WorldWideScience

Sample records for ac systems

  1. AC power supply systems

    An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)

  2. ac propulsion system for an electric vehicle

    Geppert, S.

    1980-01-01

    It is pointed out that dc drives will be the logical choice for current production electric vehicles (EV). However, by the mid-80's, there is a good chance that the price and reliability of suitable high-power semiconductors will allow for a competitive ac system. The driving force behind the ac approach is the induction motor, which has specific advantages relative to a dc shunt or series traction motor. These advantages would be an important factor in the case of a vehicle for which low maintenance characteristics are of primary importance. A description of an EV ac propulsion system is provided, taking into account the logic controller, the inverter, the motor, and a two-speed transmission-differential-axle assembly. The main barrier to the employment of the considered propulsion system in EV is not any technical problem, but inverter transistor cost.

  3. AC motor drive system for electric cars

    Morohoshi, Yukinobu; Yoshinori, Naoto; Naito, Hironobu (Fuji Electric Co., Ltd., Tokyo, (Japan))

    1989-08-10

    Various main circuit equipment with large capacity GTO thyristors are outlined for AC and DC electric cars. The configuration of a PWM converter system is presented for the AC main motor drive system of the Shinkansen trains, and its following features are described: the high power factor control capable of keeping a power factor 100% constantly, energy saving by power regenerative braking, the small triple structure with large capacity reverse-conducting GTO thyristors of 4,500V/3,000A, and the reduction of equivalent interfering current and harmonic current by three phase-triple phase difference operation. Furthermore, a control logic equipment with 16 bit MPU and a main transformer are outlined, and the verification test results of the control logic equipment by an analog model simulation and the combinational test results of the commercial equipment are reported. Prototype VVVF inverter system for DC electric cars is also presented. 6 refs., 13 figs., 3 tabs.

  4. Flexible AC transmission systems modelling and control

    Zhang, Xiao-Ping; Pal, Bikash

    2012-01-01

    The extended and revised second edition of this successful monograph presents advanced modeling, analysis and control techniques of Flexible AC Transmission Systems (FACTS). The book covers comprehensively a range of power-system control problems: from steady-state voltage and power flow control, to voltage and reactive power control, to voltage stability control, to small signal stability control using FACTS controllers. In the six years since the first edition of the book has been published research on the FACTS has continued to flourish while renewable energy has developed into a mature and

  5. A Simple Load Power Estimator For Quasi-Direct AC-AC Converter System

    Marian GAICEANU; Emil ROSU

    2003-01-01

    In this paper a simple load power estimator for the three-phase quasi-direct acac converter system is reported. Since the ac-ac converter control by means of pulsewidth modulation (PWM) is based on the power balance concept, its load power should be known. Two control boards, based on the dSMC (digital Smart Motion Controller) 30 MIPS 32-bit fixed-point digital signal processor (DSP), were involved in the ac-ac system driving. By using the power balance control, the DC link voltage variation ...

  6. Guiding Principles in Selecting AC To DC Converters For Power Factor Corrections in AC Transmission System

    Ibekwe B.E

    2014-10-01

    Full Text Available The ac to dc converters’ power factors correction in ac transmission system were investigated. The studies include: phase-controlled converter; pulse width modulated (PWM converter and ac input current shaped converter. Using Fourier series, power factors of these converters were calculated and simulated using MATLAB. The resulting curves are displayed in the hard copies for practical guides in the choice of converters; and comparatively, current shaped type is the best.

  7. Digital model for harmonic interactions in AC/DC/AC systems

    Guarini, A.P.; Rangel, R.D.; Pilotto, L.A.S.; Pinto, R.J.; Passos Junior, R. [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)

    1994-12-31

    The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.

  8. Flexible AC transmission systems: the state of the art

    Edris, Abdel-Aty [Electric Power Research Inst., Palo Alto, CA (United States). Electric Systems Division

    1994-12-31

    Flexible AC transmission systems (FACTS) is a concept promoting the use of power electronic controllers to enhance the controllability and usable capacity of AC transmission. This paper presents the state of the art of FACTS and the status of the current projects for the application of the FACTS controllers in transmission systems. (author) 8 refs., 8 figs.

  9. Nonlinear ac conductivity of interacting 1d electron systems

    Rosenow, Bernd; Nattermann, Thomas

    2004-01-01

    We consider low energy charge transport in one-dimensional (1d) electron systems with short range interactions under the influence of a random potential. Combining RG and instanton methods, we calculate the nonlinear ac conductivity and discuss the crossover between the nonanalytic field dependence of the electric current at zero frequency and the linear ac conductivity at small electric fields and finite frequency.

  10. HVDC-AC system interaction from AC harmonics. Volume 1. Harmonic impedance calculations. Final report

    Breuer, G D; Chow, J H; Lindh, C B; Miller, N W; Numrich, F H; Price, W W; Turner, A E; Whitney, R R

    1982-09-01

    Improved methods are needed to characterize ac system harmonic behavior for ac filter design for HVDC systems. The purpose of this General Electric Company RP1138 research is to evaluate the present filter design practice and to investigate methods for calculating system harmonic impedances. An overview of ac filter design for HVDC systems and a survey of literature related to filter design have been performed. Two methods for calculating system harmonic impedances have been investigated. In the measurement method, an instrumentation system for measuring system voltage and current has been assembled. Different schemes of using the measurements to calculate system harmonic impedances have been studied. In the analytical method, a procedure to include various operating conditions has been proposed. Computer programs for both methods have been prepared, and the results of the measurement and analytical methods analyzed. A conclusion of the project is that the measurement and analytical methods both provided reasonable results. There are correlations between the measured and analytical results for most harmonics, although there are discrepancies between the assumptions used in the two methods. A sensitivity approach has been proposed to further correlate the results. From the results of the analysis, it is recommended that both methods should be tested further. For the measurement method, more testing should be done to cover different system operating conditions. In the analytical method, more detailed models for representing system components should be studied. In addition, alternative statistical and sensitivity approaches should be attempted.

  11. Behaviour analysis of AC-600 passive safety systems

    Southwest Center of Reactor Engineering Research and Design has finished the first step conceptual design of 600 mwe advanced PWR (AC-600). The main research emphases of AC-600 conceptual design include the advanced reactor core, the passive safety systems and the simplification. The passive safety systems of AC-600 consist of two reactor make up water tanks, two accumulators, two emergency feedwater tanks, two emergency natural draft air condensers, a containment water jacket and an enhanced primary cycle natural circulation flow system. 25% of the rated reactor power can be removed by the natural circulation cooling. The full pressure reactor make up water tanks are able to provide enough borated water which would be injected into the reactor coolant system during small LOCA. The coolant natural circulations can be established in the primary system and the passive secondary emergency feedwater system, removing residual heat from the reactor core to the atmosphere when station blackout occurs. It is indicated from analysis that the containment diameter of AC-600 is about 35 m. The large tanks and the large vertical distances between the tanks and reactor core are the main reason of using the big containment. It is also indicated from analysis that the low head safety injection pumps are required in AC-600 design to assure the recirculation system operation when large LOCA occurs. The reliability of AC-600 engineered safety systems is increased because the function of the passive safety systems is conducted through the immutable natural laws. The paper discusses the natural circulation ability and safety behavior of the passive safety systems during LOCA or station blackout for AC-600. The passive limits to excess reactivity and thermal hydraulic transients are also preliminarily discussed. Figs and tabs

  12. Reliability of emergency ac power systems at nuclear power plants

    Reliability of emergency onsite ac power systems at nuclear power plants has been questioned within the Nuclear Regulatory Commission (NRC) because of the number of diesel generator failures reported by nuclear plant licensees and the reactor core damage that could result from diesel failure during an emergency. This report contains the results of a reliability analysis of the onsite ac power system, and it uses the results of a separate analysis of offsite power systems to calculate the expected frequency of station blackout. Included is a design and operating experience review. Eighteen plants representative of typical onsite ac power systems and ten generic designs were selected to be modeled by fault trees. Operating experience data were collected from the NRC files and from nuclear plant licensee responses to a questionnaire sent out for this project

  13. A Simple Load Power Estimator For Quasi-Direct AC-AC Converter System

    Marian GAICEANU

    2003-12-01

    Full Text Available In this paper a simple load power estimator for the three-phase quasi-direct acac converter system is reported. Since the ac-ac converter control by means of pulsewidth modulation (PWM is based on the power balance concept, its load power should be known. Two control boards, based on the dSMC (digital Smart Motion Controller 30 MIPS 32-bit fixed-point digital signal processor (DSP, were involved in the ac-ac system driving. By using the power balance control, the DC link voltage variation at the load changes can be reduced. In this way a small DC link capacitor is required to handle the dc voltage error control. The feed-forward (Sul and Lipo, 1990 current component provides fast correction of the reference control to load power variation. In order to obtain the feed-forward current component, the load power must to be known. In this paper the load power is estimated from the dc link, indirectly, through a dc load current estimator. In this way the author overcomes the use of the serial communication between control boards (Gaiceanu, 2004 in order to deliver the load power information from the inverter side. The load current estimator is based on the DC link voltage and on the load current of the supply converter. This method presents certain advantages instead of using measured method, which requires a low pass filter: no time delay, the feed-forward current component has no ripple, no additional hardware, and more fast control response. Through simulation and experimental results the performances of the proposed load current estimator scheme are demonstrated.

  14. Research on AC Variable Frequency Speed Regulation System

    Ou Bing-Xian; Li Qing-Zhong; Yan Jun-Xia

    2013-01-01

    In view of shortcomings existing in shear speed control system, shearer AC speed regulating system is designed and studied. The mathematical model of three-phase asynchronous motor in rotating coordinate system is established, and PWM technology of space vector is discussed. Software and hardware of the asynchronous motor vector control variable frequency speed regulating system are designed. The simulation of system based on Matlab is made and the correctness and feasibility of the sys...

  15. Development of an AC Module System: Final Technical Report

    Suparna Kadam; Miles Russell

    2012-06-15

    The GreenRay Inc. program focused on simplifying solar electricity and making it affordable and accessible to the mainstream population. This was accomplished by integrating a solar module, micro-inverter, mounting and monitoring into a reliable, 'plug and play' AC system for residential rooftops, offering the following advantages: (1) Reduced Cost: Reduction in installation labor with fewer components, faster mounting, faster wiring. (2) Maximized Energy Production: Each AC Module operates at its maximum, reducing overall losses from shading, mismatch, or module downtime. (3) Increased Safety. Electrical and fire safety experts agree that AC Modules have significant benefits, with no energized wiring or live connections during installation, maintenance or emergency conditions. (4) Simplified PV for a Broader Group of Installers. Dramatic simplification of design and installation of a solar power system, enabling faster and more efficient delivery of the product into the market through well-established, mainstream channels. This makes solar more accessible to the public. (5) Broadened the Rooftop Market: AC Modules enable solar for many homes that have shading, split roofs, or obstructions. In addition, due to the smaller building block size of 200W vs. 1000W, homeowners with budget limitations can start small and add to their systems over time. Through this DOE program GreenRay developed the all-in-one AC Module system with an integrated PV Module and microinverter, custom residential mounting and performance monitoring. Development efforts took the product from its initial concept, through prototypes, to a commercial product sold and deployed in the residential market. This pilot deployment has demonstrated the technical effectiveness of the AC Module system in meeting the needs and solving the problems of the residential market. While more expensive than the traditional central inverter systems at the pilot scale, the economics of AC Modules become

  16. Sustainable AC/AC hybrid electrochemical capacitors in aqueous electrolyte approaching the performance of organic systems

    Abbas, Qamar; Babuchowska, Paulina; Frąckowiak, Elżbieta; Béguin, François

    2016-09-01

    A high energy hybrid AC/AC electrochemical capacitor has been realized in aqueous Li2SO4+KI electrolyte mixture. Owing to the redox processes associated with the 2I-/I2 system, the positive electrode operates in narrow potential range and displays high capacity. During prolonged potentiostatic floating at 1.6 V, the hybrid cell demonstrates remarkably stable capacitance and resistance. Analyses by temperature programmed desorption after floating at 1.6 V proved that oxidation of the positive AC electrode is prevented by the use of Li2SO4+KI, which enables the maximum potential of this electrode to be shifted below the water oxidation potential. When charged at 0.2 A g-1 up to U = 1.6 V, the hybrid cell displays a high capacitance of 75 F g-1 (300 F g-1 per mass of one electrode) compared to 47 F g-1 (188 F g-1 per mass of one electrode) for a symmetric cell in Li2SO4. At 0.2 A g-1 up to 1.6 V, the hybrid capacitor in Li2SO4+KI displays an energy density of 26 Wh kg-1 which approaches the energy density of 30.9 Wh kg-1 measured when the same carbon is implemented in a capacitor using TEABF4/ACN electrolyte and charged up to 2.5 V.

  17. AC system stabilization via phase shift transformer with thyristor commutation

    Oliveira, Jose Carlos de; Guimaraes, Geraldo Caixeta; Moraes, Adelio Jose [Uberlandia Univ., MG (Brazil); Abreu, Jose Policarpo G. de [Escola Federal de Engenharia de Itajuba, MG (Brazil); Oliveira, Edimar Jose de [Juiz de Fora Univ., MG (Brazil)

    1994-12-31

    This article aims to present initially the constructive and operative forms of a phase-shift autotransformer which provides both magnitude and phase angle change through thyristor commutation, including a technic to reduce the number of thyristors. Following, it is proposed a control system to make such equipment an efficient AC system stabilizing tool. It is presented some simulation results to show the operation of this transformer in an electrical system. (author) 3 refs., 11 figs., 3 tabs.

  18. Active Harmonics Filtering of Distributed AC System

    Shahbaz, Muhammad

    2012-01-01

    The tendency of connecting the Power Electronic loads and distributed power plants through Power Electronic converters is increasing day by day. These Power Electronic converters and loads are the sources of harmonics and reactive power which greatly affect the performance of the power system network. In a weak power grid, the voltage unbalance and non-sinusoidal regimes are very common. Under such circumstances not only the controllability of the power grid itself but also the controllabilit...

  19. Security analysis of interconnected AC/DC systems

    Eriksson, Robert

    2015-01-01

    any line or transformer limits. Simulations were performed in a model of the Nordic power system where a dc grid is placed on top. The simulation supports the method as a tool to consider transfer limits in the grid to avoid violate the same and increase the security after a converter outage.......This paper analyses N-1 security in an interconnected ac/dc transmission system using power transfer distribution factors (PTDFs). In the case of a dc converter outage the power needs to be redistributed among the remaining converter to maintain power balance and operation of the dc grid....... The redistribution of power has a sudden effect on the power-flow in the interconnected ac system. This may cause overloading of lines and transformers resulting in disconnection of equipment, and as a consequence cascading failure. The PTDF is used as a method to analyze and avoid violating limits by in the dc...

  20. System and method for determining stator winding resistance in an AC motor using motor drives

    Lu, Bin; Habetler, Thomas G; Zhang, Pinjia

    2013-02-26

    A system and method for determining the stator winding resistance of AC motors is provided. The system includes an AC motor drive having an input connectable to an AC source and an output connectable to an input terminal of an AC motor, a pulse width modulation (PWM) converter having switches therein to control current flow and terminal voltages in the AC motor, and a control system connected to the PWM converter. The control system generates a command signal to cause the PWM converter to control an output of the AC motor drive corresponding to an input to the AC motor, selectively generates a modified command signal to cause the PWM converter to inject a DC signal into the output of the AC motor drive, and determines a stator winding resistance of the AC motor based on the DC signal of at least one of the voltage and current.

  1. The minimization of ac phase noise in interferometric systems

    Filinski, Ignacy; Gordon, R A

    1994-01-01

    A simple step-by-step procedure, including several novel techniques discussed in the Appendices, is given for minimizing ac phase noise in typical interferometric systems such as two-beam interferometers, holographic setups, four-wave mixers, etc. Special attention is given to index of refraction...... fluctuations, direct mechanical coupling, and acoustic coupling, whose importance in determining ac phase noise in interferometric systems has not been adequately treated. The minimization procedure must be carried out while continuously monitoring the phase noise which can be done very simply by using a...... in optics. Thus, the necessity of eliminating the effects of index of refraction fluctuations which degrade the performance of all interferometers is pointed out as the first priority. A substantial decrease of the effects of all vibrating, rotating, or flowing masses (e.g., cooling lines) in direct...

  2. System and Battery Charge Control for PV-Powered AC Lighting Systems

    Kern, G.

    1999-04-01

    This report reviews a number of issues specific to stand-alone AC lighting systems. A review of AC lighting technology is presented, which discusses the advantages and disadvantages of various lamps. The best lamps for small lighting systems are compact fluorescent. The best lamps for intermediate-size systems are high- or low-pressure sodium. Specifications for battery charging and load control are provided with the goal of achieving lamp lifetimes on the order of 16,000 to 24,000 hours and battery lifetimes of 4 to 5 years. A rough estimate of the potential domestic and global markets for stand-alone AC lighting systems is presented. DC current injection tests were performed on high-pressure sodium lamps and the test results are presented. Finally, a prototype system was designed and a prototype system controller (with battery charger and DC/AC inverter) was developed and built.

  3. Application of AC servo motor on the in-core neutron flux instrumentation system

    The application of ac servo motor in the In-Core Neutron Flux Instrumentation System is described. The hardware component of ac servo motor control system is different from the dc motor control system. The effect of two control system on the instrumentation system is compared. The ac servo motor control system can improve the accuracy of the motion control, optimize the speed control and increase the reliability. (authors)

  4. A transgenic system for generation of transposon Ac/Ds-induced chromosome rearrangements in rice

    Yu, Chuanhe; Han, FangPu; Zhang, Jianbo; Birchler, James; Peterson, Thomas

    2012-01-01

    The maize Activator (Ac)/Dissociation (Ds) transposable element system has been used in a variety of plants for insertional mutagenesis. Ac/Ds elements can also generate genome rearrangements via alternative transposition reactions which involve the termini of closely linked transposons. Here, we introduced a transgene containing reverse-oriented Ac/Ds termini together with an Ac transposase gene into rice (Oryza sativa ssp. japonica cv. Nipponbare). Among the transgenic progeny, we identifie...

  5. Optimizing DC Voltage Droop Settings for AC/DC System Interactions

    Eriksson, Robert; Beerten, Jef; Ghandari, Mehrdad; Belmans, Ronnie

    2014-01-01

    In this paper, a methodology is presented to optimize the dc voltage droop settings in a multiterminal voltage-source converter high-voltage direct-current system with respect to the ac system stability. Implementing dc voltage droop control enables having multiple converters assisting the system in case of a converter outage. However, the abrupt power setpoint changes create additional stress in the ac system, especially when multiple converters are connected to the same interconnected ac sy...

  6. GRID-CONNECTECD DOUBLE-STAGE AC-AC POWER CONVERTER FOR CSP RENEWABLE ENERGY SYSTEMS

    Sorrentino, Vincenzo

    2015-01-01

    In the last years the renewable energy sources have known a state of their advanced diffusion considering their advantages compared to the traditional energy sources like fossil fuels. For this reason the combined heat and power (CHP) plant fueled by renewable sources are widely used. The purpose of this Ph.D. thesis is the design of a new Grid-connected Double-Stage AC-DC/DC-AC Power Converter (DSACPC) for a Concentrating Solar plant for Combined generation of Heat and Power (CS-CHP), th...

  7. Research on closed-loop simulation system for digital AC servo system

    HAO ShuangHui; ZHENG WeiFeng; HAO MingHui; MA RuQi; LI Hong

    2009-01-01

    An intelligent and efficient closed-loop simulation system without any hardware is proposed for AC servo system. According to the characteristics of AC servo system and its control processor, the code executing platform combined with the reverse Polish notation algorithm is developed. To gain the accurate simulation results, the discrete motor model and IPM model are built to deal with the dead-time.Based on the simulation system, parameter identification can be implemented and control parameters can be optimized by using the exhaust algorithm. The parameters obtained by the simulation system were successfully applied to an experimental system, and the favorable control performance was achieved.

  8. Flexible AC transmission system devices: allocation and transmission pricing

    The transmission of electricity differs from transportation of any typical commodity by some inherent aspects such as: the production needs to match the consumption at the same time; system control is not an easy task; the electricity flows do not usually follow the economic law. The last aspect is normally observed when transmission systems are included in, for instance, an economic dispatch problem. One way to minimize the operational costs caused by an overloaded transmission system is through the installation of Flexible AC Transmission System (FACTS) devices in the system. They are able to change power flows by modifying the network parameters. This paper focuses on the ability of FACTS devices to change the overall costs of the system and their impact on transmission pricing. The allocation and the determination of the FACTS required are also discussed. Some examples using the IEEE-14 system and the Brazilian electrical system of the Southern region are given to illustrate the concepts introduced in this paper. (author)

  9. An NPV and AC Analysis of a Stochastic Inventory System with Joint Manufacturing and Remanufacturing

    Laan, Erwin

    2000-01-01

    textabstractWhile the net present value (NPV) approach is widely accepted as the right framework for studying production and inventory control systems, average cost (AC) models are more widely used. For the well known EOQ model it can be veri_ed that (under certain conditions) the AC approach gives near optimal results. This paper investigates whether the same holds for two-source systems with joint manufacturing and remanufacturing. It appears that the performance of the AC approach stands o...

  10. Mathematical modeling of Automatic Control System (ACS) and synchronous motor in high reliability power supply systems in Kozloduy NPP - set up optimization of ACS

    The article presents the models of Automatic Control System (ACS) and synchronous motor of the reversible generator-engine groups of the first category power supply section in the Kozloduy NPP units 1 to 4. The control parameter is the magnetic field. The research aims are optimal ACS setups, property control guaranties in accordance with the technical requirements. The used synchronous machine model is included in Matlab5.x library. For optimization the instruments of optimization toolbox - NCD out port block and plant actuator and created basic models of variable Discrete PID-regulator and PWM system are utilized. The results are applied for the setup of the real ACS. The results precision of the created models gives a possibility for a real summary model development and the achieved models implementation in cases of fluctuations of AC/DC reversible electromechanical supply

  11. Mathematical modeling of Automatic Control System (ACS) and synchronous generator in high reliability power supply systems in Kozloduy NPP - set up optimization of ACS

    The article presents the models of Automatic Control System (ACS) and synchronous generator of the reversible generator-engine groups of first category power supply section in the Kozloduy NPP units 1 to 4. The control parameter is the synchronous machine tension. The research aims are optimal ACS setups, property control guaranties in accordance with the technical requirements. The used synchronous machine model is included in Matlab5.x library. For optimization the instruments of optimization toolbox - NCD out port block and plant actuator and created basic models of variable Discrete PID-regulator and PWM system are utilized. The results are applied for the setup of the real ACS. The results precision of the created models gives a possibility for a real summary model development and the achieved models implementation in cases of fluctuations of AC/DC reversible electromechanical supply

  12. On two-liquid AC electroosmotic system for thin films.

    Navarkar, Abhishek; Amiroudine, Sakir; Demekhin, Evgeny A

    2016-03-01

    Lab-on-chip devices employ EOF for transportation and mixing of liquids. However, when a steady (DC) electric field is applied to the liquids, there are undesirable effects such as degradation of sample, electrolysis, bubble formation, etc. due to large magnitude of electric potential required to generate the flow. These effects can be averted by using a time-periodic or AC electric field. Transport and mixing of nonconductive liquids remain a problem even with this technique. In the present study, a two-liquid system bounded by two rigid plates, which act as substrates, is considered. The potential distribution is derived by assuming a Boltzmann charge distribution and using the Debye-Hückel linearization. Analytical solution of this time-periodic system shows some effects of viscosity ratio and permittivity ratio on the velocity profile. Interfacial electrostatics is also found to play a significant role in deciding velocity gradients at the interface. High frequency of the applied electric field is observed to generate an approximately static velocity profile away from the Electric Double Layer (EDL). PMID:26773725

  13. System Frequency as Information Carrier in AC Power Systems

    Douglass, Philip James; Heussen, Kai; You, Shi;

    2015-01-01

    -DER) using changes to frequency setpoint values of genera- tors. Signaling discrete system states by generating off-nominal system frequency values can be used as a novel narrowband unidirectional broadcast communications channel. This paper describes two protocols for utilizing off-nominal frequencies...... to carry information: First, a protocol for dispatching blocks of FS- DER that is suitable for systems restricted to relatively slow rates of change of frequency (ROCOF). Second, for systems that allow higher ROCOF values, the feasibility of using power generation resources as a power line communication...... is shown with laboratory tests of a 20 kVA inverter. The inverter was found to have a maximum ROCOF of 2.2 Hz/s, sufficient to enable its use as a power line communication transmitter...

  14. An NPV and AC Analysis of a Stochastic Inventory System with Joint Manufacturing and Remanufacturing

    E.A. van der Laan (Erwin)

    2000-01-01

    textabstractWhile the net present value (NPV) approach is widely accepted as the right framework for studying production and inventory control systems, average cost (AC) models are more widely used. For the well known EOQ model it can be veri_ed that (under certain conditions) the AC approach gives

  15. A Simulator Study of Recovery of HVDC Links Following AC System Faults

    J. Senthil; Padiyar, KR; Sachchidanand, *

    1990-01-01

    This paper presents the simulator study of a two-terminal HVDC system. The various AC system faults to which the study system is subjected are a) remote-three-phase ground fault, b)single-phase-ground fault and three phase ground faults. These faults are applied both at the rectifier and inverter ends. The results of the simulator study are presented to demonstrate the controller performance in the recovery of HVDC link following AC system faults.

  16. Research on closed-loop simulation system for digital AC servo system

    2009-01-01

    An intelligent and efficient closed-loop simulation system without any hardware is proposed for AC servo system.According to the characteristics of AC servo system and its control processor,the code executing platform combined with the reverse Polish notation algorithm is developed.To gain the accurate simulation results,the discrete motor model and IPM model are built to deal with the dead-time.Based on the simulation system,parameter identification can be implemented and control parameters can be optimized by using the exhaust algorithm.The parameters obtained by the simulation system were successfully applied to an experimental system,and the favorable control performance was achieved.

  17. Voltage Swell Mitigation Using Flexible AC Transmission Systems Based on Evolutionary Computing Methods

    Marwa Shahin; Ebtisam Saied; M.A. Moustafa Hassan; Fahmy Bendary

    2014-01-01

    The main subject of these paper deals with enhancing the steady-state and dynamics performance of the power grids by using new idea namely Advanced Flexible AC Transmission Systems based on Evolutionary Computing Methods. Control of the electric power system can be achieved by using the new trends as Particle Swarm Optimization applied to this subject to enhance the characteristics of controller performance. This paper studies and analyzes Advanced Flexible AC Transmission System to mitigate ...

  18. A New Simulator for HVdc/ac Systems-Part I

    ZANGENEH, B. Zohouri; SHOULAIE, A.

    2003-01-01

    A simulator with optimal step time (SOST) has been designed to investigate Large HVdc/ac systems. The adequacy and robustness of the simulator will be demonstrated by showing some important applications relevant to operation, operational planning and medium-term planing. Some of the features of our SOST simulator are optimal step time algorithm, interpolation, chatter removal, MATLAB interface, unlimited size of ac system, and Farsi command that help model complex power electronic ci...

  19. Risk Based Assessment of Subsynchronous Resonance in AC/DC Systems

    Adrees, Atia

    2014-01-01

    Risk Based Assessment of Subsynchronous Resonance in compensated AC/DC systemMrs Atia Adrees, The University of Manchester, April 2014This thesis investigates the phenomenon of subsynchronous resonance (SSR) in meshed series compensated AC/DC systems in the presence of operational uncertainties. The main contribution of this research is the novel application of risk assessment methods to SSR studies.In terms of network topology, future electric power transmission networks alongside the curren...

  20. Frequency support among asynchronous AC systems through VSCs emulating power plants

    Papangelis, Lampros; Guillaud, Xavier; Van Cutsem, Thierry

    2015-01-01

    This paper proposes a new control scheme for the Voltage Source Converters (VSCs) of a High Voltage Direct Current (HVDC) grid connecting asynchronous AC systems, so that the latter can mutually support their frequencies after a disturbance. The scheme involves no communication between VSCs. It is activated upon detection of a significant frequency deviation, with the possibility to limit the support requested from other AC systems. It relies on an integral control enforcing the frequency dro...

  1. Marketing information system online design for craftsmen small medium enterprises (case study: craftsmen ac)

    Fitriana, Rina; Kurniawan, Wawan; Barlianto, Anung; Adriansyah Putra, Rizki

    2016-02-01

    AC is small and medium enterprises which is engaged in the field of crafts. This SME (Small Medium Enterprise) didn't have an integrated information system for managing sales. This research aims to design a marketing Information system online as applications that built as web base. The integrated system is made to manage sales and expand its market share. This study uses a structured analysis and design in its approach to build systems and also implemented a marketing framework of STP (Segmentation, Targeting, Positioning) and 4P (Price, Product, Place, Promotion) to obtain market analysis. The main market target customer craftsmen AC is women aged 13 years to 35 years. The products produced by AC are shoes, brooch, that are typical of the archipelago. The prices is range from Rp. 2000 until Rp. 400.000. Marketing information system online can be used as a sales transaction document, promoting the goods, and for customer booking products.

  2. Development of an electric power conversion system using a high frequency AC insulating link system. Koshuha AC zetsuen link hoshiki wo mochiita denryoku henkan system no kaihatsu

    1991-05-10

    An electric power convertion system incorporating a cycloconverter type high frequency AC insulating link system of which object was the dispersed power sources of 5KVA class was experimentally developed to evaluate the properties of the developed equipment. The system was composed of a cycloconverter which converted the frequency from 20kHz to 60Hz directly by converting DC to high frequency AC at the 20kHz high frequency inverter, and then by connecting to a high frequency transformer which insulated between the inputting side and the outputting circuit. The multi-functional hybrid IC technology where semiconductor elements, driving circuits, current detecting elements and overcurrent cut-off circuits were incorporated into a module, was introduced. As a result, the size of the high frequency transformer became one-tenth or less the size of transformer using commercial frequency and the weight reduced to about one-twentyfifth. When the commutation of high frequency power source and the forced gate commutation were used jointly, the efficiency was improved by 10 percentage at the 100 percentage load, compared with the case using only the forced gate commutation and the efficiency of mounted equipment was 90 percentage. 3 figs.

  3. Study of the DEF Feedback Control System in AC Operation of Superconducting Tokamak

    WANG Hua; LUO Jiarong; YUAN Qiping; XU Congdong

    2007-01-01

    AC operation with multiple full cycles has been successfully performed on the superconducting tokamak HT-7. In the experiment, it was discovered that the saturation of the transformer magnetic flux with DEF, a signal name, was one of key aspects that affected the AC operation. The conditions of DEF were examined through the DEF feedback control system. By controlling the working patterns of the subsystems, namely the poloidal field control system and density control system, it was guaranteed that DEF would remain in the non-saturated status.

  4. Study of the DEF Feedback Control System in AC Operation of Superconducting Tokamak

    Wang, Hua; Luo, Jiarong; Yuan, Qiping; Xu, Congdong

    2007-02-01

    AC operation with multiple full cycles has been successfully performed on the superconducting tokamak HT-7. In the experiment, it was discovered that the saturation of the transformer magnetic flux with DEF, a signal name, was one of key aspects that affected the AC operation. The conditions of DEF were examined through the DEF feedback control system. By controlling the working patterns of the subsystems, namely the poloidal field control system and density control system, it was guaranteed that DEF would remain in the non-saturated status.

  5. Harmonic detection an AC excited generation system based on in-phase correlation filtering

    2002-01-01

    The paper reports results of investigation on the harmonic detection technique of a complicated power supply system such as an AC excited generation system, which has a variable fundamental frequency and low order harmonics with rich sub-harmonics whose frequencies are lower than the fundamental one. The in-phase correlation filtering technique, based on the frequency shifting principle, is proposed in this paper. Theoretical analysis and experimental results validate the effectiveness of this technique for the harmonic detections of AC excited generation systems.

  6. Design issues of the TF AC/DC converter for the ITER coil power supply system

    The ITER Toroidal Field (TF) coil system is composed of 18 series-connected superconductor coils (L=17.5 Henry), related protection circuits, and an AC/DC converter. The converter for the TF coil system is a 12-pulse and 2-quadrant converter with the two thyristor bridges connected in parallel through the inter-phase reactor. The rated current of the converter is 68 kA, and no-load output voltage is 900 V when 66 kV AC input is used. Because ITER is a pulse system that uses huge power during the pulse, there are additional critical issues in designing the AC/DC converters. In this study the following issues in designing the TF AC/DC converter are discussed to improve the characteristics of the TF coil system; - Fault current issues related with AC input voltage and operational scenario. - Junction temperatures during the faults and the thyristor numbers per an arm. - Efficient and reliable bypass method including resuming. - Protection sequence for the fault conditions. - Reactive power reduction method. - Estimation of the optimum inductance of the DC Reactor (DCR)

  7. Combined operation of AC and DC distribution system with distributed generation units

    This paper presents a DC distribution system which has been supplied by external AC systems as well as local DG units in order to demonstrate an overall solution to power quality issue. In this paper, the proposed operation method is demonstrated by simulation of power transfer between external AC systems, DG units, AC and DC loads. The power flow control in DC distribution system has been achieved by network converters and DG converters. Also, the mathematical model of the network, DG and load converters are obtained by using the average technique, which allows converter systems accurately simulated and control strategies for this converters is achieved. A suitable control strategy for network converters has been proposed that involves DC voltage droop regulator and novel instantaneous power regulation scheme. Also, a novel control technique has been proposed for DG converters. In this paper, a novel control system based on stationary and synchronously rotating reference frame has been proposed for load converters for supplying AC loads connected to the DC bus by balanced voltages. The several case studies have been studied based on proposed methods. The simulation results show that DC distribution systems including DG units can improve the power quality at the point of common coupling (PCC) in the power distribution system or industrial power system. (authors)

  8. Electromechanical systems with transient high power response operating from a resonant ac link

    Burrows, Linda M.; Hansen, Irving G.

    1992-01-01

    The combination of an inherently robust asynchronous (induction) electrical machine with the rapid control of energy provided by a high frequency resonant ac link enables the efficient management of higher power levels with greater versatility. This could have a variety of applications from launch vehicles to all-electric automobiles. These types of systems utilize a machine which is operated by independent control of both the voltage and frequency. This is made possible by using an indirect field-oriented control method which allows instantaneous torque control all four operating quadrants. Incorporating the ac link allows the converter in these systems to switch at the zero crossing of every half cycle of the ac waveform. This zero loss switching of the link allows rapid energy variations to be achieved without the usual frequency proportional switching loss. Several field-oriented control systems were developed under contract to NASA.

  9. Design study of an AC power supply system in JT-60SA

    In the initial research phase of JT-60SA, which is the International Thermonuclear Experimental Reactor (ITER) satellite Tokamak with superconducting toroidal and poloidal magnetic field coils, the plasma heating operation of 30 MW-60 s or 20 MW-100 s is planned for 5.5 MA single null divertor plasmas. To achieve this operation, AC power source of the medium voltage of 18 kV and ∼7 GJ has to be provided in total to the poloidal field coil power supplies and additional heating devices such as neutral beam injection (NBI) and electron cyclotron radio frequency (ECRF). In this paper, the proposed AC power supply system in JT-60SA was estimated from the view point of available power, and harmonic currents based on the standard plasma operation scenario during the initial research phase. This AC power supply system consists of the reused JT-60 power supply facilities including motor generators with flywheel, AC breakers, harmonic filters, etc., to make it cost effective. In addition, the conceptual design of the upgraded AC power supply system for the ultimate heating power of 41 MW-100 s in the extended research phase is also described.

  10. Electromechanical systems with transient high power response operating from a resonant AC link

    Burrows, Linda M.; Hansen, Irving G.

    1992-01-01

    The combination of an inherently robust asynchronous (induction) electrical machine with the rapid control of energy provided by a high frequency resonant AC link enables the efficient management of higher power levels with greater versatility. This could have a variety of applications from launch vehicles to all-electric automobiles. These types of systems utilize a machine which is operated by independent control of both the voltage and frequency. This is made possible by using an indirect field-oriented control method which allows instantaneous torque control in all four operating quadrants. Incorporating the AC link allows the converter in these systems to switch at the zero crossing of every half cycle of the AC waveform. This zero loss switching of the link allows rapid energy variations to be achieved without the usual frequency proportional switching loss. Several field-oriented control systems were developed by LeRC and General Dynamics Space Systems Division under contract to NASA. A description of a single motor, electromechanical actuation system is presented. Then, focus is on a conceptual design for an AC electric vehicle. This design incorporates an induction motor/generator together with a flywheel for peak energy storage. System operation and implications along with the associated circuitry are addressed. Such a system would greatly improve all-electric vehicle ranges over the Federal Urban Driving Cycle (FUD).

  11. Modelling and control of hybrid renewable energy system connected to AC grid

    Sami Younsi

    2011-12-01

    Full Text Available This paper discusses the development of new control and supervision method for the optimum operation of hybrid renewable energy system (HRES connected to AC grid. The hybrid system consists of wind generator (WG, diesel generator (DG, and flywheel energy storage system (FESS. These subsystems are based on permanent magnet synchronous machines (PMSM which are controlled by sliding mode control. A supervisor control is designed to determine the energy transfer type of flywheel energy storage system (charging / discharging / no transfer energy, to take decision on diesel generators ON/OFF status, and to determine the reference powers for these two subsystems. The supervisor inputs are the power requested by AC grid, the power generated by wind generator, and the energy stored in flywheel. The objectives of the control and supervision for hybrid renewable energy system are to satisfy the power requested by AC grid, to manage the energy transfer between hybrid system and AC grid, to optimize the use of wind energy, and to reduce fuel of diesel generator. The system is simulated with Matlab – Simulink software and it gave good results.

  12. Methods, systems and apparatus for controlling operation of two alternating current (AC) machines

    Gallegos-Lopez, Gabriel; Nagashima, James M.; Perisic, Milun; Hiti, Silva

    2012-06-05

    A system is provided for controlling two alternating current (AC) machines via a five-phase PWM inverter module. The system comprises a first control loop, a second control loop, and a current command adjustment module. The current command adjustment module operates in conjunction with the first control loop and the second control loop to continuously adjust current command signals that control the first AC machine and the second AC machine such that they share the input voltage available to them without compromising the target mechanical output power of either machine. This way, even when the phase voltage available to either one of the machines decreases, that machine outputs its target mechanical output power.

  13. Study of Power Flow Algorithm of AC/DC Distribution System including VSC-MTDC

    Haifeng Liang

    2015-08-01

    Full Text Available In recent years, distributed generation and a large number of sensitive AC and DC loads have been connected to distribution networks, which introduce a series of challenges to distribution network operators (DNOs. In addition, the advantages of DC distribution networks, such as the energy conservation and emission reduction, mean that the voltage source converter based multi-terminal direct current (VSC-MTDC for AC/DC distribution systems demonstrates a great potential, hence drawing growing research interest. In this paper, considering losses of the reactor, the filter and the converter, a mathematical model of VSC-HVDC for the load flow analysis is derived. An AC/DC distribution network architecture has been built, based on which the differences in modified equations of the VSC-MTDC-based network under different control modes are analyzed. In addition, corresponding interface functions under five control modes are provided, and a back/forward iterative algorithm which is applied to power flow calculation of the AC/DC distribution system including VSC-MTDC is proposed. Finally, by calculating the power flow of the modified IEEE14 AC/DC distribution network, the efficiency and validity of the model and algorithm are evaluated. With various distributed generations connected to the network at appropriate locations, power flow results show that network losses and utilization of transmission networks are effectively reduced.

  14. AC Versus DC Link Comparison Based on Power Flow Analysis of a Multimachine Power System

    Mohammed Abdeljalil DJEHAF

    2014-02-01

    Full Text Available Deregulation and privatization is posing new challenges on high voltage transmission and on distributions systems as well. An increasingly liberalized market will encourage trading opportunities to be identified and developed. High voltage power electronics, such as HVDC (High Voltage Direct Current and FACTS (Flexible AC Transmission Systems provide the necessary features to avoid technical problems in heavily loaded power systems; HVDC offers most advantages: it can be used for system interconnection and for control of power flow as well. The major benefit of HVDC is its incorporated ability for fault-current blocking, which is not possible with synchronous AC links. In addition, HVDC can effectively support the surrounding AC systems in case of transient fault conditions and it serves as firewall against cascading disturbances. This paper presents a comparison between HVDC link and an HVAC link in a 29 Bus multimachine system, based on load flow analysis using Newton-Raphson method for the AC link case, and sequential method for the HVDC link case.

  15. Theoretical and experimental investigation into anti-idling A/C system for trucks

    Highlights: • A mathematical model is developed and verified using a built test-bed. • Thermal and performance characteristics of an anti-idling truck A/C system are investigated. • It is shown that variable speed fans have significant effects on the COP in different conditions. • A point of optimum COP can be found by changing the fans speed for any operating condition. • Anti-idling A/C systems equipped to variable speed control can significantly save environment. - Abstract: In this study, a recently developed truck anti-idling air conditioning (A/C) system is investigated. A mathematical model is developed to simulate the thermodynamic and heat transfer characteristics of the A/C system and calculate the coefficient of performance (COP). Utilizing environmental chambers and a number of measuring equipment, an experimental setup is built to verify the accuracy of the mathematical model and to perform a comprehensive study on the performance of the system for a wide range of operating conditions. A good agreement between the simulation and the experimental data, with a maximum discrepancy of 10.6%, is achieved. The results show a range of 0.5–1.7 for the system COP under a variety of operating condition. The parametric study shows that for any cooling demand, ambient and indoor air temperatures, there is a point of optimum COP that can be achieved by adjusting the condenser and evaporator fans speed

  16. Model of Bi-directional Flyback Converter for Hybrid AC/DC Distribution System

    Riku Pasonen

    2013-01-01

    In this article, a simulation model and concept of two switch bi-directional isolated DC/DC converter is presented. Converter is based on flyback converter type. Also control method for voltage regulation with bi-directional power transfer is presented. Target application of the proposed converter was selected to be a hybrid AC/DC distribution system concept of which was briefly described. The requirement of galvanic isolation in the hybrid AC/DC concept comes from use of shared neutral wire;...

  17. Internal Heating of an IGBT module in a System With a Regenerative AC Drive

    Mabano, Michel

    2016-01-01

    The purpose of this thesis was to understand the internal heating of an IGBT module inside an AC drive in a system with a regenerative unit to it. During the implementation of the lab, various approaches were taken in an effort to collect measurements appropriate to the topic of investigation. The IGBT junction temperature was recorded over a sustained period of time at various speed of the induction motor. The braking torque applied through a second AC drive was varied in order to study...

  18. Model of Bi-directional Flyback Converter for Hybrid AC/DC Distribution System

    Riku Pasonen

    2013-12-01

    Full Text Available In this article, a simulation model and concept of two switch bi-directional isolated DC/DC converter is presented. Converter is based on flyback converter type. Also control method for voltage regulation with bi-directional power transfer is presented. Target application of the proposed converter was selected to be a hybrid AC/DC distribution system concept of which was briefly described. The requirement of galvanic isolation in the hybrid AC/DC concept comes from use of shared neutral wire; DC current runs with unbalanced part of AC current in neutral wire. Without galvanic isolation grounded neutral would cause short circuit if DC/DC converter is connected to three phase rectifier or inverter. Simulation was carried out with PSCAD electromagnetic transient simulator.

  19. Development of New Type Gap Arrester for Earth Fault Protection in AC Feeding System

    Ajiki, Kohji; Morimoto, Hiroaki; Hisamizu, Yasuzi; Kinoshita, Nobuo; Takai, Wataru; Sato, Ryogo

    A gap arrester is being used for ground fault protection in AC Feeding System. However there are faults in which a conventional gap arrester burns down in a normal state of circuit. We investigated the cause of the fault in which a gap arrester burns. Then, it was found out that the cause of the fault was the discharge of AC current from the surge voltage. Therefore, we developed a new type gap arrester which does not burn down. The new type gap arrester is composed of a discharge tube and a zinc oxide element which are connected in series. Unnecessary AC current discharge is prevented by this structure. The new type gap arrester is actually used at the railroad track.

  20. A Series-LC-Filtered Active Damper for AC Power Electronics Based Power Systems

    Wang, Xiongfei; Blaabjerg, Frede; Loh, Poh Chiang;

    2015-01-01

    This paper proposes an active damper with a series LC-filter for suppressing resonances in an ac power electronics based power system. The added filter capacitor helps to lower the voltage stress of the converter to be used for implementing the damper. Unlike active filters for the compensation of...

  1. Autonomous Active Power Control for Islanded AC Microgrids with Photovoltaic Generation and Energy Storage System

    Wu, Dan; Tang, Fen; Dragicevic, Tomislav; Vasquez, Juan Carlos; Guerrero, Josep M.

    2014-01-01

    In an islanded AC microgrid with distributed energy storage system (ESS), photovoltaic (PV) generation and loads, a coordinated active power regulation is required to ensure efficient utilization of renewable energy, while keeping the ESS from overcharge and over discharge conditions. In this pap...

  2. Modeling and Analysis of Harmonic Stability in an AC Power-Electronics-Based Power System

    Wang, Xiongfei; Blaabjerg, Frede; Wu, Weimin

    2014-01-01

    This paper addresses the harmonic stability caused by the interactions among the wideband control of power converters and passive components in an AC power-electronicsbased power system. The impedance-based analytical approach is employed and expanded to a meshed and balanced threephase network w...

  3. Flow diagram of the longitudinal and Hall conductivities in ac regime in the disordered graphene quantum Hall system

    We numerically study the behavior of σxy(ω) and σxx (ω) for graphene QHE system in the ac (frequency ω) domain. We interpret these conductivities with the dynamical scaling analysis. We also discuss the temperature flow of σxy(ω) — σxx(ω) diagram for graphene QHE system in the ac region.

  4. Digital Signal Processor System for AC Power Drivers

    Ovidiu Neamtu

    2009-10-01

    Full Text Available DSP (Digital Signal Processor is the bestsolution for motor control systems to make possible thedevelopment of advanced motor drive systems. The motorcontrol processor calculates the required motor windingvoltage magnitude and frequency to operate the motor atthe desired speed. A PWM (Pulse Width Modulationcircuit controls the on and off duty cycle of the powerinverter switches to vary the magnitude of the motorvoltages.

  5. Control Structures for VSC-based FACTS Devices under Normal and Faulted AC-systems

    Babaei, Saman

    This thesis is concerned with improving the Flexible AC Transmission Systems (FACTS) devices performance under the normal and fault AC-system conditions by proposing new control structures and also converter topologies. The combination of the increasing electricity demand and restrictions in expanding the power system infrastructures has urged the utility owners to deploy the utility-scaled power electronics in the power system. Basically, FACTS is referred to the application of the power electronics in the power systems. Voltage Source Converter (VSC) is the preferred building block of the FACTS devices and many other utility-scale power electronics applications. Despite of advances in the semiconductor technology and ultra-fast microprocessor based controllers, there are still many issues to address and room to improve[25]. An attempt is made in this thesis to address these important issues of the VSC-based FACTS devices and provide solutions to improve them.

  6. Optimization Control of Bidirectional Cascaded DC-AC Converter Systems

    Tian, Yanjun

    reliability in bidirectional cascaded converter. This research work analyses the control strategies based on the topology of dual active bridges converter cascaded with a three phase inverter. It firstly proposed a dc link voltage and active power coordinative control method for this cascaded topology, and it...... can reduce dc link voltage fluctuations, enhancing the dc link voltage reliability in case of one sub converter failure. Then the bidirectional power flow effect is analyzed, and an important guide line is proposed for the design of the two stage cascaded converter system. Towards the different...... reduce the dc link voltage control system type number, which is capable to improve system stability. Afterwards, this dissertation comes up with the concept of front to end impedance control method for the two stage cascaded converter, and it can greatly improve the system stability. At last the thesis...

  7. Direct AC–AC grid interface converter for ocean wave energy system

    Highlights: • Novel power grid interface converter for ocean wave energy system. • Unlike conventional approach, generator output is directly converted into fixed frequency AC for synchronous connection. • High conversion efficient and power quality could be achieved. - Abstract: Ocean wave energy is very promising. However, existing systems are using rectifying circuits to convert variable voltage and variable frequency output of electric generator into DC voltage and then use grid-tied inverter to connect to the power grid. Such arrangement will not only reduce the overall efficient but also increase the cost of the system. A direct AC–AC converter is a desirable solution. In this paper, a six-switch AC–AC converter has been proposed as a single phase grid-connected interface. New switching scheme has been derived for the converter such that the virtual input AC–DC conversion and the output DC–AC conversion can be decoupled. State-space averaging model and pulse width modulation scheme have been derived for the converter. As the input and the output operations can be decoupled, two independent controllers have been designed to handle the input AC–DC regulation and the output DC–AC regulation. The proposed scheme demands for two separate duty ratios and novel switching scheme has been derived to realize the combined duty ratios in one switching cycle. Power regulation, harmonics elimination and power factor correction control algorithms have also been derived for the converter when it is connected to the supply grid. Experimental results of a small scale model are included to demonstrate the effectiveness of the proposed switching and control schemes

  8. System co-optimization in wireless receiver design with TrACS

    Ramesh, Chithrupa; Rusu, Ana; Ismail, Mohammed; Skoglund, Mikael

    2008-01-01

    System co-optimization of the analog receiver front end circuit and the digital baseband processing could enable receiver designs with lower power budgets, as the signal processing in the digital receiver is asymmetric across circuit topologies. This paper presents a simulation tool that could assist with such co-optimized designs. TrACS (Transceiver Architecture and Channel Simulator) is an RF/DSP co-simulator, capable of providing an application-specific system-level perspective to receiver...

  9. A reduction of proof complexity to computational complexity for $AC^0[p]$ Frege systems

    Krajicek, Jan

    2013-01-01

    We give a general reduction of lengths-of-proofs lower bounds for constant depth Frege systems in DeMorgan language augmented by a connective counting modulo a prime $p$ (the so called $AC^0[p]$ Frege systems) to computational complexity lower bounds for search tasks involving search trees branching upon values of maps on the vector space of low degree polynomials over the finite filed with $p$ elements.

  10. Harmonic Analysis of AC-DC Topologies and their Impacts on Power Systems

    Mukhtiar Ahmed Mahar; Muhammad Aslam Uqaili; Abdul Sattar Larik

    2011-01-01

    Power Electronic Converters are commonly used in different applications because of high efficiency and low cost. Due to latest advancement in semiconductor devices it is difficult to draw the boundaries for applications of power electronic topologies. These topologies are variable structure systems and generate harmonics during the operation which will affect the power quality when are connected to system network. Rectifier is a big family of converters and used when ac-dc conv...

  11. Power Electronics for Mitigation of Voltage Sags and Improved Control of AC Power Systems

    Magalhães de Oliveira, Marcio

    2000-01-01

    The thesis deals with the application of compensators andswitches based on power electronics in AC transmission anddistribution systems. The objective of the studieddevices/equipment is the power flow and voltage control intransmission systems and the mitigation of voltage sags andmomentary interruptions to critical loads in distributionsystems. For validating the power electronics based devices/equipmentdescribed in the thesis, scaled models at a real-time simulatorhave been built. Simulatio...

  12. Influence of the iodide/iodine redox system on the self-discharge of AC/AC electrochemical capacitors in salt aqueous electrolyte

    Qamar Abbas

    2015-12-01

    Full Text Available Self-discharge (SD of AC/AC (AC=activated carbon electrochemical capacitors in aqueous solutions of lithium sulfate (Li2SO4 and lithium sulfate+iodide salts (Li2SO4+KI or Li2SO4+LiI was investigated at 24 °C and −40 °C after cell potential hold at values from 1 V to 1.6 V. At 24 °C, the cells exhibit lower SD in Li2SO4+KI than in Li2SO4, owing to the redox activity of the 2I−/I2 system which drives the positive AC electrode to operate in narrow potential range and display lower potential drop than in Li2SO4. At −40°C, the capacitors exhibit comparable and reduced SD both in Li2SO4+LiI and Li2SO4, whatever the holding cell potential. Three-electrode cell experiments demonstrate that, at −40 °C, hydrogen chemisorption is thermodynamically unfavored under negative polarization, while the activity of the 2I−/I2 redox system under positive polarization is only slightly reduced. As a consequence, the AC/AC cells in Li2SO4 exhibit a typical electrical double-layer performance at −40°C, whereas they still behave as hybrid ones in Li2SO4+LiI, with twice higher capacitance than in Li2SO4. The (Ui-Ut vs t1/2 plots demonstrate that SD is essentially controlled by diffusion at −40°C, suggesting that it originates from bulkier hydrated ions. Overall, in the investigated temperature range, the AC/AC capacitors in Li2SO4+LiI demonstrate low self-discharge and high capacitance, while being able to operate up to 1.6 V.

  13. Enhancing the Capacity of the AC Distribution System Using DC Interlinks - A Step Towards Future DC Grid

    Chaudhary, Sanjay; Guerrero, Josep M.; Teodorescu, Remus

    2015-01-01

    , the dc grid interconnection also allows the introduction of a common storage system which can be shared by the connected ac feeders, and the dc grid connection to other renewable energy resources. The increased power handling capacity and improved voltage profile of the ac distribution feeder using...

  14. An evaluation of the Panasonic model UD513AC-1 Thermoluminescence Dosimetry system

    An evaluation of the Panasonic UD513AC-1 Thermoluminescence Dosimetry system was performed to determine the system's capabilities as a general purpose thermoluminescence dosimeter measuring device. The tests that were performed included a critique of the user's manual, delimitation of the operating parameters, the quality of construction, and an evaluation of the features that were unique to this system. The UD513AC-1 was found to be an adequate measuring device for most dosimetric applications. It was not well suited for experimental work with thermoluminescence materials due to a low sensitivity displayed by the photomultiplier tube to commonly used materials. The system was well constructed and did not suffer hardware failure during this research. Major attributes of the UD513AC-1 were automatic data storage, highly reproducible heating ramps, an excellent infrared light filter and a unique feature to a single phosphor unit, a dose determination function. Negative aspects of the system included a limited data manipulation capability within the controlling program, a poorly written user's manual, inadequate sensitivity on the part of the photomultiplier tube, and insufficient capability to adjust the hot N2 gas flow to desired levels

  15. Mathematical analysis of parameter maintenance in precision technological V and AC systems (rus

    Sotnikov A.G.

    2011-08-01

    Full Text Available Various industrial processes usually take place in the air and they require different parameters of air quality and accuracy of its maintenance.In present there are no rigorous analytical methods for reliable determination the actual accuracy of maintenance of air quality parameters on condition that they change orderly or stochastically. The harmonic analysis of exponents of periodical increase and decrease of parameters is proposed. It can be used for the estimation of fluctuations and precision of maintenance of various air quality parameters, first of all, in precision technological V and AC systems.Suggested method of temperature calculation under changing periodical heat load at the premises is illustrated by the example of high-precision V and AC system operating the area of grinding and test of optical devices.

  16. ABB ACS6000传动系统在热轧线的应用%Application of ABB ACS6000 Driver System in Hot-rolling Line

    孙坚; 王君艳

    2012-01-01

    宝钢股份特钢事业部热轧厂粗轧机同步电机主传动上应用了ACS6000中压变频传动系统,采用电力电子元件IGCT作为其功率元件.详细介绍了该变频系统的硬件结构、软件组成以及技术特点.%In the hot-rolling workshop of Baosteel Special branch, ABB ACS6000 medium voltage variable speed drive system is used for rough-rolling mill synchronous motor. This system is equipped with so called integrated gate commutated thyristors (ICCT) as its power element. Detailed described the hardware and software configuration, technical characteristic of the drive system.

  17. DC and AC Josephson Effect in a Superconductor-Luttinger Liquid-Superconductor System

    Fazio, Rosario; Hekking, F. W. J.; Odintsov, A.A.; RevTex, 11 pages; figures, 9

    1995-01-01

    We calculate both the DC and the AC Josephson current through a one-dimensional system of interacting electrons, connected to two superconductors by tunnel junctions. We treat the (repulsive) Coulomb interaction in the framework of the one-channel, spin-$1/2$ Luttinger model. The Josephson current is obtained for two geometries of experimental relevance: a quantum wire and a ring. At zero temperature, the critical current is found to decay algebraically with increasing distance $d$ between th...

  18. MODES OF OPERATION OF THE SYSTEM OF TRACTION POWER AC USING REACTIVE POWER COMPENSATION DEVICES

    Domanskyi, I. V.

    2015-01-01

    The paper presents a systematic analysis of existing methods of reactive power compensation. The study of operating modes of the systems external and traction power supply is carried out. The methodology for selecting promising compensation schemes and energy-saving in the traction networks AC electrified railway lines is offered. The comparative evaluation of prospective controlled compensation devices shows that use of seamlessly adjustable devices with unregulated condensing the battery an...

  19. An active damper for stabilizing power-electronics-based AC systems

    Wang, Xiongfei; Blaabjerg, Frede; Liserre, Marco;

    2014-01-01

    The interactions among the parallel grid-connected converters coupled through the grid impedance tend to result in stability and power quality problems. To address them, this paper proposes an active damper based on a high bandwidth power electronics converter. The general idea behind this proposal...... experimental tests on a three-converter-based setup are carried out. The results show that the active damper can become a promising way to stabilize the power-electronics-based ac power systems....

  20. Comparison of Two Autonomous AC-DC Converters for Piezoelectric Energy Scavenging Systems

    Dallago, Enrico; Miatton, Daniele; Venchi, Giuseppe; Bottarel, Valeria; Frattini, Giovanni; Ricotti, Giulio; Schipani, Monica

    2010-01-01

    International audience Piezoelectric Energy Scavenging Systems (PESS) are used to convert the energy of mechanical vibrations into electrical energy exploiting the piezoelectric effect. Their output is a voltage which strongly varies in time; to obtain a suitable supply source an AC-DC conversion of the output voltage of these transducers is needed. Since the output power level of the energy transducer can be very low, the conversion should be as efficient as possible. The paper describes ...

  1. Modeling and Analysis of Harmonic Stability in an AC Power-Electronics-Based Power System

    Wang, Xiongfei; Blaabjerg, Frede; Wu, Weimin

    2014-01-01

    This paper addresses the harmonic stability caused by the interactions among the wideband control of power converters and passive components in an AC power-electronicsbased power system. The impedance-based analytical approach is employed and expanded to a meshed and balanced threephase network which is dominated by multiple current- and voltage- controlled inverters with LCL- and LC-filters. A method of deriving the impedance ratios for different inverters is proposed by means of the nodal a...

  2. Scalable Heuristics for Planning, Placement and Sizing of Flexible AC Transmission System Devices

    Frolov, Vladmir [Skolkovo Institute of Science and Technology, Skolkovo (Russia); Backhaus, Scott N. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Chertkov, Michael [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2015-07-02

    Aiming to relieve transmission grid congestion and improve or extend feasibility domain of the operations, we build optimization heuristics, generalizing standard AC Optimal Power Flow (OPF), for placement and sizing of Flexible Alternating Current Transmission System (FACTS) devices of the Series Compensation (SC) and Static VAR Compensation (SVC) type. One use of these devices is in resolving the case when the AC OPF solution does not exist because of congestion. Another application is developing a long-term investment strategy for placement and sizing of the SC and SVC devices to reduce operational cost and improve power system operation. SC and SVC devices are represented by modification of the transmission line inductances and reactive power nodal corrections respectively. We find one placement and sizing of FACTs devices for multiple scenarios and optimal settings for each scenario simultaneously. Our solution of the nonlinear and nonconvex generalized AC-OPF consists of building a convergent sequence of convex optimizations containing only linear constraints and shows good computational scaling to larger systems. The approach is illustrated on single- and multi-scenario examples of the Matpower case-30 model.

  3. Very low noise AC/DC power supply systems for large detector arrays

    Arnaboldi, C.; Baù, A.; Carniti, P.; Cassina, L.; Giachero, A.; Gotti, C.; Maino, M.; Passerini, A.; Pessina, G.

    2015-12-01

    In this work, we present the first part of the power supply system for the CUORE and LUCIFER arrays of bolometric detectors. For CUORE, it consists of AC/DC commercial power supplies (0-60 V output) followed by custom DC/DC modules (48 V input, ±5 V to ±13.5 V outputs). Each module has 3 floating and independently configurable output voltages. In LUCIFER, the AC/DC + DC/DC stages are combined into a commercial medium-power AC/DC source. At the outputs of both setups, we introduced filters with the aim of lowering the noise and to protect the following stages from high voltage spikes that can be generated by the energy stored in the cables after the release of accidental short circuits. Output noise is very low, as required: in the 100 MHz bandwidth the RMS level is about 37 μVRMS (CUORE setup) and 90 μVRMS (LUCIFER setup) at a load of 7 A, with a negligible dependence on the load current. Even more importantly, high frequency switching disturbances are almost completely suppressed. The efficiency of both systems is above 85%. Both systems are completely programmable and monitored via CAN bus (optically coupled).

  4. Combination of AC Transmission Expansion Planning and Reactive Power Planning in the restructured power system

    Highlights: ► To overcome the disadvantages of DC model in Transmission Expansion Planning, AC model should be used. ► The Transmission Expansion Planning associated with Reactive Power Planning results in fewer new transmission lines. ► Electricity market concepts should be considered in Transmission Expansion Planning problem. ► Reliability aspects should be considered in Transmission Expansion Planning problem. ► Particle Swarm Optimization is a suitable optimization method to solve Transmission Expansion Planning problem. - Abstract: Transmission Expansion Planning (TEP) is an important issue in power system studies. It involves decisions on location and number of new transmission lines. Before deregulation of the power system, the goal of TEP problem was investment cost minimization. But in the restructured power system, nodal prices, congestion management, congestion surplus and so on, have been considered too. In this paper, an AC model of TEP problem (AC-TEP) associated with Reactive Power Planning (RPP) is presented. The goals of the proposed planning problem are to minimize investment cost and maximize social benefit at the same time. In the proposed planning problem, in order to improve the reliability of the system the Expected Energy Not Supplied (EENS) index of the system is limited by a constraint. For this purpose, Monte Carlo simulation method is used to determine the EENS. Particle Swarm Optimization (PSO) method is used to solve the proposed planning problem which is a nonlinear mixed integer optimization problem. Simulation results on Garver and RTS systems verify the effectiveness of the proposed planning problem for reduction of the total investment cost, EENS index and also increasing social welfare of the system.

  5. An overview of power electronics applications in fuel cell systems: DC and AC converters.

    Ali, M S; Kamarudin, S K; Masdar, M S; Mohamed, A

    2014-01-01

    Power electronics and fuel cell technologies play an important role in the field of renewable energy. The demand for fuel cells will increase as fuel cells become the main power source for portable applications. In this application, a high-efficiency converter is an essential requirement and a key parameter of the overall system. This is because the size, cost, efficiency, and reliability of the overall system for portable applications primarily depend on the converter. Therefore, the selection of an appropriate converter topology is an important and fundamental aspect of designing a fuel cell system for portable applications as the converter alone plays a major role in determining the overall performance of the system. This paper presents a review of power electronics applications in fuel cell systems, which include various topology combinations of DC converters and AC inverters and which are primarily used in fuel cell systems for portable or stand-alone applications. This paper also reviews the switching techniques used in power conditioning for fuel cell systems. Finally, this paper addresses the current problem encountered with DC converters and AC inverter. PMID:25478581

  6. High power switch mode linear amplifiers for flexible ac transmission system

    Mwinyiwiwa, B.; Wolanski, Z.; Ooi, B.T. [McGill Univ., Montreal, Quebec (Canada). Dept. of Electrical Engineering

    1996-10-01

    The Pulse Width Modulation (PWM) technique has been proposed for the force-commutated Shunt and Series VAR Controllers and Unified Power Flow Controllers in Flexible AC Transmission Systems. The PWM converters can be operated as linear amplifiers of constant gain so that treasure trove of linear control system theory can be brought to bear more easily when applying feedback controls. For example, pole-placement and active filtering have been successfully applied in laboratory models. This paper is written as a tutorial describing the stages of signal processing: modulation, amplification and demodulation, without reference to power electronics since the solid-state switches are modelled as ON-OFF switches.

  7. Fuzzy gain auto-tuning implementation for ac speed servo and mechanical motion load system

    In this paper, in order to suppress the mechanical resonance and anti- resonance in the DC brushless motor-based AC speed servo system with two-mass mechanical motion load, the load speed observer with load disturbance estimating function, which is suitable for the load speed feedback compensation, is proposed. The auto-tuning control implementation based on fuzzy reasoning with the observer- based load speed feedback compensation is compared with conventional PI compensation scheme. The experimental results prove considerable reduction in mechanical vibration and show improved response characteristics of mechanical motion load system. (author)

  8. Spin superconductivity and ac-Josephson effect in Graphene system under strong magnetic field

    Liu, Haiwen; Jiang, Hua; Sun, Qing-Feng; Xie, X. C.; Collaborative Innovation Center of Quantum Matter, Beijing, China Collaboration

    We study the spin superconductivity in Graphene system under strong magnetic field. From the microscopically Gor'kov method combined with the Aharonov-Casher effect, we derive the effective Landau-Ginzburg free energy and analyze the time evolution of order parameter, which is confirmed to be the off-diagonal long range order. Meanwhile, we compare the ground state of spin superconductivity to the canted-antiferromagnetic state, and demonstrate the equivalence between these two states. Moreover, we give out the pseudo-field flux quantization condition of spin supercurrent, and propose an experimental measurable ac-Josephson effect of spin superconductivity in this system.

  9. Comparison of the Accuracy and Speed of Transient Mobile A/C System Simulation Models: Preprint

    Kiss, T.; Lustbader, J.

    2014-03-01

    The operation of air conditioning (A/C) systems is a significant contributor to the total amount of fuel used by light- and heavy-duty vehicles. Therefore, continued improvement of the efficiency of these mobile A/C systems is important. Numerical simulation has been used to reduce the system development time and to improve the electronic controls, but numerical models that include highly detailed physics run slower than desired for carrying out vehicle-focused drive cycle-based system optimization. Therefore, faster models are needed even if some accuracy is sacrificed. In this study, a validated model with highly detailed physics, the 'Fully-Detailed' model, and two models with different levels of simplification, the 'Quasi-Transient' and the 'Mapped- Component' models, are compared. The Quasi-Transient model applies some simplifications compared to the Fully-Detailed model to allow faster model execution speeds. The Mapped-Component model is similar to the Quasi-Transient model except instead of detailed flow and heat transfer calculations in the heat exchangers, it uses lookup tables created with the Quasi-Transient model. All three models are set up to represent the same physical A/C system and the same electronic controls. Speed and results of the three model versions are compared for steady state and transient operation. Steady state simulated data are also compared to measured data. The results show that the Quasi-Transient and Mapped-Component models ran much faster than the Fully-Detailed model, on the order of 10- and 100-fold, respectively. They also adequately approach the results of the Fully-Detailed model for steady-state operation, and for drive cycle-based efficiency predictions

  10. Shot noise in nano-electronic systems under the perturbation of ac fields

    ZHAO Hong-kang

    2007-01-01

    Current noise exists in circuits and electronic devices generally, and it exhibits specific features as the system reaches nanometer size. The noise in the nano-system where external ac fields are applied plays an important role, since the properties of the fields and the nano-system together govern the resulting noise. In this paper, we present the derivation of shot noise by employing the nonequilibrium Green's function technique. The more general formulas for the current correlation and noise spectral density are given. The system is composed of a central nanosystem coupled to electrodes, and the obtained noise formulas are related to the Green's functions of detailed central regime and the terminals. As an example, we have performed the numerical calculation on a system with a toroidal carbon nanotube coupled to normal metal leads. The noise and Fano factor show intimate relation with the structure of the system and ac fields. The Aharonov-Bohm-like behaviors on the shot noise spectral density and Fano factor are observed to exhibit oscillation structures with period of quantum flux.

  11. Nonlinear control of voltage source converters in AC-DC power system.

    Dash, P K; Nayak, N

    2014-07-01

    This paper presents the design of a robust nonlinear controller for a parallel AC-DC power system using a Lyapunov function-based sliding mode control (LYPSMC) strategy. The inputs for the proposed control scheme are the DC voltage and reactive power errors at the converter station and the active and reactive power errors at the inverter station of the voltage-source converter-based high voltage direct current transmission (VSC-HVDC) link. The stability and robust tracking of the system parameters are ensured by applying the Lyapunov direct method. Also the gains of the sliding mode control (SMC) are made adaptive using the stability conditions of the Lyapunov function. The proposed control strategy offers invariant stability to a class of systems having modeling uncertainties due to parameter changes and exogenous inputs. Comprehensive computer simulations are carried out to verify the proposed control scheme under several system disturbances like changes in short-circuit ratio, converter parametric changes, and faults on the converter and inverter buses for single generating system connected to the power grid in a single machine infinite-bus AC-DC network and also for a 3-machine two-area power system. Furthermore, a second order super twisting sliding mode control scheme has been presented in this paper that provides a higher degree of nonlinearity than the LYPSMC and damps faster the converter and inverter voltage and power oscillations. PMID:24906895

  12. Optimized list-mode acquisition and data processing procedures for ACS2 based PET systems

    PET systems using the acquisition control system version 2 (ACS2), e.g. the ECAT Exact HR PET scanner series, offer a rather restricted list-mode functionality. For instance, typical transfers of acquisition data consume a considerable amount of time. This represents a severe obstacle to the utilization of potential advantages of list-mode acquisition. In our study, we have developed hardware and software solutions which do not only allow for the integration of list-mode into routine procedures, but also improve the overall runtime stability of the system. We show that our methods are able to speed up the transfer of the acquired data to the image reconstruction and processing workstations by a factor of up to 140. We discuss how this improvement allows for the integration of list-mode-based post-processing methods such as an event-driven movement correction into the data processing environment, and how list-mode is able to improve the overall flexibility of PET investigations in general. Furthermore, we show that our methods are also attractive for conventional histogram-mode acquisition, due to the improved stability of the ACS2 system. (orig.)

  13. Efficient harvesting of wet blue-green microalgal biomass by two-aminoclay [AC]-mixture systems.

    Ji, Hye-Min; Lee, Hyun Uk; Kim, Eui Jin; Seo, Soonjoo; Kim, Bohwa; Lee, Go-Woon; Oh, You-Kwan; Kim, Jun Yeong; Huh, Yun Suk; Song, Hyun A; Lee, Young-Chul

    2016-07-01

    Blue-green microalgal blooms have been caused concerns about environmental problems and human-health dangers. For removal of such cyanobacteria, many mechanical and chemical treatments have been trialled. Among various technologies, the flocculation-based harvesting (precipitation) method can be an alternative if the problem of the low yield of recovered biomass at low concentrations of cyanobacteria is solved. In the present study, it was utilized mixtures of magnesium aminoclay [MgAC] and cerium aminoclay [CeAC] with different particle sizes to harvest cyanobacteria feedstocks with ∼100% efficiency within 1h by ten-fold lower loading of ACs compared with single treatments of [MgAC] or [CeAC]. This success was owed to the compact networks of the different-sized-ACs mixture for efficient bridging between microalgal cells. In order to determine the usage potential of biomass harvested with AC, the mass was heat treated under the reduction condition. This system is expected to be profitably utilizable in adsorbents and catalysts. PMID:27023387

  14. Coordinated Secondary Control for Balanced Discharge Rate of Energy Storage System in Islanded AC Microgrids

    Guan, Yajuan; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.

    2016-01-01

    A coordinated secondary control approach based on an autonomous current-sharing control strategy for balancing the discharge rates of energy storage systems (ESSs) in islanded AC microgrids is proposed in this paper. The coordinated secondary controller can regulate the power outputs of distributed...... generation (DG) units according to their states-of-charge (SoCs) and ESS capacities by adjusting the virtual resistances of the paralleled voltage-controlled inverters. Compared with existing controllers, the proposed control strategy not only effectively prevents operation failure caused by overcurrent...

  15. Passive AC network supplying the integration of CCC-HVDC and VSC-HVDC systems

    BIDADFAR, Ali; Abedi, Mehrdad; KARRARI, Mehdi

    2014-01-01

    The integration of a capacitor-commutated converter (CCC) high-voltage direct current (HVDC) (CCC-HVDC) and voltage source converter (VSC) HVDC (VSC-HVDC) is proposed in this paper to supply entirely passive AC networks. The key point of this integration is the flat characteristic of the DC voltage of the CCC-HVDC, which provides the condition for the VSC to connect to the CCC DC link via a current regulator. The advantages of the proposed combined infeeding system are the requirement o...

  16. Compensation methods applied in current control schemes for large AC drive systems

    Rus, D. C.; Preda, N. S.; Teodorescu, Remus; Imecs, M.

    The paper deals with modified PI current control structures for large AC drive systems which use surface mounted permanent magnet synchronous machines or squirrel-cage induction motors supplied with voltage source inverters. In order to reduce the power losses caused by high frequency switching of...... the semiconductor devices, various compensation methods are used and a modified structure for a PI current controller is proposed, to reduce the switching frequency of the inverter for the same operating frequency of the drive. Simulation, experimental development and test results are presented in...

  17. Voltage Stability Bifurcation Analysis for AC/DC Systems with VSC-HVDC

    Yanfang Wei

    2013-01-01

    Full Text Available A voltage stability bifurcation analysis approach for modeling AC/DC systems with VSC-HVDC is presented. The steady power model and control modes of VSC-HVDC are briefly presented firstly. Based on the steady model of VSC-HVDC, a new improved sequential iterative power flow algorithm is proposed. Then, by use of continuation power flow algorithm with the new sequential method, the voltage stability bifurcation of the system is discussed. The trace of the P-V curves and the computation of the saddle node bifurcation point of the system can be obtained. At last, the modified IEEE test systems are adopted to illustrate the effectiveness of the proposed method.

  18. System and component design and test of a 10 hp, 18,000 rpm AC dynamometer utilizing a high frequency AC voltage link, part 1

    Lipo, Thomas A.; Alan, Irfan

    1991-06-01

    Hard and soft switching test results conducted with one of the samples of first generation MOS-controlled thyristor (MCTs) and similar test results with several different samples of second generation MCT's are reported. A simple chopper circuit is used to investigate the basic switching characteristics of MCT under hard switching and various types of resonant circuits are used to determine soft switching characteristics of MCT under both zero voltage and zero current switching. Next, operation principles of a pulse density modulated converter (PDMC) for three phase (3F) to 3F two-step power conversion via parallel resonant high frequency (HF) AC link are reviewed. The details for the selection of power switches and other power components required for the construction of the power circuit for the second generation 3F to 3F converter system are discussed. The problems encountered in the first generation system are considered. Design and performance of the first generation 3F to 3F power converter system and field oriented induction moter drive based upon a 3 kVA, 20 kHz parallel resonant HF AC link are described. Low harmonic current at the input and output, unity power factor operation of input, and bidirectional flow capability of the system are shown via both computer and experimental results. The work completed on the construction and testing of the second generation converter and field oriented induction motor drive based upon specifications for a 10 hp squirrel cage dynamometer and a 20 kHz parallel resonant HF AC link is discussed. The induction machine is designed to deliver 10 hp or 7.46 kW when operated as an AC-dynamo with power fed back to the source through the converter. Results presented reveal that the proposed power level requires additional energy storage elements to overcome difficulties with a peak link voltage variation problem that limits reaching to the desired power level. The power level test of the second generation converter after the

  19. Real-time modeling and controls analysis using the MMS and the IBM advanced control system (ACS)

    The Penn State Nuclear Engineering Department has been used the EPRI sponsored Modular Modeling System (MMS) for research and education since 1985. The new capability presented in this paper is the adaptation of the MMS modeling procedure to produce a real-time interactive simulator. The technique additionally uses existing features of the Advanced Continuous Simulation Language (ACSL) and a commercially available control system for industrial applications, the IBM Advanced Control System (ACS). In the university environment, the IBM ACS mainframe software is used to effect the real-time interactive simulator capability. Successful demonstration of the basic mechanics for converting an existing batch mode MMS simulation to a real-time simulator using the ACS has been achieved for the MMS Deaerator example model. Future near-term work is expected to produce a real-time simulation of a primary loop of a Nuclear Steam Supply System that is used in an undergraduate Systems Interaction Course at Penn State

  20. dc and ac Josephson effect in a superconductor endash Luttinger-liquid endash superconductor system

    We calculate both the dc and the ac Josephson current through a 1-D system of interacting electrons, connected to two superconductors by tunnel junctions. We treat the (repulsive) Coulomb interaction in the framework of the one-channel, spin-1/2 Luttinger model. The Josephson current is obtained for two geometries of experimental relevance: a quantum wire and a ring. At T=0, the critical current is found to decay algebraically with increasing distance d between the junctions. The decay is characterized by an exponent which depends on the strength of the interaction. At finite temperatures T, lower than the superconducting transition temperature Tc, there is a crossover from algebraic to exponential decay of the critical current as a function of d, at a distance of the order of ℎvF/kBT. Moreover, the dependence of critical current on temperature shows nonmonotonic behavior. If the Luttinger liquid is confined to a ring of circumference L, coupled capacitively to a gate voltage and threaded by a magnetic flux, the Josephson current shows remarkable parity effects under the variation of these parameters. For some values of the gate voltage and applied flux, the ring acts as a π junction. These features are robust against thermal fluctuations up to temperatures on the order of ℎvF/kBL. For the wire geometry, we have also studied the ac-Josephson effect. The amplitude and the phase of the time-dependent Josephson current are affected by electron-electron interactions. Specifically, the amplitude shows pronounced oscillations as a function of the bias voltage due to the difference between the velocities of spin and charge excitations in the Luttinger liquid. Therefore, the ac-Josephson effect can be used as a tool for the observation of spin-charge separation. copyright 1996 The American Physical Society

  1. Lowest of AC-DC power output for electrostrictive polymers energy harvesting systems

    Meddad, Mounir; Eddiai, Adil; Hajjaji, Abdelowahed; Guyomar, Daniel; Belkhiat, Saad; Boughaleb, Yahia; Chérif, Aida

    2013-11-01

    Advances in technology led to the development of electronic circuits and sensors with extremely low electricity consumption. At the same time, structural health monitoring, technology and intelligent integrated systems created a need for wireless sensors in hard to reach places in aerospace vehicles and large civil engineering structures. Powering sensors with energy harvesters eliminates the need to replace batteries on a regular basis. Scientists have been forced to search for new power source that are able to harvested energy from their surrounding environment (sunlight, temperature gradients etc.). Electrostrictive polymer belonging to the family of electro-active polymers, offer unique properties for the electromechanical transducer technology has been of particular interest over the last few years in order to replace conventional techniques such as those based on piezoelectric or electromagnetic, these materials are highly attractive for their low-density, with large strain capability that can be as high as two orders of magnitude greater than the striction-limited, rigid and fragile electroactive ceramics. Electrostrictive polymers sensors respond to vibration with an ac output signal, one of the most important objectives of the electronic interface is to realize the required AC-DC conversion. The goal of this paper is to design an active, high efficiency power doubler converter for electrostrictive polymers exclusively uses a fraction of the harvested energy to supply its active devices. The simulation results show that it is possible to obtain a maximum efficiency of the AC-DC converter equal to 80%. Premiliminary experimental measurements were performed and the results obtained are in good agreement with simulations.

  2. Insulation measurement and supervision in live AC and DC unearthed systems

    Olszowiec, Piotr

    2014-01-01

    Low voltage unearthed (IT) AC and DC systems are commonly applied for supply of power and control circuits in industry, transportation, medical objects etc. The main reasons for their use are high reliability and numerous advantages offered by isolating them against ground. Insulation level is a decisive factor for networks operational reliability and safety. Insufficient insulation-to-ground resistance can cause various disturbances. Though ground faults in IT systems do not make networks operation impossible, they may cause severe problems with their safe functioning. In this book the most important issues concerning normal operation and ground fault phenomena are described in concise form. Numerous methods of insulation resistance and capacitance measurement in live circuits are presented. Important other procedures of  these parameters determination based on measurement and calculation are explained and reviews of selected insulation resistance measurement devices as well as earth fault locating systems ...

  3. Insulation measurement and supervision in live AC and DC unearthed systems

    Olszowiec, Piotr

    2013-01-01

    Low voltage unearthed (IT) AC and DC systems are commonly applied for supply of power and control circuits in industry, transportation, medical objects etc. The main reasons for their use are high reliability and numerous advantages offered by isolating them against ground. Insulation level is a decisive factor for networks operational reliability and safety. Insufficient insulation-to-ground resistance can cause various disturbances. Though ground faults in IT systems do not make networks operation impossible, they may cause severe problems with their safe functioning. In this book the most important issues concerning normal operation and ground fault phenomena are described in concise form. Numerous methods of insulation resistance and capacitance measurement in live circuits are presented. Important other procedures of  these parameters determination based on measurement and calculation are explained and reviews of selected insulation resistance measurement devices as well as earth fault locating systems ...

  4. Research of novel oscillating wire feeding system using the AC servo motor

    杨世彦; 于志; 刘喆

    2003-01-01

    With the background of the control of additional mechanical force droplet transfer in MIG/MAG welding, regarding the AC servo motor as core, a novel oscillating wire feeding system has been developed with excellent performances of control and dynamic acceleration which is tested. System constitution and operation principle are introduced in this paper. Influences of parameters on dynamic acceleration performance are analyzed and discussed emphatically, such as oscillating frequency, oscillating amplitude and draw-back speed. Experimental result indicates that according to the technique of welding control, the novel wire feeding system responds rapidly to various kinds of control orders of wire feeding and draw-back, and realizes flexible control of welding wire axial movement, including dynamic shifting,oscillating and so on.

  5. Ranking transmission projects in large scale systems using an AC power flow model; Priorizacao de obras em sistemas de grande porte usando um modelo AC da rede

    Melo, A.C.G. [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil); Fontoura Filho, R.N. [ELETROBRAS, Rio de Janeiro, RJ (Brazil); Peres, L.A.P. Pecorelli [FURNAS, Rio de Janeiro, RJ (Brazil); Morozowski Filho, M. [Santa Catarina Univ., Florianopolis, SC (Brazil)

    1994-12-31

    Initially, this paper summarizes the approach developed by the Brazilian Planning Criteria Working Group (GTCP/ELETROBRAS) for identifying which subset of transmission investments should be postponed to meet a pre-stablished budget constraint with the least possible impact on system performance. Next, this paper presents the main features of the computational model PRIO, which allows the application of the ranking process to large scale power systems (2,000 buses and 3,000 circuits), with as many as 100 projects to be ranked. In this model, the adequacy analysis of each system state is carried out through an AC power flow coupled to a successive linear programming based remedial actions model. Case studies with the IEEE-RTS system and a configuration of the Brazilian Southeastern are presented and discussed. (author) 7 refs., 6 figs., 5 tabs.

  6. Evaluation of reliability of on-site A.C. power systems based on maintenance records

    To the end of ascertain in what extent the evaluation of reliability of emergency diesel generators (D.G.) can be improved by means of a deeper knowledge of their operating history a study has been carried-out on 21 D.G. sets: 4 D.G. of the Caorso nuclear plant (BWR, 870 MWe) and 17 D.G. in service at 6 steam-electric fossil-fuelled plants. The major points of interest resulting from this study are: 1) reliability assessments of A.C. on-site power Systems, made on the basis of outcomes of surveillance tests, may lead to results which overestimate the real performance. 2) the unreliability of a redundant System of stand-by components is determined in large extent by unavailabilities due to scheduled and unscheduled maintenance, latent failures, tests. (authors)

  7. The sluggs survey: HST/ACS mosaic imaging of the NGC 3115 globular cluster system

    Jennings, Zachary G.; Romanowsky, Aaron J.; Brodie, Jean P.; Arnold, Jacob A. [University of California Observatories, Santa Cruz, CA 95064 (United States); Strader, Jay [Department of Physics and Astronomy, Michigan State University, East Lansing, Michigan, MI 48824 (United States); Lin, Dacheng; Irwin, Jimmy A.; Wong, Ka-Wah [Department of Physics and Astronomy, University of Alabama, Box 870324, Tuscaloosa, AL 35487 (United States); Sivakoff, Gregory R., E-mail: zgjennin@ucsc.edu [Department of Physics, University of Alberta, Edmonton, Alberta T6G 2E1 (Canada)

    2014-08-01

    We present Hubble Space Telescope/Advanced Camera for Surveys (HST/ACS) g and z photometry and half-light radii R {sub h} measurements of 360 globular cluster (GC) candidates around the nearby S0 galaxy NGC 3115. We also include Subaru/Suprime-Cam g, r, and i photometry of 421 additional candidates. The well-established color bimodality of the GC system is obvious in the HST/ACS photometry. We find evidence for a 'blue tilt' in the blue GC subpopulation, wherein the GCs in the blue subpopulation get redder as luminosity increases, indicative of a mass-metallicity relationship. We find a color gradient in both the red and blue subpopulations, with each group of clusters becoming bluer at larger distances from NGC 3115. The gradient is of similar strength in both subpopulations, but is monotonic and more significant for the blue clusters. On average, the blue clusters have ∼10% larger R {sub h} than the red clusters. This average difference is less than is typically observed for early-type galaxies but does match that measured in the literature for the Sombrero Galaxy (M104), suggesting that morphology and inclination may affect the measured size difference between the red and blue clusters. However, the scatter on the R {sub h} measurements is large. We also identify 31 clusters more extended than typical GCs, which we term ultra-compact dwarf (UCD) candidates. Many of these objects are actually considerably fainter than typical UCDs. While it is likely that a significant number will be background contaminants, six of these UCD candidates are spectroscopically confirmed as NGC 3115 members. To explore the prevalence of low-mass X-ray binaries in the GC system, we match our ACS and Suprime-Cam detections to corresponding Chandra X-ray sources. We identify 45 X-ray-GC matches: 16 among the blue subpopulation and 29 among the red subpopulation. These X-ray/GC coincidence fractions are larger than is typical for most GC systems, probably due to the increased

  8. Coordinated Stability Control of Wind-Thermal Hybrid AC/DC Power System

    Zhiqing Yao

    2015-01-01

    Full Text Available The wind-thermal hybrid power transmission will someday be the main form of transmitting wind power in China but such transmission mode is poor in system stability. In this paper, a coordinated stability control strategy is proposed to improve the system stability. Firstly, the mathematical model of doubly fed wind farms and DC power transmission system is established. The rapid power controllability of large-scale wind farms is discussed based on DFIG model and wide-field optical fiber delay feature. Secondly, low frequency oscillation and power-angle stability are analyzed and discussed under the hybrid transmission mode of a conventional power plant with wind farms. A coordinated control strategy for the wind-thermal hybrid AC/DC power system is proposed and an experimental prototype is made. Finally, real time simulation modeling is set up through Real Time Digital Simulator (RTDS, including wind power system and synchronous generator system and DC power transmission system. The experimental prototype is connected with RTDS for joint debugging. Joint debugging result shows that, under the coordinated control strategy, the experimental prototype is conductive to enhance the grid damping and effectively prevents the grid from occurring low frequency oscillation. It can also increase the transient power-angle stability of a power system.

  9. Eri silkworm (Samia ricini), a non-mulberry host system for AcMNPV mediated expression of recombinant proteins.

    Hosamani, Madhusudan; Basagoudanavar, Suresh H; Sreenivasa, B P; Inumaru, Shigeki; Ballal, Chandish R; Venkataramanan, Ramamurthy

    2015-12-20

    The baculovirus expression system (BVES) based on Autographa californica nucleopolyhedrovirus (AcMNPV) is widely used for the expression of eukaryotic proteins. Several insect cells/larvae that are permissive to AcMNPV have been routinely used as hosts to express heterologous proteins. Domesticated Eri silkworm (Samia ricini), reared in many parts of India, Japan and China, is a non-mulberry silkworm. The present study shows that the Eri silkworm larvae are susceptible to intra-haemocoelical inoculation of AcMNPV. The virus replicates in the larva, as indicated by an increased viral loads in the haemolymph upon injection of a recombinant AcMNPV carrying green fluorescent protein gene. The virus showed localized replication in different tissues including the fat body, haemocytes, tracheal matrix and in the Malphigian tubules. The larval system was successfully used to express heterologous protein, by infecting with a recombinant AcMNPV carrying the 3ABC coding sequence of foot-and-mouth disease virus (FMDV). The study shows that the Eri silkworm larva can be a potential alternative bioreactor, for scaling up of the recombinant proteins employing the baculovirus system. PMID:26467714

  10. A Series-LC-Filtered Active Damper with Grid Disturbance Rejection for AC Power-Electronics-Based Power Systems

    Wang, Xiongfei; Pang, Ying; Loh, Poh Chiang;

    2015-01-01

    This letter proposes an active damper with a series LC filter for suppressing resonances in an ac power-electronics-based power system. The added series filter capacitor helps to withstand most of the system voltage, hence, allowing a lower rated converter to be used for implementing the active...

  11. Magnetic behaviour of the UCuxGey system by AC magnetic susceptibility measurements

    We have analyzed the temperature dependence of the AC susceptibility, χac(T), of UCuxGey samples (0.800≤x, y≤1.00) applying various frequencies and magnetic field strengths up to 1 T. This was done in order to verify the reentrant ferromagnetic behaviour of UCuxGe and the antiferromagnetic behaviour of UCuGey previously observed by DC susceptibility experiments. Our χac results are discussed on the basis of existing theories. (orig.)

  12. Harmonic Analysis of AC-DC Topologies and their Impacts on Power Systems

    Mukhtiar Ahmed Mahar

    2011-01-01

    Full Text Available Power Electronic Converters are commonly used in different applications because of high efficiency and low cost. Due to latest advancement in semiconductor devices it is difficult to draw the boundaries for applications of power electronic topologies. These topologies are variable structure systems and generate harmonics during the operation which will affect the power quality when are connected to system network. Rectifier is a big family of converters and used when ac-dc conversion is needed. These converters are widely used in distribution system. Therefore, it is necessary to predict the harmonic levels of these converters and also observe their impacts on system network. Pakistan now days facing serious energy crises specially, in power sector due to increase in load demand. To bridge the gap between load demand and generation of electricity, various steps are taken by power companies and government. The steps include the up gradation of existing power plants, generation of power from rental power plants, installation of renewable power sources, taking different steps of demand side management etc. But efforts of power companies on power quality is still lacking. This research work focuses on power quality of the system network. In this work, harmonics of single phase and three phase full bridge diode rectifiers are analyzed by using the fast fourier transform method of MATLAB. The effects of harmonics on the system network are also discussed.

  13. Energy saving measures for automotive air conditioning (AC) system in the tropics

    Subiantoro, Alison; Ooi, Kim Tiow; Stimming, Ulrich

    2014-01-01

    Air conditioning (AC) is an integral component of modern cars in the tropics. However, AC usage in this region consumes a large amount of energy. In conventional internal combustion engine cars, it consumes up to 30% of the fuel, while in battery electric cars, AC may reduce the battery range by up to 40%. Fortunately, there are various ways to improve the efficiency of automotive ACs in the tropics. In this paper, three energy saving measures are discussed. These include a higher indoor temp...

  14. Simple uniaxial pressure device for ac-susceptibility measurements suitable for closed cycle refrigerator system.

    Arumugam, S; Manivannan, N; Murugeswari, A

    2007-06-01

    A simple design of the uniaxial pressure device for the measurement of ac-susceptibility at low temperatures using closed cycle refrigerator system is presented for the first time. This device consists of disc micrometer, spring holder attachment, uniaxial pressure cell, and the ac-susceptibility coil wound on stycast bobbin. It can work under pressure till 0.5 GPa and at the temperature range of 30-300 K. The performance of the system at ambient pressure is tested and calibrated with standard paramagnetic salts [Gd(2)O(3), Er(2)O(3), and Fe(NH(4)SO(4))(2)6H(2)O], Fe(3)O(4), Gd metal, Dy metal, superconductor (YBa(2)Cu(3)O(7)), manganite (La(1.85)Ba(0.15)MnO(3)), and spin glass material (Pr(0.8)Sr(0.2)MnO(3)). The performance of the uniaxial pressure device is demonstrated by investigating the uniaxial pressure dependence of La(1.85)Ba(0.15)MnO(3) single crystal with P||c axis. The Curie temperature (T(c)) decreases as a function of pressure with P||c axis (dT(c)dP(||c axis)=-11.65 KGPa) up to 46 MPa. The design is simple, is user friendly, and does not require pressure calibration. Measurement can even be made on thin and small size oriented crystals. The failure of the coil is remote under uniaxial pressure. The present setup can be used as a multipurpose uniaxial pressure device for the measurement of Hall effect and thermoelectric power with a small modification in the pressure cell. PMID:17614625

  15. Stability Analysis of Three-Phase AC Power Systems Based on Measured D-Q Frame Impedances

    Wen, Bo

    2015-01-01

    Small-signal stability is of great concern for distributed power systems with a large number of regulated power converters. These converters are constant-power loads (CPLs) exhibit a negative incremental input resistance within the output voltage regulation bandwidth. In the case of dc systems, design requirements for impedances that guarantee stability have been previously developed and are used in the design and specification of these systems. In terms of three-phase ac systems, a mathemati...

  16. Development of an in-line filter to prevent intrusion of NO2 toxic vapors into A/C systems

    Meneghelli, Barry; Mcnulty, R. J.; Springer, Mike; Lueck, Dale E.

    1995-01-01

    The hypergolic propellant nitrogen tetroxide (N2O4 or NTO) is routinely used in spacecraft launched at Kennedy Space Center (KSC) and Cape Canaveral Air Station (CCAS). In the case of a catastrophic failure of the spacecraft, there would be a release of the unspent propellant in the form of a toxic cloud. Inhalation of this material at downwind concentrations which may be as high as 20 parts per million (ppm) for 30 minutes in duration, may produce irritation to the eyes, nose and respiratory tract. Studies at both KSC and CCAS have shown that the indoor concentrations of N2O4 during a toxic release may range from 1 to 15 ppm and depend on the air change rate (ACR) for a particular building and whether or not the air conditioning (A/C) system has been shut down or left in an operating mode. This project was initiated in order to assess how current A/C systems could be easily modified to prevent personnel from being exposed to toxic vapors. A sample system has been constructed to test the ability of several types of filter material to capture the N2O4 vapors prior to their infiltration into the A/C system. Test results will be presented which compare the efficiencies of standard A/C filters, water wash systems, and chemically impregnated filter material in taking toxic vapors out of the incoming air stream.

  17. Vector control of three-phase AC machines system development in the practice

    Quang, Nguyen Phung

    2008-01-01

    Covers the area of vector control of 3-phase AC machines, in particular induction motors with squirrel-cage rotor, permanent excited synchronous motors and doubly-fed induction machines. This title summarizes the basic structure of a field-oriented controlled 3-phase AC drive and grid voltage orientated controlled wind power plant.

  18. A Secondary Voltage Control Method for an AC/DC Coupled Transmission System Based on Model Predictive Control

    Xu, Fengda; Guo, Qinglai; Sun, Hongbin;

    2015-01-01

    For an AC/DC coupled transmission system, the change of transmission power on the DC lines will significantly influence the AC systems’ voltage. This paper describes a method to coordinated control the reactive power of power plants and shunt capacitors at DC converter stations nearby, in order to...... keep the voltage of the pilot bus tracking its set point considering the DC system’s transmission schedule change. The approach is inspired by model predictive control (MPC) to compensate for predictable voltage change affected by DC side transmission power flow and the potential capacitor switching at...

  19. The vibration research of the AC dipole-girder system for CSNS/RCS

    Renhong, Liu; Huamin, Qu; Ling, Kang; Motuo, Wang; Guangyuan, Wang; Haijing, Wang

    2013-01-01

    China spallation neutron source(CSNS) is a high intensity proton accelerator based facility, and its accelerator complex includes two main parts: an H- linac and a rapid cycling synchrotron(RCS). The rcs accumulates the 80MeV proton beam, and accelerates it to 1.6GeV, with a repetition rate of 25 Hz. The AC dipole of the RCS is operated at a 25Hz sinusoidal alternating current which causes severe vibration. The vibration will influence the long-term safety and reliable operation of the magnet. The dipole magnet of RCS is active vibration equipment which is different with ground vibration accelerator. It is very important to design and research the dynamic characteristic of the dipole-girder system. This paper takes the dipole and girder as a specific model system, a method for researching the dynamic characteristic of the system is put forward by combining theoretical calculation with experimental testing. The ansys simulation method plays a very important role in the girder structure design stage. With the m...

  20. Application of Multi-Objective Evolutionary Algorithm for Optimal Reactive Power Dispatch with Flexible AC Transmission System Devices

    Abdarrazak OUALI; Hsan HADJ ABDALLAH; Tawfik GUESMI; Ismail MAROUANI

    2011-01-01

    Because their capability to change the network parameters with a rapid response and enhanced flexibility, flexible AC transmission system (FACTS) devices have taken more attention in power systems operations as improvement of voltage profile and minimizing system losses. In this way, this paper presents a multi-objective evolutionary algorithm (MOEA) to solve optimal reactive power dispatch (ORPD) problem with FACTS devices. This nonlinear multi-objective problem (MOP) consists to minimize si...

  1. An AC modulated near infrared gain calibration system for a "Violin-Mode" transimpedance amplifier, intended for advanced LIGO suspensions.

    Lockerbie, N A; Tokmakov, K V

    2016-07-01

    The background to this work was a prototype shadow sensor, which was designed for retro-fitting to an advanced LIGO (Laser Interferometer Gravitational wave Observatory) test-mass/mirror suspension, in which a 40 kg test-mass/mirror is suspended by four approximately 600 mm long by 0.4 mm diameter fused-silica suspension fibres. The shadow sensor comprised a LED source of Near InfraRed (NIR) radiation, and a "tall-thin" rectangular silicon photodiode detector, which together were to bracket the fibre under test. The photodiode was positioned so as to be sensitive (primarily) to transverse "Violin-Mode" vibrations of such a fibre, via the oscillatory movement of the shadow cast by the fibre, as this moved across the face of the detector. In this prototype shadow sensing system the photodiode was interfaced to a purpose-built transimpedance amplifier, this having both AC and DC outputs. A quasi-static calibration was made of the sensor's DC responsivity, i.e., incremental rate of change of output voltage versus fibre position, by slowly scanning a fused-silica fibre sample transversely through the illuminating beam. The work reported here concerns the determination of the sensor's more important AC (Violin-Mode) responsivity. Recognition of the correspondence between direct AC modulation of the source, and actual Violin-Mode signals, and of the transformative role of the AC/DC gain ratio for the amplifier, at any modulation frequency, f, resulted in the construction of the AC/DC calibration source described here. A method for determining in practice the transimpedance AC/DC gain ratio of the photodiode and amplifier, using this source, is illustrated by a specific numerical example, and the gain ratio for the prototype sensing system is reported over the frequency range 1 Hz-300 kHz. In fact, a maximum DC responsivity of 1.26 kV.m(-1) was measured using the prototype photodiode sensor and amplifier discussed here. Therefore, the measured AC/DC transimpedance gain

  2. Enhancing power transfer capability through flexible AC transmission system devices:a review

    Fadi M ALBATSH; Saad MEKHILEF; Shameem AHMAD; H MOKHLIS; M A HASSAN

    2015-01-01

    Global demand for power has significantly increased, but power generation and transmission capacities have not increased proportionally with this demand. As a result, power consumers suffer from various problems, such as voltage and frequency instability and power quality issues. To overcome these problems, the capacity for available power transfer of a transmission network should be enhanced. Researchers worldwide have addressed this issue by using flexible AC transmission system (FACTS) devices. We have conducted a comprehensive review of how FACTS controllers are used to enhance the avail-able transfer capability (ATC) and power transfer capability (PTC) of power system networks. This review includes a discussion of the classification of different FACTS devices according to different factors. The popularity and applications of these devices are discussed together with relevant statistics. The operating principles of six major FACTS devices and their application in increasing ATC and PTC are also presented. Finally, we evaluate the performance of FACTS devices in ATC and PTC im-provement with respect to different control algorithms.

  3. Optimization approach to unified AC/DC power flow applied to traction systems with catenary voltage constraints

    Coto García, Manuel; Arboleya Arboleya, Pablo; González Morán, Cristina

    2013-01-01

    This paper presents two innovative contributions related to the combined AC/DC power ow in railway power supply systems (RPSS). First, most of the power ow equations (the linear ones) are expressed in a compact matrix form by using graph theory based protocol. Such approach simpli- es the statement of the uni ed power ow problem and allows the train motion to be modeled without varying the system topology. Second, the problem is formulated as an Optimization Pro...

  4. An electrochemical study of corrosion protection by primer-topcoat systems on 4130 steel with ac impedance and dc methods

    Mendrek, M. J.; Higgins, R. H.; Danford, M. D.

    1988-01-01

    To investigate metal surface corrosion and the breakdown of metal protective coatings, the ac impedance method is applied to six systems of primer coated and primer topcoated 4130 steel. Two primers were used: a zinc-rich epoxy primer and a red lead oxide epoxy primer. The epoxy-polyamine topcoat was used in four of the systems. The EG and G-PARC Model 368 ac impedance measurement system, along with dc measurements with the same system using the polarization resistance method, were used to monitor changing properties of coated 4230 steel disks immersed in 3.5 percent NaCl solutions buffered at pH 5.4 over periods of 40 to 60 days. The corrosion system can be represented by an electronic analog called an equivalent circuit consisting of resistors and capacitors in specific arrangements. This equivalent circuit parallels the impedance behavior of the corrosion system during a frequency scan. Values for the resistors and capacitors, that can be assigned in the equivalent circuit following a least-squares analysis of the data, describe changes that occur on the corroding metal surface and in the protective coatings. Two equivalent circuits have been determined that predict the correct Bode phase and magnitude of the experimental sample at different immersion times. The dc corrosion current density data are related to equivalent circuit element parameters. Methods for determining corrosion rate with ac impedance parameters are verified by the dc method.

  5. Reliability evaluation of emergency AC power systems based on operating experience at U.S. nuclear power plants

    The reliability of emergency AC power Systems has been under study at the U.S. Nuclear Regulatory Commission and by its contractors for several years. This paper provides the results of work recently performed to evaluate past U.S. nuclear power plant emergency AC power System reliability performance using system level data. Operating experience involving multiple diesel generator failures, unavailabilities, and simultaneous occurrences of failures and out of service diesel generators were used to evaluate reliability performance at individual nuclear power plants covering a 9 year period from 1976 through 1984. The number and nature of failures and distributions of reliability evaluation results are provided. The results show that plant specific performance varied considerably during the period with a large number achieving high reliability performance and a smaller number accounting for lower levels of reliability performance. (author)

  6. Damping effects of Supplementary Control Signals for Enhancement of Transient Stability in AC-DC Power Systems

    Uma Vani M

    2010-07-01

    Full Text Available This paper discusses the impact of HVDC on Power System Stability and proposes a novel controlmechanism to augment the system angle stability. The effectiveness of the proposed controller is demonstrated by asingle machine-infinite bus system example. The performance of this controller, in comparison to the conventionalP and P-I controllers, is found to be very effective as a supplementary PID controller in damping generator rotoroscillations. The supplementary controls using signals derived from the AC systems to modulate the DC quantitiesis presented in this paper.

  7. Analyze and experiment on AC magnetic field's effect to fiber optic gyroscopes in compact stabilization control systems

    Zhang, Chao; Mao, Yao; Tian, Jing; Li, Zhijun

    2015-10-01

    Fiber optic gyroscopes (FOG) are getting more and more attention in areas such as stabilization control systems as they are all solid state and have a wide bandwidth. In stabilization systems that require wide bandwidth control, motors are usually used as actuating mechanism for active disturbance restrain. Voice coil motors (VCMs) are usually used in compact stabilization systems that require large torque and fast response. However, AC magnetic field, which can affect the output of FOG due to Faraday effect, will be generated during operation of VCMs. The frequency range affected by the AC magnetic field to the FOG's output is the same as VCMs drive signal frequency range, which is also exactly the stabilization system's working range. Therefore the effect of the AC magnetic field to FOGs must be evaluated to verify the feasibility of a stable system design that uses both FOGs and VCMs. In this article, the basic structure and operating principle of stabilization system is introduced. The influence of AC magnetic field to FOG is theoretically analyzed. The magnetic field generated by VCMs is numerically simulated based on the theory deduction of the magnetic field near energized wires. To verify the influence of the VCM generated magnetic field to the FOGs in practical designs, a simplified random fiber coil model is built for it's hard to accurately test the exact polarize axis's twisting rate in a fiber coil. The influence to the FOG's output of different random coil model is simulated and the result shows a same trend that the influence of the VCM's magnetic field to the FOG is reduced as the distance between the VCM and the FOG increasing. The influence of a VCM to a FOG with the same parameters is experimentally tested. In the Fourier transformed FOG data the same frequency point as the VCM drive signal frequency can be read. The result fit simulated result that as the distance increases, the influence decreases. The amplitude of the frequency point is just

  8. Module Twelve: Series AC Resistive-Reactive Circuits; Basic Electricity and Electronics Individualized Learning System.

    Bureau of Naval Personnel, Washington, DC.

    The module covers series circuits which contain both resistive and reactive components and methods of solving these circuits for current, voltage, impedance, and phase angle. The module is divided into six lessons: voltage and impedance in AC (alternating current) series circuits, vector computations, rectangular and polar notation, variational…

  9. Formation of compounds in the quasi-binary systems AcX4-MX2 (Ac = Th, U; M = Ca, Sr, Ba, Eu, Ge, Sn, Pb; X = Br, I)

    T,x-phase diagrams of the systems ThI4-SnI2, ThI4-PbI2, ThI4-CaI2 and ThI4-SrI2 were established using thermoanalysis and X-ray methods. The only ternary compounds have a 1:1 composition. Further AcMX6 compounds (Ac: Th, U; M: Ca, Sr, Ba, Eu, Ge, Sn, Pb; X: Br, I) were synthesized and their structures investigated. Four structure types are found depending on the temperature and the Ac/M combinations. The structures of γ-ThSnI6 and β-ThSnI6 were determined with single crystal methods as representatives of a whole series of isotypic compounds. (orig.)

  10. Near-optimal order-reduced control for A/C (air-conditioning) system of EVs (electric vehicles)

    This work is aimed to investigate the regulation problem for thermal comfortableness and propose control strategies for cabin environment of EVs (electric vehicles) by constructing a reduced-scale A/C (air-conditioning) system which mainly consists of two modules: ECB (environmental control box) and AHU (air-handling unit). Temperature and humidity in the ECB can be regulated by AHU via cooling, heating, mixing air streams and adjusting speed of fans. To synthesize the near-optimal controllers, the mathematical model for the system thermodynamics is developed by employing the equivalent lumped heat capacity approach, energy/mass conservation principle and the heat transfer theories. In addition, from the clustering pattern of system eigenvalues, the thermodynamics of the interested system can evidently be characterized by two-time-scale property. That is, the studied system can be decoupled into two subsystems, slow mode and fast mode, by singular perturbation technique. As to the optimal control strategies for EVs, by taking thermal comfortableness, humidity and energy consumption all into account, a series of optimal controllers is synthesized on the base of the order-reduced thermodynamic model. The feedback control loop for the experimental test rig is examined and realized by the aid of the control system development kit dSPACE DS1104 and the commercial software MATLAB/Simulink. To sum up, the intensive computer simulations and experimental results verify that the performance of the near-optimal order-reduced control law is almost as superior as that of standard LQR (Linear-Quadratic Regulator). - Highlights: • A reduced-scale test rig for A/C (air-conditioning) system to imitate the temperature/humidity of cabin in EV (electric vehicle) is constructed. • The non-linear thermodynamic model of A/C system can be decoupled by singular perturbation technique. • The temperature/humidity in cabin is regulated to the desired values by proposed optimal

  11. Error Assessment of Solar Irradiance Forecasts and AC Power from Energy Conversion Model in Grid-Connected Photovoltaic Systems

    Gianfranco Chicco

    2015-12-01

    Full Text Available Availability of effective estimation of the power profiles of photovoltaic systems is essential for studying how to increase the share of intermittent renewable sources in the electricity mix of many countries. For this purpose, weather forecasts, together with historical data of the meteorological quantities, provide fundamental information. The weak point of the forecasts depends on variable sky conditions, when the clouds successively cover and uncover the solar disc. This causes remarkable positive and negative variations in the irradiance pattern measured at the photovoltaic (PV site location. This paper starts from 1 to 3 days-ahead solar irradiance forecasts available during one year, with a few points for each day. These forecasts are interpolated to obtain more irradiance estimations per day. The estimated irradiance data are used to classify the sky conditions into clear, variable or cloudy. The results are compared with the outcomes of the same classification carried out with the irradiance measured in meteorological stations at two real PV sites. The occurrence of irradiance spikes in “broken cloud” conditions is identified and discussed. From the measured irradiance, the Alternating Current (AC power injected into the grid at two PV sites is estimated by using a PV energy conversion model. The AC power errors resulting from the PV model with respect to on-site AC power measurements are shown and discussed.

  12. A Sequential AC/DC Power Flow Algorithm for Networks Containing Multi-terminal VSC HVDC Systems

    Beerten, Jef; Cole, Stijn; Belmans, Ronnie

    2010-01-01

    In this paper, a sequential AC/DC power flow algorithm is proposed to solve networks containing Multi-terminal Voltage Source Converter High Voltage Direct Current (VSC MTDC) systems. In VSC HVDC technology, the converter losses add up to a significant fraction of the overall system losses. However, they are often neglected or not taken into account in a proper manner in VSC HVDC power flows. The algorithm put forward in this paper takes the converter losses into account using a generalized c...

  13. Speed Control of DC Motor using AC/AC/DC Converter Based on Intelligent Techniques

    Rakan Kh Antar

    2013-05-01

    Full Text Available    This paper describes the application of ac/ac/dc and ac/dc converters to control the speed of a separately excited DC motor. Artificial neural network and PI controller are trained to select the desired values of firing angles for triggering thyristors of the ac/ac/dc and ac/dc bridge converters in order to control the speed of the dc motor at a desired value with constant and different load torques in order to obtain the best speed response. Simulation results show that the rising time for ac/dc and ac/ac/dc converters at 250rpm are reduced about 79% and 89% respectively, while delay time it reduced about 69% and 64% respectively. Therefore, speed response of the dc motor is more efficient for closed loop system compared with open loop also the response of ac/ac/dc converter is better than ac/dc converter.

  14. Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition

    The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity

  15. Predictive Current Control of a 7-level AC-DC back-to-back Converter for Universal and Flexible Power Management System

    Bifaretti, Steffano; Zanchetta, Pericle; Iov, Florin;

    2008-01-01

    The paper proposes a novel power conversion system for Universal and Flexible Power Management (UNIFLEX-PM) in Future Electricity Network. Its structure is based on a back-to-back three-phase AC-DC 7-level converter; each AC side is connected to a different PCC, representing the main grid and/or ...... numerous network conditions such as voltage unbalance, frequency excursions and harmonic distortion....

  16. AC/DC Power Conversion System Using 3/9 Multiphase Transformer

    Ahmad Hoteit

    2012-07-01

    Full Text Available The main idea of this paper is to build a 3/9 AC multiphase transformer for conversion into DC power through the rectifier circuit which contains 18 pulse rectification with a ripple factor less than 0.8% produced by the odd phase number 9. This modeling has been simulated using Orcad simulation software, the nine phases are out of the main three phase power lines, each phase is shifted from the other by 40o (360o/9, this type of transformer is often required in aerospace, railway and automobile applications.

  17. An 225Ac/213Bi generator system for therapeutic clinical applications: construction and operation

    A method for construction and operation of an 225Ac/213Bi generator capable of producing 25-100 mCi of 213Bi suitable for clinical antibody labeling is described. The generator has been designed to have an effective lifetime of several weeks, producing up to six therapeutic doses of radionuclide per day. To date, 57 clinical doses have been prepared and injected into patients using the described 213Bi generator. Factors such as radiation damage, radioprotection, iodide eluate chemistry, radiolabeling chemistry and radionuclidic purity are addressed

  18. A.c. susceptibility study of CaCl2 doped copper–zinc ferrite system

    A Y Lipare; P N Vasambekar; A S Vaingankar

    2003-08-01

    Polycrystalline soft ferrites, Zn$_x$ Cu$_{1–x}$ Fe2O4 ( = 0.30, 0.50, 0.70, 0.80 and 0.90), doped with controlled amount of calcium chloride (CaCl2) were prepared by standard ceramic route and studied for a.c. susceptibility. X-ray diffraction studies of the compositions reveal formation of single-phase cubic spinel. The values of lattice constant increase as doping percentage of CaCl2 increased from 0.01% to 0.05% and afterwards decrease slightly. The presence of chlorine ions is confirmed by absorption peak in far IR spectra near 650 cm-1 for all the samples. The variation of a.c. susceptibility with temperature shows the existence of single domain structure for = 0.3 and exhibits transition from single domain to multidomain structure with increased Ca2+ contents from 0.01 to 0.1%. The composition, = 0.5, shows multidomain structure independent of Ca2+ content. The samples for = 0.70, 0.80 and 0.90 show paramagnetic behaviour at and above room temperature.

  19. AC drive system with 4 in-wheel motor for high performance electric vehicle. Yonrin Kudo koseino denki jidoshayo AC drive system

    Terashima, M.; Ashikaga, T.; Mizuno, T. (Meidensha Corp., Tokyo (Japan)); Yamamoto, T.; Natori, K.; Fujiwara, N. (The Tokyo Electric Power Co. Inc., Tokyo (Japan))

    1994-01-20

    This paper describes the following matters on a driving motor and its control system used in the electric vehicle, IZA, that has achieved performance comparable to that of gasoline-fueled cars: a system has been employed that synchronous motors using rare earth magnets as the magnetic field are assembled into each of the four wheels to drive them directly. Taking into consideration that a maximum torque of about eight times that of the rating would be required, discussions have been given on effects of the magnetic saturation in the field, and a selection has been made on a magnet shape that can reduce torque pulsation of the motor. An incident of current uncontrollability caused by induction voltage in the motor during high rotation speeds has been avoided by demagnetization control to have achieved a speed of 176 km/h. The control system has been structured based on the control methods that consider the battery characteristics, inverter loss, and motor loss, realizing a torque control over a wide range. The motors, the inverters, and the drive system have been verified to have near design performance according to evaluation tests. 12 refs., 13 figs., 2 tabs.

  20. Application of ACS6000C Cycloconverter in the Hoist System of Coal Mine%ACS6000C交流调速技术在矿井提升系统的应用

    孟强; 廉鲁炜

    2013-01-01

    本文介绍一种全数字可编程模块化交流调速控制系统,ABB公司ACS6000C系统,其独特的应用和电机控制处理板(AMC3板),能进行高速动态信息处理以及对专门的控制系统进行调节和控制,在矿井提升机同步电机的调速控制应用中显现出高性能的响应和精确的力矩控制。实现了矿井提升机的安全、高效、稳定运行。%This paper introduces a digital programmable modular AC speed control system, ACS6000C system of ABB company, the applica-tion and motor unique control board (AMC3 board), can make high speed dynamic information processing and control and adjust the control system of the special, in the synchronous motor in mine hoist control showing response high performance and precise torque control applica-tions. The mine hoist safe, efficient and stable operation of machine.

  1. Emergency ac power systems operating experience at US nuclear power plants, 1976 through 1983

    Success and failure data of test and emergency starts of emergency ac power sources (diesel generators) at US nuclear power plants were collected and evaluated to estimate diesel generator reliability parameters. A regression analysis of the estimates of the probability of failure to start based on surveillance test data from 1976 through 1983 indicates that the probability of failure to start has been decreasing. However, the reliability of diesel generator performance during losses of off-site power for 1981 through 1983 was less than expected based on the test data estimates. The failures that occurred during losses of off-site power were reviewed to determine why the calculated failure to start was greater than expected, and possible explanations for this high value are presented. The subsystems involved in diesel generator subsystem failures were categorized to determine whether there were any dominant failure modes. The results indicate that further significant improvement in diesel generator reliability will require improvement of many subsystems

  2. Advanced Technology Application Station Blackout Core Damage Frequency Reduction - The Contribution of an AC Independent Core Residual Heat Removal System

    An event of station blackout (SBO) can result in severe core damage and undesirable consequences to the public and the environment. To cope with an SBO, nuclear reactors are provided with protection systems that automatically shut down the reactor, and with safety systems to remove the core residual heat. In order to reduce core damage frequency, the design of new reactors incorporates passive systems that rely only on natural forces to operate. This paper presents an evaluation of the SBO core damage frequency of a PWR reactor being designed in Brazil. The reactor has two core residual heat removal systems - an AC dependent system, and a passive system. Probabilistic safety assessment is applied to identify failure scenarios leading to SBO core damage. The SBO is treated as an initiating event, and fault trees are developed to model those systems required to operate in SBO conditions. Event trees are developed to assist in the evaluation of the possible combinations of success or failure of the systems required to cope with an SBO. The evaluation is performed using SAPHIRE, as the software for reliability and risk assessment. It is shown that a substantial reduction in the core damage frequency can be achieved by implementing the passive system proposed for the LABGENE reactor design. Keywords: Station blackout, passive safety system, core damage frequency. (author)

  3. Station Blackout Core Damage Frequency Reduction - The Contribution of an AC Independent Core Residual Heat Removal System

    An event of station blackout (SBO) can result in severe core damage and undesirable consequences to the public and the environment. To cope with an SBO, nuclear reactors are provided with protection systems that automatically shut down the reactor, and with safety systems to remove the core residual heat. In order to reduce core damage frequency, the design of new reactors incorporates passive systems that rely only on natural forces to operate. This paper presents an evaluation of the SBO core damage frequency of a PWR reactor being designed in Brazil. The reactor has two core residual heat removal systems - an AC dependent system, and a passive system. Probabilistic safety assessment is applied to identify failure scenarios leading to SBO core damage. The SBO is treated as an initiating event, and fault trees are developed to model those systems required to operate in SBO conditions. Event trees are developed to assist in the evaluation of the possible combinations of success or failure of the systems required to cope with an SBO. The evaluation is performed using SAPHIRE, as the software for reliability and risk assessment. It is shown that a substantial reduction in the core damage frequency can be achieved by implementing the passive system proposed for the LABGENE reactor design. Keywords: Station blackout, passive safety system, core damage frequency. (author)

  4. MOEA based design of decentralized controllers for LFC of interconnected power systems with nonlinearities, AC-DC parallel tie-lines and SMES units

    A new design of Multi-Objective Evolutionary Algorithm based decentralized controllers for load-frequency control of interconnected power systems with Governor Dead Band and Generation Rate Constraint nonlinearities, AC-DC parallel tie-lines and Superconducting Magnetic Energy Storage (SMES) units, is proposed in this paper. The HVDC link is used as system interconnection in parallel with AC tie-line to effectively damp the frequency oscillations of AC system while the SMES unit provides bulk energy storage and release, thereby achieving combined benefits. The proposed controller satisfies two main objectives, namely, minimum Integral Squared Error of the system output and maximum closed-loop stability of the system. Simulation studies are conducted on a two area interconnected power system with nonlinearities, AC-DC tie-lines and SMES units. Results indicate that the proposed controller improves the transient responses and guarantees the closed-loop stability of the overall system even in the presence of system nonlinearities and with parameter changes.

  5. MOEA based design of decentralized controllers for LFC of interconnected power systems with nonlinearities, AC-DC parallel tie-lines and SMES units

    Ganapathy, S., E-mail: ganapathy1967@gmail.co [Department of Electrical Engineering, Annamalai University, Annamalainagar, Tamilnadu 608 002 (India); Velusami, S. [Department of Electrical Engineering, Annamalai University, Annamalainagar, Tamilnadu 608 002 (India)

    2010-05-15

    A new design of Multi-Objective Evolutionary Algorithm based decentralized controllers for load-frequency control of interconnected power systems with Governor Dead Band and Generation Rate Constraint nonlinearities, AC-DC parallel tie-lines and Superconducting Magnetic Energy Storage (SMES) units, is proposed in this paper. The HVDC link is used as system interconnection in parallel with AC tie-line to effectively damp the frequency oscillations of AC system while the SMES unit provides bulk energy storage and release, thereby achieving combined benefits. The proposed controller satisfies two main objectives, namely, minimum Integral Squared Error of the system output and maximum closed-loop stability of the system. Simulation studies are conducted on a two area interconnected power system with nonlinearities, AC-DC tie-lines and SMES units. Results indicate that the proposed controller improves the transient responses and guarantees the closed-loop stability of the overall system even in the presence of system nonlinearities and with parameter changes.

  6. ac bidirectional motor controller

    Schreiner, K.

    1988-01-01

    Test data are presented and the design of a high-efficiency motor/generator controller at NASA-Lewis for use with the Space Station power system testbed is described. The bidirectional motor driver is a 20 kHz to variable frequency three-phase ac converter that operates from the high-frequency ac bus being designed for the Space Station. A zero-voltage-switching pulse-density-modulation technique is used in the converter to shape the low-frequency output waveform.

  7. Emergency ac power systems operating experience at U.S. nuclear power plants - 1976 through 1983

    Success and failure data of test and emergency starts of emergency ac power sources (diesel generators) at U.S. nuclear power plants were collected and evaluated to estimate diesel generator reliability parameters. A regression analysis of the estimates of the probability of failure to start based on surveillance test data from 1976 through 1983 indicates that the probability of failure to start has been decreasing. However, the reliability of diesel generator performance during losses of off-site power for 1981 through 1983 was less than expected based on the test data estimates. The failures that occurred during losses of off-site power were reviewed to determine why the calculated failure to start was greater than expected, and possible explanations for this high value are presented. The subsystems involved In diesel generator subsystem failures were categorized to determine whether there were any dominant failure modes. The results indicate that further significant Improvement in diesel generator reliability will require improvement of many subsystems. (author)

  8. Max Launch Abort System (MLAS) Pad Abort Test Vehicle (PATV) II Attitude Control System (ACS) Integration and Pressurization Subsystem Dynamic Random Vibration Analysis

    Ekrami, Yasamin; Cook, Joseph S.

    2011-01-01

    In order to mitigate catastrophic failures on future generation space vehicles, engineers at the National Aeronautics and Space Administration have begun to integrate a novel crew abort systems that could pull a crew module away in case of an emergency at the launch pad or during ascent. The Max Launch Abort System (MLAS) is a recent test vehicle that was designed as an alternative to the baseline Orion Launch Abort System (LAS) to demonstrate the performance of a "tower-less" LAS configuration under abort conditions. The MLAS II test vehicle will execute a propulsive coast stabilization maneuver during abort to control the vehicles trajectory and thrust. To accomplish this, the spacecraft will integrate an Attitude Control System (ACS) with eight hypergolic monomethyl hydrazine liquid propulsion engines that are capable of operating in a quick pulsing mode. Two main elements of the ACS include a propellant distribution subsystem and a pressurization subsystem to regulate the flow of pressurized gas to the propellant tanks and the engines. The CAD assembly of the Attitude Control System (ACS) was configured and integrated into the Launch Abort Vehicle (LAV) design. A dynamic random vibration analysis was conducted on the Main Propulsion System (MPS) helium pressurization panels to assess the response of the panel and its components under increased gravitational acceleration loads during flight. The results indicated that the panels fundamental and natural frequencies were farther from the maximum Acceleration Spectral Density (ASD) vibrations which were in the range of 150-300 Hz. These values will direct how the components will be packaged in the vehicle to reduce the effects high gravitational loads.

  9. Observations of spatiotemporal instabilities in the strong-driving regime of an AC-driven nonlinear Schr\\"odinger system

    Anderson, Miles; Coen, Stéphane; Erkintalo, Miro; Murdoch, Stuart G

    2016-01-01

    Localized dissipative structures (LDS) have been predicted to display a rich array of instabilities, yet systematic experimental studies have remained scarce. We have used a synchronously-driven optical fiber ring resonator to experimentally study LDS instabilities in the strong-driving regime of the AC-driven nonlinear Schr\\"odinger equation (also known as the Lugiato-Lefever model). Through continuous variation of a single control parameter, we have observed a string of theoretically predicted instability modes, including irregular oscillations and chaotic collapses. Beyond a critical point, we observe behaviour reminiscent of a phase transition: LDSs trigger localized domains of spatiotemporal chaos that invade the surrounding homogeneous state. Our findings directly confirm a number of theoretical predictions, and they highlight that complex LDS instabilities can play a role in experimental systems.

  10. Application of Multi-Objective Evolutionary Algorithm for Optimal Reactive Power Dispatch with Flexible AC Transmission System Devices

    Abdarrazak OUALI

    2011-12-01

    Full Text Available Because their capability to change the network parameters with a rapid response and enhanced flexibility, flexible AC transmission system (FACTS devices have taken more attention in power systems operations as improvement of voltage profile and minimizing system losses. In this way, this paper presents a multi-objective evolutionary algorithm (MOEA to solve optimal reactive power dispatch (ORPD problem with FACTS devices. This nonlinear multi-objective problem (MOP consists to minimize simultaneously real power loss in transmission lines and voltage deviation at load buses, by tuning parameters and searching the location of FACTS devices. The constraints of this MOP are divided to equality constraints represented by load flow equations and inequality constraints such as, generation reactive power sources and security limits at load buses. Two types of FACTS devices, static synchronous series compensator (SSSC and unified power flow controller (UPFC are considered. A comparative study regarding the effects of an SSSC and an UPFC on voltage deviation and total transmission real losses is carried out. The design problem is tested on a 6-bus system.

  11. A 65-kV insulated gate bipolar transistor switch applied in damped AC voltages partial discharge detection system

    Jiang, J.; Ma, G. M.; Luo, D. P.; Li, C. R.; Li, Q. M.; Wang, W.

    2014-02-01

    Damped AC voltages detection system (DAC) is a productive way to detect the faults in power cables. To solve the problems of large volume, complicated structure and electromagnetic interference in existing switches, this paper developed a compact solid state switch based on electromagnetic trigger, which is suitable for DAC test system. Synchronous electromagnetic trigger of 32 Insulated Gate Bipolar Transistors (IGBTs) in series was realized by the topological structure of single line based on pulse width modulation control technology. In this way, external extension was easily achieved. Electromagnetic trigger and resistor-capacitor-diode snubber circuit were optimized to reduce the switch turn-on time and circular layout. Epoxy encapsulating was chosen to enhance the level of partial discharge initial voltage (PDIV). The combination of synchronous trigger and power supply is proposed to reduce the switch volume. Moreover, we have overcome the drawback of the electromagnetic interference and improved the detection sensitivity of DAC by using capacitor storage energy to maintain IGBT gate driving voltage. The experimental results demonstrated that the solid-state switch, with compact size, whose turn-on time was less than 400 ns and PDIV was more than 65 kV, was able to meet the actual demands of 35 kV DAC test system.

  12. Online fault location on crossbonded AC cables in underground transmission systems

    F. Jensen, Christian; Bak, Claus Leth; Gudmundsdottir, Unnur Stella

    2014-01-01

    of a 245 kV crossbonded cable system, connecting the newly installed 400 MW Danish offshore wind farm Anholt to the main grid, are obtained and used to verify the proposed system. Furthermore, extensive simulation data created in PSCAD/EMTDC is used in order to examine the robustness of the system to......In this paper, a fault locator system specifically designed for crossbonded cables is described. Electromagnetic wave propagation theory for crossbonded cables with focus on fault location purposes is discussed. Based on this, the most optimal modal component and input signal to the fault locator...... system are identified. The fault locator system uses the Wavelet Transform both to create reliable triggers in the units and to estimate the fault location based on time domain signals obtained in the substations by two fault locator units. Field measurements of faults artificially created on a section...

  13. Adaptive Curtailment Plan with Energy Storage for AC/DC Combined Distribution Systems

    Seungmin Jung

    2016-08-01

    Full Text Available For developing a large-scale combined system with a number of distributed resources, an appropriate compensation strategy based on the system components and changeable condition must be configured to handle the characteristics of the internal systems. Since renewable sources generate various fluctuations, the compensation plans for the storage device connected along with the sources should be supported by a precise expectation method. A cooperative strategy involving the sharing of the DC section with environmentally sensitive generators, like photovoltaic system (PVs or waves, demands appropriate ESS compensation solutions, owing to its complexity. An active power-control algorithm with voltage-expectation based on the DC power flow is introduced in this paper and is applied in the designed case studies performed on the electromagnetic transient simulation. DC based multi-generation system is composed by applying tidal generator and super capacitor. To utilize wind energy, an offshore wind–wave generation system was utilized in the verification process.

  14. Online fault location on crossbonded AC cables in underground transmission systems

    F. Jensen, Christian; Bak, Claus Leth; Gudmundsdottir, Unnur Stella

    2014-01-01

    In this paper, a fault locator system specifically designed for crossbonded cables is described. Electromagnetic wave propagation theory for crossbonded cables with focus on fault location purposes is discussed. Based on this, the most optimal modal component and input signal to the fault locator system are identified. The fault locator system uses the Wavelet Transform both to create reliable triggers in the units and to estimate the fault location based on time domain signals obtained in th...

  15. Colloid Thruster for Attitude Control Systems (ACS) and Tip-off Control Applications Project

    National Aeronautics and Space Administration — Busek proposes to develop and deliver a complete engineering model colloid thruster system, capable of thrust levels and lifetimes required for spacecraft...

  16. Online Fault Location on AC Cables in Underground Transmission Systems using Sheath Currents

    Jensen, Christian Flytkjær; Nanayakkarab, Kasun; Rajapakse, Athula;

    2014-01-01

    This paper studies online travelling wave methods for fault location on a crossbonded cable system using sheath currents. During the construction of the electrical connection to the 400 MW off shore wind farm Anholt, it was possible to perform measurements on a 38.4 km crossbonded cable system. At...

  17. Simultaneous distribution of AC and DC power

    Polese, Luigi Gentile

    2015-09-15

    A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.

  18. The dissipative two-level system under strong ac-driving: a Floquet-van-Vleck approach

    Hausinger, Johannes

    2009-01-01

    We study the dissipative dynamics of a two-level system (TLS) exposed to strong ac-driving. By combing Floquet and Van Vleck perturbation theory in the TLS tunneling matrix element, we diagonalize the time-dependent Hamiltonian and provide corrections to the renormalized Rabi frequency of the TLS, which are valid for both a biased and unbiased TLS and go beyond the known high-frequency and rotating wave results. In order to mimick environmental influences on the TLS, we couple the system weakly to a thermal bath and solve analytically the corresponding Floquet-Bloch-Redfield master equation. We give a closed expression for the relaxation and dephasing rates of the TLS and discuss their behaviour under variation of the driving amplitude. Further, we examine the robustness of coherent destruction of tunneling (CDT) and driving-induced tunneling oscillations (DITO). We show that also for a moderate driving frequency an almost complete suppression of tunneling can be achieved and demonstrate the sensitiveness of ...

  19. Colloid Thruster for Attitude Control Systems (ACS) and Tip-off Control Applications Project

    National Aeronautics and Space Administration — We propose to develop and test key technologies needed for an integrated, high thrust colloid thruster system with no moving parts, for spacecraft attitude control...

  20. Modeling and analysis of harmonic resonance in a power electronics based AC power system

    Wang, Xiongfei; Blaabjerg, Frede; Chen, Zhe; Wu, Weimin

    -based analysis approach is adopted and expanded to a meshed and balanced three-phase power network. An impedance ratio derivation method is proposed based on the nodal admittance matrix. By this means, the contribution of each inverter to the system resonance modes can be easily predicted by the Nyquist......The dynamic interactions among the interconnected power converters may bring in harmonic resonance in a power electronics based power system. This paper addresses this issue in a power system dominated by multiple current- and voltage-controlled inverters with LCL- and LC-filters. The impedance...... stability criterion. To validate the theoretical analysis, the time domain simulations and experimental tests on a three-inverter-based system are presented....

  1. Modeling and analysis of harmonic resonance in a power electronics based AC power system

    Wang, Xiongfei; Blaabjerg, Frede; Chen, Zhe; Wu, Weimin

    2013-01-01

    The dynamic interactions among the interconnected power converters may bring in harmonic resonance in a power electronics based power system. This paper addresses this issue in a power system dominated by multiple current- and voltage-controlled inverters with LCL- and LC-filters. The impedance-based analysis approach is adopted and expanded to a meshed and balanced three-phase power network. An impedance ratio derivation method is proposed based on the nodal admittance matrix. By this means,...

  2. Online fault location on AC cables in underground transmission systems using screen currents

    Jensen, Christian Flytkjær; Nanayakkara, O.M.K.K; Rajapakse, Athula;

    This paper studies online travelling wave methods for fault location on a crossbonded cable system using screen currents. During the construction of the electrical connection to the 400 MW off shore wind farm Anholt, it was possible to perform measurements on a 38.4 km crossbonded cable system. At...... coils if the screen currents contain the necessary information for accurate fault location. In this paper, this is examined by analysis of field measurements and through a study of simulations. The wavelet transform and visual inspection methods are used and the accuracy is compared. Field measurements...

  3. Online Location of Faults on AC Cables in Underground Transmission Systems

    Jensen, Christian Flytkjær

    deviations in the parameters of the OHL will result in large errors for fault location in the cable section. Field measurements showing the effect of short circuits on crossbonded systems conducted on parts of the electrical connection to the Anholt offshore wind farm are performed. The purpose is to examine...... whether neural networks can be trained using data from state-of-theart cable models to predict and estimate the fault location on crossbonded cables. Numerous measurements of different short circuits are carried out and it is concluded that the state-ofthe-art models predict general behaviour of the...... crossbonded system under fault conditions well, but the accuracy of the calculated impedance is low for fault location purposes. The neural networks can therefore not be trained and no impedance-based fault location method can be used for crossbonded cables or hybrid lines. The use of travelling wave...

  4. Modal analysis of AC quadrupole magnet system for CSNS/RCS

    The quadrupole magnet of the China Spallation Neutron Source (CSNS) Rapid-cycling Synchrotron (RCS) is operated at a 25 Hz sinusoidal alternating current which causes severe vibration. The vibration will influence the long-term safety and reliable operation of the quadrupole magnet. By taking the quadrupole magnet and girder as specific model system, a method for analyzing and studying the dynamic characteristic of the system is put forward by combining theoretical calculation with experimental testing. The theoretical modal analysis results coincide with the experimental testing results. It shows that the dynamic characteristic parameters of the structure can be obtained by modal analysis which will provide a theoretical basis for the further study and the magnet girder optimal design of CSNS/RCS. (authors)

  5. AC Power Routing System in Home Based on Demand and Supply Utilizing Distributed Power Sources

    Takashi Hikihara

    2011-04-01

    Full Text Available To help reduce consumption of fossil fuels, renewable, natural and distributed power sources are being adopted. These alternative energy sources inevitably show fluctuations in the amount of output power, frequency, and voltage. The suppression of such fluctuations is a key issue to avoid disturbances in power grids. A similar situation arises as far as the regulation of in-home power flow is concerned. We focus on the quality of supplied and demanded power in particular. In this paper, an in-home power distribution system based on information of power is proposed. The system is developed in order to integrate power dispatch and communication. The experimental results show the feasibility of new flexible and efficient power management approaches.

  6. Novel AC Side P&O Maximum Power transfer control for Grid Connected Photovoltaic Systems

    Hanif, Mohamed Moin; Basu, Malabika; Gaughan, Kevin

    2010-01-01

    Grid connected Photovoltaic inverters can convert PV energy into electricity with very high efficiencies. Power from the PV panels fluctuates depending on various weather conditions. PV inverters usually include a maximum power point tracker (MPPT) to track this varying power, in order to transfer all the available power to the grid efficiently. Control of power transferred to the grid along with the MPPT plays a crucial role in determining the efficiency of a PV system. This paper discusses ...

  7. Ant colony system (ACS with hybrid local search to solve vehicle routing problems

    Suphan Sodsoon

    2016-02-01

    Full Text Available This research applied an Ant Colony System algorithm with a Hybrid Local Search to solve Vehicle Routing Problems (VRP from a single depot when the customers’ requirements are known. VRP is an NP-hard optimization problem and has usually been successfully solved optimum by heuristics. A fleet of vehicles of a specific capacity are used to serve a number of customers at minimum cost, without violating the constraints of vehicle capacity. There are meta-heuristic approaches to solve these problems, such as Simulated Annealing, Genetic Algorithm, Tabu Search and the Ant Colony System algorithm. In this case a hybrid local search was used (Cross-Exchange, Or-Opt and 2-Opt algorithm with an Ant Colony System algorithm. The Experimental Design was tested on 7 various problems from the data set online in the OR-Library. There are five different problems in which customers are randomly distributed with the depot in an approximately central location. The customers were grouped into clusters. The results are evaluated in terms of optimal routes using optimal distances. The experimental results are compared with those obtained from meta-heuristics and they show that the proposed method outperforms six meta-heuristics in the literature.

  8. Induction Motor Control through AC/DC/AC Converters

    Elfadili, Abderrahim; Giri, Fouad; Ouadi, Hamid; El Magri, Abdelmounime; Dugard, Luc; Abouloifa, Abdelmajid

    2010-01-01

    We consider the problem of controlling inductions motors driven through AC/DC rectifiers and DC/AC inverters. The control objectives are threefold: (i) forcing the motor speed to track a reference signal, (ii) regulating the DC Link voltage, (iii) assuring a satisfactory power factor correction (PFC) with respect to the power supply net. First, a nonlinear model of the whole controlled system is developed in the Park-coordinates. Then, a nonlinear multi-loop controller is synthesized using th...

  9. Analysis and implementation of power management and control strategy for six-phase multilevel ac drive system in fault condition

    Sanjeevikumar Padmanaban

    2016-03-01

    Full Text Available This research article exploits the power management algorithm in post-fault conditions for a six-phase (quad multilevel inverter. The drive circuit consists of four 2-level, three-phase voltage source inverter (VSI supplying a six-phase open-end windings motor or/impedance load, with circumstantial failure of one VSI investigated. A simplified level-shifted pulse-width modulation (PWM algorithm is developed to modulate each couple of three-phase VSI as 3-level output voltage generators in normal operation. The total power of the whole ac drive is shared equally among the four isolated DC sources. The developed post-fault algorithm is applied when there is a fault by one VSI and the load is fed from the remaining three healthy VSIs. In faulty conditions the multilevel outputs are reduced from 3-level to 2-level, but still the system propagates with degraded power. Numerical simulation modelling and experimental tests have been carried out with proposed post-fault control algorithm with three-phase open-end (asymmetrical induction motor/R-L impedance load. A complete set of simulation and experimental results provided in this paper shows close agreement with the developed theoretical background.

  10. Optimization of AC Dipole Parameters for the Mu2e Extinction System

    Prebys, E.; /Fermilab

    2012-05-01

    The Mu2e experiment is being planned at Fermilab to measure the rate for muons to convert to electrons in the field of an atomic nucleus with unprecedented precision. This experiment uses an 8 GeV primary proton beam consisting of short ({approx}200 nsec FW) bunches, separated by 1.7 {mu}sec. It is vital that out-of-bunch beam be suppressed at the level of 10{sup -10} or less. This poster describes the parametric analysis which was done to determine the optimum harmonics and magnet specifications for this system, as well as the implications for the beam line optics.

  11. AC field measurements of Fermilab Booster correctors using a rotating coil system

    The first prototype of a new corrector package for the Fermilab Booster Synchrotron is presently in production. This water-cooled package includes normal and skew dipole, quadrupole and sextupole elements to control orbit, tune and chromaticity of the beam over the full range of Booster energies (0.4-8 GeV). These correctors operate at the 15 Hz excitation cycle of the main synchrotron magnets, but must also make more rapid excursions, in some cases even switching polarity in approximately 1 ms at transition crossing. To measure the dynamic field changes during operation, a new method based on a relatively slow rotating coil system is proposed. The method pieces together the measured voltages from successive current cycles to reconstruct the field harmonics. This paper describes the method and presents initial field quality measurements from a Tevatron corrector

  12. Hermetisk AC-Krets

    Hirsch, Carl; Smirnoff, Alexander

    2007-01-01

    Under sex månader våren 2007 har ett samarbete mellan Volvo Lastvagnar och två studenter från KTH, inriktning Integrerad produktutveckling vid institutionen för maskinkonstruktion, pågått i form av ett examensarbete på 20 poäng. Dagens AC-system i Volvos lastbilar avger 20-40 g/år av köldmediet R134a som är en kraftfull växthusgas. Detta sker främst genom diffusion via slangar och tätningsmaterial. Syftet med detta examensarbete är att ta fram förslag på tekniska lösningar på ett nytt AC-syst...

  13. Comparative study between PI, RST and sliding mode controllers of a DFIG supplied by an AC-AC converter for wind energy conversion system

    Ahmed Bourouina

    2015-12-01

    Full Text Available This paper deals with a variable speed device to produce electrical energy on a power network, based on a doubly-fed induction generator (DFIG supplied by a direct matrix converter used in wind energy conversion systems. In the first place, we carried out briefly a study of modelling on the whole system. In order to control the power flowing between the stator of the DFIG and the power network, a control law is synthesized using three types of controllers: PI, RST and sliding mode controllers. Their respective performances are compared in terms of power reference tracking, response to sudden speed variations, sensitivity to perturbations and robustness against machine parameters variations.

  14. Biological and Biomechanical Evaluation of the Ligament Advanced Reinforcement System (LARS AC) in a Sheep Model of Anterior Cruciate Ligament Replacement: A 3-Month and 12-Month Study

    Viateau, Véronique; MANASSERO, Mathieu; ANAGOSTOU, Fani; GUERARD, Sandra; Mitton, David; Migonney, Véronique

    2013-01-01

    PurposeThe purposes of this study were to assess tissue ingrowth within the Ligament Advanced Reinforcement System (LARS) artificial ligament (LARS AC; LARS, Arc sur Tille, France) and to study the biomechanical characteristics of the reconstructed knees in a sheep model of anterior cruciate ligament (ACL) replacement.MethodsTwenty-five female sheep underwent excision of the proximal third of the left ACL and intra-articular joint stabilization with a 44-strand polyethylene terephthalate liga...

  15. Identification of an Unknown Assistant Blowing Agent in AC Blowing System%一种助发泡剂的鉴定

    何文绚; Robert Shanks

    2004-01-01

    In this study, TLC was used to separate and purify the unknown assistant blowing agent in AC blowing system. After that, FTIR-Microscope was used to indicate the functional group in the uncommon unknown compound. Through combination of FTIR analysis, elemental analysis and other physical and chemical analysis, the molecular structure of unknown was deduced. Finally by explaining mass spectra of the unknown compounds, the molecular structure of unknown was further confirmed.

  16. The HST/ACS Coma Cluster Survey IV. Intergalactic Globular Clusters and the Massive Globular Cluster System at the Core of the Coma Galaxy Cluster

    Peng, Eric W.; Ferguson, Henry C.; Goudfrooij, Paul; Hammer, Derek; Lucey, John R.; Marzke, ; Ronald O.; Puzia, Thomas H.; Carter, David; Balcells, Marc; Bridges, Terry; Chiboucas, Kristin; del Burgo, Carlos; Graham, Alister W.; Guzman, Rafael; Hudson, Michael J.

    2011-01-01

    Intracluster stellar populations are a natural result of tidal interactions in galaxy clusters. Measuring these populations is difficult, but important for understanding the assembly of the most massive galaxies. The Coma cluster is one of the nearest truly massive galaxy clusters, and is host to a correspondingly large system of globular clusters (GCs). We use imaging from the HST/ACS Coma Cluster Survey to present the first definitive detection of a large population of intracluster GCs (IGC...

  17. Reliability Improvement of Ground Fault Protection System Using an S-Type Horn Attachment Gap in AC Feeding System

    Ajiki, Kohji; Morimoto, Hiroaki; Shimokawa, Fumiyuki; Sakai, Shinya; Sasaki, Kazuomi; Sato, Ryogo

    Contact wires used in feeding system for electric railroad are insulated by insulators. However, insulation of an insulator sometimes breaks down by surface dirt of an insulator and contact with a bird. The insulator breakdown derives a ground fault in feeding system. Ground fault will cause a human electric shock and a destruction of low voltage electric equipment. In order to prevent the damage by ground fault, an S-type horn has been applicable as equipped on insulators of negative feeder and protective wire until present. However, a concrete pole breaks down at the time of the ground fault because a spark-over voltage of the S-type horn is higher than a breakdown voltage of a concrete pole. Farther, the S-type horn installed in the steel tube pole does not discharge a case, because the earth resistance of a steel tube pole is very small. We assumed that we could solve these troubles by changing the power frequency spark-over voltage of the S-type horn from 12kV to 3kV. Accordingly, we developed an attachment gap that should be used to change the power frequency spark-over voltage of the S-type horn from 12kV to 3kV. The attachment gap consists of a gas gap arrester and a zinc oxide element. By the dynamic current test and the artificial ground fault test, we confirmed that the attachment gap in the S-type horn could prevent a trouble at the time of the ground fault.

  18. Some Aspects of the Use of a Cryogenic Ally-Cooled Primary Windings System for an a.c. MHD Generator

    The performance of an a.c. MHD converter depends upon the magnetic Reynolds number of the secondary (liquid metal) and the performance of the primary magnetic circuit, i.e. the windings system which produces the magnetic travelling wave. In the known a.c. MHD configuration the windings system consists of a conventional multiphase system such as that used for the conventional asynchronous machine. But unlike these, the gap between iron cores is increased to the channel height which is 20, 30 or more times greater. Therefore the reactance of the machine, and hence the inductive component of the current, becomes large. That causes an insufficiently small value of the power factor (cos ∅) of the machine. In order to compensate, the current density of the primary windings must be increased 20 to 30 times in comparison to that in the conventional asynchronous machine. This is only possible with the use of a cryogenically- cooled primary winding system. The specific resistance of pure metals (e.g. copper, aluminium or sodium) is reduced drastically at low temperatures, allowing of a drastic increase in the ampere-turn density of the machine without increasing the resistance of the windings above permissible limits. Two configurations of cryogenically-cooled windings systems for a.c. MHD converters are proposed. One uses a liquid nitrogen cooling system and the second a liquid hydrogen cooling system. Real machine data are considered and the characteristics of the converter are given, mainly by considering the circle diagram of the machine (current vector as a function of slip s). An a.c. MHD converter, based on the first winding configuration, cryogenically cooled with liquid nitrogen, and working with mercury, is now running. The performance and the technological problems are being studied. The machine details are reported. Measurements of flow velocity, pressure drop along the MHD channel, temperature of mercury, losses in mercury, power flow between working fluid and

  19. ACAC Converters for UPS

    Rusalin Lucian R. Păun

    2008-05-01

    Full Text Available This paper propose a new control technique forsingle – phase ACAC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.

  20. Ac Hybrid Charge Controller

    Shalini S. Durgam

    2015-03-01

    Full Text Available One of the primary needs for socio-economic development in any nation in the world is the provision of reliable electricity supply systems with lower carbon footprint levels. The purpose of this work is the development of a hybrid Power system that harnesses the renewable energy in sun and electricity to generate electricity. The working model can able to run on dual mode- solar and electricity. It can also be driven independently either by solar or electricity. The battery can be charge from solar panel (40W or by power supply. The household single phase A.C. power supply of 230V is converted into 12V D.C. using step down transformer and rectifying circuit. The working model can achieve energy saving, low carbon emission, environmental protection for the upcoming future of human life.

  1. Analysis of Reactive Power Compensation in UHV AC Transmission System%特高压交流输电系统无功补偿策略分析

    李静雅

    2015-01-01

    Ultra high voltage transmission system with a high rechargeable power,long transmission line characteris-tics,and thus faces a serious problem of reactive power balance,in order to ensure the effect of reactive power compensa-tion in UHV transmission system,analyzed the reactive power compensation strategy in UHV AC transmission system in this paper.%特高压输电系统具有充电功率大,输电线路长的特点,但面临严重的无功平衡问题。为了保证特高压输电系统的无功补偿效果,文中分析了特高压交流输电系统无功补偿策略。

  2. Analysis of Reactive Power Compensation in UHV AC Transmission System%特高压交流输电系统无功补偿策略分析

    李静雅

    2015-01-01

    特高压输电系统具有充电功率大,输电线路长的特点,但面临严重的无功平衡问题。为了保证特高压输电系统的无功补偿效果,文中分析了特高压交流输电系统无功补偿策略。%Ultra high voltage transmission system with a high rechargeable power,long transmission line characteris-tics,and thus faces a serious problem of reactive power balance,in order to ensure the effect of reactive power compensa-tion in UHV transmission system,analyzed the reactive power compensation strategy in UHV AC transmission system in this paper.

  3. Operating Characteristics Test System for AC/DC Contactor%交直流接触器动作特性测试系统

    林文贵; 许志红

    2014-01-01

    The operating characteristics test system of AC/DC contactor was introduced.It achieves phase selection in the closing and opening course of contactor.Keyence laser displacement sensor is used to achieve the test of displacement of contact and iron core changing over time.Moreover,the sound signal making in the closing course of contactor by electret microphone is captured.The voltage,current of coil and main circuit with three-phase contacts are obtained.All signals mentioned above transmitting to PC based on data-acquisition,the system achieves data processing,automatically measuring and saving.The test system provides technical support for contactor studying and simulation,control strategy verifying of AC/DC contactor.It is of theoretical and practical significance in the design and development of AC/DC contactor.%介绍了一套交/直流接触器动作特性测试系统。系统实现了对交流接触器的选相分/合闸控制,采用激光位移传感器实现触头与铁心动态位移测试,驻极体传声器采集接触器闭合过程声音信号,霍尔传感器采集线圈回路和三相触头回路电压电流信号;同时使用数据采集卡将信号采集到上位机,完成数据的处理分析、自动测量、数据存储等功能。系统为交直流接触器的仿真研究、控制方案等提供技术支持,对提高接触器的设计与开发水平具有理论和实际意义。

  4. Rapid cycling synchrotron magnet with separate ac and dc circuit

    In present rapid cycling synchrotron magnets ac and dc currents flow in the same coil to give the desired field. The circuit reactance is made zero at dc and the operating frequency by running the magnet in series with an external parallel resonant LC current. We propose to return the ac flux in a gap next to the synchrotron. The dc coil encloses the ac magnetic circuit and thus links no ac flux. A shorted turn between the dc coil and ac flux enhances the separation of the two circuits. Several interesting developments are possible. The dc coil could be a stable superconductor to save power. The ac flux return gap could be identical with the synchrotron gap and contain a second synchrotron. This would double the output of the system. If the return flux gap were used for a booster, the ac coil power could be greatly reduced or radiation hardening of the ac coil could be simplified

  5. THE ACS VIRGO CLUSTER SURVEY. XVII. THE SPATIAL ALIGNMENT OF GLOBULAR CLUSTER SYSTEMS WITH EARLY-TYPE HOST GALAXIES

    Wang Qiushi; Peng, Eric W. [Department of Astronomy, Peking University, Beijing 100871 (China); Blakeslee, John P.; Cote, Patrick; Ferrarese, Laura [Herzberg Institute of Astrophysics, National Research Council of Canada, 5071 West Saanich Road, Victoria, BC V9E 2E7 (Canada); Jordan, Andres [Departamento de Astronomia y Astrofisica, Pontificia Universidad Catolica de Chile, Casilla 306, Santiago 22 (Chile); Mei, Simona [University of Paris 7 Denis Diderot, F-75205 Paris Cedex 13 (France); West, Michael J., E-mail: peng@pku.edu.cn [Maria Mitchell Observatory, 4 Vestal Street, Nantucket, MA 02554 (United States)

    2013-06-01

    We study the azimuthal distribution of globular clusters (GCs) in early-type galaxies and compare them to their host galaxies using data from the ACS Virgo Cluster Survey. We find that in host galaxies with visible elongation ({epsilon} > 0.2) and intermediate to high luminosities (M{sub z} < -19), the GCs are preferentially aligned along the major axis of the stellar light. The red (metal-rich) GC subpopulations show strong alignment with the major axis of the host galaxy, which supports the notion that these GCs are associated with metal-rich field stars. The metal-rich GCs in lenticular galaxies show signs of being more strongly associated with disks rather than bulges. Surprisingly, we also find that the blue (metal-poor) GCs can also show the same correlation. If the metal-poor GCs are part of the early formation of the halo and built up through mergers, then our results support a picture where halo formation and merging occur anisotropically, and that the present-day major axis is an indicator of the preferred merging axis.

  6. Comparison of a synergetic battery pack drive system to a pulse width modulated AC induction motor drive for an electric vehicle

    Davis, A.; Salameh, Z.M. [Univ. of Massachusetts, Lowell, MA (United States). Dept. of Electrical Engineering; Eaves, S.S. [Eaves Devices, Charlestown, RI (United States)

    1999-06-01

    A new battery configuration technique and accompanying control circuitry, termed a Synergetic Battery Pack (SBP), is designed to work with Lithium batteries, and can be used as both an inverter for an electric vehicle AC induction motor drive and as a battery charger. In this paper, the performance of a Synergetic Battery Pack during motor drive operation is compared via computer simulation with a conventional motor drive which uses sinusoidal pulse width modulation (SPWM) to determine its effectiveness as a motor drive. The study showed that the drive efficiency was compatible with the conventional system, and offered a significant advantage in the lower frequency operating ranges. The voltage total harmonic distortion (THD) of the SBP was significantly lower than the PWM drive output, but the current THD was slightly higher due to the shape of the harmonic spectrum. In conclusion, the SBP is an effective alternative to a conventional drive, but the real advantage lies in its battery management capabilities and charger operation.

  7. AcEST: DK950971 [AcEST

    Full Text Available optera acutorost... 37 0.66 tr|B1ACS6|B1ACS6_BALBN DMP1 (Fragment) OS=Balaenoptera ...bonaerens... 37 0.66 tr|B1ACS5|B1ACS5_BALED DMP1 (Fragment) OS=Balaenoptera edeni... GN=... 37 0.66 tr|B1ACS4|B1ACS4_BALBO DMP1 (Fragment) OS=Balaenoptera borealis ... 37 0.66 tr|B1ACS3|B1ACS3..._BALMU DMP1 (Fragment) OS=Balaenoptera musculus ... 37 0.86 tr|B1ACS1|B1ACS1_MEGNO DMP1 (Fragment) OS=Megapt...1ACS2_BALPH DMP1 (Fragment) OS=Balaenoptera physalus ... 37 1.1 tr|B1ACT6|B1ACT6_MESPE DMP1 (Fragment) OS=Me

  8. AC1 Wing

    Adrian DOBRE

    2010-03-01

    Full Text Available The AC1 wing replaces the old wing of the wind tunnel model AEROTAXI, which has been made at scale 1:9. The new wing is part of CESAR program and improves the aerodynamic characteristics of the old one. The geometry of the whole wing was given by FOI Sweden and position of AC1 wing must coincide with the structure of the AEROTAXI model.

  9. AC1 Wing

    Adrian DOBRE

    2010-01-01

    The AC1 wing replaces the old wing of the wind tunnel model AEROTAXI, which has been made at scale 1:9. The new wing is part of CESAR program and improves the aerodynamic characteristics of the old one. The geometry of the whole wing was given by FOI Sweden and position of AC1 wing must coincide with the structure of the AEROTAXI model.

  10. Damping effects of Supplementary Control Signals for Enhancement of Transient Stability in AC-DC Power Systems

    Uma Vani M; Dr. Ramana Rao P.V.

    2010-01-01

    This paper discusses the impact of HVDC on Power System Stability and proposes a novel controlmechanism to augment the system angle stability. The effectiveness of the proposed controller is demonstrated by asingle machine-infinite bus system example. The performance of this controller, in comparison to the conventionalP and P-I controllers, is found to be very effective as a supplementary PID controller in damping generator rotoroscillations. The supplementary controls using signals derived ...

  11. Development and implementation of a 2x25kV AC bivoltage traction system simulator for high speed railways

    Plakhova, Mariia

    2015-01-01

    This thesis was focused on the power flow and power system simulation, therefore, the complex train model has not been built and trains are represented as non-linear power sources. The objective of this thesis was to develop the mathematical model of the bivoltage power system for the traction purpose and solve it, applying different numerical technics

  12. Regulation of Dynamical Systems to Optimal Solutions of Semidefinite Programs: Algorithms and Applications to AC Optimal Power Flow

    Dall'Anese, Emiliano; Dhople, Sairaj; Giannakis, Georgios B.

    2014-01-01

    This paper considers a collection of networked nonlinear dynamical systems, and addresses the synthesis of feedback controllers that seek optimal operating points corresponding to the solution of network-wide constrained optimization problems. Particular emphasis is placed on the solution of semidefinite programs (SDPs). The design of the feedback controller is grounded on a dual epsilon-subgradient approach, with the dual iterates utilized to dynamically update the dynamical-system reference...

  13. A High Swithching Frequency IGBT PWM Rectifier/Inverter System For AC Motor Drives Operating From Single Phase Supply

    Thiyagarajah, K; Ranganathan, VT; Iyenger, Ramakrishna BS

    1990-01-01

    A pulse width modulated (PWM) rectifier/inverter system using insulated gate bipolar transistors (IGBT's), capable of switching at $20 kH_z$ is reported. The base drive circuit for the IGBT, incorporating short-circuit protection, is presented. The inverter uses an Undeland snubber together with a simple energy recovery circuit, which ensures reliable and efficient operation even for $20 kH_z$ switching. The front end for the system is a regenerative single phase full bridge IGBT inverter alo...

  14. Selection of topologies for the PHOTONERGY{sup TM} project. Optimised design and control of inverter for photovoltaic systems: the AC-module

    Baekhoej Kjaer, S.

    2002-06-01

    The PHOTONERGY{sup TM} project (also known as the former 'SolcelleInverter' project) is by this report carried into its third stage; the selection of a suitable topology for the AC-Module inverter. The selection of a suitable topology is based on State-Of-The-Art analysis a specifications and a comparison of four grid-tied inverters and nine dc/dc converters. This implies 23 possible combinations, from which nine is investigated with respect to efficiency in six working points, the number of components and to some extent also the rating of the components. The conclusion is that the target of a European efficiency of 93.7% is hard to achieve. But four of the examined, and two newly discovered, inverters are recommended for a further examination by means of estimations, calculations and simulations of: cost, complexity, robustness, efficiency and mass-production. The system-layout is also examined. The first layout implies that the PV-Module and the inverter is integrated into one unit and the second layout involves that the inverter is placed indoor. The layouts are compared with respect to cable-losses, enclosure demanding and lifetime. The conclusion is somehow ambiguous and a further investigation should be initiated in order to get a clear result. (au)

  15. A Research Review on the Transmission System of AC Servo Motor Direct Drive Hydraulic Press%交流伺服电机直驱液压机传动系统研究综述

    范淑琴; 赵升吨; 陈超; 杨建辉

    2015-01-01

    交流伺服电机直驱液压机相比传统液压机,具有低速锻冲、快速空程向下及快速回程的特点,其交流伺服电机直驱的传动方式可有效减少滑块上行和下行的时间,大大提高液压机工作速度。介绍了国内外交流伺服电机直驱液压机传动系统的研究现状,提出了一种无油泵交流伺服电机直驱新型液压机传动方式,介绍了该新型液压机传动系统的构成及工作原理,并提出了研制该无油泵交流伺服电机直驱新型液压机所需要解决的科学问题。%Compared to the traditional hydraulic press, Ac servo motor direct drive hydraulic press has the characteris-tics including rapid falling, slow forging and fast return. The transmission mode of AC servo motor direct drive can effec-tively reduce both the falling time and rising time of the slider, and greatly improve the working speed of hydraulic press. The research status of transmission system of Ac servo motor direct drive hydraulic press are introduced in this paper, and the transmission model of a new type AC servo motor direct drive hydraulic press without oil pump is proposed. Both the composition and working principle of the transmission system of the new type hydraulic presser are introduced, and the sci-entific problems about the new type AC servo motor direct drive hydraulic press without oil pump are put forward.

  16. High voltage AC/AC electrochemical capacitor operating at low temperature in salt aqueous electrolyte

    Abbas, Qamar; Béguin, François

    2016-06-01

    We demonstrate that an activated carbon (AC)-based electrochemical capacitor implementing aqueous lithium sulfate electrolyte in 7:3 vol:vol water/methanol mixture can operate down to -40 °C with good electrochemical performance. Three-electrode cell investigations show that the faradaic contributions related with hydrogen chemisorption in the negative AC electrode are thermodynamically unfavored at -40 °C, enabling the system to work as a typical electrical double-layer (EDL) capacitor. After prolonged floating of the AC/AC capacitor at 1.6 V and -40°C, the capacitance, equivalent series resistance and efficiency remain constant, demonstrating the absence of ageing related with side redox reactions at this temperature. Interestingly, when temperature is increased back to 24 °C, the redox behavior due to hydrogen storage reappears and the system behaves as a freshly prepared one.

  17. AC/RF Superconductivity

    Ciovati, G.

    2015-01-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  18. AC/RF Superconductivity

    Ciovati, Gianluigi [JLAB

    2015-02-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  19. Performance of Frequency Division Multiplexing Readout System for AC-Biased Transition-Edge Sensor X-ray Microcalorimeters

    Yamamoto, R.; Sakai, K.; Takei, Y.; Yamasaki, N. Y.; Mitsuda, K.

    2014-08-01

    Frequency division multiplexing (FDM) is a promising approach to read out a large format transition-edge sensor (TES) array for future astrophysical missions. We constructed a four channel FDM readout system using baseband feedback in the MHz band. We demonstrated the principle of our FDM method with an actual TES array, a multiplexing SQUID and LC band-pass filters under 100 mK. The resonant frequencies of LC filters were consistent with the design value with an accuracy of better than 3 %. We successfully obtained X-ray pulses from two TESs simultaneously but the energy resolution was degraded to about 100 eV at 5.9 keV and crosstalk effects were observed. The origin of the crosstalk effects is investigated by modified setups. Based on comparative experiments and numerical calculations, we conclude that the non-linearity of the SQUID is the cause of some of the crosstalk effects. Unlike the regular crosstalk effect from the adjoining channels, the crosstalk effect due to non-linearity observed in this paper occurs in all channels. Solving these problems will help us to obtain FDM readout with sufficient energy resolution.

  20. Adaptive Nonlinear Control of Induction Motors through AC/DC/AC Converters

    Elfadili, Abderrahim; Giri, Fouad; El Magri, Abdelmounime; Dugard, Luc; Chaoui, Fatima Zara

    2012-01-01

    The problem of controlling induction motors, together with associated AC/DC rectifiers and DC/AC inverters, is addressed. The control objectives are threefold: (i) the motor speed should track any reference signal despite mechanical parameter uncertainties and variations; (ii) the DC Link voltage must be tightly regulated; (iii) the power factor correction (PFC) w.r.t. the power supply net must be performed in a satisfactory way. First, a nonlinear model of the whole controlled system is deve...

  1. Robust control of synchronous motors through AC/DC/AC converters

    El Magri, Abdelmounime; Giri, Fouad; Abouloifa, Abdelmajid; Chaoui, Fatima Zara

    2010-01-01

    The problem of controlling synchronous motors, driven through AC/DC rectifiers and DC/AC inverters is addressed. The control objectives are three fold: (i) forcing the motor speed to track a varying reference signal in presence of motor parameter uncertainties;(ii) regulating the DC Link voltage; (iii )assuring a satisfactory power factor correction (PFC) with respect to the power supply net .First, a nonlinear model of the whole controlled system is developed in the Park-coordinates. Then, a...

  2. Precision rectifier detectors for ac resistance bridge measurements with application to temperature control systems for irradiation creep experiments

    Duncan, M. G.

    1977-05-01

    The suitability of several temperature measurement schemes for an irradiation creep experiment is examined. It is found that the specimen resistance can be used to measure and control the sample temperature if compensated for resistance drift due to radiation and annealing effects. A modified Kelvin bridge is presented that allows compensation for resistance drift by periodically checking the sample resistance at a controlled ambient temperature. A new phase-insensitive method for detecting the bridge error signals is presented. The phase-insensitive detector is formed by averaging the magnitude of two bridge voltages. Although this method is substantially less sensitive to stray reactances in the bridge than conventional phase-sensitive detectors, it is sensitive to gain stability and linearity of the rectifier circuits. Accuracy limitations of rectifier circuits are examined both theoretically and experimentally in great detail. Both hand analyses and computer simulations of rectifier errors are presented. Finally, the design of a temperature control system based on sample resistance measurement is presented. The prototype is shown to control a 316 stainless steel sample to within a 0.15/sup 0/C short term (10 sec) and a 0.03/sup 0/C long term (10 min) standard deviation at temperatures between 150 and 700/sup 0/C. The phase-insensitive detector typically contributes less than 10 ppM peak resistance measurement error (0.04/sup 0/C at 700/sup 0/C for 316 stainless steel or 0.005/sup 0/C at 150/sup 0/C for zirconium).

  3. THE HST/ACS COMA CLUSTER SURVEY. IV. INTERGALACTIC GLOBULAR CLUSTERS AND THE MASSIVE GLOBULAR CLUSTER SYSTEM AT THE CORE OF THE COMA GALAXY CLUSTER

    Intracluster stellar populations are a natural result of tidal interactions in galaxy clusters. Measuring these populations is difficult, but important for understanding the assembly of the most massive galaxies. The Coma cluster of galaxies is one of the nearest truly massive galaxy clusters and is host to a correspondingly large system of globular clusters (GCs). We use imaging from the HST/ACS Coma Cluster Survey to present the first definitive detection of a large population of intracluster GCs (IGCs) that fills the Coma cluster core and is not associated with individual galaxies. The GC surface density profile around the central massive elliptical galaxy, NGC 4874, is dominated at large radii by a population of IGCs that extend to the limit of our data (R +4000-5000 (systematic) IGCs out to this radius, and that they make up ∼70% of the central GC system, making this the largest GC system in the nearby universe. Even including the GC systems of other cluster galaxies, the IGCs still make up ∼30%-45% of the GCs in the cluster core. Observational limits from previous studies of the intracluster light (ICL) suggest that the IGC population has a high specific frequency. If the IGC population has a specific frequency similar to high-SN dwarf galaxies, then the ICL has a mean surface brightness of μV ∼ 27 mag arcsec-2 and a total stellar mass of roughly 1012 Msun within the cluster core. The ICL makes up approximately half of the stellar luminosity and one-third of the stellar mass of the central (NGC 4874+ICL) system. The color distribution of the IGC population is bimodal, with blue, metal-poor GCs outnumbering red, metal-rich GCs by a ratio of 4:1. The inner GCs associated with NGC 4874 also have a bimodal distribution in color, but with a redder metal-poor population. The fraction of red IGCs (20%), and the red color of those GCs, implies that IGCs can originate from the halos of relatively massive, L* galaxies, and not solely from the disruption of dwarf

  4. Loss of vital ac power and the residual heat removal system during mid-loop operations at Vogtle Unit 1 on March 20, 1990

    On March 20, 1990, the Vogtle Electric Generating Plant Unit 1, located in Burke County, Georgia, about 25 miles southeast of Augusta, experienced a loss of all safety (vital) ac power. The plant was in cold shutdown with reactor coolant level lowered to ''mid-loop'' for various maintenance tasks. Both the containment building personnel hatch and equipment hatch were open. One emergency diesel generator and one reserve auxiliary transformer were out of service for maintenance, with the remaining reserve auxiliary transformer supplying both Unit 1 safety buses. A truck in the low voltage switchyard backed into the support column for an offsite power feed to the reserve auxiliary transformer which was supplying safety power. The insulator broke, a phase-to-ground fault occurred, and the feeder circuit breakers for the safety buses opened. The operable emergency diesel generator started automatically because of the undervoltage condition on the safety bus, but tripped off after about 1 minute. About 20 minutes later the diesel generator load sequencer was reset, causing the diesel generator to start a second time. The diesel generator operated for about 1 minute, and tripped off. The diesel generator was restarted in the manual emergency mode 36 minutes after the loss of power. The generator remained on line and provided power to its safety bus. During the 36 minutes without safety bus power, the reactor coolant system temperature rose from about 90 degree F to 136 degree F. This report documents the results of an Incident Investigation Team sent to Vogtle by the Executive Director for Operations of the US Nuclear Regulatory Commission to determine what happened, identify the probable causes, and make appropriate findings and conclusions. 79 figs., 16 tabs

  5. A Non-linear Controller for Single-Phase AC-AC Power Converter to meet UPS Performance Index

    Abdelhafid Ait Elmahjoub

    2012-07-01

    Full Text Available This article focuses on AC-AC power converter that can be used for uninterruptible power supply (UPS. The converter is built on two stages: a AC-DC input stage and a DC-AC output stage. The two blocks are connected by an intermediate DC bus. The aim of control is threefold: i power factor correction ii regulation of DC bus iii generating a sinusoidal voltage at the output. The synthesis of controllers has been achieved through the technique of nonlinear backstepping control. A detailed analysis of the stability control system is presented. The performances of regulators have been validated by numerical simulation in MATLAB / SIMULINK.

  6. Development of a hardware-based AC microgrid for AC stability assessment

    Swanson, Robert R.

    As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.

  7. ACS air bearing test-bed design

    Glitt, Sascha

    2010-01-01

    This thesis is about the construction and design of a new air bearing test-bed to verify the programmed ACS attitude control algorithm and to validate the ACS MATLAB/SimuLink¬ model of NPSAT1, the second small satellite currently under development at the Naval Postgraduate School Space Systems Academic Group. The software was already verified and validated using a comparable air bearing test-bed. But due to changes in hardware from commercial magnetic torque rods to custom, NPS-built, magneti...

  8. Impacts on Power Factor of AC Voltage Controllers Under Non-Sinusoidal Conditions

    Mukhtiar Ahmed Mahar

    2012-04-01

    Full Text Available AC-AC conversion is obtained with the help of Cyclo-converters, DC Link converters and AC Voltage Controllers. AC voltage controllers are also referred to as voltage regulators. Main issue concerned to these converters is that they generate harmonics due to periodic variable structure system. The generated harmonics create disturbances and degrade the performance of converter. The power factor of supply side is affected due to these harmonics. This paper focuses on source side power factor of ac voltage controllers under nonsinusoidal conditions. In order to observe the power factor, measurement tool of power factor and simulation model of ac voltage controller is also developed in MATLAB software.

  9. Titanium Aluminum Nitride Films Deposited by AC Reactive Magnetron Sputtering: Study of Positioning Effect in an Inverted Cylindrical Magnetron Sputtering System

    Vandross, George Clinton, II

    TiAlN films were deposited on glass substrates by AC magnetron sputtering at 2 kW with constant Argon and Nitrogen gas flow rates to study the effects of positioning on the deposited films. The deposition system used was an ICM-10 IsoFlux cylindrical magnetron sputtering chamber. The samples were placed in different positions and tilts with respect to the location of the Titanium and Aluminum targets in the chamber. It was found that with change in position and application of tilts, deposited films acquired different physical and chemical properties. It is believed that the differences in these properties were caused by to the change in the incident angle of bombardment of the samples, and the change in surface areas of the samples presented to the targets at each location. As related to the physical traits of the samples, analysis using Scanning Electron Microscopy of the samples displayed variations in the topography, where differences in grain density could be noted as well as structure formations. The chemical properties were also noted to be affected by the variation of tilt and position applied to the sample. X-ray Diffraction Spectroscopy analysis of the samples showed the intensity of the TiAlN characteristic peak of the samples to differ from sample to sample. Results from the XRD analysis of this work showed a 157% and 176% increase in peak intensity of the 0° tilt sample of the Bottom Plate from the 45° tilt sample and 60° tilt sample respectively of the same plate. The results from the XRD analysis of this work also showed a 74% and 151% increase of the peak intensity for the 0° tilt sample of the Middle Plate when compared to the 45° tilt sample and 60° tilt sample respectively of the same plate. Whereas results for this work showed a 54% and 41% decrease in peak intensity of the 0° tilt sample of the Top Plate from the 45° tilt sample and 60° tilt sample respectively of the same plate. Energy Dispersive X-ray Spectroscopy was also performed

  10. Superconducting ac cable

    The components of a superconducting 110 kV ac cable for power ratings >= 2000 MVA have been developed. The cable design especially considered was of the semiflexible type, with a rigid cryogenic envelope and flexible hollow coaxial cable cores pulled into the former. The cable core consists of spirally wound Nb-Al composite wires and a HDPE-tape wrapped electrical insulation. A 35 m long single phase test cable with full load terminations for 110 kV and 10 kA was constructed and successfully tested. The results obtained prove the technical feasibility and capability of our cable design. (orig.)

  11. High performance AC drives

    Ahmad, Mukhtar

    2010-01-01

    This book presents a comprehensive view of high performance ac drives. It may be considered as both a text book for graduate students and as an up-to-date monograph. It may also be used by R & D professionals involved in the improvement of performance of drives in the industries. The book will also be beneficial to the researchers pursuing work on multiphase drives as well as sensorless and direct torque control of electric drives since up-to date references in these topics are provided. It will also provide few examples of modeling, analysis and control of electric drives using MATLAB/SIMULIN

  12. A Study on Power Quality Improvement in PWM Controlled AC Voltage Controller

    Ahmet ALTINTAŞ

    2009-04-01

    Full Text Available A lot of topologies of pulse-width modulated (PWM-AC controllers for single-phase and three-phase systems are proposed up to date. PWM-AC controllers have important advantages compared with the phase-controlled AC controllers using thyristors and triacs. The PWM-AC controller has sinusoidal current waveforms, smaller THD values, better power factor, faster dynamics, and smaller input/output filter. This article presents a novel control technique for application to PWM-AC controllers with ability of generating fewer harmonics. In the proposed control method, both the traditional AC voltage controllers and the PWM-AC controllers are combined; and smaller THD values are obtained. Thus, the harmonic pollution in the power system will be reduced; and consequently, the power quality will be increased. For this purpose, computer simulations are performed in order to investigate the proposed controller performance. The obtained results are compared with the conventional PWM-AC controller.

  13. AC power generation from microbial fuel cells

    Lobo, Fernanda Leite; Wang, Heming; Forrestal, Casey; Ren, Zhiyong Jason

    2015-11-01

    Microbial fuel cells (MFCs) directly convert biodegradable substrates to electricity and carry good potential for energy-positive wastewater treatment. However, the low and direct current (DC) output from MFC is not usable for general electronics except small sensors, yet commercial DC-AC converters or inverters used in solar systems cannot be directly applied to MFCs. This study presents a new DC-AC converter system for MFCs that can generate alternating voltage in any desired frequency. Results show that AC power can be easily achieved in three different frequencies tested (1, 10, 60 Hz), and no energy storage layer such as capacitors was needed. The DC-AC converter efficiency was higher than 95% when powered by either individual MFCs or simple MFC stacks. Total harmonic distortion (THD) was used to investigate the quality of the energy, and it showed that the energy could be directly usable for linear electronic loads. This study shows that through electrical conversion MFCs can be potentially used in household electronics for decentralized off-grid communities.

  14. Advanced DC/AC inverters applications in renewable energy

    Luo, Fang Lin

    2013-01-01

    DC/AC inversion technology is of vital importance for industrial applications, including electrical vehicles and renewable energy systems, which require a large number of inverters. In recent years, inversion technology has developed rapidly, with new topologies improving the power factor and increasing power efficiency. Proposing many novel approaches, Advanced DC/AC Inverters: Applications in Renewable Energy describes advanced DC/AC inverters that can be used for renewable energy systems. The book introduces more than 100 topologies of advanced inverters originally developed by the authors,

  15. Biocontrol activity of Paenibacillus polymyxa AC-1 against Pseudomonas syringae and its interaction with Arabidopsis thaliana.

    Hong, Chi Eun; Kwon, Suk Yoon; Park, Jeong Mee

    2016-04-01

    Paenibacillus polymyxa AC-1 (AC-1) is a plant growth-promoting rhizobacterium (PGPR) that has been used as a soil inoculant for biocontrol of plant pathogenic fungi and to promote plant growth. In this study, we examine the effects of AC-1 on the bacterial phytopathogen Pseudomonas syringae and internal colonization of AC-1 by counting bacterial populations that colonize plants. AC-1 inhibited the growth of both P. syringae pv. tomato DC3000 (Pst) and P. syringae pv. tabaci (Pta) in a concentration-dependent manner in in vitro assays. Upon treatment of AC-1 dropping at root tip of axenically grown Arabidopsis, we found that most of the AC-1 was detected in interior of leaves of Arabidiopsis plants rather than roots after 5 days post infection, indicating systemic spreading of AC-1 occur. We examined further AC-1 colonization patterns in Arabidopsis mutants deficient in phytohormone signaling pathways. These results indicated that abscisic acid (ABA) and jasmonic acid (JA) signaling pathways positively and negatively contributed, respectively, to AC-1 colonization of leaves, whereas epiphytic accumulation of AC-1 around root tissues was not affected. This study shows that AC-1 is an effective biocontrol agent to suppress P. syringae growth, possibly owing to its colonization patterns as a leaf-inhabiting endophyte. The results showed in this work will help to expand our understanding of the mode of action of AC-1 as a biological control agent and consequently, its application in agriculture. PMID:26946374

  16. Implementation and Control of an AC/DC/AC Converter for Double Wound Flywheel Application

    Oliveira, J. G.; Schettino, H.; Gama, V; Carvalho, R.; H. Bernhoff

    2012-01-01

    An all-electric driveline based on a double wound flywheel, connected in series between main energy storage and a wheel motor, is presented. The flywheel works as a power buffer, allowing the battery to deliver optimized power. It also separates electrically the system in two sides, with the battery connected to the low voltage side and the wheel motor connected to the high voltage side. This paper presents the implementation and control of the AC/DC/AC converter, used to connect the flywheel...

  17. Numerical estimation of AC loss in superconductors with ripple current

    Highlights: •The loss energy density with ripple current is numerically calculated. •Irie–Yamafuji model is used for magnetic field dependence of critical current. •Calculated result of cylindrical superconductor agrees with theoretical result. •AC loss of strip superconductor becomes large at small ripple current amplitude. •Strip superconductor should be used as a form of hollow cylinder to reduce AC loss. -- Abstract: The loss energy density (AC loss) with ripple current is numerically calculated by finite element method for cylindrical and strip superconductors based on Irie–Yamafuji model in which the magnetic field dependence of the critical current density is taken into account for design of DC transmission cable system. It is confirmed that calculated result of the AC loss in the cylindrical superconductor with the ripple current agrees well with theoretical estimation which was reported in the previous work. On the contrary, the AC loss in the strip superconductor with the ripple current is obtained only by numerical calculation. It is found that the AC loss in the strip superconductor of the ripple current becomes larger than that without DC current at small ripple current amplitude, since the penetration depth of magnetic field becomes large. Therefore, it is recommended that strip superconductor is better to use as cylindrical hollow superconductor for DC transmission cable system to reduce the AC loss

  18. AcEST: BP920072 [AcEST

    Full Text Available YMU001_000132_F11 525 Adiantum capillus-veneris mRNA. clone: YMU001_000132_F11. BP920072 - Show ... YGMYGEGEKALETFADMEKSGIVPDSVVFIAII 617 Query: 139 NACSR SCLFHECHSYFEAMSTHHGIVPCLEHHSCVV 32 ACS S L E + FE M ... KLMTRDVVSWNTLIAGYAQVGQNEGLFCTFSDMLGQRVKPDLITFVIVLNACSR ... 125 VF+ + +D VSWN++I+GY Q G F M+ + D IT++++++ +R S ... YGVHGYGKKAIQIFEEMLANGASP 384 Query: 166 DLITFVIVLNACSR SCLFHECHSYFEAMSTHHGIVPCLEHHSCVV 32 +TFV VL ACS L E ... KLMTRDVVSWNTLIAGYAQVGQNEGLFCTFSDMLGQRVKPDLITFVIVLNACSR S 122 +VFDK R + WN L G E + + M V+ D T+ VL AC S Sbjc ...

  19. 基于DSP和智能功率模块的交流伺服系统硬件设计%AC Servo System Hardware Design Based on DSP and Intelligent Power Module

    刘江宁; 吴钦木; 何志琴; 张吉婷

    2012-01-01

    As the development of the microprocessor technology, power electronic technology, motor manufacturing technology and modern control theory, ac servo system used more and more widely. In this paper, we will use the TMS320F2812 as the core to design control circuit and FSBB20CH60 as the core to design power drive circuit and completed the part design of AC servo system's hardware,contains both current sampling and failure protection circuit and it with the advantage of design reasonable, structure compact, control precise and so on.%随着微处理器技术、电力电子技术、电机制造技术和现代控制理论的发展,交流伺服系统的应用越来越广.以TMS320F2812为核心设计控制电路,以FSBB20CH60为核心设计功率驱动电路,完成了包括电流采样及故障保护在内的交流伺服系统硬件部分的设计,具备了设计合理、结构紧凑和控制精确等优点.

  20. AcEST: DK950147 [AcEST

    Full Text Available TST38A01NGRL0007_O05 706 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0007_O05. 5' end seq ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... OS=Medicago truncatula GN=MtrDRAFT_AC149576g3v2 PE ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... (Fragment) OS=Medicago truncatula GN=MtrDRAFT_AC14 ...

  1. AcEST: DK959344 [AcEST

    Full Text Available TST39A01NGRL0004_G23 714 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0004_G23. 5' end seq ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... OS=Medicago truncatula GN=MtrDRAFT_AC149576g3v2 PE ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... (Fragment) OS=Medicago truncatula GN=MtrDRAFT_AC14 ...

  2. AcEST: DK949716 [AcEST

    Full Text Available TST38A01NGRL0006_L20 613 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0006_L20. 5' end seq ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... OS=Medicago truncatula GN=MtrDRAFT_AC149576g3v2 PE ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... (Fragment) OS=Medicago truncatula GN=MtrDRAFT_AC14 ...

  3. AcEST: BP920905 [AcEST

    Full Text Available EM + + D ++S L AC Sbjct: 374 NSAYKLFERMPKKNVVAWNAIISGYSQHGHPHEALALFIEMQAQGIKPDSFAIVSVLPAC 433 Query: 71 SHSSTLNDGKLIHFYILMNNFE...EM++ ++ + V + S L +C Sbjct: 255 SSERIFEKIAKKNAVSWTAMISSYNRGEFSEKALRSFSEMIKSGIEPNLVTLYSVLSSCG 314 Query: 68 HSSTLNDGKLIHFYILMNNFE...VVVMSCLKACS 69 ++ +F RRD VTW A+I GYA HG E A+ LF+ M+ EN+ + V +S L+AC+ Sbjct: 656 DSRLMFEKSLRRDFVTWNAMICGYAHHGKGEEAIQLFERMILEN...ELEKMHNKRLQEMCVSWNSIISGYVMKEQSEDAQMLFTRMME 596 Query: 122 ENVDTDGVVVMSCLKACSHSSTLNDGKLIHFYILMNNFE ...FCEADT-NVITWNAMIASYVHCEQSEKAIALFDRMVSENFKPSSITLVTLLMAC 543 Query: 71 SHSSTLNDGKLIHFYILMNNFEL 3 ++ +L G++

  4. A Study on Power Quality Improvement in PWM Controlled AC Voltage Controller

    Ahmet ALTINTAŞ

    2009-01-01

    A lot of topologies of pulse-width modulated (PWM)-AC controllers for single-phase and three-phase systems are proposed up to date. PWM-AC controllers have important advantages compared with the phase-controlled AC controllers using thyristors and triacs. The PWM-AC controller has sinusoidal current waveforms, smaller THD values, better power factor, faster dynamics, and smaller input/output filter. This article presents a novel control technique for application to PWM-AC controllers with abi...

  5. AC drives for industrial plants. Plant kudoyo AC drive sochi

    Miyazaki, M.; Shibata, M.; Yamada, S. (Toshiba Corp., Tokyo (Japan))

    1992-08-01

    Features and product series of AC drives for industrial plants were outlined. Configurations and features of various types of AC drives were briefly discussed which are put into market to meet various requirements for industrial plants and wide ranges of output voltage and capacity. The following product series were outlined; the power bipolar transistor inverter for 3.5-600 kVA in output capacity, IGBT inverter for AC 400 V in output voltage and 1,000 kVA or less, GTO inverter for AC 600 V and 700-2,000 kVA, and cycloconverter for AC 1,000-3,000 V and 1,000 kW-20 MW. The following subjects were outlined as current technical trends of AC drives for industrial plants; increasing in capacity of voltage-source PWM inverters, downsizing of converters through highly efficient cooling and highly dense mounting, spreading of sensorless vector controls, and development of high-voltage large-capacity PWM inverters. 6 figs., 2 tabs.

  6. Diagnostics of the Fermilab Tevatron using an AC dipole

    Miyamoto, Ryoichi; /Texas U.

    2008-08-01

    The Fermilab Tevatron is currently the world's highest energy colliding beam facility. Its counter-rotating proton and antiproton beams collide at 2 TeV center-of-mass. Delivery of such intense beam fluxes to experiments has required improved knowledge of the Tevatron's beam optical lattice. An oscillating dipole magnet, referred to as an AC dipole, is one of such a tool to non-destructively assess the optical properties of the synchrotron. We discusses development of an AC dipole system for the Tevatron, a fast-oscillating (f {approx} 20 kHz) dipole magnet which can be adiabatically turned on and off to establish sustained coherent oscillations of the beam particles without affecting the transverse emittance. By utilizing an existing magnet and a higher power audio amplifier, the cost of the Tevatron AC dipole system became relatively inexpensive. We discuss corrections which must be applied to the driven oscillation measurements to obtain the proper interpretation of beam optical parameters from AC dipole studies. After successful operations of the Tevatron AC dipole system, AC dipole systems, similar to that in the Tevatron, will be build for the CERN LHC. We present several measurements of linear optical parameters (beta function and phase advance) for the Tevatron, as well as studies of non-linear perturbations from sextupole and octupole elements.

  7. Acúmulo de macronutrientes pela cultivar de cebola "Superex" estabelecida por semeadura direta Evaluating macronutrients accumulated in onion plants of the 'Superex' cultivar in direct seeding system

    Diego Resende de Queirós Pôrto

    2007-08-01

    Full Text Available O objetivo do trabalho foi quantificar o acúmulo de macronutrientes ao longo do ciclo da cebola, cv. "Superex", estabelecida por semeadura direta. O experimento foi conduzido na Fazenda Rio Doce, entre os municípios de Itobi e São José do Rio Pardo, SP. As amostragens de plantas foram realizadas aos 30, 50, 70, 90, 110, 130 e 150 dias após a semeadura (DAS, para determinação da matéria seca e do acúmulo dos nutrientes (N, P, K, Ca, Mg e S. Os acúmulos máximos de matéria seca da parte aérea e do bulbo foram, respectivamente, de 4,70g planta-1 e 17,86g planta-1, aos 150 DAS. A parte aérea e o bulbo contribuíram, respectivamente, com cerca de 20 e 80% na matéria seca da planta inteira ao final do ciclo. A seqüência de acúmulo dos nutrientes verificada para a cebola "Superex" foi: K>N>Ca>S>Mg>P. A planta de cebola acumulou 202,43; 31,23; 295,28; 172,42; 35,20 e 73,47mg, respectivamente, de N, P, K, Ca, Mg e S. Exportou, pelo bulbo, 67% do N, 85% do P, 68% do K, 57% do Ca, 56% do Mg e 81% do S acumulado pela planta.This research was aimed at counting the concentration of macronutrients throughout the onion, cv Superex, established by direct seeding. The experiment was conducted at Rio Doce farm, between the counties of Itobi and São José do Rio Pardo, state of São Paulo, Brazil (21°37'16"S and 46°53'15"W. The macronutrients N, P, K, Ca, Mg, and S as well as plant dry matter content were evaluated in plant samples taken at 30, 50, 70, 90, 110, and 150 days after seeding (DAS. The maximum dry matter content in the bulb and in the aerial part were reached at 150 DAS and were, respectively, of 4.70 and 17.86g plant-1. The aerial part and the bulb contributed respectively with 20 and 80% of the whole mature plant dry matter. The macronutrients were accumulated in the plant in the following order: K>N>Ca>S>Mg>P. The onion plant accumulated 202.43; 31.23; 295.28; 172.42; 35.20 e 73.47 mg of N, P, K, Ca, Mg, and S, respectively, and

  8. AcEST: BP915640 [AcEST

    Full Text Available YMU001_000074_A01 462 Adiantum capillus-veneris mRNA. clone: YMU001_000074_A01. BP915640 CL3685C ... y: 462 GPLILRACLVYMQGAPVGSLAEDGIVSAATGKDMEQSTVGFRLMLAKI IHRLIAAFKEVG 283 G IL+AC YM+G +GSL +D V ++VGF+LMLAK ... : 1032 GYYILKACDAYMKGYLIGSLTKDASVIDERSS-ANSTSVGFKLMLAKI APKLFSALSEVG 1090 Query: 282 AYCDAYE 262 A C+ ++ Sb ... uery: 453 ILRACLVYMQGAPVGSLAEDGIVSAATGKDMEQSTVGFRLMLAKI IHRLIAAFKEVGAYC 274 +L AC YM+G PVGS A G ST GF++ML+K ... ame = -1 Query: 423 GAPVGSLAEDGIVSAATGKDMEQSTVGFRLMLAKI I----HRLIAAFKEVGAYCD 271 G P+ L D +S GK + S RL + L+ ...

  9. AcEST: DK955197 [AcEST

    Full Text Available TST39A01NGRL0022_H07 532 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0022_H07. 5' end seq ... KDEVTALPLLK 192 Query: 194 RFAFGIACELLMSRYEKEEQEMLEEPF TTMMKGILQLPIKLPGTRFSKAIVAANMLRARF 373 R+ F +AC+L S ... KDEVMALPLLK 192 Query: 194 RFAFGIACELLMSRYEKEEQEMLEEPF TTMMKGILQLPIKLPGTRFSKAIVAANMLRARF 373 R+ F +AC+L S ... KDEVKVLP 189 Query: 185 LMKRFAFGIACELLMSRYEKEEQEMLEEPF TTMMKGILQLPIKLPGTRFSKAIVAANMLR 364 L++ F IA L + +Q+ ... KDEATVLP 177 Query: 185 LMKRFAFGIACELLMSRYEKEEQEMLEEPF TTMMKGILQLPIKLPGTRFSKAIVAANMLR 364 L+K F +A L E+ QE ...

  10. Nuclear structure of $^{231}$Ac

    Boutami, R; Mach, H; Kurcewicz, W; Fraile, L M; Gulda, K; Aas, A J; García-Raffi, L M; Løvhøiden, G; Martínez, T; Rubio, B; Taín, J L; Tengblad, O

    2008-01-01

    The low-energy structure of 231Ac has been investigated by means of gamma ray spectroscopy following the beta-decay of 231Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a mini-orange electron spectrometer. The decay scheme of 231Ra --> 231Ac has been constructed for the first time. The Advanced Time Delayed beta-gamma-gamma(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

  11. AcEST: BP920800 [AcEST

    Full Text Available DLNLALQVHSRMVRFGFNAEVEACGALINMYGKCGKVLYAQRVFDDT 298 Query: 206 RQQDVISWNDIISACAQRGHGTEALENFSQMLHEGIVPNSMTFTSVMQA---CNSIEGG...G L +A S F ++ +D+ISW +I +Q EA+ F Sbjct: 217 SEKNEATSNCLINGYMGLGNLEQAESLFNQMPVKDIISWTTMIKGYSQNKRYREAIAVFY 276 Query: 119 QMLHEG...EKAWRIFDGVSCKNLPSWNAIITGCVQGGLLEEAIDLYRHMK 281 Query: 110 HEGIVPNSMTFTSVMQAC---NSIEGGR 36 + + PN +T +V+ AC +...N IIS AQ G +EA+E ++ M Sbjct: 383 DITIGNAVVVMYAKLGLVDSARAVFNWLPNTDVISWNTIISGYAQNGFASEAIEMYNIME 442 Query: 110 HEG...EIDLGEQIHSLSVKTGFESDMYVSGVLIDMYSKYGWLEKARRVLEML 406 Query: 206 RQQDVISWNDIISACAQRGHGTEALENFSQMLHEGIVPNSMTFTSVMQACNSIEGG

  12. AcEST: DK945549 [AcEST

    Full Text Available AGGCGATTTCATCTTTTCTGAGAACCCTGATTTTGTGATTGTGTAATTACA ACTGTGGAACAGAAGGATGAGAAGTCTACTGACACAACAAGATATCTCTGGAGAGGAGA...A AATTGAGAAGGTTTGAGTTCTCAACAATGGGCTATGAGGCAATAATGGGAAGGCACCGAT TGTGGGCTTGTATAGGTTTTGAC...LCTG 239 L++R+LRR + + ++ G AC+ DP +P PLC+G Sbjct: 108 LQQRELRRKLLADSGALNTNSVNGPRNWKACVQQDPSSRPGTPLCSG 154 >sp|A6UUY8|RNZ_META3...49 Tissue type young leaves Developmental stage sporophyte Contig ID CL454Contig1 Sequence GATGAGCGA...CCACCTGTGCAACCGTCAGCGCCTTTGTGCACTGGTG CAATGTCCTGTGGTTACCTTGTTTGGAATCTTAATTGTTCTCATGTAT

  13. AcEST: BP917632 [AcEST

    Full Text Available YMU001_000103_D10 554 Adiantum capillus-veneris mRNA. clone: YMU001_000103_D10. BP917632 - Show ... YSKCKIHQKALELLVLML 154 Query: 466 KDSLEPDEVTYLNVLKACARE EDLKV 543 +D++ P+ TY +VL++C D+++ Sbjct: 155 RDNVRPN ... 185 Query: 415 GHSDSS--KEALKLLTQMRKDSLEPDEVTYLNVLKACARE EDLK 540 + EA KL +M+ ++ PDE+ N++ AC R +++ Sbjct: 18 ...

  14. AcEST: DK961189 [AcEST

    Full Text Available OS=A... 127 7e-29 sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS... 125 2e-28 sp|P00785|AC...IRNSWGLNWGDSGYVKLQRNIDDPFGKCGIAMMPSYP 347 >sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS=

  15. AcEST: DK946687 [AcEST

    Full Text Available YMU02A01NGRL0013_G11 544 Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0013_G11. 5' end seq ... + G P+ TY+ + AC+ E Sbjct: 97 YSFNYMIRGLTNTWN-------DHEA ---ALSLYRRMKFSGLKPDKFTYNFVFIACAKLE 146 Query: 214 A ... Sbjct: 71 LIPKAVELGDFNYSSFLFSVTEEPNHYSFNYMIRGLTNTWNDHEA ALSLYRRMKFSGLKP 130 Query: 469 DGATFSCVLRACGNVGALDV ...

  16. AcEST: DK949372 [AcEST

    Full Text Available TST38A01NGRL0005_N02 627 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0005_N02. 5' end seq ... 363 DQLREKTC-GVDKFDDIVMACXXXXXXXXXXXXXXXXXXKARVHAYGVCD DPEYFYDYVQ 539 Q++EK G+ FDDIV+AC KA+VHA+ VCD DP+YFYD ... 264 QQVQEKKVPGITFFDDIVVACGSGGSIAGLSLGSYLSNLKAKVHAFAVCD DPDYFYDYTQ 323 Query: 540 GLLDGMNANIASRDIVNVIDAKGLG ...

  17. Consumerism triggers AC explosion

    Lafferty, Richard

    1997-05-01

    The growth in air conditioning in the United Kingdom in recent years is examined in this article, and split systems, the phasing out of CFC and HCFC refrigerants, global warming, and comfort levels are considered. (UK)

  18. DC injection into low voltage AC networks

    NONE

    2005-07-01

    This report summarises the results of a study investigating the impact of levels of injected DC current injections on a low voltage AC distribution network systems in order to recommend acceptable limits of DC from microgeneration. Relevant literature is reviewed, and the impact of DC levels in distribution transformers, transformer modelling, and instrumental transformers are discussed. The impact of DC in residual current devices (RCD) and in domestic electricity watt hour meters is examined along with DC enhanced corrosion, corrosion failure, and the measurement of DC current injection. Sources of DC injection outlined include DC from computer power supplies, network faults, geomagnetic phenomena, lighting circuits/dimmers, and embedded generators.

  19. Modelling of an adsorption system driven by engine waste heat for truck cabin a/c. Performance estimation for a standard driving cycle

    Verde, M.; Cortés, L.; Corberán, J.M.; Sapienza, A.; Vasta, S.; Restuccia, G

    2010-01-01

    Abstract This paper presents the main characteristics of an innovative cooling system for the air-conditioning of a truck cabin, as well as a first estimation of its performance during a standard driving cycle, obtained with a specifically developed vehicle-engine-cooling system overall model. The innovative cooling system consists of a water-zeolite adsorption-desorption system, which employs the waste heat from the engine to produce the cooling of the vehicle cabin. The developed...

  20. Offshore windfarm connection with low frequency AC transmission technology

    Qin, Nan; Xu, Zhao; You, Shi;

    2009-01-01

    This paper investigates the feasibility of using the low frequency AC transmission (LFAC) system, e.g. fraction of 50 Hz or 60 Hz, for connecting the large offshore wind farm to the grid by modelling and simulation. The LFAC system improves the transmission capacity and distance compared to the c...

  1. Apuntes de Acústica

    Martín Domingo, Agustín

    2014-01-01

    Esta publicacion contiene unos apuntes para la parte de Acústica de las asignaturas de la ETSAM, junto con cierta cantidad de material adicional que excede el ámbito del curso. Aunque está lejos de ser completa y de estar libre de errores, el autor espera sea útil.

  2. SSTI Clark ACS Technology Demonstrations

    Freesland, Douglas

    1997-01-01

    SSTI Clark, one of two spacecraft built under NASA's Small Satellite Technology Initiative, includes seven ACS technology demonstrations. The technologies redefine the performance cost envelope, providing improved sensor and actuator performance at reduced costs. Six sensing technologies are being flown consisting of both hardware and algorithmic demonstrations: autonomous star tracker, hemispherical resonating gyro, GPS attitude determination, miniature horizon sensors, low cost course sun s...

  3. Energy saving in ac generators

    Nola, F. J.

    1980-01-01

    Circuit cuts no-load losses, without sacrificing full-load power. Phase-contro circuit includes gate-controlled semiconductor switch that cuts off applied voltage for most of ac cycle if generator idling. Switch "on" time increases when generator is in operation.

  4. Construction and function of recombinant AcMNPV with double copies of v-cath gene

    2002-01-01

    Two recombinant baculoviruses, dciAcMNPV and dcdAcMNPV in which another copy of the v-cath gene controlled by ie1 promoter and polh promoter was inserted, were respectively constructed by the Bac-to-Bac system. The expression of the v-cath gene of the recombinant baculoviruses in Sf9 cells at different phases was investigated by SDS- PAGE and Western blot. The results showed that only recombinant virus dciAcMNPV containing late gene v-cath driven by early gene promoter could express V-CATH protein, cathepsin encoded by virus genome, 12 h post-infection and dcdAcMNPV containing late gene v-cath driven by late and very late gene promoters could express more V-CATH protein. Negative control ncAcMNPV, a mutant deleted v- cath gene, could not express V-CATH protein at all. The Spodopera exigua larvae were infected with viruses respectively and the results showed that the toxicity was as follows: dcdAcMNPV>dciAcMNPV>wtAcMNPV>ncAcMNPV. The toxicity of recombinant viruses and the characters of dead larvae showed that the v-cath gene was relative to viral toxicity and host liquefaction. Recombinant baculovirus dcdAcMNPV might be used as a new kind of safe viral-pes- ticide, because of its high toxicity obtained by adding another gene copy and changing the expression level of its own gene relative to virulence.

  5. AC 95 - selected readings

    NONE

    1995-12-31

    Reports are presented on energy efficiency and conservation in residential buildings. Topics include housing and energy linkages; the people factor; low-income initiatives; green visions; utility programs; affordable comfort; housing as a system; and pressures and air flow in buildings.

  6. Concurrent Electroencephalography Recording During Transcranial Alternating Current Stimulation (tACS).

    Fehér, Kristoffer D; Morishima, Yosuke

    2016-01-01

    Oscillatory brain activities are considered to reflect the basis of rhythmic changes in transmission efficacy across brain networks and are assumed to integrate cognitive neural processes. Transcranial alternating current stimulation (tACS) holds the promise to elucidate the causal link between specific frequencies of oscillatory brain activity and cognitive processes. Simultaneous electroencephalography (EEG) recording during tACS would offer an opportunity to directly explore immediate neurophysiological effects of tACS. However, it is not trivial to measure EEG signals during tACS, as tACS creates a huge artifact in EEG data. Here we explain how to set up concurrent tACS-EEG experiments. Two necessary considerations for successful EEG recording while applying tACS are highlighted. First, bridging of the tACS and EEG electrodes via leaking EEG gel immediately saturates the EEG amplifier. To avoid bridging via gel, the viscosity of the EEG gel is the most important parameter. The EEG gel must be viscous to avoid bridging, but at the same time sufficiently fluid to create contact between the tACS electrode and the scalp. Second, due to the large amplitude of the tACS artifact, it is important to consider using an EEG system with a high resolution analog-to-digital (A/D) converter. In particular, the magnitude of the tACS artifact can exceed 100 mV at the vicinity of a stimulation electrode when 1 mA tACS is applied. The resolution of the A/D converter is of importance to measure good quality EEG data from the vicinity of the stimulation site. By following these guidelines for the procedures and technical considerations, successful concurrent EEG recording during tACS will be realized. PMID:26862814

  7. Experiments on Corona Discharge Under AC and DC Composite Voltage

    ZHU Zhengyi; LI Ruihai; WANG Guoli; CHEN Can; JIA Zhidong; GUAN Zhicheng

    2012-01-01

    Converter transformers are one of the most important electrical apparatuses in the ultra high voltage(UHV) DC transmission systems.The valve side and the low voltage(LV) bushing are stressed by long-term AC and DC composite voltage leading to significant partial discharge(PD) and posing great danger to the insulation system.In this paper AC and DC composite voltage is applied on a metal needle-plate model to produce PD signal sequences,and then the pulse waveshape and frequency spectrum are analyzed and compared with PD signals under conventional AC or DC voltage.In the end,the phase-resolved distribution is analyzed to depict the new characteristics of PD under this composite voltage.

  8. AcEST: DK950895 [AcEST

    Full Text Available |A7SFA3|A7SFA3_NEMVE Predicted protein OS=Nematostella vectens... 210 5e-53 tr|Q0CVA9|Q0CVA9_ASPTN ATP-citrate synthase subunit...stX Result : Swiss-Prot sp_hit_id Q54YA0 Definition sp|Q54YA0|ACLY_DICDI Probable ATP-citrate synthase OS=Dictyos...PIDYSWAQELGLIRKPAAFISTI 404 >sp|Q8X097|ACL1_NEUCR Probable ATP-citrate synthase subunit 1 OS=Neurospora cras...IRKPASFMTSI 844 >sp|Q9P7W3|ACL1_SCHPO Probable ATP-citrate synthase subunit 1 OS=Schizosaccharomyces pombe G....done Score E Sequences producing significant alignments: (bits) Value sp|Q54YA0|ACLY_DICDI Probable ATP-citrate synthase OS=Dictyos

  9. AcEST: BP914304 [AcEST

    Full Text Available IDEHTFVFTLRAC 4 V+ NA++ Y G+ E A++ + +M+ E++ + TF+ LRAC Sbjct: 670 VTWNAMICGYAHHGKGEEAIQLFERMILENIKPNHVTFISI...KSLRRDFVTWNAMICGYAHHGKGEEAIQLFERMILENIKPN 703 Query: 339 NLTYVSLFKACGNVLDFGQG-RTIHGEARANGFSSDRFICTTLI...TFVFTLRAC 4 +F + + V+ N ++ +YV A +++M + D TL+AC Sbjct: 484 QIFERMCDRDNVTWNTIIGSYVQDENESEAFDLFKRMNLCGIVSDGACL...K + A+Q+ + R + +W++MI++ +A + ++ M Sbjct: 93 LGNSLINFYSKFEDVASAEQVFRRMTLRDVVTWSSMIAAYAGNNHPAKAFDTFERMTDAN 152... + R + +W++MI++ +A + ++ M Sbjct: 93 LGNSLINFYSKFEDVASAEQVFRRMTLRDVVTWSSMIAAYAGNNHPAKAFDTFERM

  10. AcEST: BP911793 [AcEST

    Full Text Available + +VSWN +++ Y QHG + ++L+ M+AE T N + + A Sbjct: 58 EAKFVFERIQNKDVVSWNCIINGYSQHGPSGSSHVMELFQRMRAENTAPNAHTFAGVF... N + + A Sbjct: 58 EAKFVFERIQNKDVVSWNCIINGYSQHGPSGSSHVMELFQRMRAENTAPNAHTFAGVFTA 117 Query: 359 CIQTGNLELCKQM...D VT S+LSACSH G + +G YF Sbjct: 602 IIGGSAQHGRGQDALQLFERMKMEGVKPDIVTFVSLLSACSHAGLLEEGRRYF 654 Score = 115 bit...53 QTGNLELCKQMHFNIVSAGNELNPSLASSLIRTYGNCGSMLDAHAVFDSLPLPDIVSWNV 174 Q +E+ K++ F+++ N S +++I Y CG + +A +FD +P D VSW Sbjct: 324 QGERME... L+ M +E + I+LV +L AC+ TG+LE + +H Sbjct: 498 VITWNAMIASYVHCEQSEKAIALFDRMVSENFKPSSITLVTLLMACVNTGSLER