WorldWideScience

Sample records for ac plasma polymerisation

  1. Surface modification of PET films using pulsed AC plasma polymerisation aimed at preventing protein adsorption

    Ademovic, Z.; Wei, J.; Winther-Jensen, Bjørn;

    2005-01-01

    We utilise pulsed AC plasma polymerisation to create thin films that either contain reactive acid functional groups (by deposition of maleic anhydride (MAH) followed by hydrolysis) or are poly(ethylene glycol) (PEG)-like in nature (by using diethylene glycol vinyl ether (DEGVE) as monomer). The MAH...

  2. RF plasma polymerised thin films from natural resources

    Plasma polymerisation is an effective tool for fabrication of thin films from volatile organic monomers. RF plasma assisted deposition is used for one-step, chemical-free polymerisation of nonsynthetic materials derived directly from agricultural produces. By varying the deposition parameters, especially the input RF power, the film properties can be tailored for a range of uses, including electronics or biomedical applications. The fabricated thin films are optically transparent with refractive index close to that of glass. Given the diversity of essential oils, this paper compares the chemical and physical properties of thin films fabricated from several commercially exploited essential oils and their components. It is interesting to note that some of the properties can be tailored for various applications even though the chemical structure of the derived polymer is very similar. The obtained material properties also show that the synthesised materials are suitable as encapsulating layers for biodegradable implantable metals. (author)

  3. Hydrolysis and stability of thin pulsed plasma polymerised maleic anhydride coatings

    Drews, Joanna Maria; Launay, Héléne; Hansen, Charles M.;

    2008-01-01

    Abstract The stability of plasma polymerised layers has become important because of their widespread use. This study explored the hydrolysis and degradation stability of coatings of plasma polymerised maleic anhydride. Coatings made with different plasma parameters were exposed to aqueous media of...... different pH as a function of time. ATR-FTIR was used for structure analysis and a toluidine blue staining method allowed quantitative analysis of the hydrolysis of anhydride groups to acid groups. Coatings with constant thickness were obtained at different plasma powers and layers with varying thickness...

  4. An XPS study of pulsed plasma polymerised allyl alcohol film growth on polyurethane

    The growth of highly functionalised poly allyl alcohol films by pulsed plasma polymerisation of CH2 =CHCH2OH on biomedical grade polyurethane has been followed by X-ray photoelectron spectroscopy (XPS) and contact angle measurements. Film thickness is observed to increase approximately linearly with plasma modification time, suggesting a layer-by-layer growth mode of poly allyl alcohol. Water contact angle measurements reveal the change in the surface free energy of wetting decreases linearly with plasma modification up to the monolayer point after which a constant limiting value of -24 mJ m-2 was attained. Films prepared at 20 W plasma power with a duty cycle of 10 μs:500 μs exhibit a high degree of hydroxyl (-OH) retention with minimal fragmentation of the monomer observed. Increasing the plasma power up to 125 W is found to improve -OH retention at the expense of ether formation generating films close to the monomer stoichiometry. Duty cycle plays an important role in controlling both film composition and thickness, with longer off times increasing -OH retention, while longer on times enhance allyl alcohol film growth

  5. Osteoblasts with impaired spreading capacity benefit from the positive charges of plasma polymerised allylamine

    F Kunz

    2015-03-01

    Full Text Available Bone diseases such as osteoporosis, osteoarthritis and rheumatoid arthritis, impinge on the performance of orthopaedic implants by impairing bone regeneration. For this reason, the development of effective surface modifications supporting the ingrowth of implants in morbid bone tissue is essential. Our study is designed to elucidate if cells with restricted cell-function limiting adhesion processes benefit from plasma polymer deposition on titanium. We used the actin filament disrupting agent cytochalasin D (CD as an experimental model for cells with impaired actin cytoskeleton. Indeed, the cell’s capacity to adhere and spread was drastically reduced due to shortened actin filaments and vinculin contacts that were smaller. The coating of titanium with a positively charged nanolayer of plasma polymerised allylamine (PPAAm abrogated these disadvantages in cell adhesion and the CD-treated osteoblasts were able to spread significantly. Interestingly, PPAAm increased spreading by causing enhanced vinculin number and contact length, but without significantly reorganising actin filaments. PPAAm with the monomer allylamine was deposited in a microwave-excited low-pressure plasma-processing reactor. Cell physiology was monitored by flow cytometry and confocal laser scanning microscopy, and the length and number of actin filaments was quantified by mathematical image processing. We showed that biomaterial surface modification with PPAAm could be beneficial even for osteoblasts with impaired cytoskeleton components. These insights into in vitro conditions may be used for the evaluation of future strategies to design implants for morbid bone tissue.

  6. Surface functionalisation of polypropylene hernia-repair meshes by RF-activated plasma polymerisation of acrylic acid and silver nanoparticles

    Graphical abstract: - Highlights: • Polypropylene meshes for hernioplasty were surface functionalised via plasma-polymerisation to confer adhesive properties. • Subsequently, silver nanoparticles were loaded to add antibacterial activity. • Materials were physico-chemical characterised and adhesive properties evaluated. - Abstract: Hernia diseases are among the most common and diffuse causes of surgical interventions. Unfortunately, still nowadays there are different phenomena which can cause the hernioplasty failure, for instance post-operative prostheses displacements and proliferation of bacteria in the surgical site. In order to limit these problems, commercial polypropylene (PP) and polypropylene/Teflon (PP/PTFE) bi-material meshes were surface functionalised to confer adhesive properties (and therefore reduce undesired displacements) using polyacrylic acid synthesized by plasma polymerisation (PPAA). A broad physico-chemical and morphological characterisation was carried out and adhesion properties were investigated by means of atomic force microscopy (AFM) used in force/distance (F/D) mode. Once biomedical devices surface was functionalised by PPAA coating, metallic silver nanoparticles (AgNPs) with antimicrobial properties were synthesised and loaded onto the polymeric prostheses. The effect of the PPAA, containing carboxylic functionalities, adhesive coating towards AgNPs loading capacity was verified by means of X-ray photoelectron spectroscopy (XPS). Preliminary measurement of the Ag loaded amount and release in water were also investigated via inductively coupled plasma atomic emission spectroscopy (ICP-AES). Promising results were obtained for the functionalised biomaterials, encouraging future in vitro and in vivo tests

  7. Surface functionalisation of polypropylene hernia-repair meshes by RF-activated plasma polymerisation of acrylic acid and silver nanoparticles

    Nisticò, Roberto, E-mail: roberto.nistico@unito.it [University of Torino, Department of Chemistry and NIS Research Centre, Via P. Giuria 7, 10125 Torino (Italy); Rosellini, Andrea [University of Torino, Department of Chemistry and NIS Research Centre, Via P. Giuria 7, 10125 Torino (Italy); Rivolo, Paola [Politecnico di Torino, Dipartimento di Scienza Applicata e Tecnologia, C.so Duca degli Abruzzi 24, 10129 Torino (Italy); Faga, Maria Giulia [CNR-IMAMOTER, Strada delle Cacce 73, 10135 Torino (Italy); Lamberti, Roberta; Martorana, Selanna [Herniamesh S.r.l., Via F.lli Meliga 1/C, 10034 Chivasso (Italy); Castellino, Micaela [Center for Space Human Robotics, Istituto Italiano di Tecnologia, Corso Trento 21, 10129 Torino (Italy); Virga, Alessandro; Mandracci, Pietro [Politecnico di Torino, Dipartimento di Scienza Applicata e Tecnologia, C.so Duca degli Abruzzi 24, 10129 Torino (Italy); Malandrino, Mery; Magnacca, Giuliana [University of Torino, Department of Chemistry and NIS Research Centre, Via P. Giuria 7, 10125 Torino (Italy)

    2015-02-15

    Graphical abstract: - Highlights: • Polypropylene meshes for hernioplasty were surface functionalised via plasma-polymerisation to confer adhesive properties. • Subsequently, silver nanoparticles were loaded to add antibacterial activity. • Materials were physico-chemical characterised and adhesive properties evaluated. - Abstract: Hernia diseases are among the most common and diffuse causes of surgical interventions. Unfortunately, still nowadays there are different phenomena which can cause the hernioplasty failure, for instance post-operative prostheses displacements and proliferation of bacteria in the surgical site. In order to limit these problems, commercial polypropylene (PP) and polypropylene/Teflon (PP/PTFE) bi-material meshes were surface functionalised to confer adhesive properties (and therefore reduce undesired displacements) using polyacrylic acid synthesized by plasma polymerisation (PPAA). A broad physico-chemical and morphological characterisation was carried out and adhesion properties were investigated by means of atomic force microscopy (AFM) used in force/distance (F/D) mode. Once biomedical devices surface was functionalised by PPAA coating, metallic silver nanoparticles (AgNPs) with antimicrobial properties were synthesised and loaded onto the polymeric prostheses. The effect of the PPAA, containing carboxylic functionalities, adhesive coating towards AgNPs loading capacity was verified by means of X-ray photoelectron spectroscopy (XPS). Preliminary measurement of the Ag loaded amount and release in water were also investigated via inductively coupled plasma atomic emission spectroscopy (ICP-AES). Promising results were obtained for the functionalised biomaterials, encouraging future in vitro and in vivo tests.

  8. Effect of RF power on the optical and morphological properties of RF plasma polymerised linalyl acetate thin films

    Thin films derived from linalyl acetate were fabricated using the Radio Frequency (RF) plasma polymerisation technique between RF power levels of 10 and 75 W. The optical properties of the films were investigated using spectroscopic ellipsometry and UV-vis spectroscopy between 200 and 1000 nm. An optical band gap of approximately 3 eV for all power levels was determined from Tauc plots. The surface morphology and hardness of the material were studied using AFM and nano-indentation respectively to determine the effect of RF power on the thin film properties. Smooth surfaces with an average roughness of approximately 0.2 nm with consistent morphology were obtained across all power levels, while hardness demonstrated a linearly increasing dependence on RF deposition power, with values ranging between 0.29 and 0.44 GPa. These studies indicate the ability to tailor film characteristics by varying the RF deposition power, and the potential for the films to be used within electronic devices as encapsulation layers, insulating layers, or as semiconducting layers with the introduction of charge carriers to the chemical structure of the material.

  9. Mesenchymal cells and entothelial cells on micropatterned surfaces prepared by plasma polymerisation

    Filová, Elena; Bullett, N. A.; Bačáková, Lucie; Grausová, Ľubica; Haycock, J. W.; Shard, A.

    Amsterdam: Marathon International, 2008. ---. [World Biomaterials Congress /8./. 28.05.2008-01.06.2008, Amsterdam] R&D Projects: GA AV ČR(CZ) IAA5011301 Institutional research plan: CEZ:AV0Z50110509 Keywords : spo2 * mesenchymal stem cells * microdomains * plasma polymerization Subject RIV: EI - Biotechnology ; Bionics

  10. Controlling Interface Adhesion and Fracture Properties in Composite Materials by Plasma Polymerisation

    Goutianos, S.; Drews, J.; Fæster Nielsen, Søren;

    2006-01-01

    The effect of plasma polymerization on the interface adhesion between carbon fibres and an epoxy matrix was investigated. This was done by loading with pure bending moments in nominal mode I planar glassy carbon/ epoxy specimens. The glassy carbon was used to simulate the carbon fibres. The...

  11. Principles of Coordination Polymerisation

    Kuran, Witold

    2001-11-01

    The first all-inclusive text covering coordination polymerisation, including important classes of non-hydrocarbon monomers. Charting the achievements and progress in the field, in terms of both basic and industrial research, this book offers a unified and complete overview of coordination polymerisation. Provides detailed description of the historical development of the subject Presents a unified view of catalysis, mechanisms, structures and utility Encourages learning through a step-by-step progression from basic to in-depth text Features end-of-chapter exercises to reinforce understanding Offers a full bibliography and comprehensive literature review Requisite reading for research students studying introductory and advanced courses in; polymer science, catalysis and polymerisation catalysis, and valuable reference for researchers and technicians in industry.

  12. Surface Polymerisation Methods for Optimised Adhesion

    Drews, Joanna Maria

    Arbejdet har fokuseret på muligheder for at forstærke kompositmaterialer til højteknologiske anvendelser fx til vindmøllevinger. Forskningen har derfor været centreret om plasma polymerisation af henholdsvis maleic anhydrid (MAH) og 1,2-methylenedioxybenzen til tynde film på modelkulstofsubstrater...

  13. Enhancing tissue integration and angiogenesis of a novel nanocomposite polymer using plasma surface polymerisation, an in vitro and in vivo study.

    Griffin, Michelle F; Palgrave, Robert G; Seifalian, Alexander M; Butler, Peter E; Kalaskar, Deepak M

    2016-01-01

    Current surgical reconstruction of facial defects including nose or ear involves harvesting patient's own autologous tissue, causing donor site morbidity and is limited by tissue availability. The use of alternative synthetic materials is also limited due to complications related to poor tissue integration and angiogenesis, which lead to extrusion of implants and infection. We intend to meet this clinical challenge by using a novel nanocomposite called polyhedral oligomeric silsesquioxane poly(carbonate-urea)urethane (POSS-PCU), which has already been successfully taken to the clinical bench-side as a replacement for trachea, tear duct and vascular by-pass graft. In this study, we aimed to enhance tissue integration and angiogenesis of POSS-PCU using an established surface treatment technique, plasma surface polymerisation (PSP), functionalising the surface using NH2 and COOH chemical groups. Physical characterisation of scaffolds was achieved by using a number of techniques, including water contact angle, SEM, AFM and XPS to study the effects of PSM modification on the POSS-PCU nanocomposite in detail, which has not been previously documented. Wettability evaluation confirmed that scaffolds become hydrophilic and AFM analysis confirmed that nano topographical alterations resulted as a consequence of PSP treatment. Chemical functionalisation was confirmed using XPS, which suggested the presence of NH2 and COOH functional groups on the scaffolds. The modified scaffolds were then tested both in vitro and in vivo to investigate the potential of PSP modified POSS-PCU scaffolds on tissue integration and angiogenesis. In vitro analysis confirmed that PSM modification resulted in higher cellular growth, proliferation and ECM production as assessed by biochemical assays and immunofluorescence. Subcutaneous implantation of modified POSS-PCU scaffolds was then carried out over 12-weeks, resulting in enhanced tissue integration and angiogenesis (p < 0.05). This study

  14. Ion irradiation as a tool for modifying the surface and optical properties of plasma polymerised thin films

    Grant, Daniel S.; Bazaka, Kateryna; Siegele, Rainer; Holt, Stephen A.; Jacob, Mohan V.

    2015-10-01

    Radio frequency (R.F.) glow discharge polyterpenol thin films were prepared on silicon wafers and irradiated with I10+ ions to fluences of 1 × 1010 and 1 × 1012 ions/cm2. Post-irradiation characterisation of these films indicated the development of well-defined nano-scale ion entry tracks, highlighting prospective applications for ion irradiated polyterpenol thin films in a variety of membrane and nanotube-fabrication functions. Optical characterisation showed the films to be optically transparent within the visible spectrum and revealed an ability to selectively control the thin film refractive index as a function of fluence. This indicates that ion irradiation processing may be employed to produce plasma-polymer waveguides to accommodate a variety of wavelengths. XRR probing of the substrate-thin film interface revealed interfacial roughness values comparable to those obtained for the uncoated substrate's surface (i.e., both on the order of 5 Å), indicating minimal substrate etching during the plasma deposition process.

  15. An epoxide modified polymerisable compound

    The description is given of an epoxide modified polymerisable compound. It includes a mixture of the following reactive substances; a vinyled carboxylic acid which is acrylic or methacrylic acid; an aliphatic epoxide; a diepoxide and a modifier containing a reagent group that is a carboxylic acid; a phenol, an alcohol, a carboxylic acid amide or a carboxylic acid halogenide

  16. AC Glow Discharge Plasma in N2O

    This paper considers the optical and electrical characterization of AC glow discharge plasma in the abnormal glow mode used for optical emission spectroscopy. The total discharge current and applied voltage are measured using conventional techniques. The electrical characteristics of the planer-cathode glow discharge confirmed that the plasma is operating at abnormal discharge mode characterized by the increases in the operating voltage as the current was raised under given pressure. Optical emission spectroscopy was used to determine the main emission lines of the glow discharge plasma of N2O at pressures between 0.5 and 4.0 Torr. It shows that the discharge emission range is mainly within 300-400 nm. The emission lines correspond to NO, O2, and O2+ are the dominant lines in the glow discharge plasma in the present study. Intensity of the emission lines show linear increase with the discharge current up to 0.4 A followed by saturation at higher currents. No emission lines were observed in this work corresponding to atomic oxygen or nitrogen

  17. Symmetry-breaking in chiral polymerisation

    Wattis, J A D; Wattis, Jonathan AD; Coveney, Peter V.

    2004-01-01

    We propose a model for chiral polymerisation and investigate its symmetric and asymmetric solutions. The model has a source species which decays into left- and right-handed types of monomer, each of which can polymerise to form homochiral chains; these chains are susceptible to `poisoning' by the opposite handed monomer. Homochiral polymers are assumed to influence the proportion of each type of monomer formed from the precursor. We show that for certain parameter values a positive feedback mechanism makes the symmetric steady-state solution unstable. The kinetics of polymer formation are then analysed in the case where the system starts from zero concentrations of monomer and chains. We show that following a long induction time, extremely large concentrations of polymers are formed for a short time, during this time an asymmetry introduced into the system by a random external perturbation may be massively amplified. The system then approaches one of the steady-state solutions described above.

  18. Characteristics of plasma sterilizer using microwave torch plasma with AC high-voltage discharge plasma

    Itarashiki, Tomomasa; Hayashi, Nobuya; Yonesu, Akira

    2016-01-01

    Microwave plasma sterilization has recently been attracting attention for medical applications. However, it is difficult to perform low-temperature sterilization in short time periods. Increasing the output power shortens the time required for sterilization but causes the temperature to increase. To overcome this issue, we have developed a hybrid plasma system that combines a microwave torch plasma and a high-voltage mesh plasma, which allows radicals to be produced at low temperatures. Using this system, successful sterilization was shown to be possible in a period of 45 min at a temperature of 41 °C.

  19. Research and Development of Large Area Color AC Plasma Displays

    Shinoda, Tsutae

    1998-10-01

    Plasma display is essentially a gas discharge device using discharges in small cavities about 0. 1 m. The color plasma displays utilize the visible light from phosphors excited by the ultra-violet by discharge in contrast to monochrome plasma displays utilizing visible light directly from gas discharges. At the early stage of the color plasma display development, the degradation of the phosphors and unstable operating voltage prevented to realize a practical color plasma display. The introduction of the three-electrode surface-discharge technology opened the way to solve the problems. Two key technologies of a simple panel structure with a stripe rib and phosphor alignment and a full color image driving method with an address-and-display-period-separated sub-field method have realized practically available full color plasma displays. A full color plasma display has been firstly developed in 1992 with a 21-in.-diagonal PDP and then a 42-in.-diagonal PDP in 1995 Currently a 50-in.-diagonal color plasma display has been developed. The large area color plasma displays have already been put into the market and are creating new markets, such as a wall hanging TV and multimedia displays for advertisement, information, etc. This paper will show the history of the surface-discharge color plasma display technologies and current status of the color plasma display.

