and age was observed. All ventricular samples displayed some degree of hypertrophy, however, no differences in enzyme expression were found between moderate and severe hypertrophy. This indicates that increased expression of MCD, and the decreased expression of ACC and AMPK are important regulators of the maturation of fatty acid oxidation in the newborn human heart. PMID:18614968

  8. Metabolic annotation of 2-ethylhydracrylic acid.

    Ryan, Robert O

    2015-08-25

    Increased levels of the organic acid, 2-ethylhydracrylic acid (2-EHA) occur in urine of subjects with impaired L(+)-isoleucine metabolism. Chiral intermediates formed during isoleucine degradation are (S) enantiomers. Blockage of (S) pathway flux drives racemization of (2S, 3S) L(+)-isoleucine and its (2S, 3R) stereoisomer, L(+)-alloisoleucine. This non-protein amino acid is metabolized to (R)-2-methylbutyryl CoA via enzymes common to branched chain amino acid degradation. Subsequently, (R) intermediates serve as alternate substrates for three valine metabolic enzymes, generating 2-EHA. Once formed, 2-EHA accumulates because it is poorly recognized by distal valine pathway enzymes. Thus, urinary 2-EHA represents a biomarker of isoleucine pathway defects. 2-EHA levels are also increased in rats exposed to the industrial solvent, ethylene glycol monomethyl ether or the neurotoxin precursor, 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine. In these cases, a block in (S) pathway isoleucine catabolism occurs at the level of (S)-2-methylbutyryl CoA conversion to tiglyl CoA via inhibition of electron transferring flavoprotein/ubiquinone oxidoreductase dependent reactions. Elevated urinary 2-EHA in propionyl CoA carboxylase deficiency and methylmalonic aciduria results from a buildup of distal intermediates in the (S) pathway of isoleucine degradation. In Barth syndrome and dilated cardiomyopathy with ataxia syndrome, 2-EHA is a byproduct of impeded propionyl CoA entry into the Krebs cycle. PMID:26115894

  9. Electrical/thermal transport and electronic structure of the binary cobalt pnictides CoPn2 (Pn = As and Sb

    Yosuke Goto

    2015-06-01

    Full Text Available We demonstrate the electrical and thermal transport properties of polycrystalline CoPn2 (Pn = As and Sb between 300 and 900 K. CoAs2 shows semiconducting electrical transport up to 900 K, while CoSb2 exhibits degenerate conduction. Sign inversion of the Seebeck coefficient is observed at ∼310 and ∼400 K for CoAs2 and CoSb2, respectively. Thermal conductivity at 300 K is 11.7 Wm−1K−1 for CoAs2 and 9.4 Wm−1K−1 for CoSb2. The thermoelectric power factor of CoAs2 is ∼10 μWcm−1K−2, although the dimensionless figure of merit is limited to ∼0.1 due to relatively high thermal conductivity. Using electronic structure calculations, the band gap value is calculated to be 0.55 eV for CoAs2 and 0.26 eV for CoSb2.

  10. Parallel and four-step synthesis of natural-product-inspired scaffolds through modular assembly and divergent cyclization

    Hiroki Oguri

    2012-06-01

    Full Text Available By emulating the universal biosynthetic strategy, which employs modular assembly and divergent cyclizations, we have developed a four-step synthetic process to yield a collection of natural-product-inspired scaffolds. Modular assembly of building blocks onto a piperidine-based manifold 6, having a carboxylic acid group, was achieved through Ugi condensation, N-acetoacetylation and diazotransfer, leading to cyclization precursors. The rhodium-catalyzed tandem cyclization and divergent cycloaddition gave rise to tetracyclic and hexacyclic scaffolds by the appropriate choice of dipolarophiles installed at modules 3 and 4. A different piperidine-based manifold 15 bearing an amino group was successfully applied to demonstrate the flexibility and scope of the unified four-step process for the generation of structural diversity in the fused scaffolds. Evaluation of in vitro antitrypanosomal activities of the collections and preliminary structure–activity relationship (SAR studies were also undertaken.

  11. Clinical Outcome Assessments: Conceptual Foundation-Report of the ISPOR Clinical Outcomes Assessment - Emerging Good Practices for Outcomes Research Task Force.

    Walton, Marc K; Powers, John H; Hobart, Jeremy; Patrick, Donald; Marquis, Patrick; Vamvakas, Spiros; Isaac, Maria; Molsen, Elizabeth; Cano, Stefan; Burke, Laurie B

    2015-09-01

    An outcome assessment, the patient assessment used in an endpoint, is the measuring instrument that provides a rating or score (categorical or continuous) that is intended to represent some aspect of the patient's health status. Outcome assessments are used to define efficacy endpoints when developing a therapy for a disease or condition. Most efficacy endpoints are based on specified clinical assessments of patients. When clinical assessments are used as clinical trial outcomes, they are called clinical outcome assessments (COAs). COAs include any assessment that may be influenced by human choices, judgment, or motivation. COAs must be well-defined and possess adequate measurement properties to demonstrate (directly or indirectly) the benefits of a treatment. In contrast, a biomarker assessment is one that is subject to little, if any, patient motivational or rater judgmental influence. This is the first of two reports by the ISPOR Clinical Outcomes Assessment - Emerging Good Practices for Outcomes Research Task Force. This report provides foundational definitions important for an understanding of COA measurement principles. The foundation provided in this report includes what it means to demonstrate a beneficial effect, how assessments of patients relate to the objective of showing a treatment's benefit, and how these assessments are used in clinical trial endpoints. In addition, this report describes intrinsic attributes of patient assessments and clinical trial factors that can affect the properties of the measurements. These factors should be considered when developing or refining assessments. These considerations will aid investigators designing trials in their choice of using an existing assessment or developing a new outcome assessment. Although the focus of this report is on the development of a new COA to define endpoints in a clinical trial, these principles may be applied more generally. A critical element in appraising or developing a COA is to

  12. Overexpression of human fatty acid transport protein 2/very long chain acyl-CoA synthetase 1 (FATP2/Acsvl1) reveals distinct patterns of trafficking of exogenous fatty acids

    Melton, Elaina M. [Department of Biochemistry, University of Nebraska, Lincoln, NE (United States); Center for Cardiovascular Sciences, Albany Medical College, Albany, NY (United States); Cerny, Ronald L. [Department of Chemistry, University of Nebraska, Lincoln, NE (United States); DiRusso, Concetta C. [Department of Biochemistry, University of Nebraska, Lincoln, NE (United States); Black, Paul N., E-mail: pblack2@unl.edu [Department of Biochemistry, University of Nebraska, Lincoln, NE (United States)

    2013-11-01

    Highlights: •Roles of FATP2 in fatty acid transport/activation contribute to lipid homeostasis. •Use of 13C- and D-labeled fatty acids provide novel insights into FATP2 function. •FATP2-dependent trafficking of FA into phospholipids results in distinctive profiles. •FATP2 functions in the transport and activation pathways for exogenous fatty acids. -- Abstract: In mammals, the fatty acid transport proteins (FATP1 through FATP6) are members of a highly conserved family of proteins, which function in fatty acid transport proceeding through vectorial acylation and in the activation of very long chain fatty acids, branched chain fatty acids and secondary bile acids. FATP1, 2 and 4, for example directly function in fatty acid transport and very long chain fatty acids activation while FATP5 does not function in fatty acid transport but activates secondary bile acids. In the present work, we have used stable isotopically labeled fatty acids differing in carbon length and saturation in cells expressing FATP2 to gain further insights into how this protein functions in fatty acid transport and intracellular fatty acid trafficking. Our previous studies showed the expression of FATP2 modestly increased C16:0-CoA and C20:4-CoA and significantly increased C18:3-CoA and C22:6-CoA after 4 h. The increases in C16:0-CoA and C18:3-CoA suggest FATP2 must necessarily partner with a long chain acyl CoA synthetase (Acsl) to generate C16:0-CoA and C18:3-CoA through vectorial acylation. The very long chain acyl CoA synthetase activity of FATP2 is consistent in the generation of C20:4-CoA and C22:6-CoA coincident with transport from their respective exogenous fatty acids. The trafficking of exogenous fatty acids into phosphatidic acid (PA) and into the major classes of phospholipids (phosphatidylcholine (PC), phosphatidylethanolamine (PE), phosphatidylinositol (PI), and phosphatidyserine (PS)) resulted in distinctive profiles, which changed with the expression of FATP2. The

  13. Overexpression of human fatty acid transport protein 2/very long chain acyl-CoA synthetase 1 (FATP2/Acsvl1) reveals distinct patterns of trafficking of exogenous fatty acids

    Highlights: •Roles of FATP2 in fatty acid transport/activation contribute to lipid homeostasis. •Use of 13C- and D-labeled fatty acids provide novel insights into FATP2 function. •FATP2-dependent trafficking of FA into phospholipids results in distinctive profiles. •FATP2 functions in the transport and activation pathways for exogenous fatty acids. -- Abstract: In mammals, the fatty acid transport proteins (FATP1 through FATP6) are members of a highly conserved family of proteins, which function in fatty acid transport proceeding through vectorial acylation and in the activation of very long chain fatty acids, branched chain fatty acids and secondary bile acids. FATP1, 2 and 4, for example directly function in fatty acid transport and very long chain fatty acids activation while FATP5 does not function in fatty acid transport but activates secondary bile acids. In the present work, we have used stable isotopically labeled fatty acids differing in carbon length and saturation in cells expressing FATP2 to gain further insights into how this protein functions in fatty acid transport and intracellular fatty acid trafficking. Our previous studies showed the expression of FATP2 modestly increased C16:0-CoA and C20:4-CoA and significantly increased C18:3-CoA and C22:6-CoA after 4 h. The increases in C16:0-CoA and C18:3-CoA suggest FATP2 must necessarily partner with a long chain acyl CoA synthetase (Acsl) to generate C16:0-CoA and C18:3-CoA through vectorial acylation. The very long chain acyl CoA synthetase activity of FATP2 is consistent in the generation of C20:4-CoA and C22:6-CoA coincident with transport from their respective exogenous fatty acids. The trafficking of exogenous fatty acids into phosphatidic acid (PA) and into the major classes of phospholipids (phosphatidylcholine (PC), phosphatidylethanolamine (PE), phosphatidylinositol (PI), and phosphatidyserine (PS)) resulted in distinctive profiles, which changed with the expression of FATP2. The

  14. Creating clinical trial designs that incorporate clinical outcome assessments.

    Gilbert, Mark R; Rubinstein, Lawrence; Lesser, Glenn

    2016-03-01

    Clinical outcome assessments (COAs) are increasingly being used in determining the efficacy of new treatment regimens. This was typified in the recent use of a symptom-based instrument combined with an organ-based measure of response for the approval of ruxolitinib in myelofibrosis. There are challenges in incorporating these COAs into clinical trials, including designating the level of priority, incorporating these measures into a combined or composite endpoint, and dealing with issues related to compliance and interpretation of results accounting for missing data. This article describes the results of a recent panel discussion that attempted to address these issues and provide guidance to the incorporation of COAs into clinical trials, including novel statistical designs, so that the testing of new treatments in patients with cancers of the central nervous system can incorporate these important clinical endpoints. PMID:26989129

  15. Psychological characteristics of children of alcoholics.

    Sher, K J

    1997-01-01

    More than 20 years ago, researchers first noted that children of alcoholics (COA's) appeared to be affected by a variety of problems over the course of their life span. Such problems include fetal alcohol syndrome, which is first manifested in infancy; emotional problems and hyperactivity in childhood; emotional problems and conduct problems in adolescence; and the development of alcoholism in adulthood. Although much has been learned over the ensuing two decades, a number of controversial research areas remain. In particular, debate stems from the fact that despite a common interest in COA's, clinically focused literature and research-focused literature have resulted in two distinct bodies of knowledge. This article reviews important research results, with emphasis on findings generated by the alcohol-research community. Attention also is given to examining the empirical validity of concepts that have been advanced by several influential clinicians from the COA field. PMID:15706777

  16. AcEST: DK944175 [AcEST

    Full Text Available 51|FADA_ECOLI 3-ketoacyl-CoA thiolase OS=Escherichia coli... 30 9.0 sp|Q9ERQ6|CSPG5_RAT Chondroit...L PRA Sbjct: 213 ETTVEALATLRPAFDPVNGMVTAGTSSALSDGAAAMLVMSESRAHELGLKPRA 265 >sp|Q9ERQ6|CSPG5_RAT Chondroit...e... 34 5.4 tr|B3NTX0|B3NTX0_DROER GG18628 OS=Drosophila erecta GN=GG18628 P... 34 5.4 tr|B4Q0W1|B4Q0W1_DROYA GE16281 OS=Dro...GTAGGGACGATTGCATC ■■Homology search results ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swiss-Prot sp_hit..._id Q14586 Definition sp|Q14586|ZN267_HUMAN Zinc finger protein 267 OS=Homo sapiens Align length 78 Score (bit

  17. Uranium determination in zirconium

    The method used for the spectrometric uranium determination with 2-(2-thiolase)-5-diethylaminophenol was modified for its application in the zirconium samples analysis with an uranium content of the 0.1% order. The samples, previously dissolved in nitric acid, were submitted to a separative stage of liquid-liquid extraction, with a trioctylphosphine (TOPO) oxide diluted in cyclohexane. A sodium fluoride aqueous solution was necessary to be aggregated in the spectrometric determination so as to complex the zirconium vestiges, which could be present, originated by the Zr/U high relation of the initial sample. Under the established working conditions, different spectrometric assays, dyes absorption spectra and its uranium complex, complex stability, PH influence determination of the dyes-uranium relation, calculation of the complex's apparent formation constant and its molar absorption, were performed. (Author)

  18. Coenzyme A disulfide reductase, the primary low molecular weight disulfide reductase from Staphylococcus aureus. Purification and characterization of the native enzyme.

    delCardayre, S B; Stock, K P; Newton, G L; Fahey, R C; Davies, J E

    1998-03-01

    The human pathogen Staphylococcus aureus does not utilize the glutathione thiol/disulfide redox system employed by eukaryotes and many bacteria. Instead, this organism produces CoA as its major low molecular weight thiol. We report the identification and purification of the disulfide reductase component of this thiol/disulfide redox system. Coenzyme A disulfide reductase (CoADR) catalyzes the specific reduction of CoA disulfide by NADPH. CoADR has a pH optimum of 7.5-8.0 and is a dimer of identical subunits of Mr 49,000 each. The visible absorbance spectrum is indicative of a flavoprotein with a lambdamax = 452 nm. The liberated flavin from thermally denatured enzyme was identified as flavin adenine dinucleotide. Steady-state kinetic analysis revealed that CoADR catalyzes the reduction of CoA disulfide by NADPH at pH 7.8 with a Km for NADPH of 2 muM and for CoA disulfide of 11 muM. In addition to CoA disulfide CoADR reduces 4,4'-diphosphopantethine but has no measurable ability to reduce oxidized glutathione, cystine, pantethine, or H2O2. CoADR demonstrates a sequential kinetic mechanism and employs a single active site cysteine residue that forms a stable mixed disulfide with CoA during catalysis. These data suggest that S. aureus employs a thiol/disulfide redox system based on CoA/CoA-disulfide and CoADR, an unorthodox new member of the pyridine nucleotide-disulfide reductase superfamily. PMID:9488707

  19. Bicuspid aortic valve and aortic coarctation are linked to deletion of the X chromosome short arm in Turner syndrome

    Bondy, Carolyn; Bakalov, Vladimir K; Cheng, Clara; Olivieri, Laura; Rosing, Douglas R; Arai, Andrew E

    2013-01-01

    Background Congenital heart disease (CHD) is a cardinal feature of X chromosome monosomy, or Turner syndrome (TS). Haploinsufficiency for gene(s) located on Xp have been implicated in the short stature characteristic of the syndrome, but the chromosomal region related to the CHD phenotype has not been established. Design We used cardiac MRI to diagnose cardiovascular abnormalities in four non-mosaic karyotype groups based on 50-metaphase analyses: 45,X (n=152); 46,X,del(Xp) (n=15); 46,X,del(Xq) (n=4); and 46,X,i(Xq) (n=14) from peripheral blood cells. Results Bicuspid aortic valves (BAV) were found in 52/152 (34%) 45,X study subjects and aortic coarctation (COA) in 19/152 (12.5%). Isolated anomalous pulmonary veins (APV) were detected in 15/152 (10%) for the 45,X study group, and this defect was not correlated with the presence of BAV or COA. BAVs were present in 28.6% of subjects with Xp deletions and COA in 6.7%. APV were not found in subjects with Xp deletions. The most distal break associated with the BAV/COA trait was at cytologic band Xp11.4 and ChrX:41,500 000. One of 14 subjects (7%) with the 46,X,i(Xq) karyotype had a BAV and no cases of COA or APV were found in this group. No cardiovascular defects were found among four patients with Xq deletions. Conclusions The high prevalence of BAV and COA in subjects missing only the X chromosome short arm indicates that haploinsufficiency for Xp genes contributes to abnormal aortic valve and aortic arch development in TS. PMID:23825392

  20. Decreased hepatic contents of coenzyme A molecular species in mice after subchronic mild social defeat stress.

    Kubota, Yoshifumi; Goto, Tatsuhiko; Hagiya, Yuki; Chohnan, Shigeru; Toyoda, Atsushi

    2016-03-01

    Social stress may precipitate psychiatric disorders such as depression, which is related to the occurrence of the metabolic syndrome, including obesity and type 2 diabetes. We have evaluated the effects of social stress on central and peripheral metabolism using a model of depression in mice. In the present study, we focused on coenzyme A (CoA) molecular species [i.e. non-esterified CoA (CoASH), acetyl-CoA and malonyl-CoA] which play important roles in numerous metabolic pathways, and we analyzed changes in expression of these molecules in the hypothalamus and liver of adult male mice (C57BL/6J) subjected to 10 days of subchronic mild social defeat stress (sCSDS) with ICR mice as aggressors. Mice (n = 12) exposed to showed hyperphagia- and polydipsia-like symptoms and increased body weight gain compared with control mice which were not affected by exposure to ICR mice (n = 12). To elucidate the underlying metabolic features in the sCSDS model, acetyl-CoA, malonyl-CoA and CoASH tissue levels were analyzed using the acyl-CoA cycling method. The levels of hypothalamic malonyl-CoA, which decreases feeding behavior, were not influenced by sCSDS. However, sCSDS reduced levels of acetyl-CoA, malonyl-CoA and total CoA (sum of the three CoA molecular species) in the liver. Hence, hyperphagia-like symptoms in sCSDS mice evidently occurred independently of hypothalamic malonyl-CoA, but might consequently lead to down-regulation of hepatic CoA via altered expression of nudix hydrolase 7. Future studies should investigate the molecular mechanism(s) underlying the down-regulation of liver CoA pools in sCSDS mice. PMID:26864137

  1. Adjuvant activity of CpG-ODN formulated as a liquid crystal.

    Sánchez Vallecillo, María F; Ullio Gamboa, Gabriela V; Palma, Santiago D; Harman, María F; Chiodetti, Ana L; Morón, Gabriel; Allemandi, Daniel A; Pistoresi-Palencia, María C; Maletto, Belkys A

    2014-03-01

    The adjuvants approved in human vaccine with recombinant/purified antigens induce weak cellular immune response and so the development of new adjuvant strategies is critical. CpG-ODN has successfully been used as an adjuvant (phase I-III clinical trials) but its bioavailability needs to be improved. We investigated the adjuvant ability of CpG-ODN formulated with a liquid crystal nanostructure of 6-O-ascorbyl palmitate (Coa-ASC16). Mice immunized with OVA/CpG-ODN/Coa-ASC16 elicited a potent specific IgG1, IgG2a, Th1 and Th17 cellular response without systemic adverse effects. These responses were superior to those induced by OVA/CpG-ODN (solution of OVA with CpG-ODN) and to those induced by the formulation OVA/CpG-ODN/Al(OH)3. Immunization with OVA/CpG-ODN/Coa-ASC16 resulted in a long-lasting cell-mediated immune response (at least 6.5 months). Furthermore, Coa-ASC16 alone allows a controlled release of CpG-ODN in vitro and induces local inflammatory response, independent of TLR4 signaling, characterized by an influx of neutrophils and Ly6C(high) monocytes and pro-inflammatory cytokines. Remarkably, the adjuvant capacity of CpG-ODN co-injected with Coa-ASC16 (OVA/CpG-ODN plus Coa-ASC16) was similar to the adjuvant activity of OVA/CpG-ODN, supporting the requirement for whole formulation to help CpG-ODN adjuvanticity. These results show the potential of this formulation, opening a new avenue for the development of better vaccines. PMID:24382332

  2. Autotrophic growth: the methyl binding site of CO dehydrogenase in the synthesis of acetyl-CoA

    A pathway in which CO or CO2 and H2 is used as a source of energy and carbon to synthesize acetyl-CoA is used for autotrophic growth of acetogenes, methanogens and some sulfate-reducing bacteria. All enzymes involved in this pathway have been purified from C. thermoaceticum. Five of them: CO dehydrogenase (CODH), corrinoid protein, methyltransferase, CODH disulfide reductase (SSRd) and ferredoxin catalyzed synthesis of acetyl-CoA from methyltetrahydrofolate, CO and CoA. CODH is a central enzyme catalyzing the condensation of CH3, CO and CoA and per se it catalyzes a reversible exchange of CO with acetyl-CoA. Thus, CODH must have binding sites for CH3, CO and CoA. They have succeeded in methylating β subunits of CODH using 14CH3I or 14CH-corrinoid protein, a native donor of the CH3 group in synthesis of acetyl-CoA. With resulting [14CH3]CODH, only SSRd is required for synthesis of [14C]acetyl-CoA from CO and CoA. The kinetic studies show that CH3I is a competitive inhibitor for exchange reaction between CO and acetyl-CoA. Acetaldehyde and acetyl-CoA but not acetic acid and CoA protected CODH against methylation by CH3I. Methyl group bound to CODH is very slowly removed by CO and CoA and acetyl-CoA accelerated this process. These data confirm that CH3 group from CH3I and CH3-corrinoid protein is bound to the methyl binding site of CODH

  3. Model for the Production of CO Cameron band emission in Comet 1P/Halley

    Raghuram, Susarla; Bhardwaj, Anil

    2012-01-01

    The abundance of CO2 in comets has been derived using CO Cameron band (a3pi --> X1Sigma+) emission assuming that photodissociative excitation of CO2 is the main production process of CO(a3pi). On comet 1P/Halley the Cameron (1-0) band has been observed by International Ultraviolet Explorer (IUE) on several days in March 1986. A coupled chemistry-emission model is developed for comet 1P/Halley to assess the importance of various production and loss mechanisms of CO(a3pi) and to calculate the i...

  4. A Case of Glutaric Aciduria Type I with a Novel Mutation

    Nilgun Uyduran Unal; Deniz Kor; Didem Yucel; Gulen Gul Mert; Neslihan Onenli Mungan

    2013-01-01

    Glutaric aciduria type I is an autosomal recessive inherited disorder caused by the deficiency of glutaryl CoA dehydrogenase. The incidence of the disease is 1/100.000. Glutaryl CoA dehydrogenase gene is located on locus 19p13.2. More than 200 mutations have been described for this gene. Most common mutation in the population is C1240T. Clinical symptoms included neurological regression complications such as loss of sucking and swallowing reflexes choreoathetosis, seizures, rigidity and opist...

  5. Isothermal titration calorimetry with micelles: Thermodynamics of inhibitor binding to carnitine palmitoyltransferase 2 membrane protein ☆

    Perspicace, Samantha; Rufer, Arne C.; Thoma, Ralf; Mueller, Francis; Hennig, Michael; Ceccarelli, Simona; Schulz-Gasch, Tanja; Seelig, Joachim

    2013-01-01

    Carnitine palmitoyl transferase 2 (CPT-2) is a key enzyme in the mitochondrial fatty acid metabolism. The active site is comprised of a Y-shaped tunnel with distinct binding sites for the substrate acylcarnitine and the cofactor CoA. We investigated the thermodynamics of binding of four inhibitors directed against either the CoA or the acylcarnitine binding sites using isothermal titration calorimetry (ITC). CPT-2 is a monotopic membrane protein and was solubilized by β-octylglucoside (β-OG) ...

  6. Detection of Cysticercus antigens and antibodies in cerbrospinal fluid of patients with chronic meningitis Detecção de antígenos e anticorpos de Cysticercus em fluido cerebrospinal de pacientes com meningite crônica

    Subhash Chandra Parija

    2007-10-01

    Full Text Available Chronic meningitism is a less frequent manifestation of neurocysticercosis caused by Taenia solium cysticerci. In the present study we used Co-agglutination (Co-A, a simple and rapid slide agglutination test to detect specific Cysticercus antigen in the 67 cerebrospinal fluid (CSF samples from patients with chronic meningitis of unknown etiology. The results were compared with that of ELISA for detection of antibodies. Among these samples four (5.97% were positive for Cysticercus antigen by Co-A test and six (8.95% were positive for antibodies by ELISA. Two samples were positive by both Co-A and ELISA, two were positive only by Co-A and four were positive only by ELISA. In the present study, although Cysticercus antigen and antibodies were present in CSF samples from eight (11.94% patients, we cannot affirm that all the cases of chronic meningitis are due to cysticercosis, but for any case of chronic meningitis of unknown origin, it would be useful to consider the possibility of cysticercal meningitis.Meningite crônica é manifestação pouco freqüente de neurocisticercose causada por cisticerco de Taenia solium. No presente estudo utilizamos co-aglutinação (Co-A um teste simples e rápido de aglutinação para detectar antígeno específico de Cysticercus nas 67 amostras de fluido cerebrospinal (CSF de pacientes com meningite crônica de etiologia desconhecida. Os resultados foram comparados com os de ELISA para detecção de anticorpos. Dentre estas amostras quatro (5,97% foram positivas para antígenos de Cysticercus pelo teste Co-A e seis (8,95% foram positivas para anticorpos por ELISA. Duas amostras foram positivas por ambos Co-A e ELISA, duas foram positivas somente por Co-A e quatro foram positivas somente por ELISA. No presente estudo embora antígenos e anticorpos de Cysticercus estivessem presentes nas amostras de CSF de oito pacientes (11,94%, não podemos afirmar que todos os casos de meningite crônica sejam devidos

  7. Hypocholesterolemic mechanism of phenolics-enriched extract from Moringa oleifera leaves in HepG2 cell lines

    Peera Tabboon

    2016-04-01

    Full Text Available Previous studies have demonstrated the hypolipidemic activity of Moringa oleifera (MO leaves via lowering serum levels of cholesterol, but the mechanism of action is unknown. In this study, we demonstrated the hypocholesterolemic mechanism of a phenolics-enriched extract of Moringa oleifera leaf (PMO in HepG2 cells. When compared to the control treatment, PMO significantly decreased total intracellular cholesterol, inhibited the activity of HMG CoA reductase in a dosedependent manner and enhanced LDL receptor binding activity. Moreover, PMO also significantly increased the genetic expressions of HMG CoA reductase and LDL receptor.

  8. Structural studies on the enzymatic units of the peroxisomal multifunctional enzyme type 2 (MFE-2)

    Koski, K.

    2004-01-01

    Abstract Multifunctional enzyme type 2 (MFE-2) is a peroxisomal enzyme participating in the breakdown of fatty acids in eukaryotes. Depending on the organism, MFE-2 is composed of two to four functional units, out of which the two enzymatic ones, 2-enoyl-coenzyme A (CoA) hydratase 2 and (3R)-hydroxyacyl-CoA dehydrogenase, are found in the all MFE-2s. These units are responsible for the catalysis of the second and third steps of the peroxisomal β-oxidation of various CoA thioesters of fatty...

  9. 76 FR 78708 - Self-Regulatory Organizations; Chicago Board Options Exchange, Incorporated; Notice of Filing and...

    2011-12-19

    ... Immediate Effectiveness of Proposed Rule Change Related to a Complex Order Auction Feature December 12, 2011... electronic complex order book (``COB'') or once on a PAR workstation. Paragraph (d) of Rule 6.53C describes.... The Exchange is proposing to amend the rule to describe a COA feature for complex orders resting...

  10. Staff Report to the Senior Department Official on Recognition Compliance Issues. Recommendation Page: Council on Accreditation of Nurse Anesthesia Educational Programs

    US Department of Education, 2010

    2010-01-01

    The Council on Accreditation of Nurse Anesthesia Educational Programs (COA) accredits institutions and programs that prepare nurses to become practicing nurse anesthetists. Currently the agency accredits 105 programs located in 35 states, the District of Columbia and Puerto Rico, including three single purpose freestanding institutions. The…

  11. Magnetic properties of cobalt-based oxypnictide SmCoAsO

    2010-01-01

    The magnetic properties of cobalt-based oxypnictides SmCoAsO are investigated by measuring magnetization,magnetoresistance and specific heat.The compound undergoes a ferromagnetic(FM) transition around Tc of 80 K,and a ferromagnetic to antiferromagnetic(AFM) transition below TN1 of about 45 K,and finally an AFM order of Sm ion at TN2 of 5.6 K.The weak FM order should originate from the itinerant 3d electrons of Co ions in the CoAs layers.We propose that the magnetic structure should be A-type AFM,which means that the FM order remains within the CoAs layer and the magnetic coupling between the CoAs layers becomes AFM below TN1 of 45 K.The AFM coupling between the CoAs layers should be very weak.A magnetic field μ0H of about 2 T may cause an AFM-FM metamagnetic transition.A rich magnetic phase diagram is established and the interplay between the 3d electrons of Co ions and 4f electrons of Sm ions is discussed.

  12. Dicty_cDB: CHA579 [Dicty_cDB

    Full Text Available 2918 Q42918 ACETYL-COA C-ACYLTRANSFERASE ;, mRNA sequence. 52 0.006 1 CB086716 |CB086716.1 hj89c06.g1 Hedyotis... centranthoides flower - Stage 2 (NYBG) Hedyotis centranthoides cDNA clone hj89

  13. Molecular Typing of Staphylococcus aureus Isolated From Clinical Specimens During an Eight-Year Period (2005 - 2012 in Tabriz, Iran

    Ahangarzadeh Rezaee

    2016-03-01

    Full Text Available Background Antibiotic resistant Staphylococcus aureus is a serious public health problem worldwide. Objectives This study aimed to investigate the susceptibility pattern and molecular typing of S. aureus isolated from clinical specimens of hospitalized patients during eight years, from 2005 to 2012. Materials and Methods A total of 151 randomly selected S. aureus isolates, identified with phenotypic tests and detection of nuc gene, were subjected to antimicrobial susceptibility testing using the disk diffusion method. Moreover, molecular typing of the isolates was carried out by PCR-RFLP based on coa and spa genes. Results All isolates were susceptible to vancomycin and teicoplanin. High rates of susceptibility were also observed with rifampin (98.1%, imipenem (94.7%, and linezolid (94.1%. On the other hand, most of the isolates were resistant against penicillin (95.4%, erythromycin (68.9% and clindamycin (57.6%. Four types of spa and coa were distinguished among the isolates based on PCR results; however, the HaeII digestion resulted in a total of sixteen and nine RFLP patterns for spa and coa genes, respectively. Conclusions The outcome of this study indicates a higher discriminatory power of the RFLP analysis based on the spa gene compared to the coa gene. Moreover, the results of our study reveal that the resistance rate of S. aureus to some antimicrobial agents including linezolid is a growing concern.

  14. Quantitative Assessment of Turbulence and Flow Eccentricity in an Aortic Coarctation: Impact of Virtual Interventions.

    Andersson, Magnus; Lantz, Jonas; Ebbers, Tino; Karlsson, Matts

    2015-09-01

    Turbulence and flow eccentricity can be measured by magnetic resonance imaging (MRI) and may play an important role in the pathogenesis of numerous cardiovascular diseases. In the present study, we propose quantitative techniques to assess turbulent kinetic energy (TKE) and flow eccentricity that could assist in the evaluation and treatment of stenotic severities. These hemodynamic parameters were studied in a pre-treated aortic coarctation (CoA) and after several virtual interventions using computational fluid dynamics (CFD), to demonstrate the effect of different dilatation options on the flow field. Patient-specific geometry and flow conditions were derived from MRI data. The unsteady pulsatile flow was resolved by large eddy simulation including non-Newtonian blood rheology. Results showed an inverse asymptotic relationship between the total amount of TKE and degree of dilatation of the stenosis, where turbulent flow proximal the constriction limits the possible improvement by treating the CoA alone. Spatiotemporal maps of TKE and flow eccentricity could be linked to the characteristics of the jet, where improved flow conditions were favored by an eccentric dilatation of the CoA. By including these flow markers into a combined MRI-CFD intervention framework, CoA therapy has not only the possibility to produce predictions via simulation, but can also be validated pre- and immediate post treatment, as well as during follow-up studies. PMID:26577361

  15. Modeling SOA formation from the oxidation of intermediate volatility n-alkanes

    J. Lee-Taylor

    2012-08-01

    Full Text Available The chemical mechanism leading to SOA formation and ageing is expected to be a multigenerational process, i.e. a successive formation of organic compounds with higher oxidation degree and lower vapor pressure. This process is here investigated with the explicit oxidation model GECKO-A (Generator of Explicit Chemistry and Kinetics of Organics in the Atmosphere. Gas phase oxidation schemes are generated for the C8–C24 series of n-alkanes. Simulations are conducted to explore the time evolution of organic compounds and the behavior of secondary organic aerosol (SOA formation for various preexisting organic aerosol concentration (COA. As expected, simulation results show that (i SOA yield increases with the carbon chain length of the parent hydrocarbon, (ii SOA yield decreases with decreasing COA, (iii SOA production rates increase with increasing COA and (iv the number of oxidation steps (i.e. generations needed to describe SOA formation and evolution grows when COA decreases. The simulated oxidative trajectories are examined in a two dimensional space defined by the mean carbon oxidation state and the volatility. Most SOA contributors are not oxidized enough to be categorized as highly oxygenated organic aerosols (OOA but reduced enough to be categorized as hydrocarbon like organic aerosols (HOA, suggesting that OOA may underestimate SOA. Results show that the model is unable to produce highly oxygenated aerosols (OOA with large yields. The limitations of the model are discussed.

  16. The Orexin Component of Fasting Triggers Memory Processes Underlying Conditioned Food Selection in the Rat

    Ferry, Barbara; Duchamp-Viret, Patricia

    2014-01-01

    To test the selectivity of the orexin A (OXA) system in olfactory sensitivity, the present study compared the effects of fasting and of central infusion of OXA on the memory processes underlying odor-malaise association during the conditioned odor aversion (COA) paradigm. Animals implanted with a cannula in the left ventricle received ICV infusion…

  17. CCoAOMT down-regulation activates anthocyanin biosynthesis in petunia

    N.F.M. Shaipulah; J.K. Muhlemann; B.D. Woodworth; A. Van Moerkercke; J.C. Verdonk; A.M. Ramirez; M.A. Haring; N. Dudareva; R.C. Schuurink

    2015-01-01

    Anthocyanins and volatile phenylpropenes (isoeugenol and eugenol) in petunia flowers have the precursor 4-coumaryl CoA in common. These phenolics are produced at different stages during flower development. Anthocyanins are synthesized during early stages of flower development and sequestered in vacu

  18. Development of a Multiplex PCR Method for Detection of the Genes Encoding 16S rRNA, Coagulase, Methicillin Resistance and Enterotoxins in Staphylococcus aureus

    A multiplex PCR method was developed for simultaneous detection of the genes encoding methicillin resistance (mecA), staphylococcal enterotoxins A, B and C (sea, seb and sec), coagulase (coa) and 16S rRNA. The primers for amplification of the 16S rRNA gene were specific for Staphylococcus spp., and ...

  19. Pantethine rescues a Drosophila model for pantothenate kinase-associated neurodegeneration.

    Rana, Anil; Seinen, Erwin; Siudeja, Katarzyna; Muntendam, Remco; Srinivasan, Balaji; van der Want, Johannes J; Hayflick, Susan; Reijngoud, Dirk-Jan; Kayser, Oliver; Sibon, Ody C M

    2010-04-13

    Pantothenate kinase-associated neurodegeneration (PKAN), a progressive neurodegenerative disorder, is associated with impairment of pantothenate kinase function. Pantothenate kinase is the first enzyme required for de novo synthesis of CoA, an essential metabolic cofactor. The pathophysiology of PKAN is not understood, and there is no cure to halt or reverse the symptoms of this devastating disease. Recently, we and others presented a PKAN Drosophila model, and we demonstrated that impaired function of pantothenate kinase induces a neurodegenerative phenotype and a reduced lifespan. We have explored this Drosophila model further and have demonstrated that impairment of pantothenate kinase is associated with decreased levels of CoA, mitochondrial dysfunction, and increased protein oxidation. Furthermore, we searched for compounds that can rescue pertinent phenotypes of the Drosophila PKAN model and identified pantethine. Pantethine feeding restores CoA levels, improves mitochondrial function, rescues brain degeneration, enhances locomotor abilities, and increases lifespan. We show evidence for the presence of a de novo CoA biosynthesis pathway in which pantethine is used as a precursor compound. Importantly, this pathway is effective in the presence of disrupted pantothenate kinase function. Our data suggest that pantethine may serve as a starting point to develop a possible treatment for PKAN. PMID:20351285

  20. Pantethine rescues a Drosophila model for pantothenate kinase-associated neurodegeneration

    Rana, Anil; Seinen, Erwin; Siudeja, Katarzyna; Muntendam, Remco; Srinivasan, Balaji; van der Want, Johannes J.; Hayflick, Susan; Reijngoud, Dirk-Jan; Kayser, Oliver; Sibon, Ody C. M.

    2010-01-01

    Pantothenate kinase-associated neurodegeneration (PKAN), a progressive neurodegenerative disorder, is associated with impairment of pantothenate kinase function. Pantothenate kinase is the first enzyme required for de novo synthesis of CoA, an essential metabolic cofactor. The pathophysiology of PKA

  1. Pantethine rescues a Drosophila model for pantothenate kinase–associated neurodegeneration

    Rana, Anil; Seinen, Erwin; Siudeja, Katarzyna; Muntendam, Remco; Srinivasan, Balaji; van der Want, Johannes J.; Hayflick, Susan; Reijngoud, Dirk-Jan; Kayser, Oliver; Sibon, Ody C. M.

    2010-01-01

    Pantothenate kinase–associated neurodegeneration (PKAN), a progressive neurodegenerative disorder, is associated with impairment of pantothenate kinase function. Pantothenate kinase is the first enzyme required for de novo synthesis of CoA, an essential metabolic cofactor. The pathophysiology of PKAN is not understood, and there is no cure to halt or reverse the symptoms of this devastating disease. Recently, we and others presented a PKAN Drosophila model, and we demonstrated that impaired function of pantothenate kinase induces a neurodegenerative phenotype and a reduced lifespan. We have explored this Drosophila model further and have demonstrated that impairment of pantothenate kinase is associated with decreased levels of CoA, mitochondrial dysfunction, and increased protein oxidation. Furthermore, we searched for compounds that can rescue pertinent phenotypes of the Drosophila PKAN model and identified pantethine. Pantethine feeding restores CoA levels, improves mitochondrial function, rescues brain degeneration, enhances locomotor abilities, and increases lifespan. We show evidence for the presence of a de novo CoA biosynthesis pathway in which pantethine is used as a precursor compound. Importantly, this pathway is effective in the presence of disrupted pantothenate kinase function. Our data suggest that pantethine may serve as a starting point to develop a possible treatment for PKAN. PMID:20351285

  2. Adaptive resolution simulation of an atomistic protein in MARTINI water

    Zavadlav, Julija; Melo, Manuel Nuno; Marrink, Siewert J.; Praprotnik, Matej

    2014-01-01

    We present an adaptive resolution simulation of protein G in multiscale water. We couple atomistic water around the protein with mesoscopic water, where four water molecules are represented with one coarse-grained bead, farther away. We circumvent the difficulties that arise from coupling to the coa

  3. Influence of precursor solution parameters on chemical properties of calcium phosphate coatings prepared using Electrostatic Spray Deposition (ESD).

    Leeuwenburgh, S.C.G.; Wolke, J.G.C.; Schoonman, J.; Jansen, J.A.

    2004-01-01

    A novel coating technique, referred to as Electrostatic Spray Deposition (ESD), was used to deposit calcium phosphate (CaP) coatings with a variety of chemical properties. The relationship between the composition of the precursor solutions and the crystal and molecular structure of the deposited coa

  4. Compartmentalized acyl-CoA metabolism in skeletal muscle regulates systemic glucose homeostasis

    Li, Lei O; Grevengoed, Trisha J; Paul, David S; Ilkayeva, Olga; Koves, Timothy R; Pascual, Florencia; Newgard, Christopher B; Muoio, Deborah M; Coleman, Rosalind A

    2015-01-01

    -CoA synthetase (ACSL)1. ACSL1 deficiency caused a 91% loss of ACSL-specific activity and a 60-85% decrease in muscle FA oxidation. Acsl1(M-/-) mice were more insulin sensitive, and, during an overnight fast, their respiratory exchange ratio was higher, indicating greater glucose use. During endurance exercise...

  5. EST Table: FY008323 [KAIKOcDNA[Archive

    Full Text Available FY008323 bmov24f18 11/11/04 62 %/126 aa ref|XP_001656563.1| alpha methylacyl-coa racemase [Aedes ... 47 %/124 aa C24A3.4#CE40019#WBGene00016034#E. coli L-carnitine ... dehydratase#status:Partially_confirmed#UniProt:Q18 ...

  6. EST Table: DC549889 [KAIKOcDNA[Archive

    Full Text Available DC549889 E_FL_phe-_19F24_F_0 10/09/28 58 %/129 aa ref|XP_001656563.1| alpha methylacyl-coa racem ... 47 %/130 aa C24A3.4#CE40019#WBGene00016034#E. coli L-carnitine ... dehydratase#status:Partially_confirmed#UniProt:Q18 ...

  7. CCoAOMT down-regulation activates anthocyanin biosynthesis in petunia

    Shaipulah, N.F.M.; Muhlemann, Joëlle K.; Woodworth, Benjamin D.; Moerkercke, Van Alex; Verdonk, J.C.; Ramirez, A.A.; Haring, Michel A.; Dudareva, Natalia; Schuurink, Robert C.

    2016-01-01

    Anthocyanins and volatile phenylpropenes (isoeugenol and eugenol) in petunia (Petunia hybrida) flowers have the precursor 4-coumaryl coenzyme A (CoA) in common. These phenolics are produced at different stages during flower development. Anthocyanins are synthesized during early stages of flower d

  8. Acyl-CoA synthetase activity links wild-type but not mutant a-Synuclein to brain arachidonate metabolism

    Golovko, Mikhail; Rosenberger, Thad; Færgeman, Nils J.;

    2006-01-01

    an established steady-state kinetic model. Liver was used as a negative control, and no changes were observed between groups. In Snca-/- brains, there was a marked reduction in 20:4n-6-CoA mass and in microsomal acyl-CoA synthetase (Acsl) activity toward 20:4n-6. Microsomal Acsl activity was...

  9. Drosophila phosphopantothenoylcysteine synthetase is required for tissue morphogenesis during oogenesis

    Bosveld, Floris; Rana, Anil; Lemstra - Wierenga, Willemina; Kampinga, Harm; Sibon, Ody

    2008-01-01

    Background: Coenzyme A (CoA) is an essential metabolite, synthesized from vitamin B5 by the subsequent action of five enzymes: PANK, PPCS, PPCDC, PPAT and DPCK. Mutations in Drosophila dPPCS disrupt female fecundity and in this study we analyzed the female sterile phenotype of dPPCS mutants in detai

  10. A Dual-Band Coaxial Waveguide Mode Converter for High-Power Microwave Applications

    A dual-band coaxial waveguide mode converter is investigated. In the converter, the TEM mode (Coa.TEM) and TM01 circular waveguide (Cir.TM01) mode are transformed simultaneously into TE11 coaxial waveguide (Coa.TE11) mode and TE11 circular waveguide (Cir.TE11) mode, respectively. The optimized geometrical dimensions are achieved by employing the mode coupling theory. A mode converter at 1.3 GHz and 5.0 GHz is designed, and conversion efficiencies of Coa.TEM-to-Coa.TE11 and Cir.TM01-to-Cir.TE11 are 99.88% and 99.70% at central frequency, respectively. Over the frequency ranges 1.15–1.51 GHz and 4.87–5.19 GHz, the conversion efficiency exceeds 90%. A good agreement between theoretical calculations and computer simulations is observed, demonstrating the feasibility of the dual-band mode converter. (cross-disciplinary physics and related areas of science and technology)

  11. Sequence Classification: 182868 [

    Full Text Available TMB Non-TMH Non-TMB TMB Non-TMB Non-TMB >gi|17987345|ref|NP_539979.1| BIOTIN CARBOX...YL CARRIER PROTEIN OF ACETYL-COA CARBOXYLASE || http://www.ncbi.nlm.nih.gov/protein/17987345 ...

  12. Sequence Classification: 565760 [

    Full Text Available TMB Non-TMH Non-TMB TMB Non-TMB Non-TMB >gi|15965073|ref|NP_385426.1| PROBABLE BIOTIN CARB...OXYL CARRIER PROTEIN OF ACETYL-COA CARBOXYLASE (BCCP) || http://www.ncbi.nlm.nih.gov/protein/15965073 ...

  13. Sequence Classification: 512243 [

    Full Text Available Non-TMB Non-TMH Non-TMB Non-TMB Non-TMB Non-TMB >gi|17547505|ref|NP_520907.1| PROBABLE BIOTIN CARB...OXYL CARRIER PROTEIN OF ACETYL-COA CARBOXYLASE (BCCP) || http://www.ncbi.nlm.nih.gov/protein/17547505 ...

  14. Sequence Classification: 400246 [

    Full Text Available Non-TMB Non-TMH Non-TMB Non-TMB Non-TMB Non-TMB >gi|57117158|ref|NP_218316.2| PROBABLE PROPIONYL-CoA CARB...OXYLASE BETA CHAIN 4 ACCD4 (PCCASE) (PROPANOYL-COA:CARBON DIOXIDE LIGASE) || http://www.ncbi.nlm.nih.gov/protein/57117158 ...

  15. Sequence Classification: 399719 [

    Full Text Available Non-TMB Non-TMH Non-TMB Non-TMB Non-TMB Non-TMB >gi|15610416|ref|NP_217797.1| PROBABLE PROPIONYL-CoA CARB...OXYLASE BETA CHAIN 5 ACCD5 (PCCASE) (PROPANOYL-COA:CARBON DIOXIDE LIGASE) || http://www.ncbi.nlm.nih.gov/protein/15610416 ...

  16. Sequence Classification: 697789 [

    Full Text Available Non-TMB Non-TMH Non-TMB Non-TMB Non-TMB Non-TMB >gi|34557455|ref|NP_907270.1| PUTATIVE BIOTIN CARB...OXYL CARRIER PROTEIN OF ACETYL-COA CARBOXYLASE || http://www.ncbi.nlm.nih.gov/protein/34557455 ...

  17. Arabidopsis CDS blastp result: AK241568 [KOME

    Full Text Available AK241568 J065179E12 At5g22500.1 68418.m02626 acyl CoA reductase, putative / male -sterility prote ... nensis] GI:5020215; contains Pfam profile PF03015: Male ... sterility protein; identical to cDNA male ... sterilit ...

  18. Arabidopsis CDS blastp result: AK065894 [KOME

    Full Text Available AK065894 J013044F22 At5g22500.1 acyl CoA reductase, putative / male -sterility protein, putative ... nensis] GI:5020215; contains Pfam profile PF03015: Male ... sterility protein; identical to cDNA male ... sterilit ...

  19. Arabidopsis CDS blastp result: AK071956 [KOME

    Full Text Available AK071956 J013084H10 At5g22500.1 acyl CoA reductase, putative / male -sterility protein, putative ... nensis] GI:5020215; contains Pfam profile PF03015: Male ... sterility protein; identical to cDNA male ... sterilit ...

  20. Arabidopsis CDS blastp result: AK069659 [KOME

    Full Text Available AK069659 J023028D15 At5g22500.1 acyl CoA reductase, putative / male -sterility protein, putative ... nensis] GI:5020215; contains Pfam profile PF03015: Male ... sterility protein; identical to cDNA male ... sterilit ...

  1. Arabidopsis CDS blastp result: AK242888 [KOME

    Full Text Available AK242888 J090079L06 At5g22500.1 68418.m02626 acyl CoA reductase, putative / male -sterility prote ... nensis] GI:5020215; contains Pfam profile PF03015: Male ... sterility protein; identical to cDNA male ... sterilit ...

  2. Arabidopsis CDS blastp result: AK061142 [KOME

    Full Text Available AK061142 006-208-C05 At5g22500.1 acyl CoA reductase, putative / male -sterility protein, putative ... nensis] GI:5020215; contains Pfam profile PF03015: Male ... sterility protein; identical to cDNA male ... sterilit ...

  3. Biochemical competition makes fatty-acid β-oxidation vulnerable to substrate overload.

    Karen van Eunen

    Full Text Available Fatty-acid metabolism plays a key role in acquired and inborn metabolic diseases. To obtain insight into the network dynamics of fatty-acid β-oxidation, we constructed a detailed computational model of the pathway and subjected it to a fat overload condition. The model contains reversible and saturable enzyme-kinetic equations and experimentally determined parameters for rat-liver enzymes. It was validated by adding palmitoyl CoA or palmitoyl carnitine to isolated rat-liver mitochondria: without refitting of measured parameters, the model correctly predicted the β-oxidation flux as well as the time profiles of most acyl-carnitine concentrations. Subsequently, we simulated the condition of obesity by increasing the palmitoyl-CoA concentration. At a high concentration of palmitoyl CoA the β-oxidation became overloaded: the flux dropped and metabolites accumulated. This behavior originated from the competition between acyl CoAs of different chain lengths for a set of acyl-CoA dehydrogenases with overlapping substrate specificity. This effectively induced competitive feedforward inhibition and thereby led to accumulation of CoA-ester intermediates and depletion of free CoA (CoASH. The mitochondrial [NAD⁺]/[NADH] ratio modulated the sensitivity to substrate overload, revealing a tight interplay between regulation of β-oxidation and mitochondrial respiration.

  4. Unlocking the Barley Genome by Chromosomal and Comparative Genomics

    Mayer, K. F. X.; Martis, M.; Hedley, P. E.; Šimková, Hana; Liu, H.; Morris, J. A.; Steuernagel, B.; Taudien, S.; Kubaláková, Marie; Suchánková, Pavla; Doležel, Jaroslav; Stein, N.

    Roč. 23, č. 4 ( 2011 ), s. 1249-1263. ISSN 1040-4651 Institutional research plan: CEZ:AV0Z50380511 Keywords : PSEUDO-RESPONSE-REGULATOR * ACETYL-COA CARBOXYLASE * TRITICUM-AESTIVUM L. Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 8.987, year: 2011

  5. Acyl-CoA binding proteins; structural and functional conservation over 2000 MYA

    Faergeman, Nils J; Wadum, Majken; Feddersen, Søren;

    2007-01-01

    -CoA binding protein, ACBP, has been proposed to play a pivotal role in the intracellular trafficking and utilization of long-chain fatty acyl-CoA esters. Depletion of acyl-CoA binding protein in yeast results in aberrant organelle morphology incl. fragmented vacuoles, multi-layered plasma membranes and...

  6. Unlocking the Barley Genome by Chromosomal and Comparative Genomics

    Mayer, K. F. X.; Martis, M.; Hedley, P. E.; Šimková, Hana; Liu, H.; Morris, J. A.; Steuernagel, B.; Taudien, S.; Kubaláková, Marie; Suchánková, Pavla; Doležel, Jaroslav; Stein, N.

    2011-01-01

    Roč. 23, č. 4 (2011), s. 1249-1263. ISSN 1040-4651 Institutional research plan: CEZ:AV0Z50380511 Keywords : PSEUDO-RESPONSE-REGULATOR * ACETYL-COA CARBOXYLASE * TRITICUM-AESTIVUM L. Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 8.987, year: 2011

  7. Short-Term Wind Speed Forecasting Using Support Vector Regression Optimized by Cuckoo Optimization Algorithm

    Jianzhou Wang

    2015-01-01

    Full Text Available This paper develops an effectively intelligent model to forecast short-term wind speed series. A hybrid forecasting technique is proposed based on recurrence plot (RP and optimized support vector regression (SVR. Wind caused by the interaction of meteorological systems makes itself extremely unsteady and difficult to forecast. To understand the wind system, the wind speed series is analyzed using RP. Then, the SVR model is employed to forecast wind speed, in which the input variables are selected by RP, and two crucial parameters, including the penalties factor and gamma of the kernel function RBF, are optimized by various optimization algorithms. Those optimized algorithms are genetic algorithm (GA, particle swarm optimization algorithm (PSO, and cuckoo optimization algorithm (COA. Finally, the optimized SVR models, including COA-SVR, PSO-SVR, and GA-SVR, are evaluated based on some criteria and a hypothesis test. The experimental results show that (1 analysis of RP reveals that wind speed has short-term predictability on a short-term time scale, (2 the performance of the COA-SVR model is superior to that of the PSO-SVR and GA-SVR methods, especially for the jumping samplings, and (3 the COA-SVR method is statistically robust in multi-step-ahead prediction and can be applied to practical wind farm applications.

  8. Changes in the epidemiology of Pierce’s disease in California due to introduction of the glassy-winged sharpshooter

    Pierce’s disease is caused by the xylem limited bacterial pathogen, Xylella fastidiosa. This pathogen is vectored by xylem feeding insects and has been present in California for more than 100 years. Within California there are three management regions that have different key vectors: the North Coa...

  9. Physical analysis of COMT and CCOMT downregulated alfalfa stems

    Caffeic Acid 3-O-Methyltransferase (COMT) and Caffeoyl CoA 3-O-Methyltransferase (CCOMT) downregulated alfalfas (Medicago sativa L.) have been created. This study examined stem characteristics of these lignin downregulated alfalfas grown in three environments. Twenty COMT and twenty CCOMT downregu...

  10. Changes in Biston robustum and Camellia japonica distributions, according to climate change predictions in South Korea

    Tae Guen Kim; Yong-Gu Han; Jong Chul Jeong; Youngjin Kim; Ohseok Kwon; Youngho Cho

    2015-01-01

    We investigated the current and potential spatial distributions and habitable areas of Biston robustum and Camellia japonica in South Korea in order to provide useful data for the conservation of C. japonica and minimize the damage caused by B. robustum. It was predicted that, by 2070, although B. robustum would be widely distributed throughout the Korean Peninsula, except for the western and eastern coa...

  11. 78 FR 42788 - American Indians Into Nursing; Notice of Competitive Grant Applications for American Indians Into...

    2013-07-17

    ... scholarship grants may be used by the educational institution to provide scholarships to students enrolled in... Anesthesia Educational Program (COA). D. The Tribally controlled community college nursing programs and... relevance, competency and faculty strength. C. Introduction and Need for Assistance (15 Points)...

  12. MOLECULAR PHENOTYPING OF LIGNIN-MODIFIED TOBACCO REVEALS ASSOCIATED CHANGES IN CELL WALL METABOLISM, PRIMARY METABOLISM, STRESS METABOLISM AND PHOTORESPIRATION

    Lignin is an important component of secondary thickened cell walls. Cinnamoyl CoA reductase (CCR) and cinnamyl alcohol dehydrogenase (CAD) are two key enzymes catalyzing the penultimate and last step in the biosynthesis of the monolignols. Down-regulation of CCR in tobacco has been shown to reduce l...

  13. Sequence Classification: 389596 [

    Full Text Available Non-TMB Non-TMH Non-TMB Non-TMB Non-TMB Non-TMB >gi|31794107|ref|NP_856600.1| FATTY-ACID...-CoA LIGASE FADD26 (FATTY-ACID-COA SYNTHETASE) (FATTY-ACID-CoA SYNTHASE) || http://www.ncbi.nlm.nih.gov/protein/31794107 ...

  14. Sequence Classification: 75536 [

    Full Text Available Non-TMB TMH Non-TMB Non-TMB Non-TMB Non-TMB >gi|56478676|ref|YP_160265.1| CoA ligase, AMP genera ... ting (three fragments in different reading frames ) || http://www.ncbi.nlm.nih.gov/protein/56478676 ...

  15. 75 FR 19827 - Acquisition Regulation Rewrite

    2010-04-15

    ... Liability Act CFR Code of Federal Regulations CIO Chief Information Officer CO Contracting Officer COA... suspected antitrust violations. Subpart 1403.4--Contingent Fees 1403.405 Misrepresentations or violations of the Covenant Against Contingent Fees. Subpart 1403.5--Other Improper Business Practices...

  16. GenBank blastx search result: AK288212 [KOME

    Full Text Available AK288212 J090009P04 AY899214.1 AY899214 Streptomyces aizunensis strain NRRL B-11277 glycosyltran ... yl transferase, membrane protein, ABC transporter, sugar ... dehydratase/epimerase, sugar ... epimerase, sugar ... nucl ... eotidyltransferase, sugar ... dehydratase/epimerase, thioesterase, acyl CoA liga ...

  17. Energy transfers and spectral eddy viscosity in large-eddy simulations of homogeneous isotropic turbulence: Comparison of dynamic Smagorinsky and multiscale models over a range of discretizations

    Hughes, T.J.R.; Wells, G.N.; Wray, A.A.

    2004-01-01

    Energy transfers within large-eddy simulation (LES) and direct numerical simulation (DNS) grids are studied. The spectral eddy viscosity for conventional dynamic Smagorinsky and variational multiscale LES methods are compared with DNS results. Both models underestimate the DNS results for a very coa

  18. Modeling SOA formation from the oxidation of intermediate volatility n-alkanes

    J. Lee-Taylor

    2012-06-01

    Full Text Available The chemical mechanism leading to SOA formation and ageing is expected to be a multigenerational process, i.e. a successive formation of organic compounds with higher oxidation degree and lower vapor pressure. This process is here investigated with the explicit oxidation model GECKO-A (Generator of Explicit Chemistry and Kinetics of Organics in the Atmosphere. Gas phase oxidation schemes are generated for the C8–C24 series of n-alkanes. Simulations are conducted to explore the time evolution of organic compounds and the behavior of secondary organic aerosol (SOA formation for various preexisting organic aerosol concentration (COA. As expected, simulation results show that (i SOA yield increases with the carbon chain length of the parent hydrocarbon, (ii SOA yield decreases with decreasing COA, (iii SOA production rates increase with increasing COA and (iv the number of oxidation steps (i.e. generations needed to describe SOA formation and evolution grows when COA decreases. The simulated oxidative trajectories are examined in a two dimensional space defined by the mean carbon oxidation state and the volatility. Most SOA contributors are not oxidized enough to be categorized as highly oxygenated organic aerosols (OOA but reduced enough to be categorized as hydrocarbon like organic aerosols (HOA, suggesting that OOA may underestimate SOA. Results show that the model is unable to produce highly oxygenated aerosols (OOA with large yields. The limitations of the model are discussed.

  19. Win-Win Trade

    NI YANSHUO

    2011-01-01

    On May 27,a total of 210 orphans in the three states around Abuja,capital of Nigeria,went to a summer camp to celebrate the country's Children's Day.Huawei Technologies Co.,a leading global information and communications technology solutions provider from China,sponsored the event.

  20. Win-Win Trade

    2011-01-01

    China and Afrca find new ways to drive mutual development On May 27,a total of 210 orphans in the three states around Abuja,capital of Nigeria,went to a summer camp to celebrate the country’s Children’s Day. Huawei Technologies Co.,a leading global information and communications technology solutions provider from China,sponsored the event.

  1. Adding Extra Value

    NiYanshuo

    2011-01-01

    A total of 210 orphans in the three states around Abuja,capital of Nigeria,went to a summer camp to celebrate the country's Children's Day on May 27.Huawei Tech nologies Co.,a leading global informa tion and communications technology solutions provider from China,sponsored the event.

  2. Removal of Trace Pharmaceuticals from Water using coagulation and powdered activated carbon as pretreatment to ultrafiltration membrane system.

    Sheng, Chenguang; Nnanna, A G Agwu; Liu, Yanghe; Vargo, John D

    2016-04-15

    In this study, the efficacy of water treatment technologies: ultra-filtration (UF), powdered activated carbon (PAC), coagulation (COA) and a combination of these technologies (PAC/UF and COA/UF) to remove target pharmaceuticals (Acetaminophen, Bezafibrate, Caffeine, Carbamazepine, Cotinine, Diclofenac, Gemfibrozil, Ibuprofen, Metoprolol, Naproxen, Sulfadimethoxine, Sulfamethazine, Sulfamethoxazole, Sulfathiazole, Triclosan and Trimethoprim) was investigated. Samples of wastewater from municipal WWTPs were analyzed using direct aqueous injection High Performance Liquid Chromatography with Tandem Quadrupole Mass Spectrometric (LC/MS/MS) detection. On concentration basis, results showed an average removal efficiency of 29%, 50%, and 7%, respectively, for the UF, PAC dosage of 50ppm, and COA dosage of 10ppm. When PAC dosage of 100ppm was used as pretreatment to the combined PAC and UF in-line membrane system, a 90.3% removal efficiency was achieved. The removal efficiency of UF in tandem with COA was 33%, an increase of 4% compared with the single UF treatment. The adsorption effect of PAC combined with the physical separation process of UF revealed the best treatment strategy for removing pharmaceutical contaminant from water. PMID:26867086

  3. The role of dyslipidemia and statins in venous thromboembolism

    Rosendaal Frits R

    2001-07-01

    Full Text Available Abstract Recent studies have proposed an association between hyperlipidemia and venous thromboembolism (VTE. We review the epidemiological evidence linking dyslipidemia with VTE and examine several possible underlying mechanisms. We discuss the possible role of HMG CoA reductase inhibitors (statins in the prevention and treatment of VTE and suggest future directions for research.

  4. Citrus flavonoids repress the mRNA for stearoyl-CoA desaturase, a key enzyme in lipid synthesis and obesity control, in rat primary hepatocytes

    Citrus flavonoids have been shown to decrease plasma lipid levels, improve glucose tolerance, and attenuate obesity. One possible mechanism underlying these physiological effects is reduction of hepatic levels of the mRNA for stearoyl CoA desaturase-1 (SCD1), since repression of this enzyme reduces ...

  5. Predicting Student Academic Performance: A Comparison of Two Meta-Heuristic Algorithms Inspired by Cuckoo Birds for Training Neural Networks

    Jeng-Fung Chen

    2014-10-01

    Full Text Available Predicting student academic performance with a high accuracy facilitates admission decisions and enhances educational services at educational institutions. This raises the need to propose a model that predicts student performance, based on the results of standardized exams, including university entrance exams, high school graduation exams, and other influential factors. In this study, an approach to the problem based on the artificial neural network (ANN with the two meta-heuristic algorithms inspired by cuckoo birds and their lifestyle, namely, Cuckoo Search (CS and Cuckoo Optimization Algorithm (COA is proposed. In particular, we used previous exam results and other factors, such as the location of the student’s high school and the student’s gender as input variables, and predicted the student academic performance. The standard CS and standard COA were separately utilized to train the feed-forward network for prediction. The algorithms optimized the weights between layers and biases of the neuron network. The simulation results were then discussed and analyzed to investigate the prediction ability of the neural network trained by these two algorithms. The findings demonstrated that both CS and COA have potential in training ANN and ANN-COA obtained slightly better results for predicting student academic performance in this case. It is expected that this work may be used to support student admission procedures and strengthen the service system in educational institutions.

  6. Need of paleoclimatic reconstructions to understand natural and anthropogenic climatic hazards

    Nigam, R.

    indicate that sea level fluctuations played an important role in shaping the destiny of ancient cities in 35 Workshop on "Natural Hazards and Coa::..tal Processes ofIndian Coast· coastal areas. The understanding developed, about the signatures of the past...

  7. Optical imaging beyond the diffraction limit by SNEM: Effects of AFM tip modifications with thiol monolayers on imaging quality

    Cumurcu, Aysegul; Diaz, J.; Lindsay, I.D.; Beer, de S.; Duvigneau, J.; Schön, P.M.; Vancso, G.J.

    2015-01-01

    Tip-enhanced nanoscale optical imaging techniques such as apertureless scanning near-field optical microscopy (a-SNOM) and scanning near-field ellipsometric microscopy (SNEM) applications can suffer from a steady degradation in performance due to adhesion of atmospheric contaminants to the metal coa

  8. Increased expression of pyruvate carboxylase and biotin protein ligase increases lysine production in a biotin prototrophic Corynebacterium glutamicum strain

    Wang, Zhihao; Moslehi-Jenabian, Soloomeh; Solem, Christian;

    2015-01-01

    -CoA (or pimeloyl-Acyl Carrier Protein [ACP]) formation. Pyruvate carboxylase (pycA), a biotin-dependent enzyme needed for lysine biosynthesis and biotin ligase (birA), which is responsible for attaching biotin to pyruvate carboxylase, were overexpressed by replacing the native promoters with the strong...

  9. THE EFFECT OF FLUORIDE ON CONVENTIONAL WATER TREATMENT USING ALUMINUM SULFATE

    Based on the Information Collection Rule survey results of 600 large utilities, approximately 50% of them fluoridate their water and of those, 15-20% do so at the location of coagulant addition. In this case, the effect of fluoride on the coagulation process, floc properties, coa...

  10. Insight into cofactor recognition in arylamine N-acetyltransferase enzymes

    Xu, Ximing; Li de la Sierra-Gallay, Inés; Kubiak, Xavier Jean Philippe;

    2015-01-01

    Bacillus anthracis NAT1 and Homo sapiens NAT2. Therefore, in contrast to previous data, this study shows that different orthologous NATs can bind their cofactors in a similar way, suggesting that the mode of binding CoA in this family of enzymes is less diverse than previously thought. Moreover, it...

  11. Children of substance abusers: overview of research findings.

    Johnson, J L; Leff, M

    1999-05-01

    A relationship between parental substance abuse and subsequent alcohol problems in their children has been documented extensively. Children of alcoholics (COAs) are considered to be at high risk because there is a greater likelihood that they will develop alcoholism compared with a randomly selected child from the same community. COAs and children of other drug-abusing parents are especially vulnerable to the risk for maladaptive behavior because they have combinations of many risk factors present in their lives. The single most potent risk factor is their parent's substance-abusing behavior. This single risk factor can place children of substance abusers at biologic, psychologic, and environmental risk. Since the turn of the century, many reports have described the deleterious influence of parental alcoholism on their children. A series of studies measured mortality, physiology, and general health in the offspring of alcoholic parents and concluded that when mothers stopped drinking during gestation, their children were healthier. Today, research on COAs can be classified into studies of fetal alcohol syndrome, the transmission of alcoholism, psychobiologic markers of vulnerability, and psychosocial characteristics. Each of these studies hypothesizes that differences between COAs and children of nonalcoholics influence maladaptive behaviors later in life, such as academic failure or alcoholism. This research supports the belief that COAs are at risk for a variety of problems that may include behavioral, psychologic, cognitive, or neuropsychologic deficits. The vast literature on COAs far outweighs the literature on children of other drug abusers. Relatively little is known about children of heroin addicts, cocaine abusers, or polydrug abusers. Nonetheless, many researchers suggest that the children of addicted parents are at greater risk for later dysfunctional behaviors and that they, too, deserve significant attention to prevent intergenerational transmission of

  12. Brain microsomal fatty acid elongation is increased in abcd1-deficient mouse during active myelination phase.

    Morita, Masashi; Kawamichi, Misato; Shimura, Yusuke; Kawaguchi, Kosuke; Watanabe, Shiro; Imanaka, Tsuneo

    2015-12-01

    The dysfunction of ABCD1, a peroxisomal ABC protein, leads to the perturbation of very long chain fatty acid (VLCFA) metabolism and is the cause of X-linked adrenoleukodystrophy. Abcd1-deficient mice exhibit an accumulation of saturated VLCFAs, such as C26:0, in all tissues, especially the brain. The present study sought to measure microsomal fatty acid elongation activity in the brain of wild-type (WT) and abcd1-deficient mice during the course of development. The fatty acid elongation activity in the microsomal fraction was measured by the incorporation of [2-(14)C]malonyl-CoA into fatty acids in the presence of C16:0-CoA or C20:0-CoA. Cytosolic fatty acid synthesis activity was completely inhibited by the addition of N-ethylmaleimide (NEM). The microsomal fatty acid elongation activity in the brain was significantly high at 3 weeks after birth and decreased substantially at 3 months after birth. Furthermore, we detected two different types of microsomal fatty acid elongation activity by using C16:0-CoA or C20:0-CoA as the substrate and found the activity toward C20:0-CoA in abcd1-deficient mice was higher than the WT 3-week-old animals. These results suggest that during the active myelination phase the microsomal fatty acid elongation activity is stimulated in abcd1-deficient mice, which in turn perturbs the lipid composition in myelin. PMID:26108493

  13. An Arabidopsis mutant impaired in coenzyme A biosynthesis is sugar dependent for seedling establishment.

    Rubio, Silvia; Larson, Tony R; Gonzalez-Guzman, Miguel; Alejandro, Santiago; Graham, Ian A; Serrano, Ramón; Rodriguez, Pedro L

    2006-03-01

    Once the plant coenzyme A (CoA) biosynthetic pathway has been elucidated by comparative genomics, it is feasible to analyze the physiological relevance of CoA biosynthesis in plant life. To this end, we have identified and characterized Arabidopsis (Arabidopsis thaliana) T-DNA knockout mutants of two CoA biosynthetic genes, HAL3A and HAL3B. The HAL3A gene encodes a 4'-phosphopantothenoyl-cysteine decarboxilase that generates 4'-phosphopantetheine. A second gene, HAL3B, whose gene product is 86% identical to that of HAL3A, is present in the Arabidopsis genome. HAL3A appears to have a predominant role over HAL3B according to their respective mRNA expression levels. The hal3a-1, hal3a-2, and hal3b mutants were viable and showed a similar growth rate as that in wild-type plants; in contrast, a hal3a-1 hal3b double mutant was embryo lethal. Unexpectedly, seedlings that were null for HAL3A and heterozygous for HAL3B (aaBb genotype) displayed a sucrose (Suc)-dependent phenotype for seedling establishment, which is in common with mutants defective in beta-oxidation. This phenotype was genetically complemented in aaBB siblings of the progeny and chemically complemented by pantethine. In contrast, seedling establishment of Aabb plants was not Suc dependent, proving a predominant role of HAL3A over HAL3B at this stage. Total fatty acid and acyl-CoA measurements of 5-d-old aaBb seedlings in medium lacking Suc revealed stalled storage lipid catabolism and impaired CoA biosynthesis; in particular, acetyl-CoA levels were reduced by approximately 80%. Taken together, these results provide in vivo evidence for the function of HAL3A and HAL3B, and they point out the critical role of CoA biosynthesis during early postgerminative growth. PMID:16415216

  14. Possible mechanism for species difference on the toxicity of pivalic acid between dogs and rats

    In a high dose toxicity study of pivalic acid (PA), PA caused skeletal muscle disorder in dog, and a significant increase of pivaloyl carnitine (PC) was observed in canine muscle, but not in rat muscle. In order to understand species difference of the toxicity of PA, we compared the in vitro metabolism of PA among dog, rat and rabbit, especially focussing on the carnitine conjugate. Canine muscle showed low, but significant carnitine conjugating activity, while that of rat was negligible. Canine kidney mitochondria had significant activity in the pivaloyl CoA synthesis (7 nmol/mg protein/h), but muscle mitochondria showed only trace activity. Both kidney and muscle mitochondria displayed similar carnitine acyltransferase activity (2-3 nmol/mg protein/h) towards pivaloyl CoA. On the other hand, with respect to the activity of carnitine acyltransferase in the reverse direction using PC as substrate, canine muscle mitochondria showed higher activity than that of kidney mitochondria. This means that PC is not the final stable metabolite, but is converted easily to pivaloyl CoA in canine muscle. These results suggest one of the possible mechanisms for canine selective muscle disorder to be as follows. Only canine muscle can metabolize PA to its carnitine conjugate slowly, but significantly. In canine muscle, PC is not the final stable metabolite; it is easily converted to pivaloyl CoA. As carnitine conjugation is thought to be the only detoxification metabolic route in canine muscle, under certain circumstances such as carnitine deficiency, the risk of exposure with toxic pivaloyl CoA might increase and the CoASH pool in canine muscle might be exhausted, resulting in toxicity in canine muscle

  15. The feasibility of using electronic clinical outcome assessments in people with schizophrenia and their informal caregivers

    Tolley C

    2015-03-01

    Full Text Available Chloe Tolley,1 Diana Rofail,2 Adam Gater,1 Justine K Lalonde31Adelphi Values Ltd, Bollington, UK; 2Roche Products Ltd, Welwyn Garden City, UK; 3Roche S.A.S, Paris, France Abstract: Many clinical outcome assessments (COAs were originally developed for completion via pen and paper. However, in recent years there have been movements toward electronic capture of such data in an effort to reduce missing data, provide time-stamped records, minimize administrative burden, and avoid secondary data entry errors. Although established in many patient populations, the implications of using electronic COAs in schizophrenia are unknown. In accordance with International Society for Pharmacoeconomics and Outcomes Research (ISPOR Task Force recommendations, in-depth cognitive debriefing and usability interviews were conducted with people with schizophrenia (n=12, their informal (unpaid caregivers (n=12, and research support staff (n=6 to assess the suitability of administration of various electronic COA measures using an electronic tablet device. Minimal issues were encountered by participants when completing or administering the COAs in electronic format, with many finding it easier to complete instruments in this mode than by pen and paper. The majority of issues reported were specific to the device functionality rather than the electronic mode of administration. Findings support data collection via electronic tablet in people with schizophrenia and their caregivers. The appropriateness of other forms of electronic data capture (eg, smartphones, interactive voice response systems, etc is a topic for future investigation. Keywords: ePRO, eCOA, mode of administration, electronic data capture, usability 

  16. Impaired rate of microsomal fatty acid elongation in undernourished neonatal rat brain

    Hypomyelination caused by undernourishment in characterized by low concentrations of myelin lipids and marked reduction in lignocerate (C/sub 24:0/) and nervonate (C/sub 24:1/) moiety of cerebroside and sulfatide. Since microsomal elongation is the major source of long chain (22 to 24 carbons) fatty acids in the brain, the effect of neonatal undernourishment on acyl elongation was investigated. Undernourishment of suckling rats were induced after birth by restricting maternal dietary intake to 40% of that consumed by dams fed ad libitum. Neonates suckled by the normally fed dams served as controls. Microsomal elongation was measured as nmol from [2-14C] malonyl CoA incorporated/h per mg of protein. At 19 days of age, rates of behenoyl CoA (C/sub 22:0/) and erucoyl CoA (C/sub 22:1/) elongation in whole brain of undernourished neonates were 30-40% lower than that of the control, whereas the elongation rates of acyl CoA 16, 18 and 20 carbons in length either saturated or monounsaturated were similar in both groups. Undernourishment had no effect on cytoplasmic de novo fatty acid synthesis from acetyl CoA. If there are multiple elongation factors, the results indicate that the depressed activity of elongating enzyme(s) for C/sub 22:0/ and C/sub 22:1/ is an important contributing factor in lowering S/sub 24:0/ and C/sub 24:1/ content in cerebroside and sulfatide. This impairment may be a specific lesion leading to hypomyelination in undernourished rats

  17. The roles of culture and gender in the relationship between divorce and suicide risk: a meta-analysis.

    Yip, Paul S F; Yousuf, Saman; Chan, Chee Hon; Yung, Tiffany; Wu, Kevin C-C

    2015-03-01

    With some exceptions, literature has consistently shown that divorced populations are at higher risk for suicide than married ones. Here we make use of coefficients of aggravation (COAs), suicide rate ratios of the divorcees over the married, to study patterns of COAs and test the contribution of international sociocultural factors and gender to the relationship between divorce and suicide. We conducted a systematic search of electronic databases to identify ecological studies reporting suicide rates and ratios of those rates within different marital statuses between Jan 1, 2000 and Dec 31, 2013. In total, ten studies consisting in suicide statistics of eleven countries/areas were selected. Using random-effect modeling, we noted that the pooled COA for men and women were 3.49 (95% CI 2.43-4.56) and 3.15 (95% CI 1.74-4.56), suggesting both divorced men and women exhibited a greater risk of suicide than their married counterparts. Subgroup analyses revealed that COAs in Asian countries are significantly higher than those in non-Asian ones. Among the sociocultural measures retrieved from the HOFSTEDE index and the World Values Surveys, we noted significant associations between COA and four measures, including the individualism-collectivism score, the long-term orientation scores, the survival/self-expression score, and the gender inequality indices. The magnitudes and the directions of the associations however differ by sex. The results confirm that overall divorced people have an aggregate higher suicide risk than married ones. The method used in our research could reveal what cultural indicators are exerting effect on the relationship between divorce and suicide risk, which might change with sociocultural transition. More investigation into the relationships and then the construction of culturally appropriate suicide prevention policy is recommended. PMID:25594953

  18. Thiolation-enhanced substrate recognition by D-alanyl carrier protein ligase DltA from Bacillus cereus [v1; ref status: indexed, http://f1000r.es/3dx

    Liqin Du

    2014-05-01

    Full Text Available D-alanylation of the lipoteichoic acid on Gram-positive cell wall is dependent on dlt gene-encoded proteins DltA, DltB, DltC and DltD. The D-alanyl carrier protein ligase DltA, as a remote homolog of acyl-(coenzyme A (CoA synthetase, cycles through two active conformations for the catalysis of adenylation and subsequent thiolation of D-alanine (D-Ala. The crystal structure of DltA in the absence of any substrate was observed to have a noticeably more disordered pocket for ATP which would explain why DltA has relatively low affinity for ATP in the absence of any D-alanyl carrier. We have previously enabled the thiolation of D-alanine in the presence of CoA as the mimic of D-alanyl carrier protein DltC which carries a 4’-phosphopantetheine group on a serine residue. Here we show that the resulting Michaelis constants in the presence of saturating CoA for both ATP and D-alanine were reduced more than 10 fold as compared to the values obtained in the absence of CoA. The presence of CoA also made DltA ~100-fold more selective on D-alanine over L-alanine. The CoA-enhanced substrate recognition further implies that the ATP and D-alanine substrates of the adenylation reaction are incorporated when the DltA enzyme cycles through its thiolation conformation.

  19. [The different notions about beta-oxidation of fatty acids in peroxisomes, peroxisomes and ketonic bodies. The diabetic, acidotic coma as an acute deficiency of acetyl-CoA and ATP].

    Kotkina, T I; Titov, V N; Parkhimovich, R M

    2014-03-01

    The mechanisms of beta-oxidation of fatty acids developed more than a century before have no compliance with actual physical chemical data. The oxidation of long-chain C 16:0 palmitic saturated fatty acid occurs not by sequential formation of eight molecules of acetyl-KoA but by force of formation of double bond and its hydrolysis on two short-chain C 8:0 fatty acids. Only short-chain fatty acids can become shorter under "chipping" of C 2-acetate with formation of C 4-butyric acid (butyrate) and its metabolites (beta-hidroxibutirate, acetoacetate, acetone). The critical moment of oxidation is a hydrolysis of acetoacetyl-KoA on two molecules of acetyl-KoA. The molecule of ATP is to be expended on hydrolysis. The foundation of nonspecific biological reaction of stress--ketoacidosis,--is a decrease in mitochondrions of acetyl-KoA pool formed both from glycogen and glucose and fatty acids. The oxalate acetate inputs into Krebs cycle inadequate amount of acetyl-KoA which limits synthesis of ATP. The insulin has no direct involvement into development of ketoacidosis but prepares conditions to facilitate nonspecific etiological factor to initiate diabetic ketoacidosis. These are the pooling of small amount of glycogen in cytozol and the predominance in cytozol of cells and adipocytes of palmitic triglycerides which are slowly hydrolyzed by hormone-dependent lipase to release non-esterified fatty acids into intercellular medium. The increase of their concentration in blood plasma precedes ketoacidosis which is developing in patients without diabetes mellitus too. When cells begin to oxidize unsaturated linoleic and linolenic acids with large number of double binds instead of medium-chain fatty acids, oleinic and palmitic fatty acids to support beta-oxidation in mitochondrions and synthesis of ATP the amount of butyric acid, beta-hidroxibutiryl-KoA and acetoacetyl-KoA increases and of acetyl-KoA decreases. The cause of fatal outcome is the development of metabolic acidosis

  20. Identification and quantification of organic aerosol from cooking and other sources in Barcelona using aerosol mass spectrometer data

    C. Mohr

    2011-10-01

    Full Text Available PM1 (particulate matter with an aerodynamic diameter <1 μm non-refractory components and black carbon were measured continuously together with additional parameters at an urban background site in Barcelona, Spain, during March 2009 (campaign DAURE, Determination of the sources of atmospheric Aerosols in Urban and Rural Environments in the western Mediterranean. Positive matrix factorization (PMF was conducted on the organic aerosol (OA data matrix measured by an aerosol mass spectrometer, on both unit mass (UMR and high resolution (HR data. Five factors or sources could be identified: LV-OOA (low-volatility oxygenated OA, related to regional, aged secondary OA; SV-OOA (semi-volatile oxygenated OA, a fresher oxygenated OA; HOA (hydrocarbon-like OA, related to traffic emissions; BBOA (biomass burning OA from domestic heating or agricultural biomass burning activities; and COA (cooking OA. LV-OOA contributed 28% to OA, SV-OOA 27%, COA 17%, HOA 16%, and BBOA 11%. The COA HR spectrum contained substantial signal from oxygenated ions (O/C: 0.21 whereas the HR HOA spectrum had almost exclusively contributions from chemically reduced ions (O/C: 0.03. If we assume that the carbon in HOA is fossil while that in COA and BBOA is modern, primary OA in Barcelona contains a surprisingly high fraction (59% of non-fossil carbon.

    This paper presents a method for estimating cooking organic aerosol in ambient datasets based on the fractions of organic mass fragments at m/z 55 and 57: their data points fall into a V-shape in a scatter plot, with strongly influenced HOA data aligned to the right arm and strongly influenced COA data points aligned to the left arm. HR data show that this differentiation is mainly driven by the oxygen-containing ions C3H3O+ and C3H5O+, even though their contributions to m/z 55 and 57 are low compared to the reduced ions C4

  1. Acetogenesis in the energy-starved deep biosphere - a paradox?

    Lever, Mark

    2012-01-01

    for both energy production and biosynthesis coupled with the ability to use many organic precursors to produce the key intermediate acetyl CoA. This leads to the general conclusion that, beside Gibbs free energy yields, variables such as metabolic strategy and energetic cost of biosynthesis need to be...... sulfate reduction and methanogenesis has called this notion into question, however. Here I argue that acetogens can successfully coexist with sulfate reducers and methanogens for multiple reasons. These include (1) substantial energy yields from most acetogenesis reactions across the wide range of...... conditions encountered in the subseafloor, (2) wide substrate spectra that enable niche differentiation by use of different substrates and/or pooling of energy from a broad range of energy substrates, (3) reduced energetic cost of biosynthesis among acetogens due to use of the reductive acetyl CoA pathway...

  2. Fat metabolism is regulated by altered gene expression oflipogenic enzymes and regulatory factors in liver and adiposetissue but not in semimembranosus muscle of pigs during thefattening period

    Duran-Montge, P; Theil, Peter Kappel; Lauridsen, Charlotte;

    2009-01-01

    It has been shown previously that lipid metabolism is regulated by fatty acids (FA) and that thyroid hormones are important regulators of energy metabolism. The effects of weight, dietary fat level and dietary FA profile on thyroid hormone levels and expression of lipogenic genes and tissue FA...... supplemented with approximately 10% fat of different origin and slaughtered at 100 kg BW. The supplemental fats were tallow, high-oleic sunflower oil, sunflower oil (SFO), linseed oil, fat blend (55% tallow, 35% sunflower oil, 10% linseed oil) and fish oil blend (40% fish oil, 60% linseed oil). In general, the...... hormones and genes encoding enzymes of fat synthesis in adipose tissue (acetyl CoA carboxylase (ACACA), fatty acid synthase and stearoyl CoA desaturase (SCD)) and the large differences in expression of lipogenic genes at different weights (60 and 100 kg BW), suggest a role for thyroid hormones and for T3...

  3. O enfrontamento cos límites da representación (imaxes entre a transgresión e a provocación)

    Nogueira, Xosé

    2007-01-01

    Proponse un achegamento ao estatuto do obsceno nos límites da representación artística, coas súas sucesivas declinacións nas operacións de transgresión e provocación. Transgresións que han coñecer contínuas e, así mesmo, distintas manifestacións ao longo do tempo marcadas polo contraste entre a moral pública e o gusto privado, e que atopan un punto de inflexión coa chegada dos medios técnicos de reprodución artística (a fotografía, o cine). Planando sobre todas elas, os temas da s...

  4. Metabolic perturbation of an essential pathway: evaluation of a glycine precursor of coenzyme A.

    Rothmann, Michael; Kang, MinJin; Villa, Reymundo; Ntai, Ioanna; La Clair, James J; Kelleher, Neil L; Chapman, Eli; Burkart, Michael D

    2013-04-24

    Pantetheine and its corresponding disulfide pantethine play a key role in metabolism as building blocks of coenzyme A (CoA), an essential cofactor utilized in ~4% of primary metabolism and central to fatty acid, polyketide, and nonribosomal peptide synthases. Using a combination of recombinant engineering and chemical synthesis, we show that the disulfide of N-pantoylglycyl-2-aminoethanethiol (GlyPan), with one fewer carbon than pantetheine, can rescue a mutant E. coli strain MG1655ΔpanC lacking a functional pantothenate synthetase. Using mass spectrometry, we show that the GlyPan variant is accepted by the downstream CoA biosynthetic machinery, ultimately being incorporated into essential acyl carrier proteins. These findings point to further flexibility in CoA-dependent pathways and offer the opportunity to incorporate orthogonal analogues. PMID:23550886

  5. Unha aproximación á conformación dos poderes locais en Galicia. Arzúa entre a II República e a protoinstitucionalización do réxime franquista (1931-1937)

    Lanero Táboas, Daniel

    2008-01-01

    A transición entre réximes políticos (Monarquía - II República) revestiu no mundo rural galego, e en vilas como Arzúa, unhas características ben distintas respecto de como se levou a cabo a proclamación e instauración do novo réxime nas principais cidades do país. A dinámica política destas vilas cabeceira de comarca tiña aínda bastante máis que ver coa competencia persoal entre notables locais que coas diferenzas propiamente ideolóxicas. Na meirande parte dos casos, os novos ...

  6. The PanK2 Genes of Mouse and Human Specify Proteins with DistinctSubcellular Locations

    Leonardi, Roberta; Zhang, Yong-Mei; Lydikis, Athanasios; Stevens,Robert D.; Ilkayeva, Olga R.; Wenner, Brett R.; Bain, James R.; Newgard,Christopher B.; Rock, Charles O.; Jackowski, Suzanne

    2007-05-01

    Coenzyme A (CoA) biosynthesis is initiated by pantothenatekinase (PanK) and CoA levels are controlled through differentialexpression and feedback regulation of PanK isoforms. PanK2 is amitochondrial protein in humans, but comparative genomics revealed thatacquisition of a mitochondrial targeting signal was limited to primates.Human and mouse PanK2 possessed similar biochemical properties, withinhibition by acetylCoA and activation by palmitoylcarnitine. Mouse PanK2localized in the cytosol, and the expression of PanK2 was higher in humanbrain compared to mouse brain. Differences in expression and subcellularlocalization should be considered in developing a mouse model for humanPanK2 deficiency. (c) 2007 Federation of European Biochemical Societies.Published by Elsevier B.V.

  7. Measurement of choline acetyltransferase with [14C]acetate by a cycling procedure

    A multiple enzyme and multisubstrate cycling system is described for the radiometric determination of cholineacetyltransferase (ChAT) activity in crude tissue homogenates. The methods employs [14C]acetate coupled with the enzymes acetate kinase (AK) and phosphotransacetylase (PTA) for the generation of [14C]acetyl CoA. By recycling it was possible to avoid product inhibition of ChAT by CoA, ATP was maintained constant by rephosphorylation of ADP. Kinetics of the individual enzyme reactions were studied and the parameters obtained were used to select appropriate conditions to maintain linearity of varying amounts ChAT activity over a sixty minute time course. The sensitivity of the method is limited only by the specific activity of commercially available isotope labeled acetate

  8. Storage lipid biosynthesis in microspore-derived Brassica napus embryos

    Erucic acid, a fatty acid which is confined to the neutral lipids in developing seed cotyledons or rape, was chosen as a marker to study triacylglycerol (TAG) biosynthesis in a Brassica napus L. cv Reston microspore-derived embryo culture system. Accumulation and changes in acyl composition of TAGs during embryogenesis strongly paralleled that observed during seed development. Homogenates of 29-day cultured embryos were examined for the ability to incorporate erucoyl moieties into storage lipids. In the presence of 14C erucoyl CoA and various acceptors, including glycerol-3-phosphate (G3P), 14C erucic acid was rapidly incorporated into the TAG fraction. However, in contrast to studies with 14C oleoyl CoA, there was no measurable radioactivity in any Kennedy Pathway intermediates or within membrane lipid components. Analysis of the radiolabelled TAG species suggested that erucoyl moieties were incorporated into the sn-3 position by a highly active diacylglyercol acyltransferase

  9. Analise funcional das traduccións en linguas en proceso de normalización: o caso da traducción do comic en galego

    Sinner, Carsten

    2002-12-01

    Full Text Available In the case of the Galician language, the translation of comics is quite important, because it contributes to the normalization of use of the Galician language and allows young readers to become familiar with the norm. The article focusses on an analysis of the Galician translation with the French original and a Spanish version of the text.

    [gl] A traducción de comics, no caso do galego xoga un papel moi importante xa que o seu obxectivo é sobre todo normalizar o uso da lingua galega ñas xeracións novas e familiariza-la xuventude coa norma. A contribución pretende unha análise ben polo miúdo dunha traducción galega de Asterix comparándoa co orixinal francés e coa traducción española.

  10. Fractional Order PID Controller Design for Level Control of Three Tank System Based on Improved Cuckoo Optimization Algorithm

    Meysam Gheisarnezhad

    2015-01-01

    Full Text Available Fractional-order PID (FOPID controller is a generalization of standard PID controller using fractional calculus. Compared with the Standard PID controller, two adjustable variables “differential order” and “integral order” are added to the PID controller.Three tank system is a nonlinear multivariable process that is a good prototype of chemical industrial processes. Cuckoo Optimization Algorithm (COA, that was recently introduced has shown its good performance in optimization problems. In this study, Improved Cuckoo Optimization Algorithm (ICOA has been presented. The aim of the paper is to compare different controllers tuned with a Improved Cuckoo Optimization Algorithm (ICOA for Three Tank System. In order to compare the performance of the optimized FOPID controller with other controllers, Genetic Algorithm(GA, Particle swarm optimization (PSO, Cuckoo Optimization Algorithm (COA and Imperialist Competitive Algorithm (ICA.

  11. A Metaheuristic Algorithm for Job Scheduling in Grid Computing

    Hedieh Sajedi

    2014-05-01

    Full Text Available These days the number of issues that we can not do on time is increasing. In the mean time, scientists are trying to make questions simpler and using computers. Still, more problems that are complicated need more complex calculations by using highly advanced technology. Grid computing integrates distributed resources to solve complex scientific, industrial, and commercial problems. In order to achieve this goal, an efficient scheduling system as a vital part of the grid is required. In this paper, we introduce CUckoo-Genetic Algorithm (CUGA, which inspired from cuckoo optimization algorithm (COA with genetic algorithm (GA for job scheduling in grids. CUGA can be applied to minimize the completion time of machines, and it could avoid trapping in a local minimum effectively. The results illustrate that the proposed algorithm, in comparison with GA, COA, and Particle Swarm Optimization (PSO is more efficient and provides higher performance.

  12. Security Applications of Diodes with Unique Current-Voltage Characteristics

    Rührmair, Ulrich; Jaeger, Christian; Hilgers, Christian; Algasinger, Michael; Csaba, György; Stutzmann, Martin

    Diodes are among the most simple and inexpensive electric components. In this paper, we investigate how random diodes with irregular I(U) curves can be employed for crypto and security purposes. We show that such diodes can be used to build Strong Physical Unclonable Functions (PUFs), Certificates of Authenticity (COAs), and Physically Obfuscated Keys (POKs), making them a broadly usable security tool. We detail how such diodes can be produced by an efficient and inexpensive method known as ALILE process. Furthermore, we present measurement data from real systems and discuss prototypical implementations. This includes the generation of helper data as well as efficient signature generation by elliptic curves and 2D barcode generation for the application of the diodes as COAs.

  13. Robust state feedback controller design of STATCOM using chaotic optimization algorithm

    Safari Amin

    2010-01-01

    Full Text Available In this paper, a new design technique for the design of robust state feedback controller for static synchronous compensator (STATCOM using Chaotic Optimization Algorithm (COA is presented. The design is formulated as an optimization problem which is solved by the COA. Since chaotic planning enjoys reliability, ergodicity and stochastic feature, the proposed technique presents chaos mapping using Lozi map chaotic sequences which increases its convergence rate. To ensure the robustness of the proposed damping controller, the design process takes into account a wide range of operating conditions and system configurations. The simulation results reveal that the proposed controller has an excellent capability in damping power system low frequency oscillations and enhances greatly the dynamic stability of the power systems. Moreover, the system performance analysis under different operating conditions shows that the phase based controller is superior compare to the magnitude based controller.

  14. Sarcopenia and body composition in diabetic Charcot osteoarthropathy

    Jansen, Rasmus Bo; Christensen, Tomas Møller; Bülow, Jens;

    2015-01-01

    BACKGROUND: Treatment of Charcot osteoarthropathy (COA) requires restricted walking and offloading for several months, which lead to fat re-distribution and increased sarcopenia. OBJECTIVES/AIM: To investigate whether subjects with COA have an altered body composition compared to controls. METHODS......: Cross-sectional case-control study of people with diabetes with acute or chronic Charcot osteoarthropathy, matched with otherwise healthy people with diabetes. A total of 49 subjects (distribution ~1:1) had a total body DXA-scanning, measuring appendicular lean mass, android/gynoid and truncal....../total body fat distribution ratios. RESULTS: Sarcopenia frequency was higher in the total population with diabetes overall (9-40%), compared to normal materials. Using two different models for correlating appendicular lean mass to sarcopenia, there were no differences in sarcopenia-rates between the groups...

  15. Cloning and Characterisation of the Gene Encoding 3-Hydroxy-3-Methylglutaryl-CoA Synthase in Tripterygium wilfordii

    Yu-Jia Liu

    2014-11-01

    Full Text Available Tripterygium wilfordii is a traditional Chinese medical plant used to treat rheumatoid arthritis and cancer. The main bioactive compounds of the plant are diterpenoids and triterpenoids. 3-Hydroxy-3-methylglutaryl-CoA synthase (HMGS catalyses the reaction of acetoacetyl-CoA to 3-hydroxy-3-methylglutaryl-CoA, which is the first committed enzyme in the mevalonate (MVA pathway. The sequence information of HMGS in Tripterygium wilfordii is a basic resource necessary for studying the terpenoids in the plant. In this paper, full-length cDNA encoding HMGS was isolated from Tripterygium wilfordii (abbreviated TwHMGS, GenBank accession number: KM978213. The full length of TwHMGS is 1814 bp, and the gene encodes a protein with 465 amino acids. Sequence comparison revealed that TwHMGS exhibits high similarity to HMGSs of other plants. The tissue expression patterns revealed that the expression level of TwHMGS is highest in the stems and lowest in the roots. Induced expression of TwHMGS can be induced by MeJA, and the expression level is highest 4 h after induction. The functional complement assays in the YML126C knockout yeast demonstrated that TwHMGS participates in yeast terpenoid biosynthesis.

  16. Genome-scale modeling using flux ratio constraints to enable metabolic engineering of clostridial metabolism in silico

    McAnulty Michael J

    2012-05-01

    Full Text Available Abstract Background Genome-scale metabolic networks and flux models are an effective platform for linking an organism genotype to its phenotype. However, few modeling approaches offer predictive capabilities to evaluate potential metabolic engineering strategies in silico. Results A new method called “flux balance analysis with flux ratios (FBrAtio” was developed in this research and applied to a new genome-scale model of Clostridium acetobutylicum ATCC 824 (iCAC490 that contains 707 metabolites and 794 reactions. FBrAtio was used to model wild-type metabolism and metabolically engineered strains of C. acetobutylicum where only flux ratio constraints and thermodynamic reversibility of reactions were required. The FBrAtio approach allowed solutions to be found through standard linear programming. Five flux ratio constraints were required to achieve a qualitative picture of wild-type metabolism for C. acetobutylicum for the production of: (i acetate, (ii lactate, (iii butyrate, (iv acetone, (v butanol, (vi ethanol, (vii CO2 and (viii H2. Results of this simulation study coincide with published experimental results and show the knockdown of the acetoacetyl-CoA transferase increases butanol to acetone selectivity, while the simultaneous over-expression of the aldehyde/alcohol dehydrogenase greatly increases ethanol production. Conclusions FBrAtio is a promising new method for constraining genome-scale models using internal flux ratios. The method was effective for modeling wild-type and engineered strains of C. acetobutylicum.

  17. Metabolic engineering of Saccharomyces cerevisiae for the production of n-butanol

    Myers Samuel

    2008-12-01

    Full Text Available Abstract Background Increasing energy costs and environmental concerns have motivated engineering microbes for the production of "second generation" biofuels that have better properties than ethanol. Results and conclusion Saccharomyces cerevisiae was engineered with an n-butanol biosynthetic pathway, in which isozymes from a number of different organisms (S. cerevisiae, Escherichia coli, Clostridium beijerinckii, and Ralstonia eutropha were substituted for the Clostridial enzymes and their effect on n-butanol production was compared. By choosing the appropriate isozymes, we were able to improve production of n-butanol ten-fold to 2.5 mg/L. The most productive strains harbored the C. beijerinckii 3-hydroxybutyryl-CoA dehydrogenase, which uses NADH as a co-factor, rather than the R. eutropha isozyme, which uses NADPH, and the acetoacetyl-CoA transferase from S. cerevisiae or E. coli rather than that from R. eutropha. Surprisingly, expression of the genes encoding the butyryl-CoA dehydrogenase from C. beijerinckii (bcd and etfAB did not improve butanol production significantly as previously reported in E. coli. Using metabolite analysis, we were able to determine which steps in the n-butanol biosynthetic pathway were the most problematic and ripe for future improvement.

  18. Coumarin-based 'turn-off' fluorescent chemosensor with high selectivity for Cu2+ in aqueous solution

    Xu, Wen-Jun; Qi, De-Qiang; You, Jin-Zong; Hu, Fei-Fei; Bian, Jia-Ying; Yang, Chun-Xia; Huang, Juan

    2015-07-01

    Coumarin-based "turn-off" fluorescent chemosensor, 3-acetoacetyl-7-diethylaminocoumarin (1), has been synthesized and structurally characterized by IR, 1H NMR and X-ray crystal structure analysis. The fluorescence behaviors in the presence of various metal ions were investigated in aqueous media. 1 Exhibits highly selective and sensitive absorbance and fluorescence sensing ability for Cu2+ over other metal ions. Addition of Cu2+ to the aqueous solution of 1 gave rise to obvious absorbance change and fluorescence quenching. Other competing ions, such as Mg2+, Ba2+, Mn2+, Fe3+, Co2+, Ni2+, Zn2+, Pb2+, Cd2+, Hg2+, induced negligible absorbance and fluorescence changes under the same conditions. The job's plot showed that the stoichiometry between 1 and Cu2+ was estimated to be 1:1. The fluorescence intensity varied almost linearly vs. the concentration of Cu2+ (1.0-7.0 μM), and the detection limit of Cu2+ was estimated to be 1.81 nM, indicating that 1 can be used as "turn-off" fluorescent chemosensor to selectively detect Cu2+ in aqueous solution.

  19. Metabolic engineering of Saccharomyces cerevisiae for the production of n-butanol

    Steen, EricJ.; Chan, Rossana; Prasad, Nilu; Myers, Samuel; Petzold, Christopher; Redding, Alyssa; Ouellet, Mario; Keasling, JayD.

    2008-11-25

    BackgroundIncreasing energy costs and environmental concerns have motivated engineering microbes for the production of ?second generation? biofuels that have better properties than ethanol.Results& ConclusionsSaccharomyces cerevisiae was engineered with an n-butanol biosynthetic pathway, in which isozymes from a number of different organisms (S. cerevisiae, Escherichia coli, Clostridium beijerinckii, and Ralstonia eutropha) were substituted for the Clostridial enzymes and their effect on n-butanol production was compared. By choosing the appropriate isozymes, we were able to improve production of n-butanol ten-fold to 2.5 mg/L. The most productive strains harbored the C. beijerinckii 3-hydroxybutyryl-CoA dehydrogenase, which uses NADH as a co-factor, rather than the R. eutropha isozyme, which uses NADPH, and the acetoacetyl-CoA transferase from S. cerevisiae or E. coli rather than that from R. eutropha. Surprisingly, expression of the genes encoding the butyryl-CoA dehydrogenase from C. beijerinckii (bcd and etfAB) did not improve butanol production significantly as previously reported in E. coli. Using metabolite analysis, we were able to determine which steps in the n-butanol biosynthetic pathway were the most problematic and ripe for future improvement.

  20. Investigation of the spraying mechanism and combustion of the suspended coal fuel

    Murko Vasiliy I.; Fedyaev Vladimir I.; Karpenok Viktor I.; Zasypkin Ivan M.; Senchurova Yulia А.; Riesterer Aleksandr

    2015-01-01

    This paper continues the earlier one [1]. It presents the results of the suspended coal fuel spraying with pneumo-mechanical sprayers followed by the fuel combustion in a vortex furnace. It is shown that, during the spraying, two qualitatively different systems of drops are forming. The first one with the “drops” diameter above 80 - 100 mm is presented by coal particles, the other - by water-coal drops. Different dynamics of temperature variation of the coa...

  1. 06271 Executive Summary - Challenges in Symbolic Computation Software

    Decker, Wolfram; Dewar, Mike; Kaltofen, Erich; Watt, Stephen M.

    2006-01-01

    Symbolic computation software allows mathematicians, scientists, engineers, or educators to deal with elaborate calculations using a computer. The applications range from introducing the experimental method in fields of pure mathematics to practical applications, for instance, in cryptology, robotics, or signal theory. The software includes mainstream commercial products such as Maple or Mathematica and highly specialized, public domain systems such as CoCoa, Macaulay2...

  2. The political structures and its influences in sport development in the state of Paraná, Brazil: the case of athletics

    Lenamar Fiorese Vieira; José Luiz Lopes Vieira

    2008-01-01

    This study aimed to investigate political structures and its influence over sport talents development in athletics, in the state of Paraná, having as basis the BRONFENBRENNER (1979, 1992, 1995) ecological systems theory. The model for this study was the person- process- context – time biological paradigm. Informer's record, semi-structured interview, research diary and documents, were used to collect the data. The sample comprised athletics talented individuals (14), their relatives (13), coa...

  3. Marcadores de prognóstico em 980 doentes com SCA internados no CHBV

    Ferreira, Carla Susana Mendes

    2014-01-01

    Acute coronary syndrome consists in a state of clinical symptoms compatible with acute myocardial ischaemia that may result from various thrombotic coronary artery diseases: unstable angina, non–ST-segment elevation acute myocardial infarction and STsegment elevation myocardial infarction. This disease normally occurs due to atherosclerosis, through the rupture of an unstable atherosclerotic plaque or through superficial endothelial erosion. Eventually the activation of the coa...

  4. Study of the underlying basis for valproate hepatotoxicity : drug metabolism and its interaction with homeostasis

    Luís, Paula Maria Brazão Mendes, 1981-

    2011-01-01

    Tese de doutoramento, Farmácia (Bioquímica), Universidade de Lisboa, Faculdade de Farmácia, 2011 Microvesicular steatosis is a chronic hepatocellular change potentially induced by valproic acid (VPA). This effect has often been associated with a disturbed fatty acid metabolism and an altered dynamic balance of the essential co-factor coenzyme A (CoA). Furthermore, the parent drug or its metabolites may interact with mitochondrial metabolism at several sites, thereby deranging cellular func...

  5. Perbandingan Efek Kombinasi Aspirin Dan Simvastatin Terhadap Kadar High Sensitivity C-Reactive Protein (Hs-CRP) Dan Outcome Fungsional Pasien Stroke Iskemik Dengan Dan Tanpa Dislipidemia

    Gusnita, Ari

    2015-01-01

    Background : Aspirin causes irreversible inhibition of platelet aggregation . High or low dose aspirin can lower CRP levels. Simvastatin is used widely to control hyperlipidemia with the mechanism of inhibition of cholesterol synthesis by blocking the HMG - CoA reductase enzyme. Statins showed a decrease in CRP levels is an anti -inflammatory mechanisms and have clinical effects on morbidity and mortality . The combination of aspirin and statin therapy is associated with a proven to work syne...

  6. Mechanical Response and Conformational Amplification in α-Helical Coiled Coils

    Yogurtcu, Osman N.; Wolgemuth, Charles W.; Sun, Sean X.

    2010-01-01

    α-Helical coiled coils (CCs) are ubiquitous tertiary structural domains that are often found in mechanoproteins. CCs have mechanical rigidity and are often involved in force transmission between protein domains. Although crystal structures of CCs are available, information about their conformational flexibility is limited. The role of hydrophobic interactions in determining the CC conformation is not clear. In this work we examined the mechanical responses of typical CCs and constructed a coa...

  7. Investigation on mechanical behaviour of ECAPed 2A12 aluminium alloy

    Wang Cun-xian; Zhang Chao; Wang Lei; Tang Zhong-bin; Suo Tao

    2015-01-01

    In the present work, the uniaxial compressive behavior of aluminum alloy processed by equal channel angular pressing (ECAP) for 1–8 passes are investigated experimentally under both quasi-static and dynamic loading conditions via an electronic universal testing machine with a maximum load capacity of 10KN and the split Hopkinson pressure bar (SHPB). The strain hardening rate as well as strain rate sensitivity the ECAPed with different passes have been determined and compared with annealed coa...

  8. Effect of alternative fuel properties on NOx reduction

    Axelsen, Ernst Petter; Tokheim, Lars-André; Bjerketvedt, Dag

    2002-01-01

    Today we see a substantial increase in the use of alternative fuels in the cement industry. The prospect of reduction in fuel costs and the environmental benefits of waste to energy conversion are the driving forces. For several years Norcem have steadily increased their use of alternative fuels such as refuse derived fuel (RDF), liquid hazardous waste (LHW), solid hazardous waste (SHW), animal meal (AM) and waste oil (WO). Alternative fuels behave differently compared to e.g. coa...

  9. Two eminently treatable genetic metabolic myopathies

    Yee Woon-Chee

    2008-01-01

    Full Text Available Treatment of the genetic metabolic myopathies remains generally unsatisfactory with the exception of a select few. Multiple Acyl Co-A Dehydrogenase Deficiency (Glutaric Aciduria type II, in particular, has been shown to respond well to riboflavin supplementation. Recently, studies have also confirmed the effectiveness of recombinant enzyme replacement therapy for Acid Maltase Deficiency (Pompe′s Disease. Accurate and early diagnosis of these diseases is vital to prevent serious complications and impaired recovery following delayed treatment.

  10. Tunable Engineered Skin Mechanics via Coaxial Electrospun Fiber Core Diameter

    Blackstone, Britani Nicole; Drexler, Jason William; Powell, Heather Megan

    2014-01-01

    Autologous engineered skin (ES) offers promise as a treatment for massive full thickness burns. Unfortunately, ES is orders of magnitude weaker than normal human skin causing it to be difficult to apply surgically and subject to damage by mechanical shear in the early phases of engraftment. In addition, no manufacturing strategy has been developed to tune ES biomechanics to approximate the native biomechanics at different anatomic locations. To enhance and tune ES biomechanics, a coaxial (CoA...

  11. Coal Hydrology Bibliography

    United States Bureau of Land Management

    1983-01-01

    In compiling this bibliography, Geological Survey publication lists, existing Geological Survey bibliographies, and the Water Resources Scientific Information Center (WRSIC) data base were searched for pertinent Geological Survey publications that contained information relevant to the hydrology of a coal area. The WRSIC abstracts were used unedited as received from the WRSIC data base. Also included are reports of the Energy Mineral Rehabilitation Inventory and Analysis (EMRIA) program, coa...

  12. CLIMATE CHANGE ADAPTATION IN ACID SULFATE LANDSCAPES

    Chuxia Lin

    2012-01-01

    Oxidation of sulfide minerals produces sulfuric acid and consequently creates Acid Sulfate Landscapes (ASLs), which represent one of the most degraded types of land-surface environments. Although acid sulfate-producing weathering is a naturally occurring process, it is markedly facilitated by human intervention. Mining is by far the dominant anthropogenic cause for the creation of inland acid sulfate footprints while land reclamation in coastal lowlands is the driver for the formation of coas...

  13. Characterization of type 2 diacylglycerol acyltransferases in Chlamydomonas reinhardtii reveals their distinct substrate specificities and functions in triacylglycerol biosynthesis.

    Liu, Jin; Han, Danxiang; Yoon, Kangsup; Hu, Qiang; Li, Yantao

    2016-04-01

    Diacylglycerol acyltransferases (DGATs) catalyze a rate-limiting step of triacylglycerol (TAG) biosynthesis in higher plants and yeast. The genome of the green alga Chlamydomonas reinhardtii has multiple genes encoding type 2 DGATs (DGTTs). Here we present detailed functional and biochemical analyses of Chlamydomonas DGTTs. In vitro enzyme analysis using a radiolabel-free assay revealed distinct substrate specificities of three DGTTs: CrDGTT1 preferred polyunsaturated acyl CoAs, CrDGTT2 preferred monounsaturated acyl CoAs, and CrDGTT3 preferred C16 CoAs. When diacylglycerol was used as the substrate, CrDGTT1 preferred C16 over C18 in the sn-2 position of the glycerol backbone, but CrDGTT2 and CrDGTT3 preferred C18 over C16. In vivo knockdown of CrDGTT1, CrDGTT2 or CrDGTT3 resulted in 20-35% decreases in TAG content and a reduction of specific TAG fatty acids, in agreement with the findings of the in vitro assay and fatty acid feeding test. These results demonstrate that CrDGTT1, CrDGTT2 and CrDGTT3 possess distinct specificities toward acyl CoAs and diacylglycerols, and may work in concert spatially and temporally to synthesize diverse TAG species in C. reinhardtii. CrDGTT1 was shown to prefer prokaryotic lipid substrates and probably resides in both the endoplasmic reticulum and chloroplast envelope, indicating its role in prokaryotic and eukaryotic TAG biosynthesis. Based on these findings, we propose a working model for the role of CrDGTT1 in TAG biosynthesis. This work provides insight into TAG biosynthesis in C. reinhardtii, and paves the way for engineering microalgae for production of biofuels and high-value bioproducts. PMID:26919811

  14. Pantethine rescues a Drosophila model for pantothenate kinase–associated neurodegeneration

    Rana, Anil; Seinen, Erwin; Siudeja, Katarzyna; Muntendam, Remco; Srinivasan, Balaji; Van der Want, Johannes J.; Hayflick, Susan; Reijngoud, Dirk-Jan; Kayser, Oliver; Sibon, Ody C.M

    2010-01-01

    Pantothenate kinase–associated neurodegeneration (PKAN), a progressive neurodegenerative disorder, is associated with impairment of pantothenate kinase function. Pantothenate kinase is the first enzyme required for de novo synthesis of CoA, an essential metabolic cofactor. The pathophysiology of PKAN is not understood, and there is no cure to halt or reverse the symptoms of this devastating disease. Recently, we and others presented a PKAN Drosophila model, and we demonstrated that impaired f...

  15. Knock-down of pantothenate kinase 2 severely affects the development of the nervous and vascular system in zebrafish, providing new insights into PKAN disease

    Zizioli, Daniela; Tiso, Natascia; Guglielmi, Adele; Saraceno, Claudia; Busolin, Giorgia; Giuliani, Roberta; Khatri, Deepak; Monti, Eugenio; Borsani, Giuseppe; Argenton, Francesco; Finazzi, Dario

    2016-01-01

    Pantothenate Kinase Associated Neurodegeneration (PKAN) is an autosomal recessive disorder with mutations in the pantothenate kinase 2 gene (PANK2), encoding an essential enzyme for Coenzyme A (CoA) biosynthesis. The molecular connection between defects in this enzyme and the neurodegenerative phenotype observed in PKAN patients is still poorly understood. We exploited the zebrafish model to study the role played by the pank2 gene during embryonic development and get new insight into PKAN pat...

  16. Metabolic perturbation of an essential pathway: evaluation of a glycine precursor of Coenzyme A

    Rothmann, Michael; Kang, MinJin; Villa, Reymundo; Ntai, Ioanna; La Clair, James J.; Kelleher, Neil L.; Chapman, Eli; Burkart, Michael D.

    2013-01-01

    Pantetheine, and its corresponding disulfide pantethine, play a key role in metabolism as a building block of coenzyme A (CoA), an essential cofactor utilized in ~4% of primary metabolism and central to fatty acid, polyketide, and non-ribosomal peptide synthases. Using a combination of recombinant engineering and chemical synthesis, we demonstrate that the disulfide of N-pantoylglycyl-2-aminoethanethiol (GlyPan), with one carbon deletion from pantetheine, can rescue a mutant E. coli strain MG...

  17. Genetic disorders of vitamin B12 metabolism: eight complementation groups – eight genes

    Froese, D. Sean; Gravel, Roy A

    2010-01-01

    Vitamin B12 (cobalamin, Cbl) is an essential nutrient in human metabolism. Genetic diseases of vitamin B12 utilisation constitute an important fraction of inherited newborn disease. Functionally, B12 is the cofactor for methionine synthase and methylmalonyl CoA mutase. To function as a cofactor, B12 must be metabolised through a complex pathway that modifies its structure and takes it through subcellular compartments of the cell. Through the study of inherited disorders of vitamin B12 utilisa...

  18. A study on the mix design and fundamental properties of pre-cast concrete artifacts prepared with coarse and fine recycled aggregates

    Garcia Navarro, Justo; Guzmán Báez, Ana de; Cervantes Villamuelas, Miguel

    2010-01-01

    This paper analyzes the use of Construction and Demolition Waste as aggregate in precast concrete artifacts production incorporating coarse and fine fractions. The recycled aggregates used were sourced from a Spanish sorting facility and were mainly composed of concrete rubbles and ceramic materials. A complete study of the properties of the aggregates was carried out and laboratory trials were conducted to investigate the possibility of the use of 10%, 20%, 30% and 50% contents of coa...

  19. Type 1 diacylglycerol acyltransferases of Brassica napus preferentially incorporate oleic acid into triacylglycerol

    Aznar-Moreno, Jose; Denolf, Peter; Van Audenhove, Katrien; De Bodt, Stefanie; Engelen, Steven; Fahy, Deirdre; Wallis, James G.; Browse, John

    2015-01-01

    DGAT1 enzymes (acyl-CoA:diacylglycerol acyltransferase 1, EC 2.3.1.20) catalyse the formation of triacylglycerols (TAGs), the most abundant lipids in vegetable oils. Thorough understanding of the enzymology of oil accumulation is critical to the goal of modifying oilseeds for improved vegetable oil production. Four isoforms of BnDGAT1, the final and rate-limiting step in triacylglycerol synthesis, were characterized from Brassica napus, one of the world’s most important oilseed crops. Transcriptional profiling of developing B. napus seeds indicated two genes, BnDGAT1-1 and BnDGAT1-2, with high expression and two, BnDGAT1-3 and BnDGAT1-4, with low expression. The activities of each BnDGAT1 isozyme were characterized following expression in a strain of yeast deficient in TAG synthesis. TAG from B. napus seeds contain only 10% palmitic acid (16:0) at the sn-3 position, so it was surprising that all four BnDGAT1 isozymes exhibited strong (4- to 7-fold) specificity for 16:0 over oleic acid (18:1) as the acyl-CoA substrate. However, the ratio of 18:1-CoA to 16:0-CoA in B. napus seeds during the peak period of TAG synthesis is 3:1. When substrate selectivity assays were conducted with 18:1-CoA and 16:0-CoA in a 3:1 ratio, the four isozymes incorporated 18:1 in amounts 2- to 5-fold higher than 16:0. This strong sensitivity of the BnDGAT1 isozymes to the relative concentrations of acyl-CoA substrates substantially explains the observed fatty acid composition of B. napus seed oil. Understanding these enzymes that are critical for triacylglycerol synthesis will facilitate genetic and biotechnological manipulations to improve this oilseed crop. PMID:26195728

  20. The Hypolipidemic Activity of Heterocyclic Thiosemicarbazones, Thioureas and Their Metal Complexes in Sprague Dawley Male Rats

    Hall, Iris H.; Chen, S. Y.; Barnes, Betsy Jo; West, Douglas X.

    1999-01-01

    Heterocyclic thiosemicarbazones, thioureas and their copper, nickel, and cobalt complexes were shown to be potent hypolipidemic agents in male Sprague Dawley rats at 8 mg/kg/day, orally. These agents lowered the activity of rat hepatic rate limiting enzymes for the synthesis of cholesterol and triglycerides. The effects of these agnets on cytoplasmic ATP-dependent citrate lyase, acetyl CoA synthetase and HMG-CoA reductase activities were reduced by a magnitude to explain the reduction of seru...

  1. Genetic Characterization of the Klebsiella pneumoniae waa Gene Cluster, Involved in Core Lipopolysaccharide Biosynthesis

    Regué, Miguel; Climent, Núria; Abitiu, Nihal; Coderch, Núria; Merino, Susana; Izquierdo, Luis; Altarriba, Maria; Juan M. Tomás

    2001-01-01

    A recombinant cosmid containing genes involved in Klebsiella pneumoniae C3 core lipopolysaccharide biosynthesis was identified by its ability to confer bacteriocin 28b resistance to Escherichia coli K-12. The recombinant cosmid contains 12 genes, the whole waa gene cluster, flanked by kbl and coaD genes, as was found in E. coli K-12. PCR amplification analysis showed that this cluster is conserved in representative K. pneumoniae strains. Partial nucleotide sequence determination showed that t...

  2. Coal and Coalbed Methane Co-Extraction Technology Based on the Ground Movement in the Yangquan Coalfield, China

    Guozhong Hu; Jialin Xu; Fuxi Zhang; Changchun Zhao; Wei Qin; Yiran Zhu

    2015-01-01

    The Yangquan coalfield is one of the typical highly gassy mining areas in China. However, its coal seams are of lower permeability, which are not conductive to coalbed methane (CBM) drainage. In this study, based on the theory of the ground movement, we analyzed the principle of coal and CBM coextraction in the Yangquan coalfield, and established the technology system of coal and CBM coextraction which was further implemented in the coal and CBM coextraction in the Yangquan coalfield. The coa...

  3. Estimation of the nopal cactus (Opuntia cochenillifera) for color removal in drinking water Evaluación de la tuna (Opuntia cochenillifera) para la remoción del color en agua potable

    Joaquín Jiménez Antillón; Maricruz Vargas Camareno; Noemi Quirós Bustos

    2012-01-01

    The efficiency of nopal cactus to remove color in river and artificial waters for human consumption was evaluated. The performance of nopal was compared with that of aluminum sulfate coagulant and a cationic flocculant.The river water was cha- racterized by high color, low turbidity, alkalinity and hardness, and a high percentage of dissolved oxygen. The cactus leaves showed no activity as unique coa- gulant to be evaluated only in river water. In artificial water, as a sole treatment (45 mg/...

  4. Solution Structure and Backbone Dynamics of Human Liver Fatty Acid Binding Protein: Fatty Acid Binding Revisited

    Cai, Jun; Lücke, Christian; Chen, Zhongjing; Qiao, Ye; Klimtchuk, Elena; Hamilton, James A.

    2012-01-01

    Liver fatty acid binding protein (L-FABP), a cytosolic protein most abundant in liver, is associated with intracellular transport of fatty acids, nuclear signaling, and regulation of intracellular lipolysis. Among the members of the intracellular lipid binding protein family, L-FABP is of particular interest as it can i), bind two fatty acid molecules simultaneously and ii), accommodate a variety of bulkier physiological ligands such as bilirubin and fatty acyl CoA. To better understand the p...

  5. Functioning of ecosystems at the land-ocean interface

    Heip, C. H. R.; Middelburg, J. J.; Philippart, C.J.M.

    2011-01-01

    In this volume, we have focused on a number of new perspectives in trying to understand the responses to changes in land–ocean interfaces. We have compiled a series of chapters that address some key aspects of coastal and estuarine ecosystem functioning. The research field is too large to be covered entirely. We have, therefore, decided to select a few topics that are illustrative of how estuarine and coastal ecosystems function. Although the chapters deal specifically with estuarine and coas...

  6. 77 FR 48134 - Combined Notice of Filings #2

    2012-08-13

    ...: NaturEner Power Watch, LLC, NorthWestern Corporation Description: NaturEner Power Watch, LLC submits tariff filing per 35.13(a)(2)(iii: Revised COA No. 260 NaturEner Power Watch to be effective 8/3/2012... Due: 5 p.m. ET 8/24/12 Docket Numbers: ER12-2398-000 Applicants: NRG Solar Borrego I LLC...

  7. Nanorheometry of Molecularly Thin Liquid Lubricant Films Coated on Magnetic Disks

    Shintaro Itoh; Yuya Hamamoto; Koki Ishii; Kenji Fukuzawa; Hedong Zhang

    2012-01-01

    Molecularly thin lubricant films are used for the lubrication of head disk interfaces in hard disk drives. The film thickness is reduced to 1-2 nm to minimize the magnetic spacing, and optimal, precise design is required to obtain sufficient lubrication. However, until now, there was no generally applicable method for investigating such thin films. Therefore, we developed a highly sensitive shear force measuring method and have applied it to the viscoelastic measurement of lubricant films coa...

  8. Children of men with alcohol dependence: Psychopathology, neurodevelopment and family environment

    Raman, Vijaya; Prasad, Suveera; Appaya, M. Prakash

    2010-01-01

    Background: Children of people with alcohol dependence (COAs) are at high risk for behavioral and cognitive problems. Aim: Aim of this study was to compare the nature and extent of these problems in children of men with and without alcohol dependence. Materials and Methods: 32 children (17 in study group and 15 controls) were evaluated for psychopathology, neurodevelopment, cognitive functioning and family environment. Tools used were: Socio-demographic data sheet, Malin’s Intelligence Scale ...

  9. NCBI nr-aa BLAST: CBRC-PTRO-27-0127 [SEVENS

    Full Text Available CBRC-PTRO-27-0127 ref|NP_000121.2| coagulation factor V precursor [Homo sapiens] gb|AAB59401.1| coagulation... factor V gb|AAQ55063.1| coagulation factor V (proaccelerin, labile factor) [Homo sapiens] gb|EAW90849.1| coa...gulation factor V (proaccelerin, labile factor) [Homo sapiens] NP_000121.2 1e-05 29% ...

  10. NCBI nr-aa BLAST: CBRC-XTRO-01-0519 [SEVENS

    Full Text Available CBRC-XTRO-01-0519 ref|NP_000121.2| coagulation factor V precursor [Homo sapiens] gb|AAB59401.1| coagulation... factor V gb|AAQ55063.1| coagulation factor V (proaccelerin, labile factor) [Homo sapiens] gb|EAW90849.1| coa...gulation factor V (proaccelerin, labile factor) [Homo sapiens] NP_000121.2 9e-11 33% ...

  11. NCBI nr-aa BLAST: CBRC-XTRO-01-2672 [SEVENS

    Full Text Available CBRC-XTRO-01-2672 ref|NP_000121.2| coagulation factor V precursor [Homo sapiens] gb|AAB59401.1| coagulation... factor V gb|AAQ55063.1| coagulation factor V (proaccelerin, labile factor) [Homo sapiens] gb|EAW90849.1| coa...gulation factor V (proaccelerin, labile factor) [Homo sapiens] NP_000121.2 2e-07 33% ...

  12. Overexpression of Carnitine Palmitoyltransferase-1 in Skeletal Muscle Is Sufficient to Enhance Fatty Acid Oxidation and Improve High-Fat Diet–Induced Insulin Resistance

    Bruce, Clinton R.; Hoy, Andrew J.; Turner, Nigel; Watt, Matthew J.; Allen, Tamara L.; Carpenter, Kevin; Cooney, Gregory J.; Febbraio, Mark A; Kraegen, Edward W.

    2009-01-01

    OBJECTIVE—Skeletal muscle insulin resistance is associated with lipid accumulation, but whether insulin resistance is due to reduced or enhanced flux of long-chain fatty acids into the mitochondria is both controversial and unclear. We hypothesized that skeletal muscle–specific overexpression of the muscle isoform of carnitine palmitoyltransferase 1 (CPT1), the enzyme that controls the entry of long-chain fatty acyl CoA into mitochondria, would enhance rates of fatty acid oxidation and improv...

  13. AMACR is associated with advanced pathologic risk factors in sporadic colorectal adenomas

    Sotiris; Lakis; Theodora; Papamitsou; Constantina; Pana

    2010-01-01

    AIM: To analyze α-methylacyl CoA racemase (AMACR) expression in relation to various dysplasia phenotypes and clinicopathological parameters of sporadic colorectal adenomas.METHODS: Fifty-f ive cases of sporadic colorectal adenomas were categorized according to the Vienna classif ication for Gastrointestinal Neoplasia.These corresponded to a total of 98 different intra-lesion microscopic f ields that were further independently assigned a histological grade based on the old nomenclature (mild,moderate,severe ...

  14. Hyperspectral remote sensing for light pollution monitoring

    P. Marcoionni; Guzzi, D.; Castagnoli, F.; M. Benvenuti; Barducci, A.; I. Pippi

    2006-01-01

    industries. In this paper we introduce the results from a remote sensing campaign performed in September 2001 at night time. For the first time nocturnal light pollution was measured at high spatial and spectral resolution using two airborne hyperspectral sensors, namely the Multispectral Infrared and Visible Imaging Spectrometer (MIVIS) and the Visible InfraRed Scanner (VIRS-200). These imagers, generally employed for day-time Earth remote sensing, were flown over the Tuscany coa...

  15. Functional dissection of the bipartite active site of the class I coenzyme A (CoA)-transferase succinyl-CoA:acetate CoA-transferase

    Murphy, Jesse; Mullins, Elwood; Kappock, T.

    2016-05-01

    Coenzyme A (CoA)-transferases catalyze the reversible transfer of CoA from acyl-CoA thioesters to free carboxylates. Class I CoA-transferases produce acylglutamyl anhydride intermediates that undergo attack by CoA thiolate on either the internal or external carbonyl carbon atoms, forming distinct tetrahedral intermediates less than 3 Å apart. In this study, crystal structures of succinyl-CoA:acetate CoA-transferase (AarC) from Acetobacter aceti are used to examine how the Asn347 carboxamide stabilizes the internal oxyanion intermediate. A structure of the active mutant AarC-N347A bound to CoA revealed both solvent replacement of the missing contact and displacement of the adjacent Glu294, indicating that Asn347 both polarizes and orients the essential glutamate. AarC was crystallized with the nonhydrolyzable acetyl-CoA (AcCoA) analogue dethiaacetyl-CoA (1a) in an attempt to trap a closed enzyme complex containing a stable analogue of the external oxyanion intermediate. One active site contained an acetylglutamyl anhydride adduct and truncated 1a, an unexpected result hinting at an unprecedented cleavage of the ketone moiety in 1a. Solution studies confirmed that 1a decomposition is accompanied by production of near-stoichiometric acetate, in a process that seems to depend on microbial contamination but not AarC. A crystal structure of AarC bound to the postulated 1a truncation product (2a) showed complete closure of one active site per dimer but no acetylglutamyl anhydride, even with acetate added. These findings suggest that an activated acetyl donor forms during 1a decomposition; a working hypothesis involving ketone oxidation is offered. The ability of 2a to induce full active site closure furthermore suggests that it subverts a system used to impede inappropriate active site closure on unacylated CoA.

  16. The molecular physiology of increased egg desiccation resistance during diapause in the invasive mosquito, Aedes albopictus

    Urbanski, Jennifer M.; BENOIT, JOSHUA B.; Michaud, M. Robert; Denlinger, David L.; Armbruster, Peter

    2010-01-01

    Photoperiodic diapause is a crucial adaptation to seasonal environmental variation in a wide range of arthropods, but relatively little is known regarding the molecular basis of this important trait. In temperate populations of the mosquito Aedes albopictus, exposure to short-day (SD) lengths causes the female to produce diapause eggs. Tropical populations do not undergo a photoperiodic diapause. We identified a fatty acyl coA elongase transcript that is more abundant under SD versus long-day...

  17. Species composition of understory vegetation in coal mined land in Central Bengkulu, Indonesia

    WIRYONO; ARIF BUHA SIAHAAN

    2013-01-01

    Wiryono, Siahaan AB. 2013. Species composition of understory vegetation in coal mined land in Central Bengkulu, Indonesia. Biodiversitas 14: 31-36. Coal stripmining in forest area has destroyed forest ecosystem and created barren land. Reclamation of mined land is done by revegetating the land. In addition to planted species, pioneer species usually grow naturally in mined land. The objectives of this study were to know the species composition of understory vegetation growing naturally in coa...

  18. The Hypolipidemic Activity of Boronated Nucleosides in Male Mice and Rats

    Burnham, Bruce S.; Sood, Anup; Tomasz, Jeno; Powell, W J; Spielvogel, Bernard F.; Chen, S. Y.; Hall, Iris H.

    1996-01-01

    The boronated nucleosides with varying bases and sugar moieties were shown to be potent hypolipidemic agents in rodents. The 3′– aminocynaoborane dideoxythymidine derivative caused reductions in serum cholesterol and triglyceride levels, tissue lipids, VLDL and LDL cholesterol levels while elevating HDL cholesterol levels in rodents. The agents suppressed rat hepatic acetyl CoA synthetase, HMG-CoA reductase, acyl-CoA cholesterol acyl transferase, phosphatidylate phosphohydrolase and lipoprote...

  19. Journal of Business Chemistry

    2013-01-01

    The Journal of Business Chemistry examines issues associated with leadership and management for chemists and managers working in chemical research or industry. This journal is devoted to improving and developing the field of Business Chemistry. The Journal of Business Chemistry publishes peer-reviewed papers (including case studies) and essays. Areas for possible publication in include: leadership issues in the chemical and biochemical industry, such as teamwork, team building, mentoring, coa...

  20. Abundance and Diversity of Viruses in Six Delaware Soils

    Williamson, Kurt E.; Radosevich, Mark; Wommack, K. Eric

    2005-01-01

    The importance of viruses in marine microbial ecology has been established over the past decade. Specifically, viruses influence bacterial abundance and community composition through lysis and alter bacterial genetic diversity through transduction and lysogenic conversion. By contrast, the abundance and distribution of viruses in soils are almost completely unknown. This study describes the abundance and diversity of autochthonous viruses in six Delaware soils: two agricultural soils, two coa...

  1. Cytotoxicity of Coprinopsis atramentaria extract, organic acids and their synthesized methylated and glucuronate derivatives

    Heleno, Sandrina A.; Isabel C. F. R. Ferreira; Calhelha, Ricardo C.; Esteves, Ana P.; Martins, Anabela; Queiroz, Maria João R. P.

    2014-01-01

    Coprinopsis atramentaria is a wild edible mushroom whose methanolic extract revealed a marked antioxidant activity; p-hydroxybenzoic (HA), p-coumaric (CoA) and cinnamic (CA) acids were identified in the extract. In the present work, the cytotoxicity of C. atramentaria extract, previously identified organic acids and their synthesized derivatives (methylated compounds and protected glucuronides) was evaluated. Among all the tested cell lines (MCF-7—breast adenocarcinoma, NCI-H460—non-small cel...

  2. ETUDES CHIMIQUE ET BIOLOGIQUE DES HUILES ESSENTIELLES DE QUATRE PLANTES AROMATIQUES MEDICINALES DE CÔTE D'IVOIRE

    Toure , Daouda

    2015-01-01

    Bacterial resistance to antibiotics has become a real concern. Faced with this, research antimicrobialcompounds is more relevant than ever. The plants are a potentiel source of these compounds. The present studydescribes the chemical composition, antibacterial and antioxidant activity of Chromoleana odorata (Asteracea)Ageratum conyzoïdes (Asteracea), Croton hirtus (Euphorbiaceae) and Cardiospermum grandiflorum (Sapindaceae)essential oils of four aromatics and medicinal provide from Ivory Coas...

  3. On Usability Relationships of Computer Technology Input Artifacts and Rural Development in India

    Dr. Sanjay Kumar Gupta

    2012-01-01

    Computer Technology is going to penetrate deep into all areas of development, but easy-to-use interface availability for rural chunk is a big challenge. Regular PC interface with a keyboard is definitely deplorable by majority of villagers. Several technologies are now available to provide easy-to-use input artifacts (IA’s) for villagers to provide good interface for new technology. In this paper, effort has been done to represent usability of Computer Technology Input Artifacts (CTIA) as coa...

  4. The antigenicity of tobacco mosaic virus.

    Van Regenmortel, M H

    1999-01-01

    The antigenic properties of the tobacco mosaic virus (TMV) have been studied extensively for more than 50 years. Distinct antigenic determinants called neotopes and cryptotopes have been identified at the surface of intact virions and dissociated coat protein subunits, respectively, indicating that the quaternary structure of the virus influences the antigenic properties. A correlation has been found to exist between the location of seven to ten residue-long continuous epitopes in the TMV coa...

  5. The Role Of Governement In Overcoming The Effects Of Global Economic Crisis In Serbia - Obstacles From The Past

    Aleksandra Prascevic

    2012-01-01

    Economic policy in Serbia as in other countries in the process of economic transition and consolidation of democracy emerges as a source of opportunistic and ideologically motivated political manipulation. This manipulation was primarily by fiscal policy, motivated by opportunistic motives of policymakers. Due to the type of government - coalition governments, which have been present in Serbia since 2000, we can acknowledge the problem of distributional conflict, as a conflict between the coa...

  6. Intracellular Acetyl Unit Transport in Fungal Carbon Metabolism

    Strijbis, K.; Distel, B.

    2010-01-01

    Acetyl coenzyme A (acetyl-CoA) is a central metabolite in carbon and energy metabolism. Because of its amphiphilic nature and bulkiness, acetyl-CoA cannot readily traverse biological membranes. In fungi, two systems for acetyl unit transport have been identified: a shuttle dependent on the carrier carnitine and a (peroxisomal) citrate synthase-dependent pathway. In the carnitine-dependent pathway, carnitine acetyltransferases exchange the CoA group of acetyl-CoA for carnitine, thereby forming...

  7. Hypocholesterolemic mechanism of phenolics-enriched extract from Moringa oleifera leaves in HepG2 cell lines

    Peera Tabboon; Bungorn Sripanidkulchai; Kittisak Sripanidkulchai

    2016-01-01

    Previous studies have demonstrated the hypolipidemic activity of Moringa oleifera (MO) leaves via lowering serum levels of cholesterol, but the mechanism of action is unknown. In this study, we demonstrated the hypocholesterolemic mechanism of a phenolics-enriched extract of Moringa oleifera leaf (PMO) in HepG2 cells. When compared to the control treatment, PMO significantly decreased total intracellular cholesterol, inhibited the activity of HMG CoA reductase in a dosedependent m...

  8. Unconventional secretion by autophagosome exocytosis

    Pfeffer, Suzanne R

    2010-01-01

    In this issue, Duran et al. (2010. J. Cell Biol. doi: 10.1083/jcb.200911154) and Manjithaya et al. (2010. J. Cell Biol. doi: 10.1083/jcb.200911149) use yeast genetics to reveal a role for autophagosome intermediates in the unconventional secretion of an acyl coenzyme A (CoA)–binding protein that lacks an endoplasmic reticulum signal sequence. Medium-chain acyl CoAs are also required and may be important for substrate routing to this pathway.

  9. CORROSION BEHAVIOR OF A CONVERSION COATING BASED ON ZIRCONIUM AND COLORANTS ON GALVANIZED STEEL BY ELECTRODEPOSITION

    Josiane Soares Costa; Raquel Dei Agnoli; Jane Zoppas Ferreira

    2015-01-01

    Corrosion performance of Zr-based coating on substrates obtained by zinc electrodeposition in an alkaline bath is compared to chromate coatings (Cr III and Cr VI). The “nano Zr” is a conversion coating formed by immersion in a hexafluorozirconic acid solution. Since the “nano Zr” coating is transparent, the addiction of a colorant provides color to the surface. In this case, the colorant, when applied after the conversion coating, conferred the yellow color to the surface. The coa...

  10. Consumption and production waste: another externality of tobacco use

    Novotny, T; Zhao, F

    1999-01-01

    OBJECTIVE—To describe the waste produced by and environmental implications of individual cigarette consumption (filter tips, packages, and cartons) and tobacco manufacturing.
STUDY SELECTION—All available articles and reports published since 1970 related to cigarette consumption and production waste were reviewed.
DATA SOURCES—Global cigarette consumption data were used to estimate cigarette butt and packaging waste quantities. Data from the Center for Marine Conservation's International Coas...

  11. Drug: D00887 [KEGG MEDICUS

    Full Text Available D00887 Drug Atorvastatin ... calcium (USAN); Lipitor (TN) (C33H34FN2O5)2. Ca 1154.4529 1155.3417 D00 ... if Inhibitor [HMG-CoA reductase] ATC code: C10AA05 Atorvastatin ... promotes up-regulation of low-density lipoprotein ... , PLAIN C10AA HMG CoA reductase inhibitors C10AA05 Atorvastatin ... D00887 Atorvastatin ... calcium (USAN) USP drug classi ...

  12. Drug: D02258 [KEGG MEDICUS

    Full Text Available D02258 Drug Atorvastatin ... calcium hydrate (JP16); Lipitor (TN) (C33H34FN2O5)2. 3H2O. Ca 1208.4846 ... gents 218 Hyperlipidemia agents 2189 Others D02258 Atorvastatin ... calcium hydrate (JP16) Anatomical Therapeutic Chem ... , PLAIN C10AA HMG CoA reductase inhibitors C10AA05 Atorvastatin ... D02258 Atorvastatin ... calcium hydrate (JP16) USP dru ...

  13. An Analytical Model to evaluate the Approaches of Mobility Management

    A.Lakshman Rao; G. Vijaya Kumar

    2011-01-01

    Now a day’s efficient mobility management for mobile users in wireless networking is a crucial issue. To maintain global mobility in IP networking the Mobile internet protocol has been proposed. To reduce the signalling traffic related to the Mobile Terminals (MTs) registration with the Home Agents (HAs), whenever their Care-of-Addresses (CoAs) change several mobility management strategies have been proposed. And for registration process they use different Foreign Agents (FAs) and Gateway FAs...

  14. Effect of vitamin D on atorvastatin induced blood sugar changes in Wistar albino rats

    Arunkumar, R; Vinayak Meti; A. Ruckmani; Shobita Devi

    2014-01-01

    Background: Statins are hypocholestrolemic agents used in atherosclerotic vascular disorders. They act by inhibiting hepatic hypoxanthine methyl glutaryl CoA reductase enzyme. They are reported to cause hyperglycemia as an important adverse event. This study was conducted to investigate atorvastatin induced blood sugar changes in Wistar, albino, male rats and the influence of vitamin D on the blood sugar changes. Methods: Forty, 12 weeks old male, Wistar albino rats, were selected and rand...

  15. Tongue Coating and the Salivary Microbial Communities Vary in Children with Halitosis

    Wang, Zicheng; Zhang, Qun; Liu, Xuenan; ZHENG, HUI; Zhang, Qian; Zhang, Yifei; Zhang, Linshuang; Wu, Chunyan; Zheng, Shuguo; Qin, Nan; Ehrlich, S. Dusko; Li, Yihong; He, Xuesong; Xu, Tao; Chen, Ting

    2016-01-01

    Halitosis is a common symptom mainly caused by microbial activities in the oral cavity. Here, we used 16S rRNA gene pyrosequencing and metagenomic sequencing to examine oral microbial compositions and their functional variations in children with halitosis. We found that the tongue coating of subjects with halitosis had greater bacterial richness than those of healthy subjects. The relative abundance and prevalence of Leptotrichia wadei and Peptostreptococcus stomatis were higher in tongue coa...

  16. 抗疟疾复方制剂——COARTEM(R)

    孙卫华

    2006-01-01

    @@ COARTEM(R)(COA)是由诺华公司研制生产的首个抗疟疾复方制剂,临床用于恶性疟疾,作用迅速可靠,使用安全方便.2002年4月已被WHO"基本药物目录"收载.本品每片含蒿甲醚(ART)20mg,本芴醇(LUM)120mg.

  17. Assessment of properties thermal sprayed coatings realised using cermet blend powder

    Brezinová, J.; A. Guzanová; Spišák, E.

    2014-01-01

    The article deals with the assessment of selected properties of plasma sprayed coatings based on ZrSiO4 doped with different volume fractions of metal dopant (Ni). Mixed powders are cermet blends. Aim of the work consists of verificating the possibility to replace the application of Ni interlayer by adding Ni directly to the ceramic powder and apply them together in a single technological operation. The coatings were studied from point of view of their structure, porosity, adhesion of the coa...

  18. ADP-bildende Acetyl-CoA Synthetasen aus hyperthermophilen Archaea: Molekularbiologische und biochemische Charakterisierung von neuartigen Enzymen der Acetat-Bildung und ATP-Synthese

    Musfeldt, Meike

    2001-01-01

    Keine deutschsprachige Zusammenfassung vorhanden. Acetyl-CoA synthetase (ADP-forming) (ADP-ACS) represents a novel enzyme of acetate formation and energy conservation (acetyl-CoA + ADP + Pi -> acetate + ATP + CoA) in Archaea and eukaryotic protists. The only characterized ADP-ACS in Archaea, two isoenzymes from the hyperthermophile Pyrococcus furiosus, constitute 145 kDa heterotetramers (a2, b2). By using the N-terminal amino acid sequences of both subunits, which are located at different ...

  19. Genes, Enzymes, and Regulation of para-Cresol Metabolism in Geobacter metallireducens▿ †

    Peters, Franziska; Heintz, Dimitri; Johannes, Jörg; Dorsselaer, Alain Van; Boll, Matthias

    2007-01-01

    In aerobic and facultatively anaerobic bacteria, the degradation of para-cresol (p-cresol) involves the initial hydroxylation to p-hydroxybenzyl alcohol by water catalyzed by the soluble, periplasmatic flavocytochrome p-cresol methylhydroxylase (PCMH; α2β2 composition). In denitrifying bacteria the further metabolism proceeds via oxidation to p-hydroxybenzoate, the formation of p-hydroxybenzoyl-coenzyme A (CoA), and the subsequent dehydroxylation of the latter to benzoyl-CoA by reduction. In ...

  20. Nutrient and Phytoplankton Analysis of a Mediterranean Coastal Area.

    Sebastiá Frasquet, María Teresa; RODILLA ALAMA, MIGUEL

    2013-01-01

    Identifying and quantifying the key anthropogenic nutrient input sources are essential to adopting management measures that can target input for maximum effect in controlling the phytoplankton biomass. In this study, three systems characterized by distinctive main nutrient sources were sampled along a Mediterranean coast transect. These sources were groundwater discharge in the Ahuir area, the Serpis river discharge in the Venecia area, and a submarine wastewater outfall 1,900 m from the coas...

  1. Structural Insights into an Oxalate-producing Serine Hydrolase with an Unusual Oxyanion Hole and Additional Lyase Activity.

    Oh, Juntaek; Hwang, Ingyu; Rhee, Sangkee

    2016-07-15

    In Burkholderia species, the production of oxalate, an acidic molecule, is a key event for bacterial growth in the stationary phase. Oxalate plays a central role in maintaining environmental pH, which counteracts inevitable population-collapsing alkaline toxicity in amino acid-based culture medium. In the phytopathogen Burkholderia glumae, two enzymes are responsible for oxalate production. First, the enzyme oxalate biosynthetic component A (ObcA) catalyzes the formation of a tetrahedral C6-CoA adduct from the substrates acetyl-CoA and oxaloacetate. Then the ObcB enzyme liberates three products from the C6-CoA adduct: oxalate, acetoacetate, and CoA. Interestingly, these two stepwise reactions are catalyzed by a single bifunctional enzyme, Obc1, from Burkholderia thailandensis and Burkholderia pseudomallei Obc1 has an ObcA-like N-terminal domain and shows ObcB activity in its C-terminal domain despite no sequence homology with ObcB. We report the crystal structure of Obc1 in its apo and glycerol-bound form at 2.5 Å and 2.8 Å resolution, respectively. The Obc1 N-terminal domain is essentially identical both in structure and function to that of ObcA. Its C-terminal domain has an α/β hydrolase fold that has a catalytic triad for oxalate production and a novel oxyanion hole distinct from the canonical HGGG motif in other α/β hydrolases. Functional analyses through mutagenesis studies suggested that His-934 is an additional catalytic acid/base for its lyase activity and liberates two additional products, acetoacetate and CoA. These results provide structural and functional insights into bacterial oxalogenesis and an example of divergent evolution of the α/β hydrolase fold, which has both hydrolase and lyase activity. PMID:27226606

  2. Pathways commonly dysregulated in mouse and human obese adipose tissue: FAT/CD36 modulates differentiation and lipogenesis

    Berger, E.; Héraud, S; Mojallal, A; Lequeux, C; Weiss-Gayet, M; Damour, O.; Géloën, A.

    2015-01-01

    Obesity is linked to adipose tissue hypertrophy (increased adipocyte cell size) and hyperplasia (increased cell number). Comparative analyses of gene datasets allowed us to identify 1426 genes which may represent common adipose phenotype in humans and mice. Among them we identified several adipocyte-specific genes dysregulated in obese adipose tissue, involved in either fatty acid storage (acyl CoA synthase ACSL1, hormone-sensitive lipase LIPE, aquaporin 7 AQP7, perilipin PLIN) or cell adhesi...

  3. Separazione funzionale o strutturale nelle industrie regolate? I vincitori non puniscono; possibilmente cooperano (e innovano)

    Congedo, Pierluigi

    2008-01-01

    Structural v. functional separation in regulated industries, in electronic communications in particular, is still a debated issue. The article, based on the Ph.D. studies carried out by the Author at King's College London, tackles the reasons that may suggest "cooperative" solutions, such as the negotiation of undertakings with the national competition authorities or sector regulators, aimed at enhancing innovation while granting consumer welfare imperatives. From Shumpeter to Arrow, from Coa...

  4. Roadmapping for improving cocoa postharvest management

    Adriana del Pilar Sánchez Vargas; Óscar Fernando Castellanos Domínguez; Karen Patricia Domínguez Martínez

    2010-01-01

    This article presents the methodology and results which led to preparing post-harvesting technological development strategies for cocoa management which emerged from identifying problems such as deficient cocoa quality and insufficient fermentation of the beans according to international market requirements as shown in the poor technological development in Colombia’s main co-coa producing areas. This situation led to using a technological management tool such as roadmapping orientated towards...

  5. Inhibition of mitochondrial functions by margosa oil: possible implications in the pathogenesis of Reye's syndrome.

    Koga, Y; Yoshida, I; Kimura, A; Yoshino, M; Yamashita, F; Sinniah, D

    1987-08-01

    Margosa oil (MO), a fatty acid-rich extract of the seeds of the neem tree and a reported cause of Reye's syndrome, has been used in the induction of an experimental model of Reye's syndrome in rats. It has been reported that MO causes a decrease in in vivo mitochondrial enzyme activity similar to that seen in Reye's syndrome. We have attempted to uncover some of the biochemical mechanisms of MO's toxicity by examining its effect in vitro on isolated rat liver mitochondria. Male rat liver mitochondria were isolated by centrifugation; oxygen uptake, reduced forms of cytochrome b, c + c1, a + a3, and flavoprotein, intramitochondrial concentrations of acetyl coA, acid-soluble coA, acid-insoluble coA, and ATP content were measured after incubation with and without MO. Our results reveal that MO is a mitochondrial uncoupler. State 4 respiration was increased while the respiratory control ratio was decreased. The intramitochondrial content of ATP was also decreased. There were substantial changes in the reduction of the respiratory chain components after incubation of mitochondria with MO. This decelerative effect on mitochondrial electron transport was alleviated by the addition of coenzyme Q and/or carnitine. These effects of MO on mitochondrial respiration may be due to changes in fatty acid metabolism caused by MO as MO caused a shift in the proportion of acid-soluble or acid-insoluble coA esters. Supplementary therapy with L-carnitine and coenzyme Q may be useful in the management of MO-induced Reye's syndrome. PMID:3658544

  6. Kinetic, Thermodynamic, and Structural Insight into the Mechanism of Phosphopantetheine Adenylyltransferase from Mycobacterium tuberculosis

    Wubben, Thomas J.; Mesecar, Andrew D. (Purdue); (UIC)

    2012-05-29

    Phosphopantetheine adenylyltransferase (PPAT) catalyzes the penultimate step in the coenzyme A (CoA) biosynthetic pathway, reversibly transferring an adenylyl group from ATP to 4'-phosphopantetheine (PhP) to form dephosphocoenzyme A. This reaction sits at the branch point between the de novo pathway and the salvage pathway, and has been shown to be a rate-limiting step in the biosynthesis of CoA. Importantly, bacterial and mammalian PPATs share little sequence homology, making the enzyme a potential target for antibiotic development. A series of steady-state kinetic, product inhibition, and direct binding studies with Mycobacterium tuberculosis PPAT (MtPPAT) was conducted and suggests that the enzyme utilizes a nonrapid-equilibrium random bi-bi mechanism. The kinetic response of MtPPAT to the binding of ATP was observed to be sigmoidal under fixed PhP concentrations, but substrate inhibition was observed at high PhP concentrations under subsaturating ATP concentrations, suggesting a preferred pathway to ternary complex formation. Negative cooperativity in the kinetic response of MtPPAT to PhP binding was observed under certain conditions and confirmed thermodynamically by isothermal titration calorimetry, suggesting the formation of an asymmetric quaternary structure during sequential ligation of substrates. Asymmetry in binding was also observed in isothermal titration calorimetry experiments with dephosphocoenzyme A and CoA. X-ray structures of MtPPAT in complex with PhP and the nonhydrolyzable ATP analogue adenosine-5'-[({alpha},{beta})-methyleno]triphosphate were solved to 1.57 {angstrom} and 2.68 {angstrom}, respectively. These crystal structures reveal small conformational changes in enzyme structure upon ligand binding, which may play a role in the nonrapid-equilibrium mechanism. We suggest that the proposed kinetic mechanism and asymmetric character in MtPPAT ligand binding may provide a means of reaction and pathway regulation in addition to that

  7. Institutional Environments for Certified Organic Agriculture: Enabling Development, Smallholders Livelihood and Public Goods for Southern Environments?

    Egelyng, Henrik

    2007-01-01

    This paper presents the case for research on institutional environments for organically certified agriculture in developing countries. Observing that some analyses hold Southern organic agriculture as pro-poor and perhaps also more energy efficient than fossil fuel dependent industrialized agriculture, the paper explores differences and similarities in the policy rationale of promoting certified organics in North and South. Based on analysis of institutional environments for COA in Brazil and...

  8. Tree-ring isotope records of tropical cyclone activity

    Miller, Dana L.; Mora, Claudia I.; Grissino-Mayer, Henri D.; Mock, Cary J.; Uhle, Maria E.; Sharp, Zachary

    2006-01-01

    The destruction wrought by North Atlantic hurricanes in 2004 and 2005 dramatically emphasizes the need for better understanding of tropical cyclone activity apart from the records provided by meteorological data and historical documentation. We present a 220-year record of oxygen isotope values of α-cellulose in longleaf pine tree rings that preserves anomalously low isotope values in the latewood portion of the ring in years corresponding with known 19th and 20th century landfalling/near-coa...

  9. Simvastatin enhances hippocampal long-term potentiation in C57BL/6 mice

    Mans, Robert A.; Chowdhury, Nazma; Cao, Dongfeng; McMahon, Lori L.; Li, Ling

    2009-01-01

    Statins inhibit 3-hydroxy-3-methylglutaryl CoA reductase (HMG-CoA), the rate-limiting enzyme in the cholesterol biosynthetic pathway, and they are widely used to control plasma cholesterol levels and prevent cardiovascular disease. However, emerging evidence indicates that the beneficial effects of statins extend to the central nervous system. Statins have been shown to improve the outcome of stroke and traumatic brain injury, and statin use has been associated with a reduced prevalence of Al...

  10. An Assessment of Metals (Pb and Cu) Contamination in Bottom Sediment from South China Sea Coastal Waters, Malaysia

    M. C. Ong; B. Y. Kamaruzzaman

    2009-01-01

    Problem statement: The accumulation of metal contaminants in sediments can pose serious environmental problems to the surrounding areas. Trace metal contamination in sediment could affect the water quality and the bio-assimilation and bioaccumulation of metals in aquatic organisms, resulting in potential long-term implications on human health and ecosystem. Approach: About 154 bottom sediment samples were collected using Smith McIntyre in a transect pattern from South China Sea East Coast coa...

  11. Bioactivation of Anti-Tuberculosis Thioamide and Thiourea Prodrugs by Bacterial and Mammalian Flavin Monooxygenases

    Nishida, Clinton R.; Ortiz de Montellano, Paul R.

    2010-01-01

    The thioamide and thiourea class of antituberculosis agents encompasses prodrugs that are oxidatively converted to their active forms by the flavin monooxygenase EtaA of Mycobacterium tuberculosis. Reactive intermediates produced in the EtaA-catalyzed transformations of ethionamide and prothionamide result in NAD+/NADH adducts that inhibit the enoyl CoA reductase InhA, the ultimate target of these drugs. In the case of thiacetazone and isoxyl, EtaA produces electrophilic metabolites that medi...

  12. Mladeč and other caves in the Middle Danube region: early modern humans, late Neandertals, and projectiles

    Svoboda, Jiří

    Lisboa : Instituto Portugués de Arqueologia , 2001 - (Zilhao, J.), s. 45-60 ISBN 972-8662-00-9. [Colloque de la Commission de lUISPP /8./. Vila Nova de Foz Coa (PT), 22.10.1998-24.10.1998] R&D Projects: GA AV ČR IAA9001901 Institutional research plan: CEZ:AV0Z8001916 Keywords : Neandertals * early modern humans * Central Europe Subject RIV: AC - Archeology, Anthropology, Ethnology

  13. A Meta-Analysis of Contingent Valuation Studies in Coastal and Near-Shore Marine Ecosystems

    Liu, Shuang; Stern, David I.

    2008-01-01

    The ecosystem services provided by coastal and nearshore marine systems contribute significantly to human welfare. However, studies that document values of these services are widely scattered in the peer-reviewed literature. We collected 39 contingent valuation papers with 120 observations to conduct the first meta-analysis of the ecosystem service values provided by the coastal and nearshore marine systems. Our results show that over ¾ of the variation in Willingness to Pay (WTP) for coas...

  14. Adding Extra Value

    2011-01-01

    China and Africa finding new ways to drive all aspects of mutual development A total of 210 orphans in the three states around Abuja,capital of Nigeria,went to a summer camp to celebrate the country’s Children’s Day on May 27.Huawei Technologies Co.,a leading global information and communications technology solutions provider from China,sponsored the event.

  15. Cervico-oculo-acoustic (Wildervanck) syndrome: clinicoradiological findings

    Rihani, Farouk Bassam

    2013-01-01

    We describe a girl presented with facial asymmetry and oral mucosal cleft and with further investigations other anomalies were found including hearing loss, Duane syndrome, Klippel-Feil anomaly, Chiari malformation and accessory bone mass in mandibular ramus leading to the clinical diagnosis of cervico-oculo-acoustic (Wildervanck) syndrome (COAS). The patient underwent surgical occipital decompression by preforming suboccipital craniectomy and C1 posterior laminectomy to relieve the cerebella...

  16. Inclusion of fresh forage in the ration for dairy cows: effects on CLA and trans C18:1 isomers content of milk fat

    P. Secchiari

    2010-01-01

    Full Text Available Milk fat is the richest natural source of conjugated linoleic acid (CLA isomers. The 9-cis, 11-trans CLA isomer (rumenic acid, RA origins from two pathways: as an intermediate of the rumen biohydrogenation process of linoleic acid or as the product of the activity of mammary Stearoyl Co-A desaturase enzyme (SCD with trans-11, C18:1 (vaccenic acid, VA as the precursor, another intermediate in the biohydrogenation of linoleic and linolenic acid.

  17. Genomic and Physiological Characterization of the Chromate-Reducing, Aquifer-Derived Firmicute Pelosinus sp. Strain HCF1

    Beller, Harry R.; Han, Ruyang; Karaoz, Ulas; Lim, HsiaoChien; Eoin L. Brodie

    2013-01-01

    Pelosinus spp. are fermentative firmicutes that were recently reported to be prominent members of microbial communities at contaminated subsurface sites in multiple locations. Here we report metabolic characteristics and their putative genetic basis in Pelosinus sp. strain HCF1, an isolate that predominated anaerobic, Cr(VI)-reducing columns constructed with aquifer sediment. Strain HCF1 ferments lactate to propionate and acetate (the methylmalonyl-coenzyme A [CoA] pathway was identified in t...

  18. Cellular coaggregation of oral Streptococcus milleri with actinomyces.

    Eifuku, H; Yakushiji, T; Mizuno, J.; Kudo, N.; M. Inoue

    1990-01-01

    Oral isolates of Streptococcus milleri were examined for their ability to coaggregate with actinomyces. Of the 68 S. milleri strains tested, including 3 reference strains, 40 strains coaggregated with Actinomyces naeslundii WVU45 (actinomyces coaggregation group B) and 36 strains coaggregated with Actinomyces viscosus T14V (actinomyces coaggregation group A). All S. milleri strains of serotypes b (4 strains), e (2 strains), and f (24 strains) coaggregated with both of the actinomyces. The coa...

  19. Early Phenylpropanoid Biosynthetic Steps in Cannabis sativa: Link between Genes and Metabolites

    Immacolata Coraggio; Monica Mattana; Roberto Consonni; Teresa Docimo

    2013-01-01

    Phenylalanine ammonia-lyase (PAL), Cinnamic acid 4-hydroxylase (C4H) and 4-Coumarate: CoA ligase (4CL) catalyze the first three steps of the general phenylpropanoid pathway whereas chalcone synthase (CHS) catalyzes the first specific step towards flavonoids production. This class of specialized metabolites has a wide range of biological functions in plant development and defence and a broad spectrum of therapeutic activities for human health. In this study, we report the isolation of hemp PAL...

  20. The application of a modified stepwise regression (MSR) method to the estimation of aircraft stability and control derivatives

    Hinds, H. A.

    1996-01-01

    A programme of research has now been completed in the College of Aeronautics (CoA) at Cranfield University to investigate the use of a Modified Stepwise Regression (MSR) procedure. The technique was applied to data obtained from a small BAe Hawk aircraft model flown in a dynamic wind tunnel facility in order to try to estimate the aerodynamic stability and control derivatives of the model. A variety of preliminary experiments were performed to enable the static stability ...

  1. Cooked rice prevents hyperlipidemia in hamsters fed a high-fat/cholesterol diet by the regulation of the expression of hepatic genes involved in lipid metabolism.

    Choi, Won Hee; Gwon, So Young; Ahn, Jiyun; Jung, Chang Hwa; Ha, Tae Youl

    2013-07-01

    Rice has many health-beneficial components for ameliorating obesity, diabetes, and dyslipidemia. However, the effect of cooked rice as a useful carbohydrate source has not been investigated yet; so we hypothesized that cooked rice may have hypolipidemic effects. In the present study, we investigated the effect of cooked rice on hyperlipidemia and on the expression of hepatic genes involved in lipid metabolism. Golden Syrian hamsters were divided into 2 groups and fed a high-fat (15%, wt/wt)/cholesterol (0.5%, wt/wt) diet supplemented with either corn starch (HFD, 54.5% wt/wt) or cooked rice (HFD-CR, 54.5% wt/wt) as the main carbohydrate source for 8 weeks. In the HFD-CR group, the triglyceride and total cholesterol levels in the serum and liver were decreased, and the total lipid, total cholesterol, and bile acid levels in the feces were increased, compared with the HFD group. In the cooked-rice group, the messenger RNA and protein levels of 3-hydroxy-3-methylglutaryl CoA reductase were significantly downregulated; and the messenger RNA and protein levels of the low-density lipoprotein receptor and cholesterol-7α-hydroxylase were upregulated. Furthermore, the expressions of lipogenic genes such as sterol response element binding protein-1, fatty acid synthase, acetyl CoA carboxylase, and stearoyl CoA desaturase-1 were downregulated, whereas the β-oxidation related genes (carnitine palmitoyl transferase-1, acyl CoA oxidase, and peroxisome proliferator-activated receptor α) were upregulated, in the cooked-rice group. Our results suggest that the hypolipidemic effect of cooked rice is partially mediated by the regulation of hepatic genes involved in lipid metabolism, which results in the suppression of cholesterol and fatty acid synthesis and the enhancement of cholesterol excretion and fatty acid β-oxidation. PMID:23827132

  2. Influence of gas detonation spraying conditions on the quality of Fe-Al intermetallic protective coatings

    Senderowski C.; Bojar Z.; Przetakiewicz W.

    2007-01-01

    The aim of this paper is to present generalized research results and analyses of the quality of coatings produced with self decomposing Fe-Al intermetallic powders deposited on 1045 steel in the gas detonation spraying (GDS). A number of GDS experiments has been carried out with significantly changed operational spraying parameters (the volume of the fuel gas, carrier gas, distance and the frequency of spraying) which define the process energy level directly influencing the quality of the coa...

  3. Characterization and Heterologous Expression of the Oxalyl Coenzyme A Decarboxylase Gene from Bifidobacterium lactis

    Federici, Federica; Vitali, Beatrice; Gotti, Roberto; Pasca, Maria Rosalia; Gobbi, Silvia; Peck, Ammon B; Brigidi, Patrizia

    2004-01-01

    Oxalyl coenzyme A (CoA) decarboxylase (Oxc) is a key enzyme in the catabolism of the highly toxic compound oxalate, catalyzing the decarboxylation of oxalyl-CoA to formyl-CoA. The gene encoding a novel oxalyl-CoA decarboxylase from Bifidobacterium lactis DSM 10140 (oxc) was identified and characterized. This strain, isolated from yogurt, showed the highest oxalate-degrading activity in a preliminary screening with 12 strains belonging to Bifidobacterium, an anaerobic intestinal bacterial grou...

  4. Biosensor development for the analysis of food quality.

    Giakoumaki, Elsa

    2003-01-01

    This thesis describes the development and evaluation of a number of biosensors for food applications. The first part of this thesis deals with the development of Surface Plasmon Resonance (SPR) biosensor systems, coupled with Polymerase Chain Reaction (PCR) for the detection of GMO related amplified nucleic acids in foodstuffs. The first SPR Biosensor described, used streptavidin-biotin linkage chemistry to attach a P35S nucleic acid probe on dextran-coa...

  5. O cinema na galiza: un cinema ianqui?

    Sixto García, José

    2008-01-01

    Full Text Available Este traballo pretende averiguar se os cines españois cumpren coa cota de cine europeo que esixe a lei 15/ 2001 de 9 de xullo, de Fomento e Promoción da Cinematografía e o Sector Audiovisual, cuxo obxectivo fundamental é o de asegurar as condicións favorables para a produción e o aumento da creatividade

  6. Coaches’ views on differences in treatment style for male and female clients.

    Barry, J. A.; Russ, S.; Ellam-Dyson, V.; Seager, M.

    2015-01-01

    Men are generally more reluctant than women to seek psychological help, perhaps because of negative preconceptions about therapy. We interviewed 20 life coaches to find out whether they had seen gender differences in expectations and outcomes regarding coaching in their male and female clients. Analysis of the interviews, using the grounded theory method, revealed that although almost all coaches described gender differences in help seeking and treatment preferences in their clients, most coa...

  7. Potential of tocotrienols in the prevention and therapy of Alzheimer's disease.

    Xia, Weiming; Mo, Huanbiao

    2016-05-01

    Currently there is no cure for Alzheimer's disease (AD); clinical trials are underway to reduce amyloid generation and deposition, a neuropathological hallmark in brains of AD patients. While genetic factors and neuroinflammation contribute significantly to AD pathogenesis, whether increased cholesterol level is a causative factor or a result of AD is equivocal. Prenylation of proteins regulating neuronal functions requires mevalonate-derived farnesyl pyrophosphate (FPP) and geranylgeranyl pyrophosphate (GGPP). The observation that the levels of FPP and GGPP, but not that of cholesterol, are elevated in AD patients is consistent with the finding that statins, competitive inhibitors of 3-hydroxy-3-methylglutaryl coenzyme A (HMG CoA) reductase, reduce FPP and GGPP levels and amyloid β protein production in preclinical studies. Retrospective studies show inverse correlations between incidence of AD and the intake and serum levels of the HMG CoA reductase-suppressive tocotrienols; tocopherols show mixed results. Tocotrienols, but not tocopherols, block the processing and nuclear localization of sterol regulatory element binding protein-2, the transcriptional factor for HMG CoA reductase and FPP synthase, and enhance the degradation of HMG CoA reductase. Consequently, tocotrienols deplete the pool of FPP and GGPP and potentially blunt prenylation-dependent AD pathogenesis. The antiinflammatory activity of tocotrienols further contributes to their protection against AD. The mevalonate- and inflammation-suppressive activities of tocotrienols may represent those of an estimated 23,000 mevalonate-derived plant secondary metabolites called isoprenoids, many of which are neuroprotective. Tocotrienol-containing plant foods and tocotrienol derivatives and formulations with enhanced bioavailability may offer a novel approach in AD prevention and treatment. PMID:27133418

  8. Quantitative Assessment of Wall Shear Stress in an Aortic Coarctation - Impact of Virtual Interventions

    Karlsson, Matts; Andersson, Magnus; Lantz, Jonas

    2014-11-01

    Turbulent and wall impinging blood flow causes abnormal shear forces onto the lumen and may play an important role in the pathogenesis of numerous cardiovascular diseases. In the present study, wall shear stress (WSS) and related flow parameters were studied in a pre-treated aortic coarctation (CoA) as well as after several virtual interventions using computational fluid dynamics (CFD). Patient-specific geometry and flow conditions were derived from magnetic resonance imaging (MRI) data. Finite element analysis was performed to acquire six different dilated CoAs. The unsteady pulsatile flow was resolved by large eddy simulation (LES) including non-Newtonian blood rheology. Pre-intervention, the presence of jet flow wall impingement caused an elevated WSS zone, with a distal region of low and oscillatory WSS. After intervention, cases with a more favorable centralized jet showed reduced high WSS values at the opposed wall. Despite significant turbulence reduction post-treatment, enhanced regions of low and oscillatory WSS were observed for all cases. This numerical method has demonstrated the morphological impact on WSS distribution in an CoA. With the predictability and validation capabilities of a combined CFD/MRI approach, a step towards patient-specific intervention planning is taken.

  9. FACET: an object-oriented software framework for modeling complex social behavior patterns

    Dolph, J. E.; Christiansen, J. H.; Sydelko, P. J.

    2000-06-30

    The Framework for Addressing Cooperative Extended Transactions (FACET) is a flexible, object-oriented architecture for implementing models of dynamic behavior of multiple individuals, or agents, in a simulation. These agents can be human (individuals or organizations) or animal and may exhibit any type of organized social behavior that can be logically articulated. FACET was developed by Argonne National Laboratory's (ANL) Decision and Information Sciences Division (DIS) out of the need to integrate societal processes into natural system simulations. The FACET architecture includes generic software components that provide the agents with various mechanisms for interaction, such as step sequencing and logic, resource management, conflict resolution, and preemptive event handling. FACET components provide a rich environment within which patterns of behavior can be captured in a highly expressive manner. Interactions among agents in FACET are represented by Course of Action (COA) object-based models. Each COA contains a directed graph of individual actions, which represents any known pattern of social behavior. The agents' behavior in a FACET COA, in turn, influences the natural landscape objects in a simulation (i.e., vegetation, soil, and habitat) by updating their states. The modular design of the FACET architecture provides the flexibility to create multiple and varied simulation scenarios by changing social behavior patterns, without disrupting the natural process models. This paper describes the FACET architecture and presents several examples of FACET models that have been developed to assess the effects of anthropogenic influences on the dynamics of the natural environment.

  10. Whole Genome Re-Sequencing Identifies a Quantitative Trait Locus Repressing Carbon Reserve Accumulation during Optimal Growth in Chlamydomonas reinhardtii.

    Goold, Hugh Douglas; Nguyen, Hoa Mai; Kong, Fantao; Beyly-Adriano, Audrey; Légeret, Bertrand; Billon, Emmanuelle; Cuiné, Stéphan; Beisson, Fred; Peltier, Gilles; Li-Beisson, Yonghua

    2016-01-01

    Microalgae have emerged as a promising source for biofuel production. Massive oil and starch accumulation in microalgae is possible, but occurs mostly when biomass growth is impaired. The molecular networks underlying the negative correlation between growth and reserve formation are not known. Thus isolation of strains capable of accumulating carbon reserves during optimal growth would be highly desirable. To this end, we screened an insertional mutant library of Chlamydomonas reinhardtii for alterations in oil content. A mutant accumulating five times more oil and twice more starch than wild-type during optimal growth was isolated and named constitutive oil accumulator 1 (coa1). Growth in photobioreactors under highly controlled conditions revealed that the increase in oil and starch content in coa1 was dependent on light intensity. Genetic analysis and DNA hybridization pointed to a single insertional event responsible for the phenotype. Whole genome re-sequencing identified in coa1 a >200 kb deletion on chromosome 14 containing 41 genes. This study demonstrates that, 1), the generation of algal strains accumulating higher reserve amount without compromising biomass accumulation is feasible; 2), light is an important parameter in phenotypic analysis; and 3), a chromosomal region (Quantitative Trait Locus) acts as suppressor of carbon reserve accumulation during optimal growth. PMID:27141848

  11. [Metabolism of pantothenic acid and its derivatives in animals deficient in this enzyme].

    Gurinovich, V A; Moiseenok, A G

    1987-01-01

    Distribution of [14C]labelled metabolites of pantothenic acid (PAA) has been studied in tissues of normal and PAA-deficient rats-weaners 6 h after single injection of the calcium pantothenate (PAA-Ca), calcium 4'-phosphopantothenate (PAA-Ca) or pantethine (PT) preparations. Essential differences in the intertissue distribution of vitamin derivatives to be injected are revealed against a background of a higher vitamin-retaining ability of the PAA-deficient tissues. A degree of radionuclides' biotransformation into CoA permits them to be arranged in the series: PPA-Ca greater than PAA-Ca greater than PT. In PAA-deficient animals which were injected labelled PPA-Ca up to 41% of the liver radioactivity is concentrated in the CoA fraction and the quantity of label in the composition of PAA-protein cytosolium complexes increases considerably. It is supposed that there is a special PAA-depositing system which provides the intracellular CoA biosynthesis. PMID:3686695

  12. Pantothenic acid and its derivatives protect Ehrlich ascites tumor cells against lipid peroxidation.

    Slyshenkov, V S; Rakowska, M; Moiseenok, A G; Wojtczak, L

    1995-12-01

    Preincubation of Ehrlich ascites tumor cells at 22 or 32 degrees C, but not at 0 degree C, with pantothenic acid, 4'-phosphopantothenic acid, pantothenol, or pantethine reduced lipid peroxidation (measured by production of thiobarbituric acid-reactive compounds) induced by the Fenton reaction (Fe2+ + H2O2) and partly protected the plasma membrane against the leakiness to cytoplasmic proteins produced by the same reagent. Pantothenic acid and its derivatives did not inhibit (Fe2+ + H2O2)-induced peroxidation of phospholipid multilamellar vesicles, thus indicating that their effect on the cells was not due to the scavenging mechanism. Homopantothenic acid and its 4'-phosphate ester (which are not precursors of CoA) neither protected Ehrlich ascites tumor cells against lipid peroxidation nor prevented plasma membrane leakiness under the same conditions. Incubation of the cells with pantothenic acid, 4'-phosphopantothenic acid, pantothenol, or pantethine significantly increased the amount of cellular CoA and potentiated incorporation of added palmitate into phospholipids and cholesterol esters. It is concluded that pantothenic acid and its related compounds protect the plasma membrane of Ehrlich ascites tumor cells against the damage by oxygen free radicals due to increasing cellular level of CoA. The latter compound may act by diminishing propagation of lipid peroxidation and promoting repair mechanisms, mainly the synthesis of phospholipids. PMID:8582649

  13. Quantitative assessment of systolic left ventricular function with speckle-tracking echocardiography in adult patients with repaired aortic coarctation.

    Menting, Myrthe E; van Grootel, Roderick W J; van den Bosch, Annemien E; Eindhoven, Jannet A; McGhie, Jackie S; Cuypers, Judith A A E; Witsenburg, Maarten; Helbing, Willem A; Roos-Hesselink, Jolien W

    2016-05-01

    Despite successful aortic coarctation (CoA) repair, systemic hypertension often recurs which may influence left ventricular (LV) function. We aimed to detect early LV dysfunction using LV global longitudinal strain (GLS) in adults with repaired CoA, and to identify associations with patient and echocardiographic characteristics. In this cross-sectional study, patients with repaired CoA and healthy controls were recruited prospectively. All subjects underwent echocardiography, ECG and blood sampling within 1 day. With speckle-tracking echocardiography, we assessed LV GLS on the apical four-, three- and two-chamber views. We included 150 subjects: 75 patients (57 % male, age 33.4 ± 12.8 years, age at repair 2.5 [IQR: 0.1-11.1] years) and 75 healthy controls of similar sex and age. LV GLS was lower in patients than in controls (-17.1 ± 2.3 vs. -20.2 ± 1.6 %, P detection of ventricular dysfunction. PMID:26780661

  14. Molecular mechanism underlying promiscuous polyamine recognition by spermidine acetyltransferase.

    Sugiyama, Shigeru; Ishikawa, Sae; Tomitori, Hideyuki; Niiyama, Mayumi; Hirose, Mika; Miyazaki, Yuma; Higashi, Kyohei; Murata, Michio; Adachi, Hiroaki; Takano, Kazufumi; Murakami, Satoshi; Inoue, Tsuyoshi; Mori, Yusuke; Kashiwagi, Keiko; Igarashi, Kazuei; Matsumura, Hiroyoshi

    2016-07-01

    Spermidine acetyltransferase (SAT) from Escherichia coli, which catalyses the transfer of acetyl groups from acetyl-CoA to spermidine, is a key enzyme in controlling polyamine levels in prokaryotic cells. In this study, we determined the crystal structure of SAT in complex with spermidine (SPD) and CoA at 2.5Å resolution. SAT is a dodecamer organized as a hexamer of dimers. The secondary structural element and folding topology of the SAT dimer resemble those of spermidine/spermine N(1)-acetyltransferase (SSAT), suggesting an evolutionary link between SAT and SSAT. However, the polyamine specificity of SAT is distinct from that of SSAT and is promiscuous. The SPD molecule is also located at the inter-dimer interface. The distance between SPD and CoA molecules is 13Å. A deep, highly acidic, water-filled cavity encompasses the SPD and CoA binding sites. Structure-based mutagenesis and in-vitro assays identified SPD-bound residues, and the acidic residues lining the walls of the cavity are mostly essential for enzymatic activities. Based on mutagenesis and structural data, we propose an acetylation mechanism underlying promiscuous polyamine recognition for SAT. PMID:27163532

  15. Including aortic valve morphology in computational fluid dynamics simulations: initial findings and application to aortic coarctation.

    Wendell, David C; Samyn, Margaret M; Cava, Joseph R; Ellwein, Laura M; Krolikowski, Mary M; Gandy, Kimberly L; Pelech, Andrew N; Shadden, Shawn C; LaDisa, John F

    2013-06-01

    Computational fluid dynamics (CFD) simulations quantifying thoracic aortic flow patterns have not included disturbances from the aortic valve (AoV). 80% of patients with aortic coarctation (CoA) have a bicuspid aortic valve (BAV) which may cause adverse flow patterns contributing to morbidity. Our objectives were to develop a method to account for the AoV in CFD simulations, and quantify its impact on local hemodynamics. The method developed facilitates segmentation of the AoV, spatiotemporal interpolation of segments, and anatomic positioning of segments at the CFD model inlet. The AoV was included in CFD model examples of a normal (tricuspid AoV) and a post-surgical CoA patient (BAV). Velocity, turbulent kinetic energy (TKE), time-averaged wall shear stress (TAWSS), and oscillatory shear index (OSI) results were compared to equivalent simulations using a plug inlet profile. The plug inlet greatly underestimated TKE for both examples. TAWSS differences extended throughout the thoracic aorta for the CoA BAV, but were limited to the arch for the normal example. OSI differences existed mainly in the ascending aorta for both cases. The impact of AoV can now be included with CFD simulations to identify regions of deleterious hemodynamics thereby advancing simulations of the thoracic aorta one step closer to reality. PMID:22917990

  16. Outcome measures of interventions in the study of children of substance-abusing parents.

    Kumpfer, K L

    1999-05-01

    Children of substance-abusing parents, including children of alcoholics (COAs), are one of the highest risk groups of youth for substance-abuse problems. For both genetic and family environmental reasons, COAs and children of drug abusers are very vulnerable to becoming alcohol or other drug abusers.1,2 With drug use rates increasing in the past 7 years,3 prevention practitioners must work harder to identify and evaluate effective ways to prevent future substance abuse in these at-risk children. Most prevention programs designed specifically for COAs or children of drug abusers have struggled with identifying, attracting, maintaining, and measuring outcomes. This article focuses on general and unique measurement methods and instrument problems in prevention interventions for children of substance-abusing parents. Part I covers the need for improved measurement in research and practice with children of substance-abusing parents and recommended measures for different hypothesized outcome variables. Part II covers considerations in selecting measures, and Part III covers how to select measures. This article concludes with recommendations to improve measurement in research and practice. PMID:10224200

  17. The molecular physiology of increased egg desiccation resistance during diapause in the invasive mosquito, Aedes albopictus

    Urbanski, Jennifer M.; Benoit, Joshua B.; Michaud, M. Robert; Denlinger, David L.; Armbruster, Peter

    2010-01-01

    Photoperiodic diapause is a crucial adaptation to seasonal environmental variation in a wide range of arthropods, but relatively little is known regarding the molecular basis of this important trait. In temperate populations of the mosquito Aedes albopictus, exposure to short-day (SD) lengths causes the female to produce diapause eggs. Tropical populations do not undergo a photoperiodic diapause. We identified a fatty acyl coA elongase transcript that is more abundant under SD versus long-day (LD) photoperiods in mature oocyte tissue of replicate temperate, but not tropical, A. albopictus populations. Fatty acyl CoA elongases are involved in the synthesis of long chain fatty acids (hydrocarbon precursors). Diapause eggs from a temperate population had one-third more surface hydrocarbons and one-half the water loss rates of non-diapause eggs. Eggs from a tropical population reared under SD and LD photoperiods did not differ in surface hydrocarbon abundance or water loss rates. In both a temperate and tropical population, composition of hydrocarbon chain lengths did not differ between eggs from SD versus LD conditions. These results implicate the expression of fatty acyl coA elongase and changes in quantity, but not composition, of egg surface hydrocarbons as important components of increased desiccation resistance during diapause in A. albopictus. PMID:20410035

  18. A plant malonyl-CoA synthetase enhances lipid content and polyketide yield in yeast cells.

    Wang, Yechun; Chen, Hui; Yu, Oliver

    2014-06-01

    Malonyl-CoA is the essential building block of natural products such as fatty acids, polyketides, and flavonoids. Engineering the biosynthesis of fatty acids is important for biofuel production while that of polyketides provides precursors of medicines and nutritional supplements. However, microorganisms maintain a small amount of cellular malonyl-CoA, which could limit production of lipid and polyketides under certain conditions. Malonyl-CoA concentration is regulated by multiple pathways and signals, and changes in intracellular malonyl-CoA often lead to complex alterations in metabolism. In the present work, overexpression of a plant malonyl-CoA synthetase gene (AAE13) in Saccharomyces cerevisiae resulted in 1.6- and 2.4-fold increases in lipid and resveratrol accumulation simultaneously. We also demonstrated that AAE13 partially complemented the temperature-sensitive acc1 mutant, replacing this key enzyme in central metabolism. Mechanistic analysis by CoA quantification and transcriptomic measurement suggested that increases in malonyl-CoA concentration were coupled with drastic reductions in other major CoA compounds and clear suppression of tricarboxylic acid cycle-related genes. These results suggest that malonyl-CoA is a critical target for fatty acid and polyketide engineering and that overexpression of malonyl-CoA synthetic enzymes needs to be combined with upregulation of CoA synthesis to maintain metastasis of central metabolism. PMID:24682482

  19. Murine FATP alleviates growth and biochemical deficiencies of yeast fat1Delta strains

    Dirusso, C C; Connell, E J; Færgeman, Nils J.;

    2000-01-01

    Saccharomyces cerevisiae is an ideal model eukaryote for studying fatty-acid transport. Yeast are auxotrophic for unsaturated fatty acids when grown under hypoxic conditions or when the fatty-acid synthase inhibitor cerulenin is included in the growth media. The FAT1 gene encodes a protein, Fat1p......-acid analogue 4, 4-difluoro-5-methyl-4-bora-3a,4a-diaza-s-indacene-3-do decanoic acid (C1-BODIPY-C12), have a greatly diminished capacity to transport exogenous long-chain fatty acids, and have very long-chain acyl CoA synthetase activities that were 40% wild-type. The depression in very long-chain acyl Co......A synthetase activities were not apparent in cells grown in the presence of oleate. Additionally, beta-oxidation of exogenous long-chain fatty acids is depressed to 30% wild-type levels. The reduction of beta-oxidation was correlated with a depression of intracellular oleoyl CoA levels in the fat1Delta strain...

  20. Whole Genome Re-Sequencing Identifies a Quantitative Trait Locus Repressing Carbon Reserve Accumulation during Optimal Growth in Chlamydomonas reinhardtii

    Goold, Hugh Douglas; Nguyen, Hoa Mai; Kong, Fantao; Beyly-Adriano, Audrey; Légeret, Bertrand; Billon, Emmanuelle; Cuiné, Stéphan; Beisson, Fred; Peltier, Gilles; Li-Beisson, Yonghua

    2016-01-01

    Microalgae have emerged as a promising source for biofuel production. Massive oil and starch accumulation in microalgae is possible, but occurs mostly when biomass growth is impaired. The molecular networks underlying the negative correlation between growth and reserve formation are not known. Thus isolation of strains capable of accumulating carbon reserves during optimal growth would be highly desirable. To this end, we screened an insertional mutant library of Chlamydomonas reinhardtii for alterations in oil content. A mutant accumulating five times more oil and twice more starch than wild-type during optimal growth was isolated and named constitutive oil accumulator 1 (coa1). Growth in photobioreactors under highly controlled conditions revealed that the increase in oil and starch content in coa1 was dependent on light intensity. Genetic analysis and DNA hybridization pointed to a single insertional event responsible for the phenotype. Whole genome re-sequencing identified in coa1 a >200 kb deletion on chromosome 14 containing 41 genes. This study demonstrates that, 1), the generation of algal strains accumulating higher reserve amount without compromising biomass accumulation is feasible; 2), light is an important parameter in phenotypic analysis; and 3), a chromosomal region (Quantitative Trait Locus) acts as suppressor of carbon reserve accumulation during optimal growth. PMID:27141848

  1. Effect of prolactin on enzymes of lipid biosynthesis in mammary gland explants

    Prolactin (PRL) stimulates an increased rate of incorporation of [14C]acetate and [3H]glucose into lipids in cultured mammary gland explants from 10-to 14-day-pregnant mice. This response is biphasic with an early increase occurring from 6 through 12 h, and an additional increase from 16 to 24 h. Enzymes likely to be rate limiting to this process include acetyl CoA carboxylase, fatty acid synthetase, acetyl CoA synthetase, and/or pyruvate dehydrogenase. Of these enzymes only pyruvate dehydrogenase activity was elevated at 6 h, suggesting that this enzymatic activity is important in stimulating early increases in lipogenesis after PRL treatment. In addition, the PRL stimulation of pyruvate dehydrogenase may also indirectly stimulate acetyl CoA carboxylase through the generation of citrate; this may explain the early (6-12 h) effect of PRL on [14C]acetate incorporation. After 16 h of PRL treatment, the activities of all the lipogenic enzymes were enhanced. The second phase of PRLs stimulation of lipogenesis thus likely involves the enhanced activities of more than one of the lipogenic enzymes

  2. Structural basis for the binding of succinate to succinyl-CoA synthetase.

    Huang, Ji; Fraser, Marie E

    2016-08-01

    Succinyl-CoA synthetase catalyzes the only step in the citric acid cycle that provides substrate-level phosphorylation. Although the binding sites for the substrates CoA, phosphate, and the nucleotides ADP and ATP or GDP and GTP have been identified, the binding site for succinate has not. To determine this binding site, pig GTP-specific succinyl-CoA synthetase was crystallized in the presence of succinate, magnesium ions and CoA, and the structure of the complex was determined by X-ray crystallography to 2.2 Å resolution. Succinate binds in the carboxy-terminal domain of the β-subunit. The succinate-binding site is near both the active-site histidine residue that is phosphorylated in the reaction and the free thiol of CoA. The carboxy-terminal domain rearranges when succinate binds, burying this active site. However, succinate is not in position for transfer of the phosphoryl group from phosphohistidine. Here, it is proposed that when the active-site histidine residue has been phosphorylated by GTP, the phosphohistidine displaces phosphate and triggers the movement of the carboxylate of succinate into position to be phosphorylated. The structure shows why succinyl-CoA synthetase is specific for succinate and does not react appreciably with citrate nor with the other C4-dicarboxylic acids of the citric acid cycle, fumarate and oxaloacetate, but shows some activity with L-malate. PMID:27487822

  3. Investigation of Virulence Genes by PCR in Stapylococcus aureus Isolates Originated from Subclinical Bovine Mastitis in Turkey

    Murat Karahan, Mehmet Nuri Acik1* and Burhan Cetinkaya

    2011-06-01

    Full Text Available The aim of the present study was to characterize coagulase (coa positive Staphylococcus aureus strains (n=92 isolated from bovine subclinical mastitis in Turkey by PCR amplification of clumping factor A (clfA and protein A (spa genes. All the coa-positive S. aureus isolates were determined to harbor the genes encoding the IgG binding region (spa-IgG and the X region (spa-X of spa. On the other hand, 84 (91.3% isolates were positive for clfA gene. These three genes displayed size polymorphisms. It was concluded that spa gene polymorphisms for S. aureus, when used together with coa-PCR, can be proposed as good alternatives to conventional methods in typing S. aureus isolates of bovine origin which may provide valuable data for the development of effective control strategies against staphylococcal mastitis. The results of the present study showed that S. aureus isolates responsible for the mastitis cases in Turkey were genetically diverse.

  4. Mitochondrial trifunctional protein deficiency due to HADHB gene mutation in a Chinese family

    Xiaona Fu

    2015-12-01

    Full Text Available We report an 8-year-old girl with lower limb weakness since birth in whom mitochondrial trifunctional protein (MTP deficiency, an autosomal recessive fatty acid oxidation disorder caused by HADHA or HADHB mutations, had not been definitively diagnosed before she was referred to our hospital. Repeated blood acylcarnitine analysis revealed slightly increased long-chain 3-OH-acylcarnitine levels; electromyography (EMG suggested peripheral nerve injury; muscle biopsy confirmed a neurogenic lesion in muscle fibers, as shown by EMG. Analysis of the HADHB, which encodes long-chain 3-ketoacyl-CoA thiolase, one of the enzymes constituting mitochondrial trifunctional protein, identified homozygous missense mutation c.739C > T (p.R247C. Mitochondrial trifunctional protein deficiency is an extremely rare disorder and has not been reported in Chinese people to date. It is likely that neonatal onset, as seen in our patient, has not been reported for the neuromyopathic phenotype of mitochondrial trifunctional protein deficiency.

  5. Ethylene and 1-MCP regulate major volatile biosynthetic pathways in apple fruit.

    Yang, Xiaotang; Song, Jun; Du, Lina; Forney, Charles; Campbell-Palmer, Leslie; Fillmore, Sherry; Wismer, Paul; Zhang, Zhaoqi

    2016-03-01

    The effects of ethylene and 1-methylcyclopropene (1-MCP) on apple fruit volatile biosynthesis and gene expression were investigated. Statistical analysis identified 17 genes that changed significantly in response to ethylene and 1-MCP treatments. Genes encoding branched-chain amino acid aminotransferase (BCAT), aromatic amino acid aminotransferase (ArAT) and amino acid decarboxylases (AADC) were up-regulated during ripening and further enhanced by ethylene treatment. Genes related to fatty acid synthesis and metabolism, including acyl-carrier-proteins (ACPs), malonyl-CoA:ACP transacylase (MCAT), acyl-ACP-desaturase (ACPD), lipoxygenase (LOX), hydroperoxide lyase (HPL), alcohol dehydrogenase (ADH), pyruvate decarboxylase (PDC2), β-oxidation, acyl-CoA synthetase (ACS), enoyl-CoA hydratase (ECHD), acyl-CoA dehydrogenase (ACAD), and alcohol acyltransferases (AATs) also increased during ripening and in response to ethylene treatment. Allene oxide synthase (AOS), alcohol dehydrogenase 1 (ADH1), 3-ketoacyl-CoA thiolase and branched-chain amino acid aminotransferase 2 (BCAT2) decreased in ethylene-treated fruit. Treatment with 1-MCP and ethylene generally produced opposite effects on related genes, which provides evidence that regulation of these genes is ethylene dependent. PMID:26471562

  6. Arabidopsis PED2 positively modulates plant drought stress resistance

    Haitao Shi; Tiantian Ye; Fan Yang; Zhulong Chan

    2015-01-01

    Abscisic acid (ABA) is an important phytohormone that functions in seed germination, plant development, and multiple stress responses. Arabidopsis Peroxisome defective 2 (AtPED2) (also known as AtPEXOXIN14, AtPEX14), is involved in the intracellular transport of thiolase from the cytosol to glyoxysomes, and perosisomal matrix protein import in plants. In this study, we assigned a new role for AtPED2 in drought stress resistance. The transcript level of AtPED2 was down-regulated by ABA and abiotic stress treatments. AtPED2 knockout mutants were insensitive to ABA-mediated seed germination, primary root elongation, and stomatal response, while AtPED2 over-expressing plants were sensitive to ABA in comparison to wide type (WT). AtPED2 also positively regulated drought stress resistance, as evidenced by the changes of water loss rate, electrolyte leakage, and survival rate. Notably, AtPED2 positively modulated expression of several stress-responsive genes (RAB18, RD22, RD29A, and RD29B), positively affected underlying antioxidant enzyme activities and negatively regulated reactive oxygen species (ROS) level under drought stress conditions. Moreover, multiple carbon metabolites including amino acids, organic acids, sugars, sugar alcohols, and aromatic amines were also positively regulated by AtPED2. Taken together, these results indicated a positive role for AtPED2 in drought resistance, through modulation of stress-responsive genes expression, ROS metabolism, and metabolic homeostasis, at least partially.

  7. Alteration of Gene Expression, DNA Methylation, and Histone Methylation in Free Radical Scavenging Networks in Adult Mouse Hippocampus following Fetal Alcohol Exposure

    Chater-Diehl, Eric J.; Castellani, Christina A.; Alberry, Bonnie L.; Singh, Shiva M.

    2016-01-01

    The molecular basis of Fetal Alcohol Spectrum Disorders (FASD) is poorly understood; however, epigenetic and gene expression changes have been implicated. We have developed a mouse model of FASD characterized by learning and memory impairment and persistent gene expression changes. Epigenetic marks may maintain expression changes over a mouse’s lifetime, an area few have explored. Here, mice were injected with saline or ethanol on postnatal days four and seven. At 70 days of age gene expression microarray, methylated DNA immunoprecipitation microarray, H3K4me3 and H3K27me3 chromatin immunoprecipitation microarray were performed. Following extensive pathway analysis of the affected genes, we identified the top affected gene expression pathway as “Free radical scavenging”. We confirmed six of these changes by droplet digital PCR including the caspase Casp3 and Wnt transcription factor Tcf7l2. The top pathway for all methylation-affected genes was “Peroxisome biogenesis”; we confirmed differential DNA methylation in the Acca1 thiolase promoter. Altered methylation and gene expression in oxidative stress pathways in the adult hippocampus suggests a novel interface between epigenetic and oxidative stress mechanisms in FASD. PMID:27136348

  8. AcEST: BP917188 [AcEST

    Full Text Available RLLFTKLDESESYGCIVNAQVRN 415 >tr|B8KW59|B8KW59_9GAMM Iron-sulfur cluster binding protein, putative OS=gamma proteobacte...id... 30 6.7 sp|A1S7L7|FADI_SHEAM 3-ketoacyl-CoA thiolase OS=Shewanella amazo... 30 6.7 sp|Q92JD4|Y133_RICCN Uncharacterized prote... Hemicentin 2 OS=Mus musculus GN=Hmcn2 PE=... 34 3.8 tr|A3ZSD0|A3ZSD0_9PLAN Putative uncharacterized protein OS=Bla...A0B2Y2_BURCH Transcriptional regulator, DeoR family OS... 33 8.3 tr|A7T3H3|A7T3H3_NEMVE Predicted protein OS=Nematostella vecte...CSNAAGTSSQEQS 2283 >tr|A3ZSD0|A3ZSD0_9PLAN Putative uncharacterized protein OS=Blastopirellula marina DSM 36

  9. Constitutive androstane receptor agonist, TCPOBOP, attenuates steatohepatitis in the methionine choline-deficient diet-fed mouse

    2007-01-01

    AIM: To ascertain whether constitutive androstane receptor (CAR) activation by 1,4-bis-[2-(3,5,dichloropyridyloxy)] benzene (TCPOBOP) modulates steatohepatitis in the methionine choline-deficient (MCD) diet-fed animal. METHODS: C57/BL6 wild-type mice were fed the MCD or standard diet for 2 wk and were treated with either the CAR agonist, TCPOBOP, or the CAR inverse agonist, androstanol. RESULTS: Expression of CYP2B10 and CYP3A11, known CAR target genes, increased 30-fold and 45-fold, respectively, in TCPOBOP-treated mice fed the MCD diet. TCPOBOP treatment reduced hepatic steatosis (44.6 ± 5.4% vs 30.4 ± 4.5%, P < 0.05) and serum triglyceride levels (48 ± 8 vs 20 ± 1 mg/Dl, P < 0.05) in MCD dietfed mice as compared with the standard diet-fed mice. This reduction in hepatic steatosis was accompanied by an increase in enzymes involved in fatty acid microsomal ω-oxidation and peroxisomal β-oxidation, namely CYP4A10, LPBE, and 3-ketoacyl-CoA thiolase. The reduction in steatosis was also accompanied by a reduction in liver cell apoptosis and inflammation. In contrast, androstanol was without effect on any of the above parameters. CONCLUSION: CAR activation stimulates induction of genes involved in fatty acid oxidation, and ameliorates hepatic steatosis, apoptosis and inflammation.

  10. Effects of pectin pentaoligosaccharide from Hawthorn ( Crataegus pinnatifida Bunge. var. Major) on the activity and mRNA levels of enzymes involved in fatty acid oxidation in the liver of mice fed a high-fat diet.

    Li, Tuo-Ping; Zhu, Ru-Gang; Dong, Yin-Ping; Liu, Yong-Hui; Li, Su-Hong; Chen, Gang

    2013-08-01

    The regulatory effects of haw pectin pentaoligosaccharide (HPPS) on fatty acid oxidation-related enzyme activities and mRNA levels were investigated in the liver of high fat diet induced hyperlipidemic mice. Results showed that HPPS (150 mg/kg for 10 weeks) significantly suppresses weight gain (32.3 ± 0.26 and 21.1 ± 0.14 g for high-fat diet and HPPS groups, respectively), decreases serum triacylglycerol levels (1.64 ± 0.09 and 0.91 ± 0.02 mmol/L, respectively), and increases lipid excretion in feces (55.7 ± 0.38 and 106.4 ± 0.57 mg/g for total lipid, respectively), compared to high-fat diet as control. HPPS significantly increased the hepatic fatty acid oxidation-related enzyme activities of acyl-CoA oxidase, carnitine palmitoyltransferase I, 3-ketoacyl-CoA thiolase, and 2,4-dienoyl-CoA reductase by 53.8, 74.2, 47.1, and 24.2%, respectively. Meanwhile, the corresponding mRNAs were up-regulated by 89.6, 85.8, 82.9, and 30.9%, respectively. Moreover, HPPS was able to up-regulate the gene and protein expressions of peroxisome proliferator-activated receptor α. Results suggest that continuous HPPS ingestion may be used as dietary therapy to prevent obesity and cardiovascular diseases. PMID:23855516

  11. Effects of different replicons in conjugative plasmids on transformation efficiency, plasmid stability, gene expression and n-butanol biosynthesis in Clostridium tyrobutyricum

    Yu, Mingrui; Du, Yinming; Jiang, Wenyan; Chang, Wei-Lun; Yang, Shang-Tian [Ohio State Univ., Columbus, OH (United States). William G. Lowrie Dept. of Chemical and Biomolecular Engineering; Tang, I-Ching [Bioprocessing Innovative Company, Dublin, OH (United States)

    2012-01-15

    Clostridium tyrobutyricum ATCC 25755 can produce butyric acid, acetic acid, and hydrogen as the main products from various carbon sources. In this study, C. tyrobutyricum was used as a host to produce n-butanol by expressing adhE2 gene under the control of a native thiolase promoter using four different conjugative plasmids (pMTL82151, 83151, 84151, and 85151) each with a different replicon (pBP1 from C. botulinum NCTC2916, pCB102 from C. butyricum, pCD6 from Clostridium difficile, and pIM13 from Bacillus subtilis). The effects of different replicons on transformation efficiency, plasmid stability, adhE2 expression and aldehyde/alcohol dehydrogenase activities, and butanol production by different mutants of C. tyrobutyricum were investigated. Among the four plasmids and replicons studied, pMTL82151 with pBP1 gave the highest transformation efficiency, plasmid stability, gene expression, and butanol biosynthesis. Butanol production from various substrates, including glucose, xylose, mannose, and mannitol were then investigated with the best mutant strain harboring adhE2 in pMTL82151. A high butanol titer of 20.5 g/L with 0.33 g/g yield and 0.32 g/L h productivity was obtained with mannitol as the substrate in batch fermentation with pH controlled at {proportional_to}6.0. (orig.)

  12. Structural snapshots along the reaction pathway of Yersinia pestis RipA, a putative butyryl-CoA transferase

    Torres, Rodrigo; Lan, Benson; Latif, Yama; Chim, Nicholas [UC Irvine, 2212 Natural Sciences I, Irvine, CA 92697 (United States); Goulding, Celia W., E-mail: celia.goulding@uci.edu [UC Irvine, 2212 Natural Sciences I, Irvine, CA 92697 (United States); UC Irvine, 2302 Natural Sciences I, Irvine, CA 92697 (United States)

    2014-04-01

    The crystal structures of Y. pestis RipA mutants were determined to provide insights into the CoA transferase reaction pathway. Yersinia pestis, the causative agent of bubonic plague, is able to survive in both extracellular and intracellular environments within the human host, although its intracellular survival within macrophages is poorly understood. A novel Y. pestis three-gene rip (required for intracellular proliferation) operon, and in particular ripA, has been shown to be essential for survival and replication in interferon γ-induced macrophages. RipA was previously characterized as a putative butyryl-CoA transferase proposed to yield butyrate, a known anti-inflammatory shown to lower macrophage-produced NO levels. RipA belongs to the family I CoA transferases, which share structural homology, a conserved catalytic glutamate which forms a covalent CoA-thioester intermediate and a flexible loop adjacent to the active site known as the G(V/I)G loop. Here, functional and structural analyses of several RipA mutants are presented in an effort to dissect the CoA transferase mechanism of RipA. In particular, E61V, M31G and F60M RipA mutants show increased butyryl-CoA transferase activities when compared with wild-type RipA. Furthermore, the X-ray crystal structures of E61V, M31G and F60M RipA mutants, when compared with the wild-type RipA structure, reveal important conformational changes orchestrated by a conserved acyl-group binding-pocket phenylalanine, Phe85, and the G(V/I)G loop. Binary structures of M31G RipA and F60M RipA with two distinct CoA substrate conformations are also presented. Taken together, these data provide CoA transferase reaction snapshots of an open apo RipA, a closed glutamyl-anhydride intermediate and an open CoA-thioester intermediate. Furthermore, biochemical analyses support essential roles for both the catalytic glutamate and the flexible G(V/I)G loop along the reaction pathway, although further research is required to fully

  13. Structural snapshots along the reaction pathway of Yersinia pestis RipA, a putative butyryl-CoA transferase

    The crystal structures of Y. pestis RipA mutants were determined to provide insights into the CoA transferase reaction pathway. Yersinia pestis, the causative agent of bubonic plague, is able to survive in both extracellular and intracellular environments within the human host, although its intracellular survival within macrophages is poorly understood. A novel Y. pestis three-gene rip (required for intracellular proliferation) operon, and in particular ripA, has been shown to be essential for survival and replication in interferon γ-induced macrophages. RipA was previously characterized as a putative butyryl-CoA transferase proposed to yield butyrate, a known anti-inflammatory shown to lower macrophage-produced NO levels. RipA belongs to the family I CoA transferases, which share structural homology, a conserved catalytic glutamate which forms a covalent CoA-thioester intermediate and a flexible loop adjacent to the active site known as the G(V/I)G loop. Here, functional and structural analyses of several RipA mutants are presented in an effort to dissect the CoA transferase mechanism of RipA. In particular, E61V, M31G and F60M RipA mutants show increased butyryl-CoA transferase activities when compared with wild-type RipA. Furthermore, the X-ray crystal structures of E61V, M31G and F60M RipA mutants, when compared with the wild-type RipA structure, reveal important conformational changes orchestrated by a conserved acyl-group binding-pocket phenylalanine, Phe85, and the G(V/I)G loop. Binary structures of M31G RipA and F60M RipA with two distinct CoA substrate conformations are also presented. Taken together, these data provide CoA transferase reaction snapshots of an open apo RipA, a closed glutamyl-anhydride intermediate and an open CoA-thioester intermediate. Furthermore, biochemical analyses support essential roles for both the catalytic glutamate and the flexible G(V/I)G loop along the reaction pathway, although further research is required to fully

  14. Percutaneous Balloon Angioplasty for Severe Native Aortic Coarctation in Young Infants Less Than 6 Months: Medium- to Long-term Follow-up

    He, Lan; Liu, Fang; Wu, Lin; Qi, Chun-Hua; Zhang, Li-Feng; Huang, Guo-Ying

    2015-01-01

    Background: Although balloon angioplasty (BA) has been performed for more than 20 years, its use as a treatment for native coarctation of the aorta (CoA) during childhood, especially in young infants, remains controversial. This study aimed to assess the effects and potential role of percutaneous transcatheter BA for native CoA as an alternative therapy to surgical repair in young infants. Methods: The 37 patients aged from 6 days to 6 months with severe CoA in congestive heart failure or circulatory shock were admitted for BA. Patient's weight ranged from 2.4 to 6.1 kg. All 37 patients were experiencing cardiac dysfunction, and eight patients were in cardiac shock with severe metabolic acidosis. Eleven patients had an isolated CoA, whereas the others had a CoA associated with other cardiac malformations. Cardiac catheterization and aortic angiography were performed under general anesthesia with intubation. Transfemoral arterial approaches were used for the BA. The size of the balloon ranged from 3 mm × 20 mm to 8 mm × 20 mm, and a coronary artery balloon catheter was preferred over a regular peripheral vascular balloon catheter. Results: The femoral artery was successfully punctured in all but one patient, with that patient undergoing a carotid artery puncture. The systolic peak pressure gradient (PG) across the coarctation was 41.0 ± 16.0 mmHg (range 13–76 mmHg). The mean diameter of the narrowest coarctation site was 1.7 ± 0.6 mm (range 0.5–2.8 mm). All patients had successful dilation; the PG significantly decreased to 13.0 ± 11.0 mmHg (range 0–40 mmHg), and the diameter of coarctation significantly improved to 3.8 ± 0.9 mm (range 2.5–5.3 mm). No intraoperative complications occurred for any patients. However, in one case that underwent a carotid artery puncture, a giant aneurysm formed at the puncture site and required surgical repair. The following observations were made during the follow-up period from 6-month to 7-year: (1) The PG across the

  15. Construction of a transcription map around the gene for ataxia telangiectasia: Identification of at least four novel genes

    Stankovic, T.; Byrd, P.J.; Cooper, P.R. [Univ. of Birmingham (United Kingdom)] [and others

    1997-03-01

    We have constructed YAC, PAC, and cosmid contigs in the ataxia-telangiectasia gene region and used the assembled clones to isolate expressed sequences by exon trapping and hybridization selection. In the interval between D11S1819 and D11S2029, exons and cDNAs for potentially 13 different genes were identified. Three of these genes, F37, K28, and 6.82, are large novel genes expressed in a variety of different tissues. K28 shows sequence homology to the Rab GTP binding protein family and gene 6.82 homology to the rabbit vasopressin activated calcium mobilizing receptor, while gene F37 has no homology to any known sequence in the database. Three further clones, exon 6.41 and cDNAs K22 and E74, from the interval between D11S1819 and D11S2029, appear to be expressed endogenous retrovirus sequences. The fourth large novel gene, E14, together with two further possible novel genes, E13 and E3, was identified from exons and cDNAs in the more telomeric 300-kb interval between markers D11S2029 and D11S2179. These are in addition to the genes for mitochondrial acetoacetyl-CoA-acetyltransferase (ACAT) and the ATM gene in the same region. Genes E3, E13, and E14 do not show homology to any known genes. K28, 6.82, ACAT, and ATM all appear to have the same transcriptional orientation toward the telomere. 39 refs., 3 figs., 1 tab.

  16. The metabolic network of Clostridium acetobutylicum: Comparison of the approximate Bayesian computation via sequential Monte Carlo (ABC-SMC) and profile likelihood estimation (PLE) methods for determinability analysis.

    Thorn, Graeme J; King, John R

    2016-01-01

    The Gram-positive bacterium Clostridium acetobutylicum is an anaerobic endospore-forming species which produces acetone, butanol and ethanol via the acetone-butanol (AB) fermentation process, leading to biofuels including butanol. In previous work we looked to estimate the parameters in an ordinary differential equation model of the glucose metabolism network using data from pH-controlled continuous culture experiments. Here we combine two approaches, namely the approximate Bayesian computation via an existing sequential Monte Carlo (ABC-SMC) method (to compute credible intervals for the parameters), and the profile likelihood estimation (PLE) (to improve the calculation of confidence intervals for the same parameters), the parameters in both cases being derived from experimental data from forward shift experiments. We also apply the ABC-SMC method to investigate which of the models introduced previously (one non-sporulation and four sporulation models) have the greatest strength of evidence. We find that the joint approximate posterior distribution of the parameters determines the same parameters as previously, including all of the basal and increased enzyme production rates and enzyme reaction activity parameters, as well as the Michaelis-Menten kinetic parameters for glucose ingestion, while other parameters are not as well-determined, particularly those connected with the internal metabolites acetyl-CoA, acetoacetyl-CoA and butyryl-CoA. We also find that the approximate posterior is strongly non-Gaussian, indicating that our previous assumption of elliptical contours of the distribution is not valid, which has the effect of reducing the numbers of pairs of parameters that are (linearly) correlated with each other. Calculations of confidence intervals using the PLE method back this up. Finally, we find that all five of our models are equally likely, given the data available at present. PMID:26561777

  17. Identification and quantification of organic aerosol from cooking and other sources in Barcelona using aerosol mass spectrometer data

    C. Mohr

    2012-02-01

    Full Text Available PM1 (particulate matter with an aerodynamic diameter <1 μm non-refractory components and black carbon were measured continuously together with additional air quality and atmospheric parameters at an urban background site in Barcelona, Spain, during March 2009 (campaign DAURE, Determination of the sources of atmospheric Aerosols in Urban and Rural Environments in the western Mediterranean. Positive matrix factorization (PMF was conducted on the organic aerosol (OA data matrix measured by an aerosol mass spectrometer, on both unit mass (UMR and high resolution (HR data. Five factors or sources could be identified: LV-OOA (low-volatility oxygenated OA, related to regional, aged secondary OA; SV-OOA (semi-volatile oxygenated OA, a fresher oxygenated OA; HOA (hydrocarbon-like OA, related to traffic emissions; BBOA (biomass burning OA from domestic heating or agricultural biomass burning activities; and COA (cooking OA. LV-OOA contributed 28% to OA, SV-OOA 27%, COA 17%, HOA 16%, and BBOA 11%. The COA HR spectrum contained substantial signal from oxygenated ions (O:C: 0.21 whereas the HR HOA spectrum had almost exclusively contributions from chemically reduced ions (O:C: 0.03. If we assume that the carbon in HOA is fossil while that in COA and BBOA is modern, primary OA in Barcelona contains a surprisingly high fraction (59% of non-fossil carbon.

    This paper presents a method for estimating cooking organic aerosol in ambient datasets based on the fractions of organic mass fragments at m/z 55 and 57: their data points fall into a V-shape in a scatter plot, with strongly influenced HOA data aligned to the right arm and strongly influenced COA data points aligned to the left arm. HR data show that this differentiation is mainly driven by the oxygen-containing ions C3H3O+ and C3H5O+, even though their contributions to m/z 55 and 57 are low compared to the

  18. Percutaneous Balloon Angioplasty for Severe Native Aortic Coarctation in Young Infants Less Than 6 Months: Medium-to Long-term Follow-up

    Lan He; Fang Liu; Lin Wu; Chun-Hua Qi; Li-Feng Zhang; Guo-Ying Huang

    2015-01-01

    Background:Although balloon angioplasty (BA) has been performed for more than 20 years,its use as a treatment for native coarctation of the aorta (CoA) during childhood,especially in young infants,remains controversial.This study aimed to assess the effects and potential role of percutaneous transcatheter BA for native CoA as an alternative therapy to surgical repair in young infants.Methods:The 37 patients aged from 6 days to 6 months with severe CoA in congestive heart failure or circulatory shock were admitted for BA.Patient's weight ranged from 2.4 to 6.1 kg.All 37 patients were experiencing cardiac dysfunction,and eight patients were in cardiac shock with severe metabolic acidosis.Eleven patients had an isolated CoA,whereas the others had a CoA associated with other cardiac malformations.Cardiac catheterization and aortic angiography were performed under general anesthesia with intubation.Transfemoral arterial approaches were used for the BA.The size of the balloon ranged from 3 mm × 20 mm to 8 mm × 20 mm,and a coronary artery balloon catheter was preferred over a regular peripheral vascular balloon catheter.Results:The femoral artery was successfully punctured in all but one patient,with that patient undergoing a carotid artery puncture.The systolic peak pressure gradient (PG) across the coarctation was 41.0 ± 16.0 mmHg (range 13-76 mmHg).The mean diameter of the narrowest coarctation site was 1.7 ± 0.6 mm (range 0.5-2.8 mm).All patients had successful dilation;the PG significantly decreased to 13.0 ± 1 1.0 mmHg (range 0-40 mmHg),and the diameter of coarctation significantly improved to 3.8 ± 0.9 mm (range 2.5-5.3 mm).No intraoperative complications occurred for any patients.However,in one case that underwent a carotid artery puncture,a giant aneurysm formed at the puncture site and required surgical repair.The following observations were made during the follow-up period from 6-month to 7-year:(1) The PG across the coarctation measured by

  19. Uptake of benzoate by Rhodopseudomonas palustris grown anaerobically in light

    The uptake and anaerobic metabolism of benzoate were studied in short-term experiments with phototrophic cells of Rhodopseudomonas palustris. Cells that were preincubated and assayed anaerobically in the presence of 1 mM dithiothreitol accumulated (7-14C)benzoate at a rate of at least 0.5 nmol x min-1 x mg-1 of protein. Cells that were preincubated aerobically, or anaerobically in the absence of a reducing agent or an electron donor such as succinate, took up benzoate at reduced rates. Benzoate was removed from the external medium with remarkably high efficiency; initial uptake rates were independent of substrate concentration, and uptake remained linear down to concentrations of less than 1 μM. Uptake rates were not sensitive to external pH in the range of 6.5 to 8.1, and very little free benzoate was found associated with the cells. By contrast, benzoyl coenzyme A (CoA) was formed rapidly in cells exposed to labeled benzoate. Its appearance in such cells, together with the more gradual accumulation of other compounds tentatively identified as reduction products, is consistent with the identification of benzoyl CoA as an intermediate in the anaerobic reductive metabolism of benzoate. The very effective uptake of external benzoate can be explained by its conversion to benzoyl CoA immediately after its passage across the cell membrane by simple or facilitated diffusion. Such a chemical conversion would serve to maintain a downhill concentration gradient between the cell cytoplasm and the cell surroundings, even at very low external benzoate concentrations

  20. Integrated electroosmotic perfusion of tissue with online microfluidic analysis to track the metabolism of cystamine, pantethine, and coenzyme A.

    Wu, Juanfang; Sandberg, Mats; Weber, Stephen G

    2013-12-17

    We have developed an approach that integrates electroosmotic perfusion of tissue with a substrate-containing solution and online microfluidic analysis of products, in this case thiols. Using this approach we have tracked the metabolism of cystamine, pantethine and CoA in the extracellular space of organotypic hippocampal slice cultures (OHSCs). Currently, little is known about coenzyme A (CoA) biodegradation and even less is known about the regulation and kinetic characteristics for this sequential multienzyme reaction. We found that the steady state percentage yields of cysteamine from cystamine and pantethine during the transit through OHSCs were 91% ± 4% (SEM) and 0.01%-0.03%, respectively. The large difference in the yields of cysteamine can be used to explain the drugs' different toxicities and clinical effectiveness against cystinosis. The kinetic parameters of the enzyme reaction catalyzed by the ectoenzyme pantetheinase are KM,C/α = 4.4 ± 1.1 mM and Vmax,C = 29 ± 3 nM/s, where α is the percentage yield of pantethine to pantetheine through disulfide exchange. We estimate that the percentage yield of pantethine to pantetheine through disulfide exchange is approximately 0.5%. Based on the formation rate of cysteamine in the OHSCs, we obtained the overall apparent Michaelis constant and maximum reaction rate for sequential, extracellular CoA degradation in an in situ environment, which are K'M = 16 ± 4 μM, V'max = 7.1 ± 0.5 nM/s. Kinetic parameters obtained in situ, although difficult to measure, are better representations of the biochemical flux in the living organism than those from isolated enzymes in vitro. PMID:24215585

  1. Reaction mechanism of WGS and PROX reactions catalyzed by Pt/oxide catalysts revealed by an FeO(111)/Pt(111) inverse model catalyst.

    Xu, Lingshun; Wu, Zongfang; Jin, Yuekang; Ma, Yunsheng; Huang, Weixin

    2013-08-01

    We have employed XPS and TDS to study the adsorption and surface reactions of H2O, CO and HCOOH on an FeO(111)/Pt(111) inverse model catalyst. The FeO(111)-Pt(111) interface of the FeO(111)/Pt(111) inverse model catalyst exposes coordination-unsaturated Fe(II) cations (Fe(II)CUS) and the Fe(II)CUS cations are capable of modifying the reactivity of neighbouring Pt sites. Water facilely dissociates on the Fe(II)CUS cations at the FeO(111)-Pt(111) interface to form hydroxyls that react to form both water and H2 upon heating. Hydroxyls on the Fe(II)CUS cations can react with CO(a) on the neighbouring Pt(111) sites to produce CO2 at low temperatures. Hydroxyls act as the co-catalyst in the CO oxidation by hydroxyls to CO2 (PROX reaction), while they act as one of the reactants in the CO oxidation by hydroxyls to CO2 and H2 (WGS reaction), and the recombinative reaction of hydroxyls to produce H2 is the rate-limiting step in the WGS reaction. A comparison of reaction behaviors between the interfacial CO(a) + OH reaction and the formate decomposition reaction suggest that formate is the likely surface intermediate of the CO(a) + OH reaction. These results provide some solid experimental evidence for the associative reaction mechanism of WGS and PROX reactions catalyzed by Pt/oxide catalysts. PMID:23576093

  2. Carbon monoxide induced erythroid differentiation of K562 cells mimics the central macrophage milieu in erythroblastic islands.

    Shlomi Toobiak

    Full Text Available Growing evidence supports the role of erythroblastic islands (EI as microenvironmental niches within bone marrow (BM, where cell-cell attachments are suggested as crucial for erythroid maturation. The inducible form of the enzyme heme oxygenase, HO-1, which conducts heme degradation, is absent in erythroblasts where hemoglobin (Hb is synthesized. Yet, the central macrophage, which retains high HO-1 activity, might be suitable to take over degradation of extra, harmful, Hb heme. Of these enzymatic products, only the hydrophobic gas molecule--CO can transfer from the macrophage to surrounding erythroblasts directly via their tightly attached membranes in the terminal differentiation stage.Based on the above, the study hypothesized CO to have a role in erythroid maturation. Thus, the effect of CO gas as a potential erythroid differentiation inducer on the common model for erythroid progenitors, K562 cells, was explored. Cells were kept under oxygen lacking environment to mimic BM conditions. Nitrogen anaerobic atmosphere (N₂A served as control for CO atmosphere (COA. Under both atmospheres cells proliferation ceased: in N₂A due to cell death, while in COA as a result of erythroid differentiation. Maturation was evaluated by increased glycophorin A expression and Hb concentration. Addition of 1%CO only to N₂A, was adequate for maintaining cell viability. Yet, the average Hb concentration was low as compared to COA. This was validated to be the outcome of diversified maturation stages of the progenitor's population.In fact, the above scenario mimics the in vivo EI conditions, where at any given moment only a minute portion of the progenitors proceeds into terminal differentiation. Hence, this model might provide a basis for further molecular investigations of the EI structure/function relationship.

  3. Combining human and machine processes (CHAMP)

    Sudit, Moises; Sudit, David; Hirsch, Michael

    2015-05-01

    Machine Reasoning and Intelligence is usually done in a vacuum, without consultation of the ultimate decision-maker. The late consideration of the human cognitive process causes some major problems in the use of automated systems to provide reliable and actionable information that users can trust and depend to make the best Course-of-Action (COA). On the other hand, if automated systems are created exclusively based on human cognition, then there is a danger of developing systems that don't push the barrier of technology and are mainly done for the comfort level of selected subject matter experts (SMEs). Our approach to combining human and machine processes (CHAMP) is based on the notion of developing optimal strategies for where, when, how, and which human intelligence should be injected within a machine reasoning and intelligence process. This combination is based on the criteria of improving the quality of the output of the automated process while maintaining the required computational efficiency for a COA to be actuated in timely fashion. This research addresses the following problem areas: • Providing consistency within a mission: Injection of human reasoning and intelligence within the reliability and temporal needs of a mission to attain situational awareness, impact assessment, and COA development. • Supporting the incorporation of data that is uncertain, incomplete, imprecise and contradictory (UIIC): Development of mathematical models to suggest the insertion of a cognitive process within a machine reasoning and intelligent system so as to minimize UIIC concerns. • Developing systems that include humans in the loop whose performance can be analyzed and understood to provide feedback to the sensors.

  4. Catalytic Mechanism of Perosamine N-Acetyltransferase Revealed by High-Resolution X-ray Crystallographic Studies and Kinetic Analyses

    Thoden, James B.; Reinhardt, Laurie A.; Cook, Paul D.; Menden, Patrick; Cleland, W.W.; Holden, Hazel M. (UW); (Mount Union); (UW-MED)

    2012-09-17

    N-Acetylperosamine is an unusual dideoxysugar found in the O-antigens of some Gram-negative bacteria, including the pathogenic Escherichia coli strain O157:H7. The last step in its biosynthesis is catalyzed by PerB, an N-acetyltransferase belonging to the left-handed {beta}-helix superfamily of proteins. Here we describe a combined structural and functional investigation of PerB from Caulobacter crescentus. For this study, three structures were determined to 1.0 {angstrom} resolution or better: the enzyme in complex with CoA and GDP-perosamine, the protein with bound CoA and GDP-N-acetylperosamine, and the enzyme containing a tetrahedral transition state mimic bound in the active site. Each subunit of the trimeric enzyme folds into two distinct regions. The N-terminal domain is globular and dominated by a six-stranded mainly parallel {beta}-sheet. It provides most of the interactions between the protein and GDP-perosamine. The C-terminal domain consists of a left-handed {beta}-helix, which has nearly seven turns. This region provides the scaffold for CoA binding. On the basis of these high-resolution structures, site-directed mutant proteins were constructed to test the roles of His 141 and Asp 142 in the catalytic mechanism. Kinetic data and pH-rate profiles are indicative of His 141 serving as a general base. In addition, the backbone amide group of Gly 159 provides an oxyanion hole for stabilization of the tetrahedral transition state. The pH-rate profiles are also consistent with the GDP-linked amino sugar substrate entering the active site in its unprotonated form. Finally, for this investigation, we show that PerB can accept GDP-3-deoxyperosamine as an alternative substrate, thus representing the production of a novel trideoxysugar.

  5. Radiation doses in interventional radiology procedures

    Objective: To investigate the radiation doses for the patients undergoing interventional radiology and to analyze the dose - influencing factors. Methods: The clinical data of 461 patients undergoing interventional radiology, including cerebral angiography (CEA), cerebral aneurysm embolism (CAE), superselective hepatic arterial chemoembolization (SHAG), coronary angiography (COA), percutaneous intracoronary stent implantation (PISI), cardiac radiofrequency catheter ablation (RFCA), and permanent cardiac pacemaker implantation (PCPI) were collected to observe the cumulative air kerma (CAK), dose area product (DAP), and fluoroscopy time, and effective dose was estimated using the conversion factors. Results: The effective doses for CEA, CAE, SHAG, COA, PISI, RFCA, and PCPI were (0.33 ±0.20), (0.49 ±0.35), (6.92 ±4.19),(0.76 ±0.91), (2.35 ± 1.47), (0.50 ±0.74), and (0.67 ±0.70) Sv,respectively. In 126 of the 416 patients (26%), the effective doses were greater than 1 Sv, and the effective doses of 10 person-times were greater than 10 Sv, all of which were observed in the patients undergoing SHAG. The CAK values for CEA, CAE, SHAG, COA, PISI, RFCA, and PCPI were (0.55 ±0.43), (1.34 ± 1.11), (0.95 ±0.57), (0.32 ±0.31), (0.91 ±0.33), (0.16 ±0.22), and (0.15 ±0.14) Gy, respectively. The CAK values were greater than 1 Gy in 59 of the 461 patients (12.8%), greater than 2 Gy in 11 cases (2.4%), and greater than 3 Gy in 1 CEA cases and 1 CEA case, respectively. Conclusions: There is a wide variation range in radiation dose for different procedures. As most interventional radiology procedure can result in clinically significant radiation dose to the patient, stricter dose control should be carried out. (authors)

  6. Autotrophic growth: methylated carbon monoxide dehydrogenase as an intermediate of acetyl-CoA synthesis

    A new pathway of autotrophic growth has been discovered in certain anaerobic bacteria in which acetyl-CoA is the product formed from CO2 for initiation of anabolism rather than 3-phosphoglycerate as in the Calvin Cycle. CO2 is reduced in combination with tetrahydrofolate to methyltetrahydrofolate (CH3THF) and is the source of the CH3 group. CO2 or CO is the source of the carbonyl group. CO dehydrogenase (CODH), corrinoid enzyme, methyltransferase, ferredoxin and CODH disulfide reductase have been isolated from Clostridium thermoaceticum and shown to catalyze the synthesis of acetyl-CoA from CH3THF, CO and CoA. The methyltransferase catalyzes transfer of the CH3 group from CH3THF to the corrinoid enzyme from which the methyl is transferred to CODH. CO is bound to the Ni of CODH forming a Ni-Fe-C center. When CO2 is the source of carbon, H2 and hydrogenase are required for reduction of the CO2 by CODH. CODH disulfide reductase is required for the addition of CoA to the CODH (Pezacka, E. and Wood, H.G. J. Biol. Chem., in press). Then, CODH catalyzes the combination of the three groups forming acetyl-CoA. The authors have now succeeded in methylating CODH using 14CH3I or 14CH3-B12. With the resulting 14CH3-CODH, only CODH disulfide reductase is required for synthesis of [14C]acetyl-CoA from CO and CoA. The amino acid sequence at the CH3-site is being investigated

  7. Prevalence of enterotoxin-encoding genes and antimicrobial resistance in coagulase-negative and coagulase-positive Staphylococcus isolates from black pudding

    Tiane Martin de Moura

    2012-10-01

    Full Text Available INTRODUCTION: Staphylococcal species are pathogens that are responsible for outbreaks of foodborne diseases. The aim of this study was to investigate the prevalence of enterotoxin-genes and the antimicrobial resistance profile in staphylococcus coagulase-negative (CoNS and coagulasepositive (CoPS isolates from black pudding in southern Brazil. METHODS: Two hundred typical and atypical colonies from Baird-Parker agar were inoculated on mannitol salt agar. Eighty-two mannitol-positive staphylococci were submitted to conventional biochemical tests and antimicrobial susceptibility profiling. The presence of coagulase (coa and enterotoxin (se genes was investigated by polymerase chain reaction. RESULTS: The isolates were divided into 2 groups: 75.6% (62/82 were CoNS and 24.4% (20/82 were CoPS. The biochemical tests identified 9 species, of which Staphylococcus saprophyticus (37.8% and Staphylococcus carnosus (15.9% were the most prevalent. Antimicrobial susceptibility tests showed resistance phenotypes to antibiotics widely administered in humans, such as gentamicin, tetracycline, chloramphenicol, and erythromycin. The coa gene was detected in 19.5% (16/82 of the strains and 4 polymorphic DNA fragments were observed. Five CoNS isolates carrying the coa gene were submitted for 16S rRNA sequencing and 3 showed similarity with CoNS. Forty strains were positive for at least 1 enterotoxin-encoding gene, the genes most frequently detected were sea (28.6% and seb (27.5%. CONCLUSIONS: The presence of antimicrobial resistant and enterotoxin-encoding genes in staphylococci isolates from black pudding indicated that this fermented food may represent a potential health risk, since staphylococci present in food could cause foodborne diseases or be a possible route for the transfer of antimicrobial resistance to humans.

  8. Association of HADHA expression with the risk of breast cancer: targeted subset analysis and meta-analysis of microarray data

    Mamtani Manju

    2012-01-01

    Full Text Available Abstract Background The role of n-3 fatty acids in prevention of breast cancer is well recognized, but the underlying molecular mechanisms are still unclear. In view of the growing need for early detection of breast cancer, Graham et al. (2010 studied the microarray gene expression in histologically normal epithelium of subjects with or without breast cancer. We conducted a secondary analysis of this dataset with a focus on the genes (n = 47 involved in fat and lipid metabolism. We used stepwise multivariate logistic regression analyses, volcano plots and false discovery rates for association analyses. We also conducted meta-analyses of other microarray studies using random effects models for three outcomes--risk of breast cancer (380 breast cancer patients and 240 normal subjects, risk of metastasis (430 metastatic compared to 1104 non-metastatic breast cancers and risk of recurrence (484 recurring versus 890 non-recurring breast cancers. Results The HADHA gene [hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein, alpha subunit] was significantly under-expressed in breast cancer; more so in those with estrogen receptor-negative status. Our meta-analysis showed an 18.4%-26% reduction in HADHA expression in breast cancer. Also, there was an inconclusive but consistent under-expression of HADHA in subjects with metastatic and recurring breast cancers. Conclusions Involvement of mitochondria and the mitochondrial trifunctional protein (encoded by HADHA gene in breast carcinogenesis is known. Our results lend additional support to the possibility of this involvement. Further, our results suggest that targeted subset analysis of large genome-based datasets can provide interesting association signals.

  9. Regulation of wheat seed dormancy by after-ripening is mediated by specific transcriptional switches that induce changes in seed hormone metabolism and signaling.

    Aihua Liu

    Full Text Available Treatments that promote dormancy release are often correlated with changes in seed hormone content and/or sensitivity. To understand the molecular mechanisms underlying the role of after-ripening (seed dry storage in triggering hormone related changes and dormancy decay in wheat (Triticum aestivum, temporal expression patterns of genes related to abscisic acid (ABA, gibberellin (GA, jasmonate and indole acetic acid (IAA metabolism and signaling, and levels of the respective hormones were examined in dormant and after-ripened seeds in both dry and imbibed states. After-ripening mediated developmental switch from dormancy to germination appears to be associated with declines in seed sensitivity to ABA and IAA, which are mediated by transcriptional repressions of PROTEIN PHOSPHATASE 2C, SNF1-RELATED PROTEIN KINASE2, ABA INSENSITIVE5 and LIPID PHOSPHATE PHOSPHTASE2, and AUXIN RESPONSE FACTOR and RELATED TO UBIQUITIN1 genes. Transcriptomic analysis of wheat seed responsiveness to ABA suggests that ABA inhibits the germination of wheat seeds partly by repressing the transcription of genes related to chromatin assembly and cell wall modification, and activating that of GA catabolic genes. After-ripening induced seed dormancy decay in wheat is also associated with the modulation of seed IAA and jasmonate contents. Transcriptional control of members of the ALLENE OXIDE SYNTHASE, 3-KETOACYL COENZYME A THIOLASE, LIPOXYGENASE and 12-OXOPHYTODIENOATE REDUCTASE gene families appears to regulate seed jasmonate levels. Changes in the expression of GA biosynthesis genes, GA 20-OXIDASE and GA 3-OXIDASE, in response to after-ripening implicate this hormone in enhancing dormancy release and germination. These findings have important implications in the dissection of molecular mechanisms underlying regulation of seed dormancy in cereals.

  10. Regulation of wheat seed dormancy by after-ripening is mediated by specific transcriptional switches that induce changes in seed hormone metabolism and signaling.

    Liu, Aihua; Gao, Feng; Kanno, Yuri; Jordan, Mark C; Kamiya, Yuji; Seo, Mitsunori; Ayele, Belay T

    2013-01-01

    Treatments that promote dormancy release are often correlated with changes in seed hormone content and/or sensitivity. To understand the molecular mechanisms underlying the role of after-ripening (seed dry storage) in triggering hormone related changes and dormancy decay in wheat (Triticum aestivum), temporal expression patterns of genes related to abscisic acid (ABA), gibberellin (GA), jasmonate and indole acetic acid (IAA) metabolism and signaling, and levels of the respective hormones were examined in dormant and after-ripened seeds in both dry and imbibed states. After-ripening mediated developmental switch from dormancy to germination appears to be associated with declines in seed sensitivity to ABA and IAA, which are mediated by transcriptional repressions of PROTEIN PHOSPHATASE 2C, SNF1-RELATED PROTEIN KINASE2, ABA INSENSITIVE5 and LIPID PHOSPHATE PHOSPHTASE2, and AUXIN RESPONSE FACTOR and RELATED TO UBIQUITIN1 genes. Transcriptomic analysis of wheat seed responsiveness to ABA suggests that ABA inhibits the germination of wheat seeds partly by repressing the transcription of genes related to chromatin assembly and cell wall modification, and activating that of GA catabolic genes. After-ripening induced seed dormancy decay in wheat is also associated with the modulation of seed IAA and jasmonate contents. Transcriptional control of members of the ALLENE OXIDE SYNTHASE, 3-KETOACYL COENZYME A THIOLASE, LIPOXYGENASE and 12-OXOPHYTODIENOATE REDUCTASE gene families appears to regulate seed jasmonate levels. Changes in the expression of GA biosynthesis genes, GA 20-OXIDASE and GA 3-OXIDASE, in response to after-ripening implicate this hormone in enhancing dormancy release and germination. These findings have important implications in the dissection of molecular mechanisms underlying regulation of seed dormancy in cereals. PMID:23437172

  11. Microgram-order ammonium perfluorooctanoate may activate mouse peroxisome proliferator-activated receptor α, but not human PPARα

    Perfluorooctanoic acid (PFOA) is a ligand for peroxisome proliferator-activated receptor (PPAR) α, which exhibits marked species differences in expression and function, especially between rodents and humans. We investigated the functional difference in PFOA response between mice and humans, using a humanized PPARα transgenic mouse line. Three genotyped mice, 129/Sv wild-type (mPPARα), Pparα-null mice and humanized PPARα (hPPARα) mice (8-week-old males) were divided into three groups: the first was treated with water daily for 2 weeks by gavage (control group), and the remaining two groups were treated with 0.1 and 0.3 mg/kg ammonium perflurooctanate (APFO), respectively, for 2 weeks by gavage. The APFO dosages used did not influence the plasma triglyceride or total cholesterol levels in any mouse line, but the high dose increased both hepatic lipid levels only in mPPARα mice. APFO increased mRNA and/or protein levels of PPARα target genes cytochrome P450 Cyp4a10, peroxisomal thiolase and bifunctional protein only in the liver of mPPARα mice, but not in Pparα-null or hPPARα mice. This chemical also increased expression of mitochondrial very long chain acyl-CoA dehydrogenase only in the liver of mPPARα mice. Taken together, human PPARα may be less responsive to PFOA than that of mice when a relatively low dose is applied. This information may be very valuable in considering whether PFOA influences the lipid metabolism in humans.

  12. Expression of acyl-CoA synthetase 5 reflects the state of villus architecture in human small intestine

    Gassler, Nikolaus; Kopitz, Jürgen; Tehrani, Arman;

    2004-01-01

    -CoA synthetase 5 pattern correlate with conversion of intestinal epithelial cells to a gastric phenotype. These results suggest that deranged acyl-CoA synthetase 5 expression, synthesis, and activity are closely related to the state of villus architecture and epithelial homeostasis in human small intestine.......Several disorders of the small intestine are associated with disturbances in villus architecture. Thus, an understanding of the molecular mechanisms associated with the differentiation of villi represents an important step in the improvement of the understanding of small intestinal pathology...

  13. Model for Cameron band emission in comets: A case for EPOXI mission target comet 103P/Hartley 2

    Bhardwaj, Anil; Raghuram, Susarla

    2010-01-01

    The CO2 production rate has been derived in comets using the Cameron band (a3Pi - X1Sigma) emission of CO molecule assuming that photodissociative excitation of CO2 is the main production mechanism of CO in a3Pi metastable state. We have devoloped a model for the production and loss of CO(a3Pi) which has been applied to comet 103P/Hartley 2: the target of EPOXI mission. Our model calculations show that photoelectron impact excitation of CO and dissociative excitation of CO2 can together contr...

  14. Coenzyme A-acylating aldehyde dehydrogenase from Clostridium beijerinckii NRRL B592.

    Yan, R T; Chen, J S

    1990-01-01

    Acetaldehyde and butyraldehyde are substrates for alcohol dehydrogenase in the production of ethanol and 1-butanol by solvent-producing clostridia. A coenzyme A (CoA)-acylating aldehyde dehydrogenase (ALDH), which also converts acyl-CoA to aldehyde and CoA, has been purified under anaerobic conditions from Clostridium beijerinckii NRRL B592. The ALDH showed a native molecular weight (Mr) of 100,000 and a subunit Mr of 55,000, suggesting that ALDH is dimeric. Purified ALDH contained no alcohol...

  15. Utilisation de l'Extrait Enzymatique des Fleurs du Cynara cardunculus pour la Fabrication du Fromage

    BENSAID, ilhem

    2015-01-01

    La préparation du fromage traditionnelle connue sous le nom de « Djeben », par coagulation du lait à l'aide d'extraits des fleurs du cardon constitue une technologie originale spécifique de certaines régions Algériennes. Notre étude s'inscrit dans le cadre de la préservation du patrimoine culinaire du pays afin de combler le manque de données scientifiques sur cette coagulation. En effet, les tests préliminaires effectués sur la fleur de la plante, indiquent une activité coa...

  16. PET-based delineation of tumour volumes in lung cancer: comparison with pathological findings

    The objective of the study was to validate an adaptive, contrast-oriented thresholding algorithm (COA) for tumour delineation in 18F-fluorodeoxyglucose (FDG) positron emission tomography (PET) for non-small cell lung cancer (NSCLC) in comparison with pathological findings. The impact of tumour localization, tumour size and uptake heterogeneity on PET delineation results was also investigated. PET tumour delineation by COA was compared with both CT delineation and pathological findings in 15 patients to investigate its validity. Correlations between anatomical volume, metabolic volume and the pathology reference as well as between the corresponding maximal diameters were determined. Differences between PET delineations and pathological results were investigated with respect to tumour localization and uptake heterogeneity. The delineated volumes and maximal diameters measured on PET and CT images significantly correlated with the pathology reference (both r > 0.95, p < 0.0001). Both PET and CT contours resulted in overestimation of the pathological volume (PET 32.5 ± 26.5 %, CT 46.6 ± 27.4 %). CT volumes were larger than those delineated on PET images (CT 60.6 ± 86.3 ml, PET 48.3 ± 61.7 ml). Maximal tumour diameters were similar for PET and CT (51.4 ± 19.8 mm for CT versus 53.4 ± 19.1 mm for PET), slightly overestimating the pathological reference (mean difference CT 4.3 ± 3.2 mm, PET 6.2 ± 5.1 mm). PET volumes of lung tumours located in the lower lobe were significantly different from those determined from pathology (p = 0.037), whereas no significant differences were observed for tumours located in the upper lobe (p = 0.066). Only minor correlation was found between pathological tumour size and PET heterogeneity (r = -0.24). PET tumour delineation by COA showed a good correlation with pathological findings. Tumour localization had an influence on PET delineation results. The impact of tracer uptake heterogeneity on PET delineation should be considered

  17. Congenital aortic arch anomalies: diagnosis using contrast enhanced magnetic resonance angiography

    ZHU Ming; ZHONG Yu-min; LI Yu-hua; SUN Ai-min; JIN Biao

    2005-01-01

    @@ Congenital aortic arch anomalies occur most commonly in children. The disease can be classified into three types: ① obstructive congenital abnormalities, including coarctation of aorta (CoA) and interruption of aortic arch (IAA); ② non-obstructive congenital abnormalities, including double aortic arch and others; ③ congenital shunt abnormalities, including different types of patent ductus arteriosus (PDA). Management of patients with congenital aortic arch anomalies relies on imaging. Routine imaging modalities, such as conventional X-ray plain film and transthoracic echocardiography (TTE), have been recently complemented by magnetic resonance imaging (MRI).

  18. Modeling unmanned system collaborative target engagement

    Jaenisch, Holger M.; Handley, James W.; Hicklen, Michael L.

    2007-04-01

    This paper describes a novel algorithm for collaborative target engagement by unmanned systems (UMS) resulting in emergent behavior. We demonstrate UMS collaborative engagement using a simulation testbed model of a road, convoy vehicles traveling along the road, a squadron of unmanned aerial vehicles (UAVs), and multiple unmanned ground vehicles (UGVs) which are set to detonate when within close proximity to a convoy vehicle. No explicit artificial intelligence or swarming algorithms were used. Collision avoidance was an intrinsic phenomena. All entities acted independently throughout the simulation, but were given similar local instructions for possible courses of action (COAs) depending on current situations. Our algorithm and results are summarized in this paper.

  19. Molecular Studies on Soybean Mosaic Virus-Soybean Interations

    Qusus, Saba J.

    1997-01-01

    In the U.S., soybean mosaic virus (SMV) is classified into seven strain groups, designated G1 to G7, based on their different responses on resistant soybean [Glycine max (L.) Merr.] cultivars. These responses are: symptomless or resistant (R), necrotic (N), and mosaic or susceptible (S). The gene-for-gene model has been proposed for SMV-soybean interactions. In the majority of cultivars, a single dominant gene, Rsv1, confers both the R and N responses. In the first part of this study, the coa...

  20. NCBI nr-aa BLAST: CBRC-PTRO-06-0019 [SEVENS

    Full Text Available gulation factor II (thrombin) receptor [Homo sapiens] gb|AAX32147.1| coagulation fa...ctor II receptor [synthetic construct] gb|ABM86025.1| coagulation factor II (thrombin) receptor [synthetic c...onstruct] gb|ABW03766.1| coagulation factor II (thrombin) receptor [synthetic construct] AAH02464.1 0.0 99% ... ...CBRC-PTRO-06-0019 gb|AAH02464.1| Coagulation factor II (thrombin) receptor [Homo sapiens] gb|AAP35943.1| coa

  1. NCBI nr-aa BLAST: CBRC-TNIG-12-0002 [SEVENS

    Full Text Available gulation factor II (thrombin) receptor [Homo sapiens] gb|AAX32147.1| coagulation fa...ctor II receptor [synthetic construct] gb|ABM86025.1| coagulation factor II (thrombin) receptor [synthetic c...onstruct] gb|ABW03766.1| coagulation factor II (thrombin) receptor [synthetic construct] AAH02464.1 2e-95 46% ... ...CBRC-TNIG-12-0002 gb|AAH02464.1| Coagulation factor II (thrombin) receptor [Homo sapiens] gb|AAP35943.1| coa

  2. NCBI nr-aa BLAST: CBRC-VPAC-01-1477 [SEVENS

    Full Text Available gulation factor II (thrombin) receptor [Homo sapiens] gb|AAX32147.1| coagulation fa...ctor II receptor [synthetic construct] gb|ABM86025.1| coagulation factor II (thrombin) receptor [synthetic c...onstruct] gb|ABW03766.1| coagulation factor II (thrombin) receptor [synthetic construct] AAH02464.1 0.0 84% ... ...CBRC-VPAC-01-1477 gb|AAH02464.1| Coagulation factor II (thrombin) receptor [Homo sapiens] gb|AAP35943.1| coa

  3. NCBI nr-aa BLAST: CBRC-TBEL-01-2493 [SEVENS

    Full Text Available gulation factor II (thrombin) receptor [Homo sapiens] gb|AAX32147.1| coagulation fa...ctor II receptor [synthetic construct] gb|ABM86025.1| coagulation factor II (thrombin) receptor [synthetic c...onstruct] gb|ABW03766.1| coagulation factor II (thrombin) receptor [synthetic construct] AAH02464.1 1e-116 90% ... ...CBRC-TBEL-01-2493 gb|AAH02464.1| Coagulation factor II (thrombin) receptor [Homo sapiens] gb|AAP35943.1| coa

  4. NCBI nr-aa BLAST: CBRC-CJAC-01-0928 [SEVENS

    Full Text Available gulation factor II (thrombin) receptor [Homo sapiens] gb|AAX32147.1| coagulation fa...ctor II receptor [synthetic construct] gb|ABM86025.1| coagulation factor II (thrombin) receptor [synthetic c...onstruct] gb|ABW03766.1| coagulation factor II (thrombin) receptor [synthetic construct] AAH02464.1 0.0 91% ... ...CBRC-CJAC-01-0928 gb|AAH02464.1| Coagulation factor II (thrombin) receptor [Homo sapiens] gb|AAP35943.1| coa

  5. NCBI nr-aa BLAST: CBRC-STRI-01-2861 [SEVENS

    Full Text Available gulation factor II (thrombin) receptor [Homo sapiens] gb|AAX32147.1| coagulation fa...ctor II receptor [synthetic construct] gb|ABM86025.1| coagulation factor II (thrombin) receptor [synthetic c...onstruct] gb|ABW03766.1| coagulation factor II (thrombin) receptor [synthetic construct] AAH02464.1 0.0 88% ... ...CBRC-STRI-01-2861 gb|AAH02464.1| Coagulation factor II (thrombin) receptor [Homo sapiens] gb|AAP35943.1| coa

  6. NCBI nr-aa BLAST: CBRC-MMUR-01-1599 [SEVENS

    Full Text Available gulation factor II (thrombin) receptor [Homo sapiens] gb|AAX32147.1| coagulation fa...ctor II receptor [synthetic construct] gb|ABM86025.1| coagulation factor II (thrombin) receptor [synthetic c...onstruct] gb|ABW03766.1| coagulation factor II (thrombin) receptor [synthetic construct] AAH02464.1 0.0 89% ... ...CBRC-MMUR-01-1599 gb|AAH02464.1| Coagulation factor II (thrombin) receptor [Homo sapiens] gb|AAP35943.1| coa

  7. NCBI nr-aa BLAST: CBRC-FRUB-02-0029 [SEVENS

    Full Text Available gulation factor II (thrombin) receptor [Homo sapiens] gb|AAX32147.1| coagulation fa...ctor II receptor [synthetic construct] gb|ABM86025.1| coagulation factor II (thrombin) receptor [synthetic c...onstruct] gb|ABW03766.1| coagulation factor II (thrombin) receptor [synthetic construct] AAH02464.1 1e-93 52% ... ...CBRC-FRUB-02-0029 gb|AAH02464.1| Coagulation factor II (thrombin) receptor [Homo sapiens] gb|AAP35943.1| coa

  8. NCBI nr-aa BLAST: CBRC-CFAM-03-0005 [SEVENS

    Full Text Available gulation factor II (thrombin) receptor [Homo sapiens] gb|AAX32147.1| coagulation fa...ctor II receptor [synthetic construct] gb|ABM86025.1| coagulation factor II (thrombin) receptor [synthetic c...onstruct] gb|ABW03766.1| coagulation factor II (thrombin) receptor [synthetic construct] AAH02464.1 0.0 83% ... ...CBRC-CFAM-03-0005 gb|AAH02464.1| Coagulation factor II (thrombin) receptor [Homo sapiens] gb|AAP35943.1| coa

  9. NCBI nr-aa BLAST: CBRC-DNOV-01-2809 [SEVENS

    Full Text Available gulation factor II (thrombin) receptor [Homo sapiens] gb|AAX32147.1| coagulation fa...ctor II receptor [synthetic construct] gb|ABM86025.1| coagulation factor II (thrombin) receptor [synthetic c...onstruct] gb|ABW03766.1| coagulation factor II (thrombin) receptor [synthetic construct] AAH02464.1 0.0 85% ... ...CBRC-DNOV-01-2809 gb|AAH02464.1| Coagulation factor II (thrombin) receptor [Homo sapiens] gb|AAP35943.1| coa

  10. NCBI nr-aa BLAST: CBRC-TTRU-01-0295 [SEVENS

    Full Text Available gulation factor II (thrombin) receptor [Homo sapiens] gb|AAX32147.1| coagulation fa...ctor II receptor [synthetic construct] gb|ABM86025.1| coagulation factor II (thrombin) receptor [synthetic c...onstruct] gb|ABW03766.1| coagulation factor II (thrombin) receptor [synthetic construct] AAH02464.1 0.0 86% ... ...CBRC-TTRU-01-0295 gb|AAH02464.1| Coagulation factor II (thrombin) receptor [Homo sapiens] gb|AAP35943.1| coa

  11. NCBI nr-aa BLAST: CBRC-OLAT-09-0012 [SEVENS

    Full Text Available gulation factor II (thrombin) receptor [Homo sapiens] gb|AAX32147.1| coagulation fa...ctor II receptor [synthetic construct] gb|ABM86025.1| coagulation factor II (thrombin) receptor [synthetic c...onstruct] gb|ABW03766.1| coagulation factor II (thrombin) receptor [synthetic construct] AAH02464.1 8e-93 50% ... ...CBRC-OLAT-09-0012 gb|AAH02464.1| Coagulation factor II (thrombin) receptor [Homo sapiens] gb|AAP35943.1| coa

  12. NCBI nr-aa BLAST: CBRC-HSAP-05-0018 [SEVENS

    Full Text Available gulation factor II (thrombin) receptor [Homo sapiens] gb|AAX32147.1| coagulation fa...ctor II receptor [synthetic construct] gb|ABM86025.1| coagulation factor II (thrombin) receptor [synthetic c...onstruct] gb|ABW03766.1| coagulation factor II (thrombin) receptor [synthetic construct] AAH02464.1 0.0 99% ... ...CBRC-HSAP-05-0018 gb|AAH02464.1| Coagulation factor II (thrombin) receptor [Homo sapiens] gb|AAP35943.1| coa

  13. Inhibition of hepatic Carnitine Palmitoyl-Transferase I (CPT IA) by Valproyl?CoA as a possible mechanism of Valproate-induced steatosis

    Aires, Cátia C.P.; IJlst, Lodewijk; Stet, Femke; Prip-Buus, Carina; de Almeida, Isabel Tavares; Duran, Marinus; Wanders, Ronald J. A.; Silva, Margarida F.B.

    2009-01-01

    Abstract Background/Aims Carnitine palmitoyl-transferase I (CPT I) catalyses the synthesis of long-chain(LC)-acylcarnitines from LC-acyl-CoA esters. It is the rate-limiting enzyme of mitochondrial fatty acid ??oxidation (FAO) pathway and its activity is regulated by malonyl-CoA. The antiepileptic drug valproic acid (VPA) is a branched chain fatty acid that is activated to the respective CoA ester in the intra- and extra-mitochondrial compartments. This drug has been asso...

  14. Genetic Analysis of the Upper Phenylacetate Catabolic Pathway in the Production of Tropodithietic Acid by Phaeobacter gallaeciensis

    Berger, Martine; Brock, Nelson L.; Liesegang, Heiko; Dogs, Marco; Preuth, Ines; Simon, Meinhard; Dickschat, Jeroen S.; Brinkhoff, Thorsten

    2012-01-01

    Production of the antibiotic tropodithietic acid (TDA) depends on the central phenylacetate catabolic pathway, specifically on the oxygenase PaaABCDE, which catalyzes epoxidation of phenylacetyl-coenzyme A (CoA). Our study was focused on genes of the upper part of this pathway leading to phenylacetyl-CoA as precursor for TDA. Phaeobacter gallaeciensis DSM 17395 encodes two genes with homology to phenylacetyl-CoA ligases (paaK1 and paaK2), which were shown to be essential for phenylacetate cat...

  15. Activation of human mitochondrial pantothenate kinase 2 by palmitoylcarnitine

    Leonardi, Roberta; Rock, Charles O.; Jackowski, Suzanne; Zhang, Yong-Mei

    2007-01-01

    The human isoform 2 of pantothenate kinase (PanK2) is localized to the mitochondria, and mutations in this protein are associated with a progressive neurodegenerative disorder. PanK2 inhibition by acetyl-CoA is so stringent (IC50 < 1 μM) that it is unclear how the enzyme functions in the presence of intracellular CoA concentrations. Palmitoylcarnitine was discovered to be a potent activator of PanK2 that functions to competitively antagonize acetyl-CoA inhibition. Acetyl-CoA was a competitive...

  16. Menaquinone (vitamin K2) biosynthesis: overexpression, purification, and properties of o-succinylbenzoyl-coenzyme A synthetase from Escherichia coli.

    Kwon, O; Bhattacharyya, D K; Meganathan, R

    1996-01-01

    The coenzyme A (CoA)- and ATP-dependent conversion of o-succinylbenzoic acid [OSB; 4-(2'-carboxyphenyl)-4-oxobutyric acid], to o-succinylbenzoyl-CoA is carried out by the enzyme o-succinylbenzoyl-CoA synthetase. o-Succinylbenzoyl-CoA is a key intermediate in the biosynthesis of menaquinone (vitamin K2) in both gram-negative and gram-positive bacteria. The enzyme has been overexpressed and purified to homogeneity. The purified enzyme was found to have a native molecular mass of 185 kDa as dete...

  17. Mechanism of Allosteric Inhibition of N-Acetyl-L-glutamate Synthase by L-Arginine*

    Min, Li; Jin, Zhongmin; Caldovic, Ljubica; Morizono, Hiroki; Allewell, Norma M.; Tuchman, Mendel; Shi, Dashuang

    2009-01-01

    N-Acetylglutamate synthase (NAGS) catalyzes the first committed step in l-arginine biosynthesis in plants and micro-organisms and is subject to feedback inhibition by l-arginine. This study compares the crystal structures of NAGS from Neisseria gonorrhoeae (ngNAGS) in the inactive T-state with l-arginine bound and in the active R-state complexed with CoA and l-glutamate. Under all of the conditions examined, the enzyme consists of two stacked ...

  18. Crystal Structure of the N-Acetyltransferase Domain of Human N-Acetyl-L-Glutamate Synthase in Complex with N-Acetyl-L-Glutamate Provides Insights into Its Catalytic and Regulatory Mechanisms

    Zhao, Gengxiang; Jin, Zhongmin; Allewell, Norma M.; Tuchman, Mendel; Shi, Dashuang

    2013-01-01

    N-acetylglutamate synthase (NAGS) catalyzes the conversion of AcCoA and L-glutamate to CoA and N-acetyl-L-glutamate (NAG), an obligate cofactor for carbamyl phosphate synthetase I (CPSI) in the urea cycle. NAGS deficiency results in elevated levels of plasma ammonia which is neurotoxic. We report herein the first crystal structure of human NAGS, that of the catalytic N-acetyltransferase (hNAT) domain with N-acetyl-L-glutamate bound at 2.1 Å resolution. Functional studies indicate that the hNA...

  19. The Crystal Structure of N-Acetyl-l-glutamate Synthase from Neisseria gonorrhoeae Provides Insights into Mechanisms of Catalysis and Regulation*†

    Shi, Dashuang; Sagar, Vatsala; Jin, Zhongmin; Yu, Xiaolin; Caldovic, Ljubica; Morizono, Hiroki; Allewell, Norma M.; Tuchman, and Mendel

    2008-01-01

    The crystal structures of N-acetylglutamate synthase (NAGS) in the arginine biosynthetic pathway of Neisseria gonorrhoeae complexed with acetyl-CoA and with CoA plus N-acetylgluta-mate have been determined at 2.5- and 2.6-Å resolution, respectively. The monomer consists of two separately folded domains, an amino acid kinase (AAK) domain and an N-acetyltransferase (NAT) domain connected through a 10-Å linker. The monomers assemble into a hexameric ring that consists of a trimer of dimers with ...

  20. Metabolomics and mass isotopomer analysis as a strategy for pathway discovery: Pyrrolyl and cyclopentenyl derivatives of the pro-drug of abuse, levulinate

    Harris, Stephanie R.; Zhang, Guo-Fang; Sadhukhan, Sushabhan; WANG Hua; Shi, Chuan; Puchowicz, Michelle A.; Anderson, Vernon E.; Salomon, Robert G.; Tochtrop, Gregory P.; Brunengraber, Henri

    2012-01-01

    We recently reported that levulinate (4-ketopentanoate) is converted in the liver to 4-hydroxypentanoate, a drug of abuse, and that the formation of 4-hydroxypentanoate is stimulated by ethanol oxidation. We also identified 3 parallel β-oxidation pathways by which levulinate and 4-hydroxypentanoate are catabolized to propionyl-CoA and acetyl-CoA. We now report that levulinate forms three seven-carbon cyclical CoA esters by processes starting with the elongation of levulinyl-CoA by acetyl-CoA ...

  1. Durability of VO 2 -based thin films at elevated temperature : Towards thermochromic fenestration

    Ji, Yu-Xia; Niklasson, Gunnar A.; Granqvist, Claes-Göran

    2014-01-01

    An explorative study was performed on sputter-deposited thermochromic VO 2 films with top coatings of Al oxide and Al nitride. The films were exposed to dry air at a high temperature. Bare 80-nm-thick VO 2 films rapidly converted to non-thermochromic V 2 O 5 under the chosen conditions. Al oxide top coatings protected the underlying VO 2 films and, expectedly, increased film thickness yielded improved protection. Specifically, it was found that a 30-nm-thick sputter-deposited Al oxide top coa...

  2. Electroless Ni-B-W coatings for improving hardness, wear and corrosion resistance: Nanašanje Ni-B-W s cementacijskim galvaniziranjem za izboljšavo trdote, obrabe in odpornosti proti koroziji:

    Aydeniz, Ali Imre; Calli, Cagdas; Dil, Gökce; Göksenli, Ali; MUHAFFEL, Faiz; Yüksel, Behiye

    2013-01-01

    In this study the formation of a Ni-B-W coating on steel using an electroless plating process and evaluation of the hardness, wear and corrosion resistance was analyzed. The Ni-B-W coating was prepared using an alkaline borohydride-reduced electroless nickel bath. Scanning electron microscopy (SEM) of the cross-sectional view of the Ni-B-W coating was analyzed and the layer characteristics were investigated. The Ni-B-W coating was characterized using XRD. The study reveals that the Ni-B-W coa...

  3. Alpha-synuclein gene ablation increases docosahexaenoic acid incorporation and turnover in brain phospholipids

    Golovko, Mikhail Y; Rosenberger, Thad A; Feddersen, Søren;

    2007-01-01

    incorporation rate and turnover in ethanolamine glycerophospholipid, phosphatidylserine, and phosphatidylinositol pools. Increased 22:6n-3-CoA mass was not the result of altered Acsl activity, which was unaffected by the absence of Snca. While Snca bound 22:6n-3, Kd = 1.0 +/- 0.5 micromol/L, it did not bind 22......Previously, we demonstrated that ablation of alpha-synuclein (Snca) reduces arachidonate (20:4n-6) turnover in brain phospholipids through modulation of an endoplasmic reticulum-localized acyl-CoA synthetase (Acsl). The effect of Snca ablation on docosahexaenoic acid (22:6n-3) metabolism is unknown...

  4. Evolution of the acyl-CoA binding protein (ACBP)

    Burton, Mark; Rose, Timothy M; Faergeman, Nils J;

    2005-01-01

    -CoA pool size, donation of acyl-CoA esters for beta-oxidation, vesicular trafficking, complex lipid synthesis and gene regulation. In the present study, we delineate the evolutionary history of ACBP to get a complete picture of its evolution and distribution among species. ACBP homologues were identified...... duplication and/or retrotransposition events. The ACBP protein is highly conserved across phylums, and the majority of ACBP genes are subjected to strong purifying selection. Experimental evidence indicates that the function of ACBP has been conserved from yeast to humans and that the multiple lineage...

  5. Extreme events, intrinsic landforms and humankind: Post-tsunami scenario along Nagore–Velankanni coast, Tamil Nadu, India

    Mascarenhas, A.

    average width were a f fected (Figure 3 d ). Scenario 3 ? A natural, functional and sustainable coas t Lessons learnt from extreme events have set a new par a- digm for coastal management worldwide 15,16,21 . Know l edge of coastal ecosystems....), Bookwell Press, New Delhi, 2000, pp. 201 ? 216. 6. Paul, A. K., Cyclonic storms and their impacts on West Bengal coast. In Procee dings of the I n ternational Seminar on Quaternary Sea Level Variation, Shoreline Displacement and Coastal Env i...

  6. PET-based delineation of tumour volumes in lung cancer: comparison with pathological findings

    Schaefer, Andrea; Mai, Sebastian; Bohnenberger, Hendrik; Kirsch, Carl-Martin; Grgic, Aleksandar [Saarland University Medical Center, Department of Nuclear Medicine, Homburg (Germany); Kim, Yoo Jin; Bohle, Rainer M. [Saarland University Medical Center, Department of Pathology, Homburg (Germany); Kremp, Stephanie; Fleckenstein, Jochen; Ruebe, Christian [Saarland University Medical Center, Department of Radiooncology, Homburg (Germany); Schaefers, Hans-Joachim [Saarland University Medical Center, Department of Thoracic and Cardiovascular Surgery, Homburg (Germany); Kuhnigk, Jan-Martin [MeVis Research Center for Medical Diagnostic Systems and Visualization, Bremen (Germany)

    2013-08-15

    The objective of the study was to validate an adaptive, contrast-oriented thresholding algorithm (COA) for tumour delineation in {sup 18}F-fluorodeoxyglucose (FDG) positron emission tomography (PET) for non-small cell lung cancer (NSCLC) in comparison with pathological findings. The impact of tumour localization, tumour size and uptake heterogeneity on PET delineation results was also investigated. PET tumour delineation by COA was compared with both CT delineation and pathological findings in 15 patients to investigate its validity. Correlations between anatomical volume, metabolic volume and the pathology reference as well as between the corresponding maximal diameters were determined. Differences between PET delineations and pathological results were investigated with respect to tumour localization and uptake heterogeneity. The delineated volumes and maximal diameters measured on PET and CT images significantly correlated with the pathology reference (both r > 0.95, p < 0.0001). Both PET and CT contours resulted in overestimation of the pathological volume (PET 32.5 {+-} 26.5 %, CT 46.6 {+-} 27.4 %). CT volumes were larger than those delineated on PET images (CT 60.6 {+-} 86.3 ml, PET 48.3 {+-} 61.7 ml). Maximal tumour diameters were similar for PET and CT (51.4 {+-} 19.8 mm for CT versus 53.4 {+-} 19.1 mm for PET), slightly overestimating the pathological reference (mean difference CT 4.3 {+-} 3.2 mm, PET 6.2 {+-} 5.1 mm). PET volumes of lung tumours located in the lower lobe were significantly different from those determined from pathology (p = 0.037), whereas no significant differences were observed for tumours located in the upper lobe (p = 0.066). Only minor correlation was found between pathological tumour size and PET heterogeneity (r = -0.24). PET tumour delineation by COA showed a good correlation with pathological findings. Tumour localization had an influence on PET delineation results. The impact of tracer uptake heterogeneity on PET delineation

  7. MFE1, a Member of the Peroxisomal Hydroxyacyl Coenzyme A Dehydrogenase Family, Affects Fatty Acid Metabolism Necessary for Morphogenesis in Dictyostelium spp.

    Matsuoka, Satomi; Saito, Tamao; Kuwayama, Hidekazu; Morita, Naoki; Ochiai, Hiroshi; Maeda, Mineko

    2003-01-01

    β-Oxidation of long-chain fatty acids and branched-chain fatty acids is carried out in mammalian peroxisomes by a multifunctional enzyme (MFE) or d-bifunctional protein, with separate domains for hydroxyacyl coenzyme A (CoA) dehydrogenase, enoyl-CoA hydratase, and steroid carrier protein SCP2. We have found that Dictyostelium has a gene, mfeA, encoding MFE1 with homology to the hydroxyacyl-CoA dehydrogenase and SCP2 domains. A separate gene, mfeB, encodes MFE2 with homology to the enoyl-CoA h...

  8. Evaluación de comunidades microbianas edáficas oxidantes del amonio durante un ciclo de cultivo de papa criolla (Solanum phureja)

    González Sáyer, Sandra Milena

    2012-01-01

    La nitrificación depende enteramente del metabolismo microbiano e inicia con la transformación del amonio a hidroxilamina, catalizada por la enzima AMO (Amonio Monooxigenasa). El avance de las tecnologías independientes de cultivo, ha permitido conocer la secuencia del gen que codifica para el sitio activo de dicha enzima (amoA), identificándolo como un potente marcador taxonómico y funcional especifico para el rastreo de las comunidades microbianas oxidantes del amonio (COA) en diverso...

  9. Dicty_cDB: VHC671 [Dicty_cDB

    Full Text Available VH (Link to library) VHC671 (Link to dictyBase) - - - Contig-U11308-1 VHC671P (Link to Original ... 964 |BD194964.1 Candida albicans-origin acetyl-COA-car boxylase. 46 6e-07 3 A94755 |A94755.1 Sequence 2 fr ... ts: (bits) Value (Q54J08) RecName: Full=Acetyl-CoA car boxylase; EC=6.4.1... 468 e-130 BC137287_1( BC13728 ...

  10. Formulation, in vitro drug release and in vivo human X-ray investigation of polysaccharide based drug delivery systems for targeting 5-fluorouracil to the colon

    Sidramappa Mallikarjun Chickpetty; Baswaraj Veerappa Raga

    2013-01-01

    The purpose of this research study was to develop 5-fluorouracil compression coated tablets by using biodegradable polysaccharide polymer locust bean gum (LBG) and hydroxyl propyl methyl cellulose (HPMC) as coating materials. The fast disintegrating core tablets containing 50 mg of 5-fluorouracil were compression coated with LBG and HPMC in different ratios (8:1, 7:2 and 6:3) with a coat weight of 300, 400 and 500 mg. In vitro dissolution data indicated that the formulation (CLH63) with a coa...

  11. International Collaboration in Psychology is on the Rise

    Kliegl, Reinhold; Bates, Douglas

    2011-01-01

    There has been a substantial increase in the percentage for publications with co-authors located in departments from different countries in 12 major journals of psychology. The results are evidence for a remarkable internationalization of psychological research, starting in the mid 1970s and increasing in rate at the beginning of the 1990s. This growth occurs against a constant number of articles with authors from the same country; it is not due to a concomitant increase in the number of co-a...

  12. Kinetic controlled affinity labeling of target enzyme with thioester chemistry.

    Tomohiro, Takenori; Nakabayashi, Masahiro; Sugita, Yuka; Morimoto, Shota

    2016-08-01

    High specificity has been an important feature in affinity labeling for target profiling. Especially, to label targets via rapidly progressing reactions with consumption of ligand (probe), high specificity of reaction with common functional groups of target protein should be achieved without reactions with similar groups of non-target proteins. Herein, we demonstrate the kinetic controlled affinity labeling of acyl CoA synthetase using a fatty acid analogue containing a phenylthioester linkage. High specificity was attained by accelerating the labeling rate in the binding pocket. This approach could be useful for profiling a series of target enzymes and transporters in signal transduction pathways. PMID:27298000

  13. Comercio y transporte marítimo: El caso del Pacífico Suramericano

    Fernando González-Vigil; Alexis Yong; Juan Hurtado

    2012-01-01

    "Este documento presenta los resultados preliminares de una investigación sobre el rol del transporte marítimo en los cambios de participación entre países suramericanos en su comercio con el Asia-Pacífico. La investigación enfoca el caso del tráfico de carga en contenedores por los principales puertos de la Costa Oeste de América del Sur (COAS). De conformidad con la literatura especializada, los factores analizados son tres: el marco regulatorio e institucional de la actividad marítimo-port...

  14. Metabolismo del colesterol y su regulaci??n en c??lulas aisladas de epitelio intestinal

    Iglesias G??mez, Jos??

    1986-01-01

    Se han estudiado los procesos de s??ntesis y esterificaci??n del colesterol a lo largo del eje longitudinal y transversal del intestino de pollo. La m??xima actividad de s??ntesis (medida como actividad hmg-coa reductasa y ppmoa descarbotilasa) la mostraron yeyuno e ileon. La m??xima actividad esterificante se determin?? en yeyuno siendo las c??lulas superiores y medias de la vellosidad las gen exhibieron los valores mas elevados. Tambi??n se ha estudiado el efecto que la ...

  15. Influencia de la alimentaci??n sobre la evoluci??n diurna de la bios??ntesis del colesterol en pollo : Efecto sobre la HMG-CoA reductasa y la composici??n lipidica microsomal

    Ram??rez Rodrigo, Hilario

    1980-01-01

    Se han estudiado las propiedades del enzima clave de la regulaci??n de la bios??ntesis del colesterol la hmg-coa reductasa inherentes a su condici??n de enzima ligado a membranas microsomales. Se ha estudiado su patr??n diurno de actividad as?? como la velocidad total de s??ntesis de esteroles en h??gado asa duodenal y cerebro de pollos reci??n nacidos poni??ndose de manifiesto variaciones r??tmicas diurnas en ambos par??metros de h??gado e intestino. Se ha establecido asimismo sobre ellos y ...

  16. Intestinal absorption of specific structured triacylglycerols

    Mu, Huiling; Høy, Carl-Erik

    2001-01-01

    To clarify the intestinal absorption pathway of medium-chain fatty acids from MMM-type structured triaclyglycerols containing both medium- and long-chain fatty acids, we studied the lymphatic transport of 1,3-dioctanoyl-2-linoleoyl-sn- glycerol (8:0/18:2/8:0), 1,3-didecanoyl-2-linoleoyl...... activated into CoA, and reacylated into triacylglycerols in the enterocyte, The hydrolysis of MLM-type STAG is predominantly partial hydrolysis, whereas part of the STAG can also be hydrolyzed to free glycerol and free fatty acids. - Mu, H., and CE. Hoy. Intestinal absorption of specific structured...

  17. Detecting ALS and ACCase herbicide tolerant accession of Echinochloa oryzoides (Ard.) Fritsch. in rice (Oryza sativa L.) fields

    Altop, Emine Kaya; Mennan, Husrev; Streibig, Jens Carl; Budak, Unal; Ritz, Christian

    2014-01-01

    -sodium) and acetyl CoA carboxylase (cyhalofob-butyl) inhibiting herbicides. Comparison of 95% lower confidence intervals of ED90 derived from log-logistic dose-response curves, and twice the recommended field rates of the herbicides showed some, but not distinct separation of susceptible and tolerant...... bispyribac-sodium) at recommended field rates; and 38% were not controlled by the ACCase Inhibitor (cyhalofob-butyl) at twice the field rates. The effective response level of ED90 resulted in 64 and 14 tolerant accessions to ALS and ACCase, respectively. Fourteen accessions showed multiple resistances to ALS...

  18. Efecto dun estímulo potenciador na actividade neuronal da corteza motora, putamen e amígdala

    Montes Lourido, María del Pilar

    2016-01-01

    RESUMO: O presente traballo de investigación propón describir as características da actividade neuronal da corteza premotora, o putamen e a amígdala durante a realización dunha tarefa visuomotora que require dun movemento para recibir unha recompensa. O obxectivo deste traballo é estudar a influenza da presentación de estimulación visual, xunto coa presencia ou ausencia dun estímulo potenciador, na actividade neuronal das citadas áreas. Para realizar este estudo rexistrouse a actividade unita...

  19. RESEARCH ON THE QUALITY PRICE RATIO OF COKING COAL

    陶树人; 王永君

    1994-01-01

    If assortment price parity of Clean coling coal and its quallty price difference is nonreasortable, it doesn't guide in improving the qualiry metaljurgical eoking coal and may be influence the economic benefit of metallurgical enterprises. This paper propose the principles and mathematic model for determination assortment parity of ciean cokingcoal and its quality difference of ash content in clean coking coa in order to urge wasberies into producing superior clean coking coal which is under condition of consideration both intorest waskcries and interest metallurgical industry. It canbe used as a method in theory to make price stra,iegics under condition of socialism maket economic for washeries of clean coking coal

  20. Randomized controlled trial of Hepatitis B virus vaccine in HIV-1-infected patients comparing two different doses

    Ruiz-Palacios Guillermo; Vilar-Compte Diana; Escobedo-López Kenia; Volkow-Fernández Patricia; Cornejo-Juárez Patricia; Soto-Ramírez Luis

    2006-01-01

    Abstract Background Co-infection with hepatitis B virus (HBV) and human immunodeficiency virus (HIV) is not infrequent as both share same route of exposure. The risk of developing chronic hepatitis B virus is 6%, in general population but can reach 10–20% in HBV/HIV co-infected patients. When compared to general population, the response rate to HBV vaccine in HIV-infected patients is diminished, so previous studies have tried to improve this response using variety of schedules, doses and co-a...