  20. Plasmas in saline solutions sustained using rectified ac voltages: polarity and frequency effects on the discharge behaviour

    Chang, Hung-wen; Hsu, Cheng-che

    2012-06-01

    In this work, three major problems, namely severe electrode damage, poor plasma stability and excess power consumption, arising in ac-driven plasmas in saline solutions are solved using a rectified power source. Diagnostic studies on the effects of power source polarity and frequency on the plasma behaviour are performed. Examination of I-V characteristics and temporally resolved light emission shows that the polarity significantly influences the current amplitude when the plasma exists, while the frequency alters the bubble dynamics, which in turn affects the plasma ignition voltage. When the plasma is driven by a rectified ac power source, the electrode erosion is reduced substantially. With a low frequency, moderate applied voltage and positively rectified ac power source (e.g. 100 Hz and 350 V), a stable plasma is ignited in nearly every power cycle.

  1. Bespoke cationic nano-objects via RAFT aqueous dispersion polymerisation

    Williams, M.; Penfold, NJW; Lovett, JR; Warren, NJ; Douglas, CWI; Doroshenko, N; Verstraete, P; Smets, J; Armes, SP

    2016-01-01

    A range of cationic diblock copolymer nanoparticles are synthesised via polymerisation-induced self-assembly (PISA) using a RAFT aqueous dispersion polymerisation formulation. The cationic character of these nanoparticles can be systematically varied by utilising a binary mixture of two macro-CTAs, namely non-ionic poly(glycerol monomethacrylate) (PGMA) and cationic poly[2-(methacryloyloxy)ethyl]trimethylammonium chloride (PQDMA), with poly(2-hydroxypropyl methacrylate) (PHPMA) being selected...

  2. Studies on the incorporation of lipase in synthetic polymerisable vesicles.

    Mosmuller, E.W.J.

    1993-01-01

    This thesis describes studies on the suitability of synthetic polymerisable vesicles for the incorporation and stabilisation of lipase for the bioconversion of organic chemical compounds.In chapter 1 , some characteristics are reviewed of hydrolytic enzymes, and more specific those of lipases. In chapter 2 an overview is presented of the features and properties of surfactants and vesicles.In chapter 3 , the incorporation is described of lipase from Candida cylindracea (CCL) into polymerisable...

  3. Anionic polymerisation of methyl methacrylate with complex initiator system

    Nugay, Turgut; Nugay, Nihan; Jérôme, Robert

    2002-01-01

    Polymerisation of methyl methacrylate was conducted by using alkyl lithium/dimethylsulfoxide (DMSO) system as initiator in toluene. A special attention was focused on using some lithium polyetheralkoxides as polymerisation promoters at ambient temperatures. Poly(methyl methacrylate) samples were characterized with Gel Permeation Chromatography (GPC), Nuclear Magnetic Resonance Spectroscopy (H-1 NMR) and Differential Scanning Calorimetry (DSC). The positive effect of the mu/sigma type ligands ...

  4. Measurements of Electron Temperature and Density, in an AC Pulsed Oxygen Plasma Discharge

    Yousif, Farook; Martinez, Horacio; Castillo, Fermin

    2007-06-01

    Emission and analytical spectroscopy was applied to investigate O2 plasma, which was generated by an AC discharge between 0.15 and 0.5 Torr pressure. For the diagnostic study, a double Langmuir probe was employed. The derivation of plasma parameters is based on a theoretical description of the double-probe current-voltage characterization in the Thick Sheath Limit (TSL) region [1]. Electron temperature of Te = 1.09 eV and an ion density of ni= 2.08 x 10^10 cm-3 were evaluated at 2 Torr. We present electron temperature and ion density as a function of the pressure at 3 different power discharge levels. Also we present emission spectroscopy in the wavelength range of 200-1100 nm as a function of the pressure. [1] J.D. Swift and J. R. Schwar, Electric Probes for Plasma Diagnostics (New York: Elsevier) 1971.

  5. Thermal and radiation induced polymerisation of carbon sub-oxide

    This research thesis addresses the study of the polymerisation of carbon sub-oxide (C3O2) in gaseous phase. As this work is related to other researches dealing with the reactions of the graphite-CO2 system which occur in graphite-moderated nuclear reactors, a first intention was to study the behaviour of C3O2 when submitted to radiations. Preliminary tests showed that the most remarkable result of this action was the formation of a polymer. It was also noticed that the polymerisation of this gas was spontaneous however slower at room temperature. The research thus focused on this polymerisation, and on the formula of the obtained polymer. After some generalities, the author reports the preparation, purification and storage and conservation of the carbon sub-oxide. The next parts report the kinetic study of thermal polymerisation, the study of polymerisation under γ rays, the study of the obtained polymer by using visible, UV and infrared spectroscopy, electronic paramagnetic resonance, and semi-conductivity measurements

  6. Carbon Nanostructures Production by AC Arc Discharge Plasma Process at Atmospheric Pressure

    Shenqiang Zhao; Ruoyu Hong; Zhi Luo; Haifeng Lu; Biao Yan

    2011-01-01

    Carbon nanostructures have received much attention for a wide range of applications. In this paper, we produced carbon nanostructures by decomposition of benzene using AC arc discharge plasma process at atmospheric pressure. Discharge was carried out at a voltage of 380 V, with a current of 6 A–20 A. The products were characterized by scanning electron microscopy (SEM), high-resolution transmission electron microscopy (HRTEM), powder X-ray diffraction (XRD), and Raman spectra. The results sho...

  7. Production Of Multi-magnetron Plasma By Using Polyphase Ac Glow Discharge In An Improved Multi-pole Magnetic Field

    Matsumoto, Kazunori; Motoki, Kentaro; Miyamoto, Masahiro; Uetani, Yasuhiro

    1998-10-01

    Effects of an improved multi-pole magnetic field on a plasma production generated by a polyphase ac glow discharge with multiple electrodes have been investigated. Conventional configuration of the multi-pole magnetic filed has been modified to suppress plasma losses at both ends of the chamber due to ExB drift motion. The modified multi-pole magnetic field has enabled us to produce a multiple magnetron-plasma at a considerably low pressure less than mTorr. The low temperature plasma has been widely used as the fine processing technology of a dry etching and as the thin film formation technology of a sputtering coating. Large-scale plasmas which can be generated at a low gas-pressure have been desired for more wider dry etching and greater sputter coating. The purpose of this study is to develop a large-scale and low-cost plasma generator by using a polyphase ac power source with the low frequency. In this session, we will present the experimental result as to a multiple magnetron-plasma generated in the modified twenty-four poles magnetic field by using the twenty-four-phase ac power source with the commercial electric power frequency of 60Hz. The ac power is supplied to twenty-four electrodes which are fixed to the water-cooled chamber-wall through sheet insulators so that the electrodes can be cooled indirectly.

  8. Plasma antennas driven by 5–20 kHz AC power supply

    Zhao, Jiansen, E-mail: 67093058@qq.com; Chen, Yuli; Sun, Yang; Wu, Huafeng; Liu, Yue; Yuan, Qiumeng [Merchant Marine College, Shanghai Maritime University, Shanghai, 201306 (China)

    2015-12-15

    The experiments described in this work were performed with the aim of introducing a new plasma antenna that was excited by a 5–20 kHz alternating current (AC) power supply, where the antenna was transformed into a U-shape. The results show that the impedance, voltage standing-wave ratio (VSWR), radiation pattern and gain characteristics of the antenna can be controlled rapidly by varying not only the discharge power, but also by varying the discharge frequency in the range from 5 to 20 kHz. When the discharge frequency is adjusted from 10 to 12 kHz, the gain is higher within a relatively broad frequency band and the switch-on time is less than 1 ms when the discharge power is less than 5 W, meaning that the plasma antenna can be turned on and off rapidly.

  9. Plasma characteristics of argon glow discharge produced by AC power supply operating at low frequencies

    Kongpiboolkid, Watcharapon; Mongkolnavin, Rattachat [Department of Physics, Facuty of Science, Chulalongkorn University, Bangkok (Thailand); Plasma Technology and Nuclear Fusion Research Unit, Chulalongkorn University, Bangkok (Thailand)

    2015-04-24

    Non-thermal properties of Argon glow discharge operating with various operating pressures were measured and presented in this work. The Argon plasma is produced by a parallel conducting electrodes coupling with a high voltage AC power supply. The power supply can generate high AC voltage at various frequencies. The frequencies for the operation are in the range of a few kHz. The system is capable of generating electric field between the two metal electrodes discharge system. The characteristics of plasma produced were measured by optical emission spectroscopy (OES) technique where electron temperature (T{sub e}) and electron number density (n{sub e}) can be determined by line intensity ratio method. The value of electron number density was then determined from the Saha-Eggert equation. Our results show that the electron number density of the discharge obtained is of the order of 10{sup −17} − 10{sup −18} m{sup −3} where the electron temperature is between 1.00−2.00 eV for various operating frequencies used which are in good agreement with similar results published earlier.

  10. Plasma characteristics of argon glow discharge produced by AC power supply operating at low frequencies

    Non-thermal properties of Argon glow discharge operating with various operating pressures were measured and presented in this work. The Argon plasma is produced by a parallel conducting electrodes coupling with a high voltage AC power supply. The power supply can generate high AC voltage at various frequencies. The frequencies for the operation are in the range of a few kHz. The system is capable of generating electric field between the two metal electrodes discharge system. The characteristics of plasma produced were measured by optical emission spectroscopy (OES) technique where electron temperature (Te) and electron number density (ne) can be determined by line intensity ratio method. The value of electron number density was then determined from the Saha-Eggert equation. Our results show that the electron number density of the discharge obtained is of the order of 10−17 − 10−18 m−3 where the electron temperature is between 1.00−2.00 eV for various operating frequencies used which are in good agreement with similar results published earlier

  11. Clinical significance of changes of plasma ADM, ET-1 and GMP-140 levels in patients with acute coronary syndrome (ACS)

    Objective: To investigate the clinical significance of changes of plasma levels of adrenomedullin (ADM), ET-1 and α-granule membrane protein (GMP-140) levels in the pathogenesis of acute coronary syndrome (ACS). Methods: Plasma ADM, ET-1 and GMP-140 levels were measured with RIA in (1) 31 cases of ACS with unstable angina pectoris (UAP) or non-ST segment elevation myocardial infarction (NSTEMI), (2) 32 cases of ACS with ST segment elevation myocardial infarction (STEMI), (3) 31 patients with stable angina pectoris (SAP) and, (4) 33 controls. Results: The plasma ADM, ET-1 and GMP-140 levels in both patient groups with UAP/NSTEMI and STEMI were significantly higher than those in controls (P0.05). However, the plasma levels of ADM, ET-1 and GMP-140 in the three groups of patients (2 groups of ACS and 1 group of SAP) were significantly different from each other (P< 0.01). Plasma levels of ADM, ET-1 and GMP-140 were mutually positively correlated. Conclusion: Changes of plasma levels of ADM, ET-1 and GMP-140 might reflect the severity of acute coronary syndrome and might serve as a marker for instability of the atheromatous plaques. (authors)

  12. Studies on the incorporation of lipase in synthetic polymerisable vesicles.

    Mosmuller, E.W.J.

    1993-01-01

    This thesis describes studies on the suitability of synthetic polymerisable vesicles for the incorporation and stabilisation of lipase for the bioconversion of organic chemical compounds.In chapter 1 , some characteristics are reviewed of hydrolytic enzymes, and more specific those

  13. Actin polymerisation at the cytoplasmic face of eukaryotic nuclei

    David-Watine Brigitte

    2006-05-01

    Full Text Available Abstract Background There exists abundant molecular and ultra-structural evidence to suggest that cytoplasmic actin can physically interact with the nuclear envelope (NE membrane system. However, this interaction has yet to be characterised in living interphase cells. Results Using a fluorescent conjugate of the actin binding drug cytochalasin D (CD-BODIPY we provide evidence that polymerising actin accumulates in vicinity to the NE. In addition, both transiently expressed fluorescent actin and cytoplasmic micro-injection of fluorescent actin resulted in accumulation of actin at the NE-membrane. Consistent with the idea that the cytoplasmic phase of NE-membranes can support this novel pool of perinuclear actin polymerisation we show that isolated, intact, differentiated primary hepatocyte nuclei support actin polymerisation in vitro. Further this phenomenon was inhibited by treatments hindering steric access to outer-nuclear-membrane proteins (e.g. wheat germ agglutinin, anti-nesprin and anti-nucleoporin antibodies. Conclusion We conclude that actin polymerisation occurs around interphase nuclei of living cells at the cytoplasmic phase of NE-membranes.

  14. On the optical and electrical properties of rf and a.c. plasma polymerized aniline thin films

    U S Sajeev; C Joseph Mathai; S Saravanan; Rajeev R Ashokan; S Venkatachalam; M R Anantharaman

    2006-04-01

    Polyaniline is a widely studied conducting polymer and is a useful material in its bulk and thin film form for many applications, because of its excellent optical and electrical properties. Pristine and iodine doped polyaniline thin films were prepared by a.c. and rf plasma polymerization techniques separately for the comparison of their optical and electrical properties. Doping of iodine was effected in situ. The structural properties of these films were evaluated by FTIR spectroscopy and the optical band gap was estimated from UV-vis-NIR measurements. Comparative studies on the structural, optical and electrical properties of a.c. and rf polymerization are presented here. It has been found that the optical band gap of the polyaniline thin films prepared by rf and a.c. plasma polymerization techniques differ considerably and the band gap is further reduced by in situ doping of iodine. The electrical conductivity measurements on these films show a higher value of electrical conductivity in the case of rf plasma polymerized thin films when compared to the a.c. plasma polymerized films. Also, it is found that the iodine doping enhanced conductivity of the polymer thin films considerably. The results are compared and correlated and have been explained with respect to the different structures adopted under these two preparation techniques.

  15. Polymerisation by acrylamide and acrylic acid inverse suspension

    Sergio Alejandro LLoreda Blanco

    2010-04-01

    Full Text Available This work describes polymerisation by inverse suspension of acrylamide monomers and acrylic acid for forming homopolymers or copolymers This type of polymersitaion's advantages are described and reasons given for why it should be studied. The article stresses the importance of these types of monomer for obtaining materials presenting great affinity for water, such as super-absorbents and controlled liberation mechanism. Important aspects are presented such as type of initiation, monomer composition and continuous phase composition; parameters are described offering an important basis for formulating a system leading to successfully obtaining the desired materials' most relevant characteristics such as particle distribution and size polymerisation kinetics, conversion and water absorption capacity respecting the system's modifiable parameters. The foregoing is important since the product can be modified, bestowing propierties on it which are suitable for its use.

  16. Aluminium salen and salan catalysts for polymerisation of novel monomers and macrostructures

    MacDonald, Jarret Preston

    2016-01-01

    Aluminium salen and aluminium salan complexes are excellent catalysts for the ring-opening polymerisation of lactide. This thesis studied their efficacy in the polymerisation of novel monomers and their ability to build new macrostructures. Aluminium salen and aluminium salan complexes were tested as catalysts for ring-opening polymerisation of common aliphatic monomers where controlled polymer synthesis has not yet been achieved with similar systems. Excellent control over ...

  17. Characterization of combined power plasma jet using AC high voltage and nanosecond pulse for reactive species composition control

    Takashima, Keisuke; Konishi, Hideaki; Kato, Toshiaki; Kaneko, Toshiro

    2014-10-01

    In the application studies for both bio-medical and agricultural applications, the roles of the reactive oxide and/or nitride species generated in the plasma has been reported as a key to control the effects and ill-effects on the living organism. The correlation between total OH radical exposure from an air atmospheric pressure plasma jet and the sterilization threshold on Botrytis cinerea is presented. With the increase of the OH radical exposure to the Botrytis cinerea, the probability of sterilization is increased. In this study, to resolve the roles of reactive species including OH radicals, a combined power plasma jet using nanosecond pulses and low-frequency sinusoidal AC high voltage (a few kHz) is studied for controlling the composition of the reactive species. The nanosecond pulses are superimposed on the AC voltage which is in synchronization with the AC phase. The undergoing work to characterize the combined power discharge with electric charge and voltage cycle on the plasma jet will also be presented to discuss the discharge characteristics to control the composition of the reactive species.

  18. Asymmetric polymerisation in liquid crystals and resultant electro-chiroptical effect: Structure organising polymerisation and chiral charge carrier ''chiralion''

    Electrochemical synthesis in liquid crystal (LC) affords conducting polymers having LC molecular order and electro-activity. The polymerisation method can be referred to as structure organising polymerisation (SOP). The optical textures of the polymers thus prepared appear very similar to that of the LC electrolyte solution used for the polymerisation. Especially, polymers prepared in cholesteric LC (chiral LC) having structural chirality show doping-dedoping (redox) driven change in chiroptical activity (controllable circular dichroism and optical rotation), as electro-chiroptical effect. The polymer films exhibit interference colour and electrochemically driven refractive index modulations. The chiroptical activity of the polymer prepared in cholesteric LC comes from axial chirality of the helical structure

  19. Developed Hybrid Model for Propylene Polymerisation at Optimum Reaction Conditions

    Mohammad Jakir Hossain Khan

    2016-02-01

    Full Text Available A statistical model combined with CFD (computational fluid dynamic method was used to explain the detailed phenomena of the process parameters, and a series of experiments were carried out for propylene polymerisation by varying the feed gas composition, reaction initiation temperature, and system pressure, in a fluidised bed catalytic reactor. The propylene polymerisation rate per pass was considered the response to the analysis. Response surface methodology (RSM, with a full factorial central composite experimental design, was applied to develop the model. In this study, analysis of variance (ANOVA indicated an acceptable value for the coefficient of determination and a suitable estimation of a second-order regression model. For better justification, results were also described through a three-dimensional (3D response surface and a related two-dimensional (2D contour plot. These 3D and 2D response analyses provided significant and easy to understand findings on the effect of all the considered process variables on expected findings. To diagnose the model adequacy, the mathematical relationship between the process variables and the extent of polymer conversion was established through the combination of CFD with statistical tools. All the tests showed that the model is an excellent fit with the experimental validation. The maximum extent of polymer conversion per pass was 5.98% at the set time period and with consistent catalyst and co-catalyst feed rates. The optimum conditions for maximum polymerisation was found at reaction temperature (RT 75 °C, system pressure (SP 25 bar, and 75% monomer concentration (MC. The hydrogen percentage was kept fixed at all times. The coefficient of correlation for reaction temperature, system pressure, and monomer concentration ratio, was found to be 0.932. Thus, the experimental results and model predicted values were a reliable fit at optimum process conditions. Detailed and adaptable CFD results were capable

  20. Bonding auto-polymerising acrylic resin to acrylic denture teeth.

    Nagle, Susan

    2009-09-01

    This study investigated the effect of surface treatments on the shear bond strength of an auto-polymerising acrylic resin cured to acrylic denture teeth. The surface treatments included a combination of grit-blasting and\\/or wetting the surface with monomer. Samples were prepared and then stored in water prior to shear testing. The results indicated that the application of monomer to the surface prior to bonding did not influence the bond strength. Grit blasting was found to significantly increase the bond strength.

  1. Evaluation of AC losses for HT-7U CICC on plasma disruption

    AC loss is one of the main issues in the design of the CICC used for PF and TF coils of superconducting tokamak. A preliminary calculation of AC loss for the designed HT-7U CICCs used for TF magnets is given. The authors only consider the hysteresis and coupling losses related to transversal and longitudinal kinds. In addition to the strand resistive barriers (Pb-30Sn-2Sb coating for NbTi strands), a stainless steel strip has been used inside these cables to reduce the AC loss in this kind of conductor. The available theory has enabled to emphasize the role played by the stainless steel strip in the reduction of total AC losses in this kind of conductor. It was shown that AC losses of cable were affected by the structure and change rate of magnetic field

  2. Two-dimensional model of an AC plasma display panel cell in a neon-xenon mixture

    We present a 2-D fluid model of an AC plasma display panel cell. Plasma Display Panels (PDP) are flat display devices where the light of each picture element is emitted from a plasma created by an electric discharge. In the simplest electrode configuration, AC plasma display panels consist of two glass plates, each with parallel electrodes deposited on their surfaces. The electrodes are covered with a dielectric film above which a protective MgO layer is deposited. The plates are sealed together with their electrodes at right angles, and the cap between the plates is filled with a rare gas mixture. An electric discharge can be initiated in the gas cap by applying a voltage pulse between a line electrode and a column electrode. This discharge is transient due to the dielectric layers covering the electrode: the charges deposited on the dielectric surfaces induce in the gas cap a voltage which opposes the electrode voltage. Since the electrode voltage is AC (frequency in the 10-100 kHz range), a discharge is initiated each time the electrode voltage changes sign (the voltage across the dielectric layers adds to the electrode voltage when it changes sign). The open-quotes ONclose quotes state of a picture element is therefore a succession of transient discharges. In color displays, the UV light of the discharge is used to excite phosphors in the three fundamental colors (at least three discharge cells are used for one pixel of the screen). Neon-xenon or helium-xenon mixtures are generally used in color displays where photons emitted by excited atomic (147 nm) and molecular (150 nm and 173 nm) xenon are used to excite the phosphors

  3. Investigation of In-Flight Melting Behaviour of Granulated Glass Raw Material by Multi-Phase AC Arc Plasma and Hybrid Plasma

    An innovative in-flight glass melting technology was developed for a purpose of energy saving and environmental protection. Granulated glass raw materials with small diameter were treated by twelve-phase AC arc and that combined with an oxygen burner. The particle measurement was carried out to investigate the in-flight melting behavior of glass raw materials during the in-flight melting by twelve-phase AC arc. Obtained results show the mean particle velocity was about 9 m s-1 and mean temperature was about 2600 K. The high vitrification degree achieved within several milliseconds reveals that the new in-flight melting technology of hybrid plasma treating can reduce energy consumption and shorten the glass production cycle.

  4. Nanoscale precision of 3D polymerisation via polarisation control

    Rekstyte, Sima; Gailevicius, Darius; Malinauskas, Mangirdas; Mizeikis, Vygantas; Gamaly, Eugene G; Juodkazis, Saulius

    2016-01-01

    A systematic analysis of polarization effects in a direct write femtosecond laser 3D lithography is presented. It is newly shown that coupling between linear polarization of the writing light electric field and temperature gradient can be used to fine-tune feature sizes in structuring of photoresists at a nanoscale. The vectorial Debye focusing is used to simulate polarization effects and a controlled variation up to 20% in the linewidth is shown experimentally for the identical axial extent of the polymerised features. The revealed mechanisms are relevant for a wide range of phenomena of light-matter interaction at tight focusing in laser-tweezers and in plasmonic or dielectric sub-wavelength focusing where strong light intensity and thermal gradients coexist.

  5. Experimental Investigation of “Why an AC Dielectric Barrier Discharge Plasma Actuator is Preferred to DC Corona Wind Actuator in Boundary Layer Flow Control?”

    Gholam reza Tathiri; Esmaeil Esmaeilzadeh; seyyed mahdi mirsajedi; hossein mahdavy moghaddam

    2014-01-01

    In this paper, characteristics of the flow induced in the boundary layer by an AC-Dielectric Barrier Discharge (DBD) plasma actuator are compared against those of a DC-corona wind actuator. This is achieved by visualization of the induced flow using smoke injection and measuring the horizontal induced velocity. Our measurements show that the maximum induced velocity of an AC-DBD actuator is about one order of magnitude larger than that of a DC-corona actuator. For an AC-DBD actuator, the indu...

  6. The investigation of an electric arc in the long cylindrical channel of the powerful high-voltage AC plasma torch

    The comparison of conductivity obtained in experiments with calculated values is made in this paper. Powerful stationary plasma torches with prolonged period of continuous work are popular for modern plasmachemical applications. The maximum electrode lifetime with the minimum erosion can be reached while working on rather low currents. Meanwhile it is required to provide voltage arc drop for the high power achievement. Electric field strength in the arc column of the high-voltage plasma torch, using air as a plasma-forming gas, does not exceed 15 V/cm. It is possible to obtain the high voltage drop in the long arc stabilized in the channel by the intensive gas flow under given conditions. Models of high voltage plasma torches with rod electrodes with power up to 50 kW have been developed and investigated. The plasma torch arcs are burning in cylindrical channels. Present investigations are directed at studying the possibility of developing long arc plasma torches with higher power. The advantage of AC power supplies usage is the possibility of the loss minimization due to the reactive power compensation. The theoretical maximum of voltage arc drop for power supplies with inductive current limitations is about 50 % of the no-load voltage for a single-phase circuit and about 30 % for the three-phase circuit. Burning of intensively blown arcs in the long cylindrical channel using the AC power supply with 10 kV no-load voltage is experimentally investigated in the work. Voltage drops close to the maximum possible had been reached in the examined arcs in single-phase and three-phase modes. Operating parameters for single-phase mode were: current −30 A, voltage drop −5 kV, air flow rate 35 g/s; for three-phase mode: current (40–85) A, voltage drop (2.5–3.2) kV, air flow rate (60–100) g/s. Arc length in the installations exceeded 2 m.

  7. γ-radiolysis investigation of the effect of electrosteric stabilizers in emulsion polymerisation

    An emulsion polymerisation typically consists of two phases: the continuous aqueous phase, and the discreet organic phase, which comprises of monomer droplets and latex particles. This system is stabilised by some form of surfactant. While polymerisation mainly occurs in the latex particles, the events which initiate polymerisation usually occur in the aqueous phase. Therefore, the transfer of radical activity from the aqueous phase to the organic phase (otherwise known as entry) is important in the kinetics of polymerisation. Likewise, transfer of radicals from the latex particles to the aqueous phase (exit), is important as a means whereby polymerisation in the latex particle ceases. This study utilizes seeded emulsion polymerisations. Two electrostatically stabilised styrene lattices were grown, of 24 nm and 44 nm particle radius. Poly(acrylic acid), an electrosteric stabiliser, was absorbed onto the surface of the latex particles as a second stage procedure, forming electrosterically stabilised lattices. Dilatometry was used to measure the conversion rate: the steady rate with chemical initiator and relaxation from steady state in a system initiated by γ radiolysis has been used to obtain the exit rate coefficient

  8. Experimental Investigation of “Why an AC Dielectric Barrier Discharge Plasma Actuator is Preferred to DC Corona Wind Actuator in Boundary Layer Flow Control?”

    Gholam reza Tathiri

    2014-01-01

    Full Text Available In this paper, characteristics of the flow induced in the boundary layer by an AC-Dielectric Barrier Discharge (DBD plasma actuator are compared against those of a DC-corona wind actuator. This is achieved by visualization of the induced flow using smoke injection and measuring the horizontal induced velocity. Our measurements show that the maximum induced velocity of an AC-DBD actuator is about one order of magnitude larger than that of a DC-corona actuator. For an AC-DBD actuator, the induced velocity is maximized on the plate surface while for a DC-corona actuator the induced velocity peaks at about 20mm above the surface. Using flow visualization, we demonstrate that the induced velocity of an AC-DBD actuator is parallel to the surface, while the induced velocity of a DC-corona actuator has components perpendicular to surface.

  9. Polymerisation shrinkage versus layer thickness of a dentine bonding resin: Method development

    Jafarzadeh T

    2002-07-01

    Full Text Available Dentine bonding systems are usually unfilled, and so their shrinkage may be significant. High"nshrinkage may cause internal stress at the interface between resin-composite restoration and the dentine"nsubstrate. Failure of the adhesive interface may be observed due to the interna! stress. The aims of this"nstudy were:"nA To obtain a suitable method for measuring the kinetics of polymerisation shrinkage in unfilled resm at different thicknesses, particularly for thin films."nB Consideraing the effect of thickness on shrinkage."nScotchbond Multipurpose (3M adhesive bond resin was used. To overcome the particular challenges presented by thin films, a filled-ring measurement procedure was used. Also, a non-contact laser analogue displacement sensor system was developed and applied to measure polymerisation shrinkage. Regression analysis was performed on a complete data set. Non-linear regression analysis established a logarithmic relationship between polymerisation shrinkage and layer thickness. The method applied in this study was found to be sensitive and accurate procedure for determining photo-polymerisation shrinkage of thin films. Polymerisation shrinkage increased with logarithmic of the adhesive thickness.

  10. Highly selective etching of silicon nitride to physical-vapor-deposited a-C mask in dual-frequency capacitively coupled CH2F2/H2 plasmas

    A multilevel resist (MLR) structure can be fabricated based on a very thin amorphous carbon (a-C) layer ( congruent with 80 nm) and Si3N4 hard-mask layer ( congruent with 300 nm). The authors investigated the selective etching of the Si3N4 layer using a physical-vapor-deposited (PVD) a-C mask in a dual-frequency superimposed capacitively coupled plasma etcher by varying the process parameters in the CH2F2/H2/Ar plasmas, viz., the etch gas flow ratio, high-frequency source power (PHF), and low-frequency source power (PLF). They found that under certain etch conditions they obtain infinitely high etch selectivities of the Si3N4 layers to the PVD a-C on both the blanket and patterned wafers. The etch gas flow ratio played a critical role in determining the process window for infinitely high Si3N4/PVD a-C etch selectivity because of the change in the degree of polymerization. The etch results of a patterned ArF photoresisit/bottom antireflective coating/SiOx/PVD a-C/Si3N4 MLR structure supported the idea of using a very thin PVD a-C layer as an etch-mask layer for the Si3N4 hard-mask pattern with a pattern width of congruent with 80 nm and high aspect ratio of congruent with 5.

  11. Novel biocompatible materials for in vivo two-photon polymerisation

    Two-photon polymerisation (2PP) is a versatile laser fabrication technique that allows the creation of 3D structures at micro- and nanometre precision. The structures are created additively in direct accordance to a computer-aided design (CAD). It requires tightly focused fs-pulsed light sources usually operating in the near infrared wavelength range. In this region, biological tissues exhibit a window of transparency and only absorb light minimally. When operating below a certain pulse energy threshold, the laser light does not cause any cellular damage. This theoretically allows inducing 2PP in the presence of living biological tissues and cells. Suitable biocompatible formulations that can render bioactive constructs would potentially allow building a dynamic environment with topographical, chemical and mechanical cues similar to that of the natural extracellular matrix. In that way, 2PP would allow to alter key elements of this environment without changing any other influencing factors. To explore these possibilities, 2PP has to overcome two main limitations, the slow process speeds and the lack of available optimised formulations. In this thesis, we report the design and realisation of a 2PP experimental setup, which allows fabricating hydrogel structures from novel water-based formulations. Writing speeds of above 100 mm/s are feasible, which is the highest speed reported in 2PP. Moreover, the presented components have the potential to be formed in vivo, in the presence of living cells and tissues. Using water-soluble two-photon optimised photoinitiators, we could effectively cross-link acrylates in formulations of up to 80% water content. As acrylates show a tendency towards Michael addition to proteins, we explored the use of vinyl ester and vinyl carbonate monomers for 2PP. In contrast to acrylic polymers, which form potentially toxic poly (acrylic acid), vinyl ester and carbonate polymers form biocompatible poly (vinyl alcohol) during degradation

  12. Needle-array to Plate DBD Plasma Using Sine AC and Nanosecond Pulse Excitations for Purpose of Improving Indoor Air Quality.

    Zhang, Li; Yang, Dezheng; Wang, Wenchun; Wang, Sen; Yuan, Hao; Zhao, Zilu; Sang, Chaofeng; Jia, Li

    2016-01-01

    In this study, needle-array to plate electrode configuration was employed to generate an atmospheric air diffuse discharge using both nanosecond pulse and sine AC voltage as excitation voltage for the purpose of improving indoor air quality. Different types of voltage sources and electrode configurations are employed to optimize electrical field distribution and improve discharge stability. Discharge images, electrical characteristics, optical emission spectra, and plasma gas temperatures in both sine AC discharge and nanosecond pulse discharge were compared and the discharge stability during long operating time were discussed. Compared with the discharge excited by sine AC voltage, the nanosecond pulsed discharge is more homogenous and stable, besides, the plasma gas temperature of nanosecond pulse discharge is much lower. Using packed-bed structure, where γ- Al2O3 pellets are filled in the electrode gap, has obvious efficacy in the production of homogenous discharge. Furthermore, both sine AC discharge and nanosecond pulse discharge were used for removing formaldehyde from flowing air. It shows that nanosecond pulse discharge has a significant advantage in energy cost. And the main physiochemical processes for the generation of active species and the degradation of formaldehyde were discussed. PMID:27125663

  13. pH stable thin film composite polyamine nanofiltration membranes by interfacial polymerisation

    Lee, Kah P.; Zheng, Jumeng; Bargeman, Gerrald; Kemperman, Antoine J.B.; Benes, N.E.

    2015-01-01

    In this work polyamine membranes are presented that are prepared by the interfacial polymerisation of polyethylenimine and cyanuric chloride on porous polyethersulfone supports. The thin film composite polyamine membranes have superior pH stability as compared to conventional polyamide membranes tha

  14. Triarylsulfonium hexafluorophosphate salts as photoactivated acidic catalysts for ring-opening polymerisation.

    Barker, Ian A; Dove, Andrew P

    2013-02-11

    Triarylsulfonium hexafluorophosphate salts were shown to be effective catalysts for the ring-opening polymerisation of various cyclic monomers under UV irradiation. A dual basic/acidic catalytic system demonstrated the potential for UV-triggered formation of poly(δ-valerolactone)-b-poly(L-lactide)-b-poly(δ-valerolactone) in a 'one-pot' reaction. PMID:23283246

  15. Polymorphism and polymerisation of acrylic and methacrylic acid at high pressure

    Oswald, Iain D. H.; Urquhart, Andrew J.

    2011-01-01

    The polymorphism and polymerisation of two related acids have been investigated under high pressure conditions. Acrylic acid crystallises as a new polymorph at 0.65 GPa whilst methacrylic acid crystallises in a new polymorph at a higher pressure of 1.5 GPa. Both these new polymorphs exhibit similar...

  16. Propene Polymerisation with rac-[Me2Si(2-Me-4-(Naphthyl)-1-Ind)2]ZrCl2 as a Highly Active Catalyst: Influence of Monomer Concentration, Polymerisation Temperature and a Heterogenising Support

    M.Frediani; Kaminsky, W.

    2003-01-01

    Propene was polymerised at high temperatures (up to 90 °C) using rac-[Me2Si(2-Me-4-(α-naphthyl)-1-Ind)2]ZrCl2/MAO as the catalytic system. The increasing deactivation reaction rate of the catalyst for polymerisations above 60 °C was less for a silica supported catalyst compared with the homogeneous one. The isotacticity of polypropene decreases from 99 to 96%. Also the morphology changes with different temperatures.

  17. Plasma Ion Sources

    A wide variety of ion source types has been developed. Ion sources can provide beams of hundreds of amperes for fusion applications, nano-amperes for microprobe trace analysis and broad beams for ion implantation, space thrusters, industrial polymerisation and food sterilisation. Also it can be used in medical, military and accelerators applications. In this paper, three different types of plasma ion sources with different means for producing the discharge current and the ions extracting current from the plasma are studied. The various plasma described include, d.c glow discharge plasma, arc discharge plasma and radio frequency discharge plasma

  18. Experimental Investigation of Separation Control on a NACA0024 Airfoil using Stationary and Non-Stationary AC-Dielectric Barrier Discharge Plasma Actuator

    Hossein Parishani

    2016-01-01

    Full Text Available An experimental study of stationary and non-stationary dielectric barrier discharge (DBD plasma actuator is presented to control the flow around a NACA0024 airfoil. First, an induced air velocity of ~5 m/s is generated on a flat plate in still air using an AC-DBD actuator to find the optimal setup of the actuator (voltage, frequency, electrode width and gap size. Using the same actuator in the optimal position/setup on a NACA0024 airfoil at Reynolds number of 0.48×106, we are able to increase the stall angle of the airfoil to 18º, compared to 16º in no-actuator state. Furthermore, during the plasma actuation, the lift is increased by up to 5%. We show that non-stationary actuation, while yielding a performance similar to stationary actuation, leads to a considerable reduction of ~51% in plasma power consumption.

  19. AC plasma torch with a H2O/CO2/CH4 mix as the working gas for methane reforming

    This paper presents results of investigations implemented during construction of the three-phase ac plasma torch working on a mixture of steam with carbon dioxide and methane (H2O/CO2/CH4) with power upto 120 kW. Such thermal plasma generators are needed in industrial technologies for methane reforming with the aim of producing the syngas comprising of the hydrogen and carbon mono-oxide (H2/CO). It was shown that during plasma torch work there are two character parts of the high-voltage arc. In these parts, the arc column has a different diameter and temperature about (8.5  −  8.3) · 103 K and (10.5  −  10.0) · 103 K, respectively. The plasma torch output characteristics have been obtained for working regimes with various flow rates of the methane (0.0–0.8 g s−1) in the plasma-forming mix and constant flow rates of the carbon dioxide and water steam (each of 3.0 g s−1). For the mentioned mix of gases, the unit generates plasma with the mass-average temperature ∼(3.2–3.3) · 103K and the thermal efficiency ∼94–96%. This provides effective reforming of methane. (paper)

  20. Adaptive control using a hybrid-neural model: application to a polymerisation reactor

    Cubillos F.

    2001-01-01

    Full Text Available This work presents the use of a hybrid-neural model for predictive control of a plug flow polymerisation reactor. The hybrid-neural model (HNM is based on fundamental conservation laws associated with a neural network (NN used to model the uncertain parameters. By simulations, the performance of this approach was studied for a peroxide-initiated styrene tubular reactor. The HNM was synthesised for a CSTR reactor with a radial basis function neural net (RBFN used to estimate the reaction rates recursively. The adaptive HNM was incorporated in two model predictive control strategies, a direct synthesis scheme and an optimum steady state scheme. Tests for servo and regulator control showed excellent behaviour following different setpoint variations, and rejecting perturbations. The good generalisation and training capacities of hybrid models, associated with the simplicity and robustness characteristics of the MPC formulations, make an attractive combination for the control of a polymerisation reactor.

  1. Pattern formation in polymerising actin flocks: spirals, spots and waves without nonlinear chemistry

    Goff, Thomas Le; Marenduzzo, Davide

    2016-01-01

    We propose a model solely based on actin treadmilling and polymerisation which describes many characteristic states of actin wave formation: spots, spirals and travelling waves. In our model, as in experiments on cell recovering motility following actin depolymerisation, we choose an isotropic low density initial condition; polymerisation of actin filaments then raises the density towards the Onsager threshold where they align. We show that this alignment, in turn, destabilizes the isotropic phase and generically induces transient actin spots or spirals as part of the dynamical pathway towards a polarized phase which can either be uniform or consist of a series of actin-wave trains (flocks). Our results uncover a universal route to actin wave formation in the absence of any system specific nonlinear biochemistry, and it may help understand the mechanism underlying the observation of actin spots and waves in vivo. They also suggest a minimal setup to design similar patterns in vitro.

  2. Direct 'in situ', low VOC, high yielding, CO2 expanded phase catalytic chain transfer polymerisation: towards scale-up.

    Adlington, Kevin; Green, Anthony; Wang, Wenxin; Howdle, Steven M; Irvine, Derek J

    2013-01-01

    The successful application of catalytic chain transfer polymerisation (CCTP) by adopting an 'in situ' catalyst preparation methodology in several polymerisation media is described. More specifically, this study is focused on reporting the development of 'in situ' CCTP within a CO(2) expanded phase polymerisation process, which achieved high yields of polymer whilst minimising both VOC footprint and CO(2) compression costs. The 'in situ' method is shown to be effective in controlling polymerisations conducted in both conventional solvents and bulk under inert atmosphere, delivering molecular weight reductions and a Cs value of appropriate similar magnitude to those achieved by the benchmark, commercially sourced CoPhBF catalyst. The 'in situ' effect has been achieved with equal efficiency when both using catalysts with different axial ligands and where the complex is required to undergo a facile ligand dissociation in order to create the required catalyst necessary to achieve CCTP control. Furthermore, both catalysts are shown to effectively control polymerisations in a CO(2) expanded phase process, in which a small amount of compressed CO(2) is introduced to reduce the viscosity of the reaction mixture, allowing for easy heat transfer and good catalyst diffusion during reaction. In this way, yield limitations imposed to avoid the Trommsdorff effect required in bulk processing and the need for post precipitation have been successfully overcome. Both of these factors further improve the sustainability of such a polymerisation process. However, the 'in situ', high pressure expanded phase environment was observed to retard the ligand dissociation required for catalyst activation. PMID:23085824

  3. Metal-catalysed organic transformations in water: From bromination to polymerisation

    Manish Bhattacharjee; Braja N Patra

    2006-11-01

    Reaction of ,-unsaturated aromatic carboxylic acids with KBr and H2O2 in the presence of Na2MoO4$\\cdot$H2O in aqueous medium affords -bromo alkenes in high yields. Metallocene dichlorides, Cp2MCl2 (M = Ti, Zr, or V) catalyse polymerisation of olefins in aqueous medium to afford high molecular weight polymers with low molecular weight distribution.

  4. POLYELECTROLYTE CORE/HYDROPHOBIC SHELL POLYMER PARTICLES BY DOUBLE EMULSION TEMPLATING POLYMERISATION FOR ENVIRONMENTAL APPLICATIONS

    Menzel, Cristian

    2015-01-01

    The University of Manchester, Faculty of Engineering and Physical SciencesCristian Adolfo Menzel BuenoA thesis submitted for the degree of Doctor of PhilosophyPolyelectrolyte core/hydrophobic shell polymer particles by double emulsion templating polymerisation for environmental applicationsDate: 25th September 2014Herein two novel synthetic strategies for the synthesis of sub-millimetre sized core–shell particles comprising a polyelectrolyte core and a porous hydrophobic shell are presented.I...

  5. Characterising the association of latency with α1-antitrypsin polymerisation using a novel monoclonal antibody

    Tan, Lu; Perez, Juan; Mela, Marianna; Miranda, Elena; Burling, Keith; Rouhani, Farshid N.; DeMeo, Dawn L; Haq, Imran; Irving, James; Ordóñez, Adriana; Dickens, Jennifer; Brantly, Mark L; Marciniak, Stefan J; Alexander, Graeme; Gooptu, Bibekbrata

    2015-01-01

    α1-Antitrypsin is primarily synthesised in the liver, circulates to the lung and protects pulmonary tissues from proteolytic damage. The Z mutant (Glu342Lys) undergoes inactivating conformational change and polymerises. Polymers are retained within the hepatocyte endoplasmic reticulum (ER) in homozygous (PiZZ) individuals, predisposing the individuals to hepatic cirrhosis and emphysema. Latency is an analogous process of inactivating, intra-molecular conformational change and may co-occur wit...

  6. High internal phase emulsions (HIPEs) and polymerised HIPEs (PolyHIPEs)

    Cameron, N R

    1995-01-01

    High internal phase emulsions (HIPEs) possess an internal phase volume ratio (phi) greater than 0.74. Novel non-aqueous HIPEs can be obtained from a non-polar organic liquid, such as petroleum ether, dispersed in a highly polar medium, such as formamide or dimethylsulfoxide. The system is stabilised with block copolymer surfactants of suitable HLB number. Polymerisation of a HIPE continuous phase leads to a highly porous monolithic material known as PolyHIPE. These polymers often have a completely open-cellular structure. The mechanism for the formation of this morphology was elucidated by performing scanning electron microscopy (SEM) on frozen HIPE samples at various stages of polymerisation. The point of transition from emulsion to open-cell polymer was found to coincide with the gel-point of the system, implying that the interconnected structure forms as a result of contraction of the continuous phase thin films on polymerisation. Novel PolyHIPE materials have been prepared by chemical modification of cros...

  7. Experimental Investigation of Separation Control on a NACA0024 Airfoil using Stationary and Non-Stationary AC-Dielectric Barrier Discharge Plasma Actuator

    Hossein Parishani

    2016-01-01

    An experimental study of stationary and non-stationary dielectric barrier discharge (DBD) plasma actuator is presented to control the flow around a NACA0024 airfoil. First, an induced air velocity of ~5 m/s is generated on a flat plate in still air using an AC-DBD actuator to find the optimal setup of the actuator (voltage, frequency, electrode width and gap size). Using the same actuator in the optimal position/setup on a NACA0024 airfoil at Reynolds number of 0.48×106, we are ab...

  8. Estudio por emisión acústica del comportamiento a flexión de recubrimientos WC-Co obtenidos por plasma atmosférico

    Segovia, F.

    2007-12-01

    Full Text Available Plasma sprayed cermet coatings WC-Co are used in a wide range of industrial applications, mainly due to their wear resistance even in corrosive environments. The objective of this work is to analyze mechanical response of hard metal coatings by means of three- and four-points bend tests applying acoustic emission technique to determine failure critical strength. It has been observed the effect of supported charge level in structural damage by means of optical microscopy and scanning electron microscopy. Acoustic emission has allowed us to relate damage level to stresses level and then to understand coatings failure mechanism.

    Los recubrimientos de cermet WC-Co proyectados por plasma se utilizan en un amplio rango de aplicaciones industriales, principalmente por su resistencia al desgaste, incluso en medio corrosivo. El objetivo de este trabajo es analizar la respuesta mecánica de los recubrimientos de metal duro mediante ensayos de flexión a 3 y 4 puntos aplicando el método de emisión acústica para determinar las tensiones críticas de fallo. Se ha observado el efecto del nivel de carga soportado en el dañado estructural mediante microscopia óptica y electrónica de barrido. La emisión acústica ha permitido relacionar el grado de dañado con el nivel de tensiones y, así, entender el mecanismo de fallo de los recubrimientos.

  9. A comparative study of the physical properties of Sb2S3 thin films treated with N2 AC plasma and thermal annealing in N2

    As-deposited antimony sulfide thin films prepared by chemical bath deposition were treated with nitrogen AC plasma and thermal annealing in nitrogen atmosphere. The as-deposited, plasma treated, and thermally annealed antimony sulfide thin films have been characterized by X-ray diffraction (XRD), energy dispersive X-ray spectroscopy, scanning electron microscopy, atomic force microscopy, UV-vis spectroscopy, and electrical measurements. The results have shown that post-deposition treatments modify the crystalline structure, the morphology, and the optoelectronic properties of Sb2S3 thin films. X-ray diffraction studies showed that the crystallinity of the films was improved in both cases. Atomic force microscopy studies showed that the change in the film morphology depends on the post-deposition treatment used. Optical emission spectroscopy (OES) analysis revealed the plasma etching on the surface of the film, this fact was corroborated by the energy dispersive X-ray spectroscopy analysis. The optical band gap of the films (Eg) decreased after post-deposition treatments (from 2.36 to 1.75 eV) due to the improvement in the grain sizes. The electrical resistivity of the Sb2S3 thin films decreased from 108 to 106 Ω-cm after plasma treatments.

  10. High internal phase emulsions (HIPEs) and polymerised HIPEs (PolyHIPEs)

    High internal phase emulsions (HIPEs) possess an internal phase volume ratio (φ) greater than 0.74. Novel non-aqueous HIPEs can be obtained from a non-polar organic liquid, such as petroleum ether, dispersed in a highly polar medium, such as formamide or dimethylsulfoxide. The system is stabilised with block copolymer surfactants of suitable HLB number. Polymerisation of a HIPE continuous phase leads to a highly porous monolithic material known as PolyHIPE. These polymers often have a completely open-cellular structure. The mechanism for the formation of this morphology was elucidated by performing scanning electron microscopy (SEM) on frozen HIPE samples at various stages of polymerisation. The point of transition from emulsion to open-cell polymer was found to coincide with the gel-point of the system, implying that the interconnected structure forms as a result of contraction of the continuous phase thin films on polymerisation. Novel PolyHIPE materials have been prepared by chemical modification of crosslinked polystyrene polymers. Sulfonation, nitration and bromination of monolithic samples to moderate levels and reasonable uniformity have been performed with mild reagents in homogeneous reaction conditions. In addition, crosslinked poly(phenyl methacrylate) (PPMA) PolyHIPE materials have been synthesised and chemically modified with tris(hydroxymethyl)-aminomethane (TRIS) under basic conditions, again to a moderate degree. Elastomeric PolyHIPE materials were prepared by copolymerisation of styrene and divinyl benzene (DVB) with 2-ethylhexyl (meth)acrylate. The variation of their glass transition temperatures (Tg) with composition was found to be non-linear. This is proposed to be due to both intra- and intermolecular interactions between polymer chains. Novel PolyHIPE polymers with enhanced thermal properties have been obtained by copolymerisation of an end-capped aryl ether sulfone oligomer with a number of monomers in a non-aqueous HIPE system. Therefore

  11. Catalytic behaviour in the ring-opening polymerisation of organoaluminiums supported by bulky heteroscorpionate ligands.

    Castro-Osma, Jose A; Alonso-Moreno, Carlos; Lara-Sánchez, Agustín; Otero, Antonio; Fernández-Baeza, Juan; Sánchez-Barba, Luis F; Rodríguez, Ana M

    2015-07-21

    A series of alkyl organoaluminium complexes based on bulky heteroscorpionate ligands were designed as catalysts for the ring-opening polymerisation of cyclic esters. Thus, the treatment of AlX3 (X = Me, Et) with bulky acetamide or thioacetamide heteroscorpionate ligands nbptamH (1) [nbptamH = N-naphthyl-2,2-bis(3,5-dimethylpyrazol-1-yl)thioacetamide], fbpamH (2) [fbpamH = N-fluorenyl-2,2-bis(3,5-dimethylpyrazol-1-yl)acetamide], ptbptamH (3) [ptbptamH = N-phenyl-2,2-bis(3,5-di-tert-butylpyrazol-1-yl)thioacetamide], ntbptamH (4) [ntbptamH = N-naphthyl-2,2-bis(3,5-di-tert-butylpyrazol-1-yl)thioacetamide], ptbpamH (5) [ptbpamH = N-phenyl-2,2-bis(3,5-di-tert-butylpyrazol-1-yl)acetamide] and (S)-mtbpamH (6) [(S)-mtbpamH = (S)-(−)-N-α-methylbenzyl-2,2-bis(3,5-di-tert-butylpyrazol-1-yl)acetamide] for 1 hour at 0 °C afforded the dialkyl aluminium complexes [AlX2{κ(2)-nbptam}] (X = Me 7, Et 8), [AlX2{κ(2)-fbpam}] (X = Me 9, Et 10), [AlX2{κ(2)-ptbptam}] (X = Me 11, Et 12), [AlX2{κ(2)-ntbptam}] (X = Me 13, Et 14), [AlX2{κ2(-)ptbpam}] (X = Me 15, Et 16) and [AlX2{κ(2)-(S)-mtbpam}] (X = Me 17, Et 18). The structures of the complexes were determined by spectroscopic methods and the X-ray crystal structure of 14 was also established. The alkyl-containing aluminium complexes 7–18 can act as efficient single-component initiators for the ring-opening polymerisation of ε-caprolactone and rac-lactide. The polymerisations are living, as evidenced by the narrow polydispersities of the isolated polymers and the linear nature of the number average molecular weight versus conversion plot. Finally, a comparative study of ring-opening polymerisation for new bulky heteroscorpionate aluminium initiators and the less congested aluminium analogues is reported. PMID:25534594

  12. Plasma chemistry during the deposition of a-C : H films and its influence on film properties

    Benedikt, J.; Woen, RV.; van Mensfoort, SLM.; Peřina, Vratislav; Hong, J.; van de Sanden, MCM.

    2003-01-01

    Roč. 12, č. 2 (2003), s. 90-97. ISSN 0925-9635 R&D Projects: GA AV ČR KSK4055109; GA ČR GA104/03/0385 Institutional research plan: CEZ:AV0Z1048901 Keywords : plasma chemistry * spectroscopic ellipsometry Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.867, year: 2003

  13. Novel additives in radiation polymerisation processes. Significance of molecular weight data in their application to grafting, curing and composite formation

    The role of additives in accelerating rates of reaction has been investigated in the following related radiation polymerisation processes, i.e simple homopolymerisation, grafting, WPC formation and curing. Additives used include mineral acid, polyfunctional monomers, urea and thermal and photochemical initiators. Molecular weight analysis carried out on the polymers formed in the presence of the additives indicate that both chemical and physical processes are involved in the mechanism of the polymerisation reaction. Chemical processes (free radicals) lead to an enhancement in initial rate of polymerisation whilst the physical parameter involves partitioning of reagents during reaction. Both chemical and physical processes are shown to act in concert to influence both polymer yield and properties

  14. Gas permeability of thin polyimide foils prepared by in-situ polymerisation

    The entrance windows to the gas detector chambers as well as to the target containers used in high-energy and high-intensity accelerators must be as thin as possible to minimise energy losses of the particles used in astrophysics and nuclear physics studies. Because of their good physical properties, polyimide foils are often considered as suitable material for such windows, but commercially available foils, having a thickness greater than 7-8 μm (>1 mg/cm2), would cause energy losses of particles significant for some nuclear reactions studied. Foils prepared by in-situ polymerisation can, however, be as thin as 0.07 μm (∼10 μg/cm2). The permeability of 4 μm foils produced by in-situ polymerisation has been measured at room temperature for He and Ar. For He measurements were performed in the pressure range of 4-70 mbar and for Ar in the range of 20-140 mbar and the permeability was found to be in good agreement with the values published for the thicker commercial foils

  15. Using plasma polymerised allylamine to culture hepatocytes in in-vitro fluidic bioreactor

    Dehili, Chafika

    2008-01-01

    Tissues constituting mammalian organisms are finitely organised 3-D multicellular structures where cell-cell and cell-matrix interactions are important modulators of functionality. The liver, being the site of metabolism in mammals, is extensively employed in in-vitro studies such as toxicology, drug testing and liver replacement. Most existing liver models have been static, homogenous 2-D models which have shown limited morphological and functional characteristics of in-vivo liver. With the ...

  16. Synthesis of novel glycopolymer brushes via a combination of RAFT-mediated polymerisation and ATRP

    Eric T.A. van den Dungen

    2011-03-01

    Full Text Available Glycopolymers (synthetic sugar-containing polymers have become increasingly attractive to polymer chemists because of their role as biomimetic analogues and their potential for commercial applications. Glycopolymers of different structures confer high hydrophilicity and water solubility and can therefore be used for specialised applications, such as artificial materials for a number of biological, pharmaceutical and biomedical uses. The synthesis and characterisation of a series of novel glycopolymer brushes, namely poly(2-(2-bromoisobutyryloxy ethyl methacrylate-g-poly(methyl 6-O-methacryloyl-α-D-glucoside (P(BIEM-g-P(6-O-MMAGIc, poly(2-(2-bromoisobutyryloxy ethyl methacrylate-co-methyl methacrylate-g-poly(methyl 6-O-methacryloyl-α-D-glucoside P(BIEM-co-MMA-g-P(6-O-MMAGIc, poly(2-(2-bromoisobutyryloxy ethyl methacrylate-b-methyl methacrylate-g-poly(methyl 6-O-methacryloyl-α-D-glucoside P(BIEM-b-MMA-g-P(6-O-MMAGIc and poly(4-vinylbenzyl chloride-alt-maleic anhydride-g-poly(methyl 6-O-methacryloyl-α-D-glucoside (P(Sd-alt-MAnh-g-P(6-O-MMAGIc are described in this paper. Reversible addition-fragmentation chain transfer (RAFT-mediated polymerisation was used to synthesise four well-defined atom transfer radical polymerisation (ATRP macroinitiators (the backbone of the glycopolymer brushes. These ATRP macroinitiators were subsequently used in the ‘grafting from’ approach (in which side chains are grown from the backbone to prepare high molar mass and low polydispersity index glycopolymer brushes with different grafting densities along the backbone. The number average molar mass of the glycopolymer brushes was determined using size exclusion chromatography with a multi-angle laser light

  17. Codex dietary fibre definition - Justification for inclusion of carbohydrates from 3 to 9 degrees of polymerisation.

    de Menezes, Elizabete Wenzel; Giuntini, Eliana Bistriche; Dan, Milana Cara Tanasov; Sardá, Fabiana Andréa Hoffmann; Lajolo, Franco Maria

    2013-10-01

    The main controversy about the DF definition, adopted by the commission of Codex Alimentarius, refers to the inclusion of carbohydrates of 3-9 degrees of polymerisation (DP), decision which may be made individually by the authorities of each country. Due to the possibility of having two definitions and the negative impact it would cause over the harmonisation of nutritional information, a bibliographic review was carried, from 2009 to 2011, aiming to gather justifications for the inclusion of carbohydrates of 3-9 DP in the definition. The current review presents scientific bases that are directed to three topics: physiological aspects; repercussion over the analytical method; and impact on consumers and other users. The decision of including unavailable carbohydrates of 3-9 DP in the definition of DF may cause effective global harmonisation in the nutritional labelling, considering that the main goal is to help consumers choose healthy foods. PMID:23601410

  18. Die Herstellung von Scaffolds aus funktionellen Hybridpolymeren für die regenerative Medizin mittels Zwei-Photonen-Polymerisation

    Stichel, Thomas Günther

    2016-01-01

    In der vorliegenden Arbeit wurde das Verfahren der Zwei-Photonen-Polymerisation von anorganisch-organischen Hybridpolymeren (ORMOCER®e) untersucht. Untersuchungsschwerpunkte bildeten dabei die theoretischen Betrachtungen der Wechselwirkung zwischen Laser und Hybridpolymer, die experimentelle Charakterisierung unterschiedlicher ORMOCER®e sowie die Aufskalierung der Technologie im Hinblick auf die Herstellung von Scaffold-Strukturen für die regenerative Medizin. Hierbei wurde u. a. ein innovati...

  19. High-Order Volterra Model Predictive Control and Its Application to a Nonlinear Polymerisation Process

    Yun Li; Hiroshi Kashiwagi

    2005-01-01

    Model Predictive Control (MPC) has recently found wide acceptance in the process industry, but existing design and implementation methods are restricted to linear process models. A chemical process, however, involves severe nonlinearity which cannot be ignored in practice. This paper aims to solve this nonlinear control problem by extending MPC to accommodate nonlinear models. It develops an analytical framework for nonlinear model predictive control (NMPC). It also offers a third-order Volterra series based nonparametric nonlinear modelling technique for NMPC design, which relieves practising engineers from the need for deriving a physical-principles based model first. An on-line realisation technique for implementing NMPC is then developed and applied to a Mitsubishi Chemicals polymerisation reaction process. Results show that this nonlinear MPC technique is feasible and very effective. It considerably outperforms linear and low-order Volterra model based methods. The advantages of the developed approach lie not only in control performance superior to existing NMPC methods, but also in eliminating the need for converting an analytical model and then convert it to a Volterra model obtainable only up to the second order.

  20. Nanocomposites with functionalised polysaccharide nanocrystals through aqueous free radical polymerisation promoted by ozonolysis.

    Espino-Pérez, E; Gilbert, Robert G; Domenek, S; Brochier-Salon, M C; Belgacem, M N; Bras, J

    2016-01-01

    Cellulose nanocrystals (CNC) and starch nanocrystals (SNC) were grafted by ozone-initiated free-radical polymerisation of styrene in a heterogeneous medium. Surface functionalisation was confirmed by infrared spectroscopy, contact angle measurements, and thermogravimetric and elemental analysis. X-ray diffraction and scanning electron microscopy showed that there was no significant change in the morphology or crystallinity of the nanoparticles following ozonolysis. The grafting efficiency, quantified by (13)C NMR, was greater for SNC, with a styrene/anhydroglucose ratio of 1.56 compared to 0.25 for CNC. The thermal stability improved by 100°C. The contact angles were 97° and 78° following the SNC and CNC grafting, respectively, demonstrating the efficiency of the grafting in changing the surface properties even at low levels of surface substitution. The grafting increased the compatibility with the polylactide, and produced nanocomposites with improved water vapour barrier properties. Ozone-mediated grafting is thus a promising approach for surface functionalisation of polysaccharide nanocrystals. PMID:26453876

  1. Chemosynthesis of bioresorbable poly(gamma-butyrolactone) by ring-opening polymerisation: a review.

    Moore, Tim; Adhikari, Raju; Gunatillake, Pathiraja

    2005-06-01

    Recent advances in the synthesis of poly(gamma-butyrolactone) have yielded homopolymers of up to 50,000 Mw from the low-cost monomer gamma-butyrolactone. This monomer has for the better part of a century been thought impossible to polymerise. Poly(gamma-butyrolactone) displays properties that are ideal for tissue-engineering applications and the bacterially derived equivalent, poly(4-hydroxybutyrate) (P4HB), has been evaluated for such uses. The glass transition temperature (-48 to -51 degrees C), melting point (53-60 degrees C), tensile strength (50 MPa), Young's modulus (70 MPa) and elongation at break (1000%) of P4HB make it a very useful biomaterial. Poly(gamma-butyrolactone) degrades to give gamma-hydroxybutyric acid which is a naturally occurring metabolite in the body and it has been shown to be bioresorbable. Investigation into the synthesis of poly(gamma-butyrolactone) has recently produced homo-oligomeric diols 400-1000 Mw that are suitable for reacting with diisocyanates to form polyurethanes. Biodegradable polyurethanes made from diols of polyglycolide (PGA) and poly(epsilon-caprolactone) (PCL) have the disadvantage of high glass transition and slow degradation, respectively. Poly(gamma-butyrolactone) can be thought of as being the missing link in the biodegradable polyester family immediately between PGA and PCL and displaying intermediate properties. PMID:15626425

  2. NDK Interacts with FtsZ and Converts GDP to GTP to Trigger FtsZ Polymerisation--A Novel Role for NDK.

    Saurabh Mishra

    Full Text Available Nucleoside diphosphate kinase (NDK, conserved across bacteria to humans, synthesises NTP from NDP and ATP. The eukaryotic homologue, the NDPK, uses ATP to phosphorylate the tubulin-bound GDP to GTP for tubulin polymerisation. The bacterial cytokinetic protein FtsZ, which is the tubulin homologue, also uses GTP for polymerisation. Therefore, we examined whether NDK can interact with FtsZ to convert FtsZ-bound GDP and/or free GDP to GTP to trigger FtsZ polymerisation.Recombinant and native NDK and FtsZ proteins of Mycobacterium smegmatis and Mycobacterium tuberculosis were used as the experimental samples. FtsZ polymersation was monitored using 90° light scattering and FtsZ polymer pelleting assays. The γ32P-GTP synthesised by NDK from GDP and γ32P-ATP was detected using thin layer chromatography and quantitated using phosphorimager. The FtsZ bound 32P-GTP was quantitated using phosphorimager, after UV-crosslinking, followed by SDS-PAGE. The NDK-FtsZ interaction was determined using Ni2+-NTA-pulldown assay and co-immunoprecipitation of the recombinant and native proteins in vitro and ex vivo, respectively.NDK triggered instantaneous polymerisation of GDP-precharged recombinant FtsZ in the presence of ATP, similar to the polymerisation of recombinant FtsZ (not GDP-precharged upon the direct addition of GTP. Similarly, NDK triggered polymerisation of recombinant FtsZ (not GDP-precharged in the presence of free GDP and ATP as well. Mutant NDK, partially deficient in GTP synthesis from ATP and GDP, triggered low level of polymerisation of MsFtsZ, but not of MtFtsZ. As characteristic of NDK's NTP substrate non-specificity, it used CTP, TTP, and UTP also to convert GDP to GTP, to trigger FtsZ polymerisation. The NDK of one mycobacterial species could trigger the polymerisation of the FtsZ of another mycobacterial species. Both the recombinant and the native NDK and FtsZ showed interaction with each other in vitro and ex vivo, alluding to the

  3. Synthesis of poly-(epsilon)-caprolactone grafted starch co-polymers by ring-opening polymerisation using silylated starch precursors

    Sugih, Asaf K.; Picchioni, Francesco; Janssen, Leon P.B.M.; 068883455; Heeres, Hero J.

    2009-01-01

    Poly-(epsilon)-caprolactone grafted corn starch co-polymers were synthesized using a hydrophobised silylated starch precursor. The silylation reaction was performed using hexamethyl disilazane (HMDS) as the reagent in DMSO at 70 degrees C. Silylated starch with a degree of substitution (DS) between 0.45 and 0.7 was obtained. E-Caprolactone is grafted to silylated starch by a ring-opening polymerisation catalysed by Al(OiPr)(3) in THF at 50 degrees C. The grafting efficiency varies between 28%...

  4. The Electrochemical polymerisation of 1,2 dihydroxybenzene and 2-hydroxybenzyl alcohol prepared in different solutions media

    ABSTRACT: The electrochemical polymerisation of 1,2 dihydroxybenzene (catechol) and 2-hydroxybenzyl alcohol (2HBA) from aqueous neutral, acidic and basic solutions was investigated. The development of polymer films on gold working electrodes was observed by the rapid decrease in current seen in the cyclic voltammograms (CV). The currents pertaining to the oxidation and polymerisation of catechol are far higher (by some two orders of magnitude) than for the 2HBA in all tested media. The presence of polymer films was confirmed by the decrease in current in the CV scans subsequent to the first. Molecular structures, electron density distribution and the eigenvalues of the Highest Occupied Molecular Orbital (HOMO) and the Lowest Unoccupied Molecular Orbital (LUMO) of each compound and their ionised forms were calculated using Spartan 14 V1.1.4 molecular modelling suite package. All values have been carried out by restricted Hartree–Fock (RHF) level using 6–311G* basis set. The calculated energy levels were used to evaluate the electrochemical event

  5. Modification of surface properties of high and low density polyethylene by Ar plasma discharge

    Švorčík, J.; Kolářová, K.; Slepička, P.; Macková, Anna; Novotná, M.; Hnatowicz, Vladimír

    2006-01-01

    Roč. 91, č. 6 (2006), s. 1219-1225. ISSN 0141-3910 R&D Projects: GA MŠk OC 527.100; GA MŠk 1P05OC014 Institutional research plan: CEZ:AV0Z10480505 Keywords : plasma polymerisation * surface modification Subject RIV: CD - Macromolecular Chemistry Impact factor: 2.174, year: 2006

  6. A comparative study of the physical properties of Sb{sub 2}S{sub 3} thin films treated with N{sub 2} AC plasma and thermal annealing in N{sub 2}

    Calixto-Rodriguez, M., E-mail: manuela@fis.unam.mx [Instituto de Ciencias Fisicas, Universidad Nacional Autonoma de Mexico, Apartado Postal 48-3, 62210, Cuernavaca, Morelos (Mexico); Martinez, H. [Instituto de Ciencias Fisicas, Universidad Nacional Autonoma de Mexico, Apartado Postal 48-3, 62210, Cuernavaca, Morelos (Mexico); Pena, Y. [Facultad de Ciencias Quimicas, Universidad Autonoma de Nuevo Leon, Pedro de Alba s/n, Cd. Universitaria, 66451, San Nicolas de los Garza, Nuevo Leon (Mexico); Flores, O. [Instituto de Ciencias Fisicas, Universidad Nacional Autonoma de Mexico, Apartado Postal 48-3, 62210, Cuernavaca, Morelos (Mexico); Esparza-Ponce, H.E. [Centro de Investigacion en Materiales Avanzados S.C., Laboratorio Nacional de Nanotecnologia, Miguel de Cervantes 120, Complejo Industrial Chihuahua, Chihuahua, Chihuahua 31109 (Mexico); Sanchez-Juarez, A.; Campos-Alvarez, J. [Centro de Investigacion en Energia, Universidad Nacional Autonoma de Mexico, Privada Xochicalco s/n, Col. Centro, 62580, Temixco, Morelos (Mexico); Reyes, P. [Facultad de Ciencias, Departamento de Fisica, Universidad Autonoma del Estado de Mexico, Instituto Literario 100, Col. Centro, 50000, Toluca, Estado de Mexico (Mexico)

    2010-02-01

    As-deposited antimony sulfide thin films prepared by chemical bath deposition were treated with nitrogen AC plasma and thermal annealing in nitrogen atmosphere. The as-deposited, plasma treated, and thermally annealed antimony sulfide thin films have been characterized by X-ray diffraction (XRD), energy dispersive X-ray spectroscopy, scanning electron microscopy, atomic force microscopy, UV-vis spectroscopy, and electrical measurements. The results have shown that post-deposition treatments modify the crystalline structure, the morphology, and the optoelectronic properties of Sb{sub 2}S{sub 3} thin films. X-ray diffraction studies showed that the crystallinity of the films was improved in both cases. Atomic force microscopy studies showed that the change in the film morphology depends on the post-deposition treatment used. Optical emission spectroscopy (OES) analysis revealed the plasma etching on the surface of the film, this fact was corroborated by the energy dispersive X-ray spectroscopy analysis. The optical band gap of the films (E{sub g}) decreased after post-deposition treatments (from 2.36 to 1.75 eV) due to the improvement in the grain sizes. The electrical resistivity of the Sb{sub 2}S{sub 3} thin films decreased from 10{sup 8} to 10{sup 6} {Omega}-cm after plasma treatments.

  7. Plasma treatment advantages for textiles

    Sparavigna, Amelia

    2008-01-01

    The textile industry is searching for innovative production techniques to improve the product quality, as well as society requires new finishing techniques working in environmental respect. Plasma surface treatments show distinct advantages, because they are able to modify the surface properties of inert materials, sometimes with environment friendly devices. For fabrics, cold plasma treatments require the development of reliable and large systems. Such systems are now existing and the use of plasma physics in industrial problems is rapidly increasing. On textile surfaces, three main effects can be obtained depending on the treatment conditions: the cleaning effect, the increase of microroughness (anti-pilling finishing of wool) and the production of radicals to obtain hydrophilic surfaces. Plasma polymerisation, that is the deposition of solid polymeric materials with desired properties on textile substrates, is under development. The advantage of such plasma treatments is that the modification turns out to ...

  8. Characterization of Plasma-Polymerized 4-vinyl pyridine on Poly(Ethylene Terephthalate) film for anti-microbial properties

    Jiang, Juan; Winther-Jensen, Bjørn; Kjær, Erik Michael

    2005-01-01

    As an efficient way to create an anti-bacterial function on polymer surfaces, we have used plasma polymerisation to create a poly-4-vinyl-pyridine coating on the surface of a common polymer, PET, a polymerisation process that we have shown also works well on several other polymers. We have found a...... mechanical strength of the bond between the substrate and the surface layer has been tested by several methods, and the antibacterial effect of the surface layer with and without silver nano particles has been estimated by measuring electrical resistance as a function of time. The bacteria investigated were...

  9. The molecular structure of melts along the carbonatite-kimberlite-basalt compositional joint: CO2 and polymerisation

    Moussallam, Yves; Florian, Pierre; Corradini, Dario; Morizet, Yann; Sator, Nicolas; Vuilleumier, Rodolphe; Guillot, Bertrand; Iacono-Marziano, Giada; Schmidt, Burkhard C.; Gaillard, Fabrice

    2016-01-01

    Transitional melts, intermediate in composition between silicate and carbonate melts, form by low degree partial melting of mantle peridotite and might be the most abundant type of melt in the asthenosphere. Their role in the transport of volatile elements and in metasomatic processes at the planetary scale might be significant yet they have remained largely unstudied. Their molecular structure has remained elusive in part because these melts are difficult to quench to glass. Here we use FTIR, Raman, 13C and 29Si NMR spectroscopy together with First Principle Molecular Dynamic (FPMD) simulations to investigate the molecular structure of transitional melts and in particular to assess the effect of CO2 on their structure. We found that carbon in these glasses forms free ionic carbonate groups attracting cations away from their usual 'depolymerising' role in breaking up the covalent silicate network. Solution of CO2 in these melts strongly modifies their structure resulting in a significant polymerisation of the aluminosilicate network with a decrease in NBO/Si of about 0.2 for every 5 mol% CO2 dissolved. This polymerisation effect is expected to influence the physical and transport properties of transitional melts. An increase in viscosity is expected with increasing CO2 content, potentially leading to melt ponding at certain levels in the mantle such as at the lithosphere-asthenosphere boundary. Conversely an ascending and degassing transitional melt such as a kimberlite would become increasingly fluid during ascent hence potentially accelerate. Carbon-rich transitional melts are effectively composed of two sub-networks: a carbonate and a silicate one leading to peculiar physical and transport properties.

  10. From molecules to particles in silane plasmas

    Particle formation has been investigated experimentally from the initial molecular precursor up to the final micron-sized particles in a low pressure silane rf capacity discharge. Neutrals and ions were studied by quadrupole mass spectrometry in power-modulated plasmas: Whole series of negative ions were observed, ranging from monosilicon anions through to nanometric clusters. Anion confinement results in particles and conversely, anion de-trapping can inhibit particle formation. Plasma polymerisation is considered in terms of neutral and ionic species. Laser light scattering measurements show that particles appear during a rapid coalescence phase and possible mechanisms are discussed. (author) 5 figs., 28 refs

  11. From molecules to particles in silane plasmas

    Howling, A.A.; Courteille, C.; Dorier, J.L.; Sansonnier, L.; Hollenstein, C. [Ecole Polytechnique Federale, Lausanne (Switzerland). Centre de Recherche en Physique des Plasma (CRPP)

    1995-06-01

    Particle formation has been investigated experimentally from the initial molecular precursor up to the final micron-sized particles in a low pressure silane rf capacity discharge. Neutrals and ions were studied by quadrupole mass spectrometry in power-modulated plasmas: Whole series of negative ions were observed, ranging from monosilicon anions through to nanometric clusters. Anion confinement results in particles and conversely, anion de-trapping can inhibit particle formation. Plasma polymerisation is considered in terms of neutral and ionic species. Laser light scattering measurements show that particles appear during a rapid coalescence phase and possible mechanisms are discussed. (author) 5 figs., 28 refs.

  12. Effect of gas flow on transport of O (3Pj) atoms produced in ac power excited non-equilibrium atmospheric-pressure O2/Ar plasma jet

    The Spatial distribution of O (3Pj) atoms emitted from a non-equilibrium atmospheric-pressure O2/Ar plasma jet in ambient N2 gas has been measured by using the vacuum ultraviolet absorption spectroscopy. In remote regions of the plasma, the absolute density of O (3Pj) atoms for a total gas flow rate of 1 slm decreased from 4.1 × 1014 to 1.5 × 1013 cm−3 as the distance from the main discharge region increased from 10 to 16 mm and that for 5 slm decreased from 7.7 × 1014 to 2.0 × 1014 cm−3. The reduction ratio thus changed from 0.037 to 0.259 with increasing total gas flow rate. Although loss of O (3Pj) atoms occurs frequently due to the influence of N2 or nitrogen oxide species produced by the inflow of ambient gas, it is found that the gas flow velocity is a very important factor for the transport of the active species to longer distances from the plasma, and it determines the material processing performance for a non-equilibrium atmospheric-pressure O2/Ar plasma jet. (paper)

  13. Phase separation micromoulding and photopatterning based on radiation induced free radical polymerisation of acrylates for the microfabrication of porous monolithic structures

    Two different microfabrication techniques for the preparation of monolithic porous polymeric 3D microstructures were assessed. The first approach is based on a radiation assisted imprint process. Electron beam initiated free radical polymerisation of acrylates/methacrylates in a porogenic solvent within the confinements of V-shaped microgrooves in a silicon master enables the pattern transfer, thereby phase separation allows for the generation of a porous material of the replicate simultaneously. Furthermore, porous 3D microstructures in the format of arrays with different feature sizes in the range of 50 to 1000 micrometers were obtained by UV exposure of a liquid film of acrylates/methacrylates in a porogenic solvent through a photomask. In this paper we present the first results regarding the combined pattern transfer and polymerisation-phase separation process in the micrometer range. Microstructures and the dimension of pores and globules within these microstructures were analysed by scanning electron microscopy. (paper)

  14. Estudio por emisión acústica del comportamiento a flexión de recubrimientos WC-Co obtenidos por plasma atmosférico

    Segovia, F.; Klyatskina, E.; Bonache, V.; Salvador, M. D.; Sanchez, E.; Cantavella, V.; Bloem, C.

    2007-01-01

    Plasma sprayed cermet coatings WC-Co are used in a wide range of industrial applications, mainly due to their wear resistance even in corrosive environments. The objective of this work is to analyze mechanical response of hard metal coatings by means of three- and four-points bend tests applying acoustic emission technique to determine failure critical strength. It has been observed the effect of supported charge level in structural damage by means of optical microscopy and scanning electron ...

  15. In-situ polymerisation of fully bioresorbable polycaprolactone/phosphate glass fibre composites: In vitro degradation and mechanical properties.

    Chen, Menghao; Parsons, Andrew J; Felfel, Reda M; Rudd, Christopher D; Irvine, Derek J; Ahmed, Ifty

    2016-06-01

    Fully bioresorbable composites have been investigated in order to replace metal implant plates used for hard tissue repair. Retention of the composite mechanical properties within a physiological environment has been shown to be significantly affected due to loss of the integrity of the fibre/matrix interface. This study investigated phosphate based glass fibre (PGF) reinforced polycaprolactone (PCL) composites with 20%, 35% and 50% fibre volume fractions (Vf) manufactured via an in-situ polymerisation (ISP) process and a conventional laminate stacking (LS) followed by compression moulding. Reinforcing efficiency between the LS and ISP manufacturing process was compared, and the ISP composites revealed significant improvements in mechanical properties when compared to LS composites. The degradation profiles and mechanical properties were monitored in phosphate buffered saline (PBS) at 37°C for 28 days. ISP composites revealed significantly less media uptake and mass loss (pproperties of ISP composites were substantially higher (pproperty retention profiles were also seen for the ISP composites compared to LS composites. SEM micrographs of fracture surfaces for the LS composites revealed dry fibre bundles and poor fibre dispersion with polymer rich zones, which indicated poor interfacial bonding, distribution and adhesion. In contrast, evenly distributed fibres without dry fibre bundles or polymer rich zones, were clearly observed for the ISP composite samples, which showed that a superior fibre/matrix interface was achieved with highly improved adhesion. PMID:26748261

  16. ACAC Converters for UPS

    Rusalin Lucian R. Păun

    2008-05-01

    Full Text Available This paper propose a new control technique forsingle – phase ACAC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.

  17. Couches minces organiques riches en amines primaires par photo-polymerisation ultraviolette : Caracterisation et applications biomedicales

    St-Georges-Robillard, Amelie

    the coating with oxygen in air or dissolved in water. The UV-PE:N coating proved virtually insoluble, despite a high concentration of nitrogen and showed excellent retention of the R-NH 2 groups when immersed in water, two essential properties for applications in cell culture. These studies have also shown that UV-PE:N coatings (deposited with two gas ratios, R = 0.75 and 1) permit adhesion and survival of U937 monocytes without causing any significant inflammatory response, which enables one to study wear particle effects. However, the adhesion of U937 monocytes on parylene diX AM manifests a rather different behavior, adhesion being proportional to [NH2] and not controlled by the critical threshold, [NH 2]crit, observed for different types of plasma-polymer coatings. Also, monocytes do not survive for 24 hours on parylene diX AM. The cause for these differences remains to be elucidated. Finally, the adhesion and growth of HUVEC on both types of UV-PE:N (R = 0.75 and 1), as well as on L-PPE:N and on gelatinized polystyrene, were statistically higher than on untreated PET. Therefore, UV-PE:N has proven to be a cell culture surface well-adapted for HUVEC, of similar efficiency to gelatinized polystyrene, a surface known to promote the adhesion and growth of HUVEC. UV-PE: N is therefore a promising coating that provides stability in air and in water for use in cell culture and has demonstrated its performance for two biomedical applications. Keywords: biomaterials, primary amines, thin film deposition, photo-polymerization, plasma polymerization, XPS, chemical derivatization, ellipsometry, cellular adhesion, arthroplasty, vascular graft.

  18. Interface modification and material synthesis of organic light-emitting diodes using plasma technology

    Liang, Rongqing; Ou, Qiongrong; Yang, Cheng; He, Kongduo; Yang, Xilu; Zhong, Shaofeng; plasma application Team

    2015-09-01

    Organic light-emitting diodes (OLEDs), due to their unique properties of solution processability, compatibility with flexible substrates and with large-scale printing technology, attract huge interest in the field of lighting. The integration of plasma technology into OLEDs provides a new route to improve their performance. Here we demonstrate the modification of indium-tin-oxide (ITO) work function by plasma treatment, synthesis of thermally activated delayed fluorescence (TADF) materials using plasma grafting (polymerisation), and multi-layer solution processing achieved by plasma cross-linking.

  19. Synthesis of selected cage alkenes and their attempted ring-opening metathesis polymerisation with well-defined ruthenium carbene catalysts / Justus Röscher

    Röscher, Justus

    2011-01-01

    In this study a number of cage alkenes were synthesised and tested for activity towards ringopening metathesis polymerisation (ROMP) with the commercially available catalysts 55 (Grubbs-I) and 56 (Grubbs-II). The first group of monomers are derivatives of tetracyclo[6.3.0.04,1105,9]undec-2-en-6-one (1). The synthesis of these cage alkenes are summarised in Scheme 7.1. The cage alkene 126b was synthesised by a Diels-Alder reaction between 1 and hexachlorocyclopentadiene (9, Scheme ...

  20. AC power supply systems

    An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)

  1. AcEST: DK950971 [AcEST

    Full Text Available optera acutorost... 37 0.66 tr|B1ACS6|B1ACS6_BALBN DMP1 (Fragment) OS=Balaenoptera ...bonaerens... 37 0.66 tr|B1ACS5|B1ACS5_BALED DMP1 (Fragment) OS=Balaenoptera edeni... GN=... 37 0.66 tr|B1ACS4|B1ACS4_BALBO DMP1 (Fragment) OS=Balaenoptera borealis ... 37 0.66 tr|B1ACS3|B1ACS3..._BALMU DMP1 (Fragment) OS=Balaenoptera musculus ... 37 0.86 tr|B1ACS1|B1ACS1_MEGNO DMP1 (Fragment) OS=Megapt...1ACS2_BALPH DMP1 (Fragment) OS=Balaenoptera physalus ... 37 1.1 tr|B1ACT6|B1ACT6_MESPE DMP1 (Fragment) OS=Me

  2. AC1 Wing

    Adrian DOBRE

    2010-03-01

    Full Text Available The AC1 wing replaces the old wing of the wind tunnel model AEROTAXI, which has been made at scale 1:9. The new wing is part of CESAR program and improves the aerodynamic characteristics of the old one. The geometry of the whole wing was given by FOI Sweden and position of AC1 wing must coincide with the structure of the AEROTAXI model.

  3. AC1 Wing

    Adrian DOBRE

    2010-01-01

    The AC1 wing replaces the old wing of the wind tunnel model AEROTAXI, which has been made at scale 1:9. The new wing is part of CESAR program and improves the aerodynamic characteristics of the old one. The geometry of the whole wing was given by FOI Sweden and position of AC1 wing must coincide with the structure of the AEROTAXI model.

  4. Contributions to the Experimental Investigation of the Nascent Polymerisation of Ethylene on Supported Catalysts, 1: A Quenched-Flow Apparatus for the Study of Particle Morphology and Nascent Polymer Properties

    Di Martino, Audrey; Weickert, Günter; McKenna, Timothy F.L.

    2007-01-01

    A detailed investigation of the kinetics, morphology and polymer properties observed during the polymerisation of ethylene on a Ziegler-Natta catalyst at very short times (t 40 ms) in a novel, quenched-flow reactor is presented. It was found that for times shorter than a tenth of a second, the obse

  5. ac bidirectional motor controller

    Schreiner, K.

    1988-01-01

    Test data are presented and the design of a high-efficiency motor/generator controller at NASA-Lewis for use with the Space Station power system testbed is described. The bidirectional motor driver is a 20 kHz to variable frequency three-phase ac converter that operates from the high-frequency ac bus being designed for the Space Station. A zero-voltage-switching pulse-density-modulation technique is used in the converter to shape the low-frequency output waveform.

  6. AC/RF Superconductivity

    Ciovati, Gianluigi [JLAB

    2015-02-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  7. AC/RF Superconductivity

    Ciovati, G.

    2015-01-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  8. Modulation of release kinetics by plasma polymerization of ampicillin-loaded β-TCP ceramics

    Labay, C.; Buxadera-Palomero, J.; Avilés, M.; Canal, C.; Ginebra, M. P.

    2016-08-01

    Beta-tricalcium phosphate (β-TCP) bioceramics are employed in bone repair surgery. Their local implantation in bone defects puts them in the limelight as potential materials for local drug delivery. However, obtaining suitable release patterns fitting the required therapeutics is a challenge. Here, plasma polymerization of ampicillin-loaded β-TCP is studied for the design of a novel antibiotic delivery system. Polyethylene glycol-like (PEG-like) coating of β-TCP by low pressure plasma polymerization was performed using diglyme as precursor, and nanometric PEG-like layers were obtained by simple and double plasma polymerization processes. A significant increase in hydrophobicity, and the presence of plasma polymer was visible on the surface by SEM and quantified by XPS. As a main consequence of the plasma polymerisation, the release kinetics were successfully modified, avoiding burst release, and slowing down the initial rate of release leading to a 4.5 h delay in reaching the same antibiotic release percentage, whilst conservation of the activity of the antibiotic was simultaneously maintained. Thus, plasma polymerisation on the surface of bioceramics may be a good strategy to design controlled drug delivery matrices for local bone therapies.

  9. Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition

    The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity

  10. Hermetisk AC-Krets

    Hirsch, Carl; Smirnoff, Alexander

    2007-01-01

    Under sex månader våren 2007 har ett samarbete mellan Volvo Lastvagnar och två studenter från KTH, inriktning Integrerad produktutveckling vid institutionen för maskinkonstruktion, pågått i form av ett examensarbete på 20 poäng. Dagens AC-system i Volvos lastbilar avger 20-40 g/år av köldmediet R134a som är en kraftfull växthusgas. Detta sker främst genom diffusion via slangar och tätningsmaterial. Syftet med detta examensarbete är att ta fram förslag på tekniska lösningar på ett nytt AC-syst...

  11. Negative hydrogen ion beam extraction from an AC heated cathode driven Bernas-type ion source

    Okano, Y.; Miyamoto, N.; Kasuya, T.; Wada, M.

    2015-04-01

    A plasma grid structure was installed to a Bernas-type ion source used for ion implantation equipment. A negative hydrogen (H-) ion beam was extracted by an AC driven ion source by adjusting the bias to the plasma grid. The extracted electron current was reduced by positively biasing the plasma grid, while an optimum plasma grid bias voltage for negative ion beam extraction was found to be positive 3 V with respect to the arc chamber. Source operations with AC cathode heating show extraction characteristics almost identical to that with DC cathode heating, except a minute increase in H- current at higher frequency of cathode heating current.

  12. Novel Cobalt(II) complexes containing N,N-di(2-picolyl)amine based ligands; Synthesis, characterization and application towards methyl methacrylate polymerisation

    Ahn, Seoung Hyun; Choi, Sang-Il; Jung, Maeng Joon; Nayab, Saira; Lee, Hyosun

    2016-06-01

    The reaction of [CoCl2·6H2O] with N‧-substituted N,N-di(2-picolyl)amine ligands such as 1-cyclohexyl-N,N-bis(pyridin-2-ylmethyl)methanamine (LA), 2-methoxy-N,N-bis(pyridin-2-ylmethyl)ethan-1-amine (LB), and 3-methoxy-N,N-bis(pyridin-2-ylmethyl)propan-1-amine (LC), yielded [LnCoCl2] (Ln = LA, LB and LC), respectively. The Co(II) centre in [LnCoCl2] (Ln = LA, and LC) adopted distorted bipyramidal geometries through coordination of nitrogen atoms of di(2-picolyl)amine moiety to the Co(II) centre along with two chloro ligands. The 6-coordinated [LBCoCl2] showed a distorted octahedral geometry, achieved through coordination of the two pyridyl units, two chloro units, and bidentate coordination of nitrogen and oxygen in the N‧-methoxyethylamine to the Co(II) centre. [LCCoCl2] (6.70 × 104 gPMMA/molCo h) exhibited higher catalytic activity for the polymerisation of methyl methacrylate (MMA) in the presence of modified methylaluminoxane (MMAO) compared to rest of Co(II) complexes. The catalytic activity was considered as a function of steric properties of ligand architecture and increased steric bulk around the metal centre resulted in the decrease catalytic activity. All Co(II) initiators yielded syndiotactic poly(methylmethacrylate) (PMMA).

  13. High performance AC drives

    Ahmad, Mukhtar

    2010-01-01

    This book presents a comprehensive view of high performance ac drives. It may be considered as both a text book for graduate students and as an up-to-date monograph. It may also be used by R & D professionals involved in the improvement of performance of drives in the industries. The book will also be beneficial to the researchers pursuing work on multiphase drives as well as sensorless and direct torque control of electric drives since up-to date references in these topics are provided. It will also provide few examples of modeling, analysis and control of electric drives using MATLAB/SIMULIN

  14. Superconducting ac cable

    The components of a superconducting 110 kV ac cable for power ratings >= 2000 MVA have been developed. The cable design especially considered was of the semiflexible type, with a rigid cryogenic envelope and flexible hollow coaxial cable cores pulled into the former. The cable core consists of spirally wound Nb-Al composite wires and a HDPE-tape wrapped electrical insulation. A 35 m long single phase test cable with full load terminations for 110 kV and 10 kA was constructed and successfully tested. The results obtained prove the technical feasibility and capability of our cable design. (orig.)

  15. Surface Modification due to Solution Plasma

    Shuai, Z.; Akaki, K.; Shimizu, K.; Kotani, K; Shinohara, M.; Matsuda, Y.; Fujiyama, H.

    2009-01-01

    We succeeded in the generation of two types of solution plasmas: one was generated in the ultrasonic bubbles by feeding DC power or commercial AC 60Hz power for the etching of silicon substrate. The other plasma was generated by low frequency power for the film deposition inside tubes. Now we are optimizing the plasma generation condition for each application.

  16. Ac Hybrid Charge Controller

    Shalini S. Durgam

    2015-03-01

    Full Text Available One of the primary needs for socio-economic development in any nation in the world is the provision of reliable electricity supply systems with lower carbon footprint levels. The purpose of this work is the development of a hybrid Power system that harnesses the renewable energy in sun and electricity to generate electricity. The working model can able to run on dual mode- solar and electricity. It can also be driven independently either by solar or electricity. The battery can be charge from solar panel (40W or by power supply. The household single phase A.C. power supply of 230V is converted into 12V D.C. using step down transformer and rectifying circuit. The working model can achieve energy saving, low carbon emission, environmental protection for the upcoming future of human life.

  17. Controlling the Plasma-Polymerization Process of N-Vinyl-2-pyrrolidone

    Norrman, Kion; Winther-Jensen, Bjørn

    2005-01-01

    N-vinyl-2-pyrrolidone was plasma-polymerized on glass substrates using a pulsed AC plasma. Pulsed AC plasma produces a chemical surface structure different from that produced by conventional RF plasma; this is ascribed to the different power regimes used. A high degree of control over the structure...... of the chemical surface was obtained using pulsed AC plasma, as shown by ToF-SIMS. It is demonstrated how the experimental conditions to some extent control the chemical structure of the plasma-polymerized film, e.g., film thickness, density of post-plasma-polymerized oligomeric chains, and the...

  18. Diagnostics of particle genesis and growth in RF silane plasmas by ion mass spectrometry and light scattering

    Experimental identification of the precursors and processes leading to particles is essential for understanding particulate contamination in deposition plasmas. We have investigated particle formation in rf plasmas using light scattering (elastic and inelastic) and quadrupole ion mass spectrometry as complementary plasma diagnostics. Negative ions reach high masses (at least 500 amu) and are the only elementary species with a residence time on the scale of the powder formation time. Furthermore, a negative ion polymerisation scheme shows that the densities of high mass anions are strongly diminished at kHz power modulation frequencies, where reduced powder production is also observed. We conclude that negative ions are the particle precursors and that initial clusters grow by negative ion polymerisation in silane plasmas. In situ light scattering techniques are described to self-consistently determine particle size, number density and refractive index. Novel, visible photoluminescence measurements from particles suspended in the plasma are also reported. These diagnostics demonstrate that particle evolution proceeds by an agglomeration phase and that the particle properties are different from the bulk material early in the particle development. (author) 9 figs., 45 refs

  19. AcEST: BP920072 [AcEST

    Full Text Available YMU001_000132_F11 525 Adiantum capillus-veneris mRNA. clone: YMU001_000132_F11. BP920072 - Show ... YGMYGEGEKALETFADMEKSGIVPDSVVFIAII 617 Query: 139 NACSR SCLFHECHSYFEAMSTHHGIVPCLEHHSCVV 32 ACS S L E + FE M ... KLMTRDVVSWNTLIAGYAQVGQNEGLFCTFSDMLGQRVKPDLITFVIVLNACSR ... 125 VF+ + +D VSWN++I+GY Q G F M+ + D IT++++++ +R S ... YGVHGYGKKAIQIFEEMLANGASP 384 Query: 166 DLITFVIVLNACSR SCLFHECHSYFEAMSTHHGIVPCLEHHSCVV 32 +TFV VL ACS L E ... KLMTRDVVSWNTLIAGYAQVGQNEGLFCTFSDMLGQRVKPDLITFVIVLNACSR S 122 +VFDK R + WN L G E + + M V+ D T+ VL AC S Sbjc ...

  20. Induction Motor Control through AC/DC/AC Converters

    Elfadili, Abderrahim; Giri, Fouad; Ouadi, Hamid; El Magri, Abdelmounime; Dugard, Luc; Abouloifa, Abdelmajid

    2010-01-01

    We consider the problem of controlling inductions motors driven through AC/DC rectifiers and DC/AC inverters. The control objectives are threefold: (i) forcing the motor speed to track a reference signal, (ii) regulating the DC Link voltage, (iii) assuring a satisfactory power factor correction (PFC) with respect to the power supply net. First, a nonlinear model of the whole controlled system is developed in the Park-coordinates. Then, a nonlinear multi-loop controller is synthesized using th...

  1. AcEST: BP920905 [AcEST

    Full Text Available EM + + D ++S L AC Sbjct: 374 NSAYKLFERMPKKNVVAWNAIISGYSQHGHPHEALALFIEMQAQGIKPDSFAIVSVLPAC 433 Query: 71 SHSSTLNDGKLIHFYILMNNFE...EM++ ++ + V + S L +C Sbjct: 255 SSERIFEKIAKKNAVSWTAMISSYNRGEFSEKALRSFSEMIKSGIEPNLVTLYSVLSSCG 314 Query: 68 HSSTLNDGKLIHFYILMNNFE...VVVMSCLKACS 69 ++ +F RRD VTW A+I GYA HG E A+ LF+ M+ EN+ + V +S L+AC+ Sbjct: 656 DSRLMFEKSLRRDFVTWNAMICGYAHHGKGEEAIQLFERMILEN...ELEKMHNKRLQEMCVSWNSIISGYVMKEQSEDAQMLFTRMME 596 Query: 122 ENVDTDGVVVMSCLKACSHSSTLNDGKLIHFYILMNNFE ...FCEADT-NVITWNAMIASYVHCEQSEKAIALFDRMVSENFKPSSITLVTLLMAC 543 Query: 71 SHSSTLNDGKLIHFYILMNNFEL 3 ++ +L G++

  2. AcEST: DK950147 [AcEST

    Full Text Available TST38A01NGRL0007_O05 706 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0007_O05. 5' end seq ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... OS=Medicago truncatula GN=MtrDRAFT_AC149576g3v2 PE ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... (Fragment) OS=Medicago truncatula GN=MtrDRAFT_AC14 ...

  3. AcEST: DK959344 [AcEST

    Full Text Available TST39A01NGRL0004_G23 714 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0004_G23. 5' end seq ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... OS=Medicago truncatula GN=MtrDRAFT_AC149576g3v2 PE ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... (Fragment) OS=Medicago truncatula GN=MtrDRAFT_AC14 ...

  4. AcEST: DK949716 [AcEST

    Full Text Available TST38A01NGRL0006_L20 613 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0006_L20. 5' end seq ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... OS=Medicago truncatula GN=MtrDRAFT_AC149576g3v2 PE ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... (Fragment) OS=Medicago truncatula GN=MtrDRAFT_AC14 ...

  5. AC drives for industrial plants. Plant kudoyo AC drive sochi

    Miyazaki, M.; Shibata, M.; Yamada, S. (Toshiba Corp., Tokyo (Japan))

    1992-08-01

    Features and product series of AC drives for industrial plants were outlined. Configurations and features of various types of AC drives were briefly discussed which are put into market to meet various requirements for industrial plants and wide ranges of output voltage and capacity. The following product series were outlined; the power bipolar transistor inverter for 3.5-600 kVA in output capacity, IGBT inverter for AC 400 V in output voltage and 1,000 kVA or less, GTO inverter for AC 600 V and 700-2,000 kVA, and cycloconverter for AC 1,000-3,000 V and 1,000 kW-20 MW. The following subjects were outlined as current technical trends of AC drives for industrial plants; increasing in capacity of voltage-source PWM inverters, downsizing of converters through highly efficient cooling and highly dense mounting, spreading of sensorless vector controls, and development of high-voltage large-capacity PWM inverters. 6 figs., 2 tabs.

  6. Condensation production in comet tail plasma

    Koshevaya, S. V.; M. Tecpoyotl T.; E. A. Gutiérrez D.; Burlak, G. N.; A. N. Kotsarenko

    2000-01-01

    Los solitones producen condensaciones en la cola del cometa, como resultado de su interacci on con el viento solar. Se obtienen las condiciones de excitaci on de las ondas ion ac usticas y polvo-ac usticas. La teor a presentada, trata sobre los solitones ion-ac usticos polvosos en este plasma magnetizado. Se demuestra que la longitud de Debye y el radio de cyclotr on de las part culas de polvo cargadas, de nen la dimensi on transversal de los solitones polvo-ac usticos. Para ...

  7. AcEST: DK955197 [AcEST

    Full Text Available TST39A01NGRL0022_H07 532 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0022_H07. 5' end seq ... KDEVTALPLLK 192 Query: 194 RFAFGIACELLMSRYEKEEQEMLEEPF TTMMKGILQLPIKLPGTRFSKAIVAANMLRARF 373 R+ F +AC+L S ... KDEVMALPLLK 192 Query: 194 RFAFGIACELLMSRYEKEEQEMLEEPF TTMMKGILQLPIKLPGTRFSKAIVAANMLRARF 373 R+ F +AC+L S ... KDEVKVLP 189 Query: 185 LMKRFAFGIACELLMSRYEKEEQEMLEEPF TTMMKGILQLPIKLPGTRFSKAIVAANMLR 364 L++ F IA L + +Q+ ... KDEATVLP 177 Query: 185 LMKRFAFGIACELLMSRYEKEEQEMLEEPF TTMMKGILQLPIKLPGTRFSKAIVAANMLR 364 L+K F +A L E+ QE ...

  8. AcEST: BP915640 [AcEST

    Full Text Available YMU001_000074_A01 462 Adiantum capillus-veneris mRNA. clone: YMU001_000074_A01. BP915640 CL3685C ... y: 462 GPLILRACLVYMQGAPVGSLAEDGIVSAATGKDMEQSTVGFRLMLAKI IHRLIAAFKEVG 283 G IL+AC YM+G +GSL +D V ++VGF+LMLAK ... : 1032 GYYILKACDAYMKGYLIGSLTKDASVIDERSS-ANSTSVGFKLMLAKI APKLFSALSEVG 1090 Query: 282 AYCDAYE 262 A C+ ++ Sb ... uery: 453 ILRACLVYMQGAPVGSLAEDGIVSAATGKDMEQSTVGFRLMLAKI IHRLIAAFKEVGAYC 274 +L AC YM+G PVGS A G ST GF++ML+K ... ame = -1 Query: 423 GAPVGSLAEDGIVSAATGKDMEQSTVGFRLMLAKI I----HRLIAAFKEVGAYCD 271 G P+ L D +S GK + S RL + L+ ...

  9. Speed Control of DC Motor using AC/AC/DC Converter Based on Intelligent Techniques

    Rakan Kh Antar

    2013-05-01

    Full Text Available    This paper describes the application of ac/ac/dc and ac/dc converters to control the speed of a separately excited DC motor. Artificial neural network and PI controller are trained to select the desired values of firing angles for triggering thyristors of the ac/ac/dc and ac/dc bridge converters in order to control the speed of the dc motor at a desired value with constant and different load torques in order to obtain the best speed response. Simulation results show that the rising time for ac/dc and ac/ac/dc converters at 250rpm are reduced about 79% and 89% respectively, while delay time it reduced about 69% and 64% respectively. Therefore, speed response of the dc motor is more efficient for closed loop system compared with open loop also the response of ac/ac/dc converter is better than ac/dc converter.

  10. Imact of feeding and post prandial time on plasma ketone bodies in sows during transition and lactation

    Theil, Peter Kappel; Olesen, A K; Flummer, Christine;

    2013-01-01

    high levels (3% or 8%) of dietary fats with different proportions of medium- and long-chain fatty acids. Blood was obtained by jugular venipuncture on d 3 and 7 prepartum, and d 1, 10, 17, and 28 postpartum, and concentrations of plasma beta-hydroxy butyric acid (BHBA), acetoacetate + acetone (Ac......Ac+Ac), glucose, NEFA, lactate, acetate, and butyrate were determined. For 4 out of 5 treatments, plasma BHBA decreased slightly, whereas plasma AcAc+Ac remained stable. However, plasma BHBA (P < 0.01) and AcAc+Ac (P < 0.001) doubled after d 10 of lactation in sows fed 4% octanoic acid and 4% fish oil diet (4......+4% FO; P < 0.001), compared with earlier in lactation (P < 0.001). Plasma AcAc+Ac was positively related to BHBA (P < 0.01), glucose (P < 0.05), and butyrate (P < 0.001), and negatively related to the acetate:butyrate ratio (P < 0.001). In addition, plasma BHBA was positively related to lactate (P < 0...

  11. Nuclear structure of $^{231}$Ac

    Boutami, R; Mach, H; Kurcewicz, W; Fraile, L M; Gulda, K; Aas, A J; García-Raffi, L M; Løvhøiden, G; Martínez, T; Rubio, B; Taín, J L; Tengblad, O

    2008-01-01

    The low-energy structure of 231Ac has been investigated by means of gamma ray spectroscopy following the beta-decay of 231Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a mini-orange electron spectrometer. The decay scheme of 231Ra --> 231Ac has been constructed for the first time. The Advanced Time Delayed beta-gamma-gamma(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

  12. AcEST: BP920800 [AcEST

    Full Text Available DLNLALQVHSRMVRFGFNAEVEACGALINMYGKCGKVLYAQRVFDDT 298 Query: 206 RQQDVISWNDIISACAQRGHGTEALENFSQMLHEGIVPNSMTFTSVMQA---CNSIEGG...G L +A S F ++ +D+ISW +I +Q EA+ F Sbjct: 217 SEKNEATSNCLINGYMGLGNLEQAESLFNQMPVKDIISWTTMIKGYSQNKRYREAIAVFY 276 Query: 119 QMLHEG...EKAWRIFDGVSCKNLPSWNAIITGCVQGGLLEEAIDLYRHMK 281 Query: 110 HEGIVPNSMTFTSVMQAC---NSIEGGR 36 + + PN +T +V+ AC +...N IIS AQ G +EA+E ++ M Sbjct: 383 DITIGNAVVVMYAKLGLVDSARAVFNWLPNTDVISWNTIISGYAQNGFASEAIEMYNIME 442 Query: 110 HEG...EIDLGEQIHSLSVKTGFESDMYVSGVLIDMYSKYGWLEKARRVLEML 406 Query: 206 RQQDVISWNDIISACAQRGHGTEALENFSQMLHEGIVPNSMTFTSVMQACNSIEGG

  13. AcEST: DK945549 [AcEST

    Full Text Available AGGCGATTTCATCTTTTCTGAGAACCCTGATTTTGTGATTGTGTAATTACA ACTGTGGAACAGAAGGATGAGAAGTCTACTGACACAACAAGATATCTCTGGAGAGGAGA...A AATTGAGAAGGTTTGAGTTCTCAACAATGGGCTATGAGGCAATAATGGGAAGGCACCGAT TGTGGGCTTGTATAGGTTTTGAC...LCTG 239 L++R+LRR + + ++ G AC+ DP +P PLC+G Sbjct: 108 LQQRELRRKLLADSGALNTNSVNGPRNWKACVQQDPSSRPGTPLCSG 154 >sp|A6UUY8|RNZ_META3...49 Tissue type young leaves Developmental stage sporophyte Contig ID CL454Contig1 Sequence GATGAGCGA...CCACCTGTGCAACCGTCAGCGCCTTTGTGCACTGGTG CAATGTCCTGTGGTTACCTTGTTTGGAATCTTAATTGTTCTCATGTAT

  14. AcEST: BP917632 [AcEST

    Full Text Available YMU001_000103_D10 554 Adiantum capillus-veneris mRNA. clone: YMU001_000103_D10. BP917632 - Show ... YSKCKIHQKALELLVLML 154 Query: 466 KDSLEPDEVTYLNVLKACARE EDLKV 543 +D++ P+ TY +VL++C D+++ Sbjct: 155 RDNVRPN ... 185 Query: 415 GHSDSS--KEALKLLTQMRKDSLEPDEVTYLNVLKACARE EDLK 540 + EA KL +M+ ++ PDE+ N++ AC R +++ Sbjct: 18 ...

  15. AcEST: DK961189 [AcEST

    Full Text Available OS=A... 127 7e-29 sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS... 125 2e-28 sp|P00785|AC...IRNSWGLNWGDSGYVKLQRNIDDPFGKCGIAMMPSYP 347 >sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS=

  16. AcEST: DK946687 [AcEST

    Full Text Available YMU02A01NGRL0013_G11 544 Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0013_G11. 5' end seq ... + G P+ TY+ + AC+ E Sbjct: 97 YSFNYMIRGLTNTWN-------DHEA ---ALSLYRRMKFSGLKPDKFTYNFVFIACAKLE 146 Query: 214 A ... Sbjct: 71 LIPKAVELGDFNYSSFLFSVTEEPNHYSFNYMIRGLTNTWNDHEA ALSLYRRMKFSGLKP 130 Query: 469 DGATFSCVLRACGNVGALDV ...

  17. AcEST: DK949372 [AcEST

    Full Text Available TST38A01NGRL0005_N02 627 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0005_N02. 5' end seq ... 363 DQLREKTC-GVDKFDDIVMACXXXXXXXXXXXXXXXXXXKARVHAYGVCD DPEYFYDYVQ 539 Q++EK G+ FDDIV+AC KA+VHA+ VCD DP+YFYD ... 264 QQVQEKKVPGITFFDDIVVACGSGGSIAGLSLGSYLSNLKAKVHAFAVCD DPDYFYDYTQ 323 Query: 540 GLLDGMNANIASRDIVNVIDAKGLG ...

  18. Energy saving in ac generators

    Nola, F. J.

    1980-01-01

    Circuit cuts no-load losses, without sacrificing full-load power. Phase-contro circuit includes gate-controlled semiconductor switch that cuts off applied voltage for most of ac cycle if generator idling. Switch "on" time increases when generator is in operation.

  19. Apuntes de Acústica

    Martín Domingo, Agustín

    2014-01-01

    Esta publicacion contiene unos apuntes para la parte de Acústica de las asignaturas de la ETSAM, junto con cierta cantidad de material adicional que excede el ámbito del curso. Aunque está lejos de ser completa y de estar libre de errores, el autor espera sea útil.

  20. SSTI Clark ACS Technology Demonstrations

    Freesland, Douglas

    1997-01-01

    SSTI Clark, one of two spacecraft built under NASA's Small Satellite Technology Initiative, includes seven ACS technology demonstrations. The technologies redefine the performance cost envelope, providing improved sensor and actuator performance at reduced costs. Six sensing technologies are being flown consisting of both hardware and algorithmic demonstrations: autonomous star tracker, hemispherical resonating gyro, GPS attitude determination, miniature horizon sensors, low cost course sun s...

  1. AcEST: BP916469 [AcEST

    Full Text Available 29 8.3 >sp|Q9M2L4|ACA11_ARATH Putative calcium-transporting ATPase 11, plasma membrane-type OS=Arabid...RRLQFPCEKVGSD 453 >sp|Q2QMX9|ACA1_ORYSJ Calcium-transporting ATPase 1, plasma membra...rting ATPase 11, plasma membrane-type OS=Arabidopsis thaliana Align length 91 Score (bit) 33.5 E-value 0.34 ...um-transporting ATPase 1, plasma membr... 31 2.2 sp|A8EZT5|DNLJ_RICCK DNA ligase OS=Ri...terized protein (Fragment) OS=Branchiostoma floridae GN=

  2. Development of ac corona discharge modes at atmospheric pressure

    Corona discharges in gases exist under several distinctive forms. In this paper, a survey study has been made of ac corona discharge modes generated in some different gases fed in a wire-duct reactor with a constant rate of flowing at atmospheric pressure. The properties of different corona modes are analyzed under some condition transitions from Trichel pulses to a steady glow. In the course of the presented experimental work, numerous apparent contradictions with earlier observations necessitated further study and are given to provide more information on the physical mechanisms of the ac corona discharges. Furthermore, we have gained insight into some new technologies and applications of the environmentally friendly corona and plasma discharges.

  3. AcEST: DK950895 [AcEST

    Full Text Available |A7SFA3|A7SFA3_NEMVE Predicted protein OS=Nematostella vectens... 210 5e-53 tr|Q0CVA9|Q0CVA9_ASPTN ATP-citrate synthase subunit...stX Result : Swiss-Prot sp_hit_id Q54YA0 Definition sp|Q54YA0|ACLY_DICDI Probable ATP-citrate synthase OS=Dictyos...PIDYSWAQELGLIRKPAAFISTI 404 >sp|Q8X097|ACL1_NEUCR Probable ATP-citrate synthase subunit 1 OS=Neurospora cras...IRKPASFMTSI 844 >sp|Q9P7W3|ACL1_SCHPO Probable ATP-citrate synthase subunit 1 OS=Schizosaccharomyces pombe G....done Score E Sequences producing significant alignments: (bits) Value sp|Q54YA0|ACLY_DICDI Probable ATP-citrate synthase OS=Dictyos

  4. Design study of an AC power supply system in JT-60SA

    In the initial research phase of JT-60SA, which is the International Thermonuclear Experimental Reactor (ITER) satellite Tokamak with superconducting toroidal and poloidal magnetic field coils, the plasma heating operation of 30 MW-60 s or 20 MW-100 s is planned for 5.5 MA single null divertor plasmas. To achieve this operation, AC power source of the medium voltage of 18 kV and ∼7 GJ has to be provided in total to the poloidal field coil power supplies and additional heating devices such as neutral beam injection (NBI) and electron cyclotron radio frequency (ECRF). In this paper, the proposed AC power supply system in JT-60SA was estimated from the view point of available power, and harmonic currents based on the standard plasma operation scenario during the initial research phase. This AC power supply system consists of the reused JT-60 power supply facilities including motor generators with flywheel, AC breakers, harmonic filters, etc., to make it cost effective. In addition, the conceptual design of the upgraded AC power supply system for the ultimate heating power of 41 MW-100 s in the extended research phase is also described.

  5. AcEST: BP914304 [AcEST

    Full Text Available IDEHTFVFTLRAC 4 V+ NA++ Y G+ E A++ + +M+ E++ + TF+ LRAC Sbjct: 670 VTWNAMICGYAHHGKGEEAIQLFERMILENIKPNHVTFISI...KSLRRDFVTWNAMICGYAHHGKGEEAIQLFERMILENIKPN 703 Query: 339 NLTYVSLFKACGNVLDFGQG-RTIHGEARANGFSSDRFICTTLI...TFVFTLRAC 4 +F + + V+ N ++ +YV A +++M + D TL+AC Sbjct: 484 QIFERMCDRDNVTWNTIIGSYVQDENESEAFDLFKRMNLCGIVSDGACL...K + A+Q+ + R + +W++MI++ +A + ++ M Sbjct: 93 LGNSLINFYSKFEDVASAEQVFRRMTLRDVVTWSSMIAAYAGNNHPAKAFDTFERMTDAN 152... + R + +W++MI++ +A + ++ M Sbjct: 93 LGNSLINFYSKFEDVASAEQVFRRMTLRDVVTWSSMIAAYAGNNHPAKAFDTFERM

  6. AcEST: BP911793 [AcEST

    Full Text Available + +VSWN +++ Y QHG + ++L+ M+AE T N + + A Sbjct: 58 EAKFVFERIQNKDVVSWNCIINGYSQHGPSGSSHVMELFQRMRAENTAPNAHTFAGVF... N + + A Sbjct: 58 EAKFVFERIQNKDVVSWNCIINGYSQHGPSGSSHVMELFQRMRAENTAPNAHTFAGVFTA 117 Query: 359 CIQTGNLELCKQM...D VT S+LSACSH G + +G YF Sbjct: 602 IIGGSAQHGRGQDALQLFERMKMEGVKPDIVTFVSLLSACSHAGLLEEGRRYF 654 Score = 115 bit...53 QTGNLELCKQMHFNIVSAGNELNPSLASSLIRTYGNCGSMLDAHAVFDSLPLPDIVSWNV 174 Q +E+ K++ F+++ N S +++I Y CG + +A +FD +P D VSW Sbjct: 324 QGERME... L+ M +E + I+LV +L AC+ TG+LE + +H Sbjct: 498 VITWNAMIASYVHCEQSEKAIALFDRMVSENFKPSSITLVTLLMACVNTGSLER

  7. AcEST: BP921649 [AcEST

    Full Text Available 40 + ++LV YAK L + ++ +P R W+ +I+ + + ++E AL+ + M+ G Sbjct: 144 VASSLVGMYAKFNLFENSLQVFDEMPERDVASWNTVISCFYQSGEAEKALELFGRME...LDCYKEM 52 ++L +GNALVD YAKCG L A ++ +R+ R V W+ +I Y + E A D +K M Sbjct: 461 KNLFVGNALVDMYAKCGALEDARQIFERMCDRDNVTWNTIIGSYVQDEN...RD+ WNA+I Sbjct: 237 LEQGKQIHCYAIRSG-IESDVLVVNGLVNMYAKCGNVNTAHKLFERMPIRDVASWNAIIG 295 Query: 411 GYVNHGRAEVALDCFGKME...SNDVV-GNALVNMYAKCGNVNSAYKLFERMPKKNVVAWNAIIS 396 Query: 411 GYVNHGRAEVALDCFGKME... HGR + AL F +M+ EG PD +TF +L AC G + + + + Sbjct: 603 IGGSAQHGRGQDALQLFERMKMEGVKPDIVTFVSLLSACSHAGLLEEGRRYFCSM

  8. AcEST: BP919669 [AcEST

    Full Text Available D + RDV SW ++S + + G+ ++F M G +P+ Sbjct: 148 LVGMYAKFNLFENSLQVFDEMPERDVASWNTVISCFYQSGEAEKALELFGRMESSGFEPN 20...+ +++AC L + +G+E+H + K+G EL V Sbjct: 190 EKALELFGRMESSGFEPNSVSLTVAISACSRLLWLERGKE...F Sbjct: 468 IY---VVNSLIDSYGKCSHVEDAERIFEECTIGDLVSFTSMITAYAQYGQGEEALKLFLE 524 Query: 226 MVGEGTKPDSISLLVVLRA-YNF...+ IR DV W +LMSGY+K D ++F ++ Sbjct: 44 SLINVYFTCKDHCSARHVFENFDIRSDVYIWNSLMSGYSKNSMFHDTLEVFKRLLNCSIC 103 Query: 208 KPDSISLLVVLRAYNF...KPD Sbjct: 261 VDMYAKCGCIETAVEVFEKLTRRNVFSWAALIGGYAAYGYAKKATTCLDRIEREDGIKPD 320 Query: 199 SISLLVVLRAYNFLGFP

  9. AcEST: DK957916 [AcEST

    Full Text Available PQKQPVPAVSHSPQKSSTPPTPAATKPKEEPSVPKEVPKLQQGKLEKT 967 Query: 577 --TTEASQGIPVEEG...G E+ P+ P Sbjct: 1974 QEQGRAPSQDQEAPSPEALPSPGQEPAAGASPRRGELRRGSSAESALPRAGP 2025 >sp|Q05175|BASP_RAT Brain ac... +P AP P Sbjct: 388 ERETAASAGPQG----AFPEPRPAQPSAGPEPRPAQPSAGPEPRPAQPSAAPEPRP---- 439 Query: 571 GQTTE... L ++ +A+ +E AP Sbjct: 406 IVTTPEPEGSGEEDVPKPDEIPEKEVTEEELIKVSTAAPAKASPEEEVVKATTLAPSEED 465 Query: 550 VSPYIASGQTTE... Query: 424 KGQAYEAIPDPHVDPAAGVHERLAQLQLGDEPEATKPKEAPG-VSPYI--ASGQTTEASQ 594 K A E P + + G E + E EA P A G +P

  10. AcEST: DK956923 [AcEST

    Full Text Available CCATAGTCTCAA CAGCGATAAGCAGGAAATGCATGCAGTGACCATGGGTAAGAAAAGGGTCATGGTGGGCGC CATTAACACGATACTTATCCTA...CTCCTCTTGCAGTTTATGAAGCAATGTTCTTCCTCTTC TAGTCATGATGATGATGGCGATGCCTTTGCGGATGACACTCTAAGCAGACGCAACGAT...AC GGTCGAGTCTGCTCCTCGACATTGGCCAAGGCGAATGCTGGGCAGCCAAGAACCTGCCTC CAACAAGACTTCATATGGTATTCCTGAT...H At1g73965 (CLE13 / CLAVATA3/ESR-Related 13) (CLE13) OS=Arabidopsis thaliana Align length 25 Sco...icant alignments: (bits) Value tr|Q6NMF0|Q6NMF0_ARATH At1g73965 (CLE13 / CLAVATA3/ESR-Related 1... 49 3e-04

  11. AcEST: BP921492 [AcEST

    Full Text Available + AL +G+ +H Sbjct: 286 DVASWNAIIGGYSLNSQHHEALAFFNRMQVRGIKPNSITMVSVLPACAHLFAL... ++ L +GK +H Sbjct: 178 NLVSWTAMVSGYAQGGFADEALRMFYEMQGEDVKANYVTVASVLPACAQLSDLQQGKEIH 237 Query: 153 AC...FDRMPEK 171 Query: 333 DVVSWSAMIAMYGQQGCGKEAFQLFQEMACEGGMPNRVTYVSILDACASVAALPEGKLVH 154 +V+W+++++ + Q G EA Q+F +M G P+ T+VS+L ACA...333 DVVSWSAMIAMYGQQGCGKEAFQLFQEMACE-GGMPNRVTYVSILDACASVAALPEGKLV 157 +V +W+AMI+ YG G G++A +LF +M + G +PN VT+V++L ACA...SKL 85 Query: 288 GCGKEAFQLFQEMACEGGMPNRVTYVSILDACASVAALPEGKLVHACFMESELELDVVVG 109 ++ M P+ T+ S++ +CA ++AL G

  12. Some consideration on the potentially of the relaxation discharge use for plasma technological processes

    We generated relaxation discharges in different gases using both dc and ac (50 Hz) supplying sources. We followed spectroscopically the plasma behavior in dc discharges, ac discharges and combinations of these discharges with relaxation ones in dichlorodifluoromethane and carbon tetrafluoride gases, mostly used in plasma etching technologies at pressures of around 0.1 torr

  13. Pregnancy-associated plasma protein-A and the vulnerable plaque

    Jespersen, Camilla H B; Vestergaard, Kirstine R; Schou, Morten;

    2014-01-01

    For more than a decade, pregnancy-associated plasma protein-A (PAPP-A) has been examined for its relation to acute coronary syndrome (ACS) and the vulnerable plaque. This review summarizes the current knowledge of plasma PAPP-A in relation to nonpregnant individuals focusing on patients with ACS...

  14. Electric field in an AC dielectric barrier discharge overlapped with a nanosecond pulse discharge

    Goldberg, Benjamin M.; Shkurenkov, Ivan; Adamovich, Igor V.; Lempert, Walter R.

    2016-08-01

    The effect of ns discharge pulses on the AC barrier discharge in hydrogen in plane-to-plane geometry is studied using time-resolved measurements of the electric field in the plasma. The AC discharge was operated at a pressure of 300 Torr at frequencies of 500 and 1750 Hz, with ns pulses generated when the AC voltage was near zero. The electric field vector is measured by ps four-wave mixing technique, which generates coherent IR signal proportional to the square of electric field. Absolute calibration was done using an electrostatic (sub-breakdown) field applied to the discharge electrodes, when no plasma was generated. The results are compared with one-dimensional kinetic modeling of the AC discharge and the nanosecond pulse discharge, predicting behavior of both individual micro-discharges and their cumulative effect on the electric field distribution in the electrode gap, using stochastic averaging based on the experimental micro-discharge temporal probability distribution during the AC period. Time evolution of the electric field in the AC discharge without ns pulses, controlled by a superposition of random micro-discharges, exhibits a nearly ‘flat top’ distribution with the maximum near breakdown threshold, reproduced quite well by kinetic modeling. Adding ns pulse discharges on top of the AC voltage waveform changes the AC discharge behavior in a dramatic way, inducing transition from random micro-discharges to a more regular, near-1D discharge. In this case, reproducible volumetric AC breakdown is produced at a well-defined moment after each ns pulse discharge. During the reproducible AC breakdown, the electric field in the plasma exhibits a sudden drop, which coincides in time with a well-defined current pulse. This trend is also predicted by the kinetic model. Analysis of kinetic modeling predictions shows that this effect is caused by large-volume ionization and neutralization of surface charges on the dielectrics by ns discharge pulses. The present

  15. Plasma pyrolysis of toxic waste

    Rutberg, Ph G.

    2003-06-01

    The comparison of technical economic indexes of different waste treatment methods and plasma pyrolysis is presented in the paper. It testifies that plasma technologies are economically expedient for these purposes. Physical prerequisites allowing realizing plasma technologies are presented. Reliable and economical (70-120 Euro per ton of treated product) plasma generation is the basic condition of the technology realization. In this connection, various types of powerful generators of dense plasma (plasmatrons) in the range from 100 kW to 3 MW and temperature of plasma jets from 2000 to 10 000 K, and also physical processes taking place in electric-discharge chambers are examined. Differences between AC and DC electric arc plasma generators are analysed. Temperature in arcs of plasma generators varies from 6000 to 20 000 K, electron concentration is ne~(1014-1019 cm-3). Specific ware of electrodes in various types of plasma generators intended for long-time operation modes is (10-7-10-4) g C-1. Physicochemical processes in plasma reactors intended for waste treatment and pyrolysis are described. Different types of technological processes on plasma treatment and pyrolysis of waste are analysed. Estimation of present situation of physical investigations and technological developments in this area and predictions for nearest future are included. This article was scheduled to appear in issue 5 of Plasma Phys. Control. Fusion. To access this Special issue please follow this link: http://www.iop.org/EJ/toc/0741-3335/45/5

  16. Performance of AC/graphite capacitors at high weight ratios of AC/graphite

    Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)

    2008-03-01

    The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)

  17. Simultaneous distribution of AC and DC power

    Polese, Luigi Gentile

    2015-09-15

    A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.

  18. A plasma-arc pyrolysis system for hazardous waste treatment

    2008-01-01

    @@ A laboratory system for the treatment of medical and hazardous wastes via AC plasma-arc pyrolysis was recently built up by a research team led by Prof. SHENG Hongzhi at the CAS Institute of Mechanics (IMECH) in Beijing.

  19. Atmospheric pressure plasmas for aerosols processes in materials and environment

    Borra, J.P.; Jidenko, N; Bourgeois, E

    2009-01-01

    Abstract The paper highlights applications of some atmospheric pressure plasmas (dc-corona, streamer and spark and ac-Dielectric Barrier Discharges) to aerosol processes for Materials and Environment (filtration, diagnostics). The production of vapor i.e. condensable gaseous species, leads to nano-sized particles by physical and chemical routes of nucleation in these AP plasmas: (i) when dc streamer and spark filamentary discharges as well as ac filamenta...

  20. Charge dependence of the plasma travel length in atmospheric-pressure plasma

    Yambe, Kiyoyuki; Konda, Kohmei; Masuda, Seiya

    2016-06-01

    Plasma plume is generated using a quartz tube, helium gas, and foil electrode by applying AC high voltage under the atmosphere. The plasma plume is released into the atmosphere from inside of the quartz tube and is seen as the continuous movement of the plasma bullet. The travel length of plasma bullet is defined from plasma energy and force due to electric field. The drift velocity of plasma bullet has the upper limit under atmospheric-pressure because the drift velocity is determined from the balance between electric field and resistive force due to collisions between plasma and air. The plasma plume charge depends on the drift velocity. Consequently, in the laminar flow of helium gas flow state, the travel length of the plasma plume logarithmically depends on the plasma plume charge which changes with both the electric field and the resistive force.

  1. Plasma pyrolysis of toxic waste

    The comparison of technical economic indexes of different waste treatment methods and plasma pyrolysis is presented in the paper. It testifies that plasma technologies are economically expedient for these purposes. Physical prerequisites allowing realizing plasma technologies are presented. Reliable and economical (70-120 Euro per ton of treated product) plasma generation is the basic condition of the technology realization. In this connection, various types of powerful generators of dense plasma (plasmatrons) in the range from 100 kW to 3 MW and temperature of plasma jets from 2000 to 10 000 K, and also physical processes taking place in electric-discharge chambers are examined. Differences between AC and DC electric arc plasma generators are analysed. Temperature in arcs of plasma generators varies from 6000 to 20,000 K, electron concentration is ne ∼ (1014-1019 cm-3). Specific ware of electrodes in various types of plasma generators intended for long-time operation modes is (10-7-10-4) g C-1. Physicochemical processes in plasma reactors intended for waste treatment and pyrolysis are described. Different types of technological processes on plasma treatment and pyrolysis of waste are analysed. Estimation of present situation of physical investigations and technological developments in this area and predictions for nearest future are included

  2. AcEST: BP919581 [AcEST

    Full Text Available 795_NEOFI Integral plasma membrane protein, putativ... 34 4.0 tr|B3CPY1|B3CPY1_WOLPP Peptidyl-prolyl cis-trans isomers...B6Y8R1_9RICK Peptidyl-prolyl cis-trans isomerse D, put... 34 5.3 tr|B8M758|B8M758_9EURO Integral plasma memb

  3. AcEST: DK954798 [AcEST

    Full Text Available TST39A01NGRL0021_G12 588 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0021_G12. 5' end seq ... 6_SALBI Plasma membrane major intrinsic protein OS=Salicornia ... bigelovii Align length 141 Score (bit) 211.0 E-val ... 6_SALBI Plasma membrane major intrinsic protein OS=Salicornia ... bigelovii GN=PIP1 PE=2 SV=1 Length = 285 Score = 2 ...

  4. Review of some research work on surface modification and polymerizations by non-equilibrium plasma in Turkey

    Non equilibrium plasma studies in Turkey can be considered as organized on two different lines: surface modification studies and plasma polymerization studies. Plasma surface modification studies: In different laboratories in Turkey the modification of materials' surfaces by plasma covers a wide spectra, for example: fibers (Carbon (CF) and polyacrylonitrile (PAN)), fabrics (PET/Cotton and PET/PA), biomaterials-food oriented (PU), denture Acrylic matrix, plasmochemical modification of a (PE and PP) film surface by several selected silicon and tin containing monomers, polymer blends and composites, recycled rubber and epoxy systems, etc. Plasma polymerization studies: This topic is accomplished by a great number of projects, for instance: plasma initiation polymerization and copolymerization of Styrene and MMA, Plasma-initiated polymerizations of Acrylamide (AA), kinetics of polymer deposition of several selected saturated hydrocarbons, silanization treatments by hexamethyldisilazane (HDMS), Plasma initiated polymerization (PIP) of allyl alcohol and 1-propano, (PSP) and (PIP) studies related to activated charcoal are done to explore their applications in haemoperfusion, an amperometric alcohol single-layer electrode is prepared by (EDA) plasma polymerization, preparation of mass sensitive immuno sensors and single layer multi enzyme electrodes by plasma polymerisation technique, etc

  5. AcEST: DK948526 [AcEST

    Full Text Available TST38A01NGRL0003_I19 675 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0003_I19. 5' end seq ... IAMVRTTTPVYV 214 Query: 542 ALALFNQARVSSLPIIDDNGSLIDIY ARSDITALARDDTY 661 AL +F Q RVS+LP++D+ G ++DIY ++ D+ ... LA + TY Sbjct: 215 ALGIFVQHRVSALPVVDEKGRVVDIY SKFDVINLAAEKTY 254 >sp|Q09138|AAKG1_PIG 5'-AMP-acti ... IAMVRTTTPVYV 215 Query: 542 ALALFNQARVSSLPIIDDNGSLIDIY ARSDITALARDDTY 661 AL +F Q RVS+LP++D+ G ++DIY ++ D+ ... LA + TY Sbjct: 216 ALGIFVQHRVSALPVVDEKGRVVDIY SKFDVINLAAEKTY 255 >sp|O54950|AAKG1_MOUSE 5'-AMP-ac ...

  6. AcEST: DK962916 [AcEST

    Full Text Available TST39A01NGRL0015_C06 596 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0015_C06. 5' end seq ... NA. clone: TST39A01NGRL0015_C06. 5' end sequence. Acce ssion DK962916 Tissue type prothallia with plantlet ... 2 Query: 317 MPKSKEPCSQEACDIQTCLVKNNFITERCFPVIEALQACCE K 442 MP+ K+PC ++AC+IQ CL NN++ +C VI+ L+ CC + Sbjct ... me = +2 Query: 335 PCSQEACDIQTCLVKNNFITERCFPVIEALQACCE K 442 PC +EAC IQ CL+ + + +C VI+ L CC K Sbjct: 4 PCQ ... = +2 Query: 326 SKEPCSQEACDIQTCLVKNNFITERCFPVIEALQACCE KCNSK 454 + E C+ CD +TC +K F +C AL CCE KC K Sbjct: 4 ...

  7. AcEST: DK955705 [AcEST

    Full Text Available TST39A01NGRL0023_N02 635 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0023_N02. 5' end seq ... NA. clone: TST39A01NGRL0023_N02. 5' end sequence. Acce ssion DK955705 Tissue type prothallia with plantlet ... 2 Query: 296 MPKSKEPCSQEACDIQTCLVKNNFITERCFPVIEALQACCE K 421 MP+ K+PC ++AC+IQ CL NN++ +C VI+ L+ CC + Sbjct ... me = +2 Query: 314 PCSQEACDIQTCLVKNNFITERCFPVIEALQACCE K 421 PC +EAC IQ CL+ + + +C VI+ L CC K Sbjct: 4 PCQ ... = +2 Query: 305 SKEPCSQEACDIQTCLVKNNFITERCFPVIEALQACCE KCNSK 433 + E C+ CD +TC +K F +C AL CCE KC K Sbjct: 4 ...

  8. AcEST: DK961330 [AcEST

    Full Text Available FWVPCMHTPIKQEKHTHA 405 +AR P W +++PI+ ++C++ P + AK+ PL DVTH+F+V + +QE Sbjct: 61 VARRTRP-SWHEDNPINYVQCDISDPDD...+IL +D PGGPWKVYG Sbjct: 4 WWAGAIGAAKKKLEEDDAPPKHS---SVALIVGVTGIIGNSLAEILPLADTPGGP...AWHEDNPINYIQCDISDPDDSLAKLSPLTDVTHVFYVTCANR--STEPENCE 117 Query: 406 MATHMFENIIGVLLTHAPNLQHVCMQTSDKHY-... : Swiss-Prot sp_hit_id Q7MXT7 Definition sp|Q7MXT7|LPXD_PORGI UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac...lue sp|Q7MXT7|LPXD_PORGI UDP-3-O-[3-hydroxymyristoyl] glucosamine N-... 34 0.62 sp|P60369|KR103_HUMAN Kerati

  9. AcEST: BP913772 [AcEST

    Full Text Available N VT V L C+ G G+ H Sbjct: 350 NVVTWSAVIAGYAQRGLGFEALDVFRQMRLCGSEPNVVTLVSLLSGCALAGTLLHGKETH 409 Query: 376 IEIER--RGLLEVDP-...VFNKLSVQDIVSW 236 + + A ++G+++H I RRGL + PV+ + LV MY R G L Q VF+++ +D+VSW Sbjct: 296 ASLAALEQGKLIHGYILRRGLDSILPVI-S... TF M+ +PN+VT V VL+AC+ + Q + Sbjct: 250 SWSAMIACYAKNGKAFEALRTFREMMRETKDSSPNSVTMVSVLQACASLA...MIEGGVAPNAVTFVVVLRACSQTGSYSQSQTFFEAMSKNF 50 + G A G + F+ M + GV PNAVTFV VLR CS G + Q F++M F Sbjct: 312 ALNGLAMNGFGEKCLELFSL...L YA G + + +F++ D+ +TA + + Sbjct: 48 IHAAILRHNLLLHPRYPVLNLKLHRAYASHGKIRHSLALFHQTIDP

  10. AcEST: DK952954 [AcEST

    Full Text Available TST38A01NGRL0015_H21 616 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0015_H21. 5' end seq ... LIHAHIVCSCNDVDNFVRSTLVNLYSKCGSIEDAHNVFAKLATRRSVDWSMMIS ... 541 ++ Q K +HA I + D + V + L+++Y+KCGSI DA F +++T+ ... LIHAHIVCSCNDVDNFVRSTLVNLYSKCGSIEDAHNVFAKLATRRSVDWSMMIS GS 547 + + IHA S D ++ LV LYS+CG IE+++ F + ++ W+ ++S ... LIHAHIVCSCNDVDNFVRSTLVNLYSKCGSIEDAHNVFAKLATRRSVDWSMMIS ... 541 DL + IH+ I+ + ++ +V S L+++Y+K G ++ A ++ + A + ... EA+ LF +M G+ P + + L AC Sbjct: 243 RVFDGLRLKDHSSWVAMIS GLSKNECEAEAIRLFCDMYVLGIMPTPYAFSSVLSACKKIE 302 Query ...

  11. AcEST: BP912540 [AcEST

    Full Text Available YMU001_000020_B03 501 Adiantum capillus-veneris mRNA. clone: YMU001_000020_B03. BP912540 - Show ... 2 EELTVHHTASVGDVEALKALLAEGADKDEKDSEGRTALHFACGYGEVMCAE VLLEAGVAV 181 EE VH TAS+GDVE LKA LA G +KDE+DSEGRTAL ... ry: 14 VHHTASVGDVEALKALLAEGADKDEKDSEGRTALHFACGYGEVMCAE VLLEAGVAVDAVD 193 +H A V ++ LL GAD KD G LH AC YG AE ... uery: 26 ASVGDVEALKALLAEGADKDEKDSEGR--TALHFACGYGEVMCAE VLLEAGVAVDAVDKN 199 + GD+E +K L + + + +D EGR T LHFA ... ry: 14 VHHTASVGDVEALKALLAEGADKDEKDSEGRTALHFACGYGEVMCAE VLLEAGVAVDAVD 193 +H A ++E + LL GAD + +D G LH A YG ...

  12. Speed Control of DC Motor using AC/AC/DC Converter Based on Intelligent Techniques

    Rakan Kh Antar

    2013-01-01

       This paper describes the application of ac/ac/dc and ac/dc converters to control the speed of a separately excited DC motor. Artificial neural network and PI controller are trained to select the desired values of firing angles for triggering thyristors of the ac/ac/dc and ac/dc bridge converters in order to control the speed of the dc motor at a desired value with constant and different load torques in order to obtain the best speed response. Simulation results show that the rising time fo...

  13. Universality of ac conduction in disordered solids

    Dyre, Jeppe; Schrøder, Thomas

    2000-01-01

    non-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally......The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual...

  14. Plasma theory

    A series of lectures on plasma theory with the main headings: introduction; charged particles moving in em fields; the liquid model; transport phenomena in the plasma; wave propagation in plasmas; plasma instabilities. 57 figs. (qui)

  15. Plasma Modeling of Electrosurgery

    Jensen, Scott; Friedrichs, Daniel; Gilbert, James; Park, Wounjhang; Maksimovic, Dragan

    2014-10-01

    Electrosurgery is the use of high frequency alternating current (AC) to illicit a clinical response in tissue, such as cutting or cauterization. Power electronics converters have been demonstrated to generate the necessary output voltage and current for electrosurgery. The design goal of the converter is to regulate output power while supplying high frequency AC. The design is complicated by fast current and voltage transients that occur when the current travels through air in the form of an arc. To assist in designing a converter that maintains the desired output power during these transients, we have used the COMSOL Plasma Module to determine the output voltage and current characteristics during an arc. This plasma model, used in conjunction with linear circuit elements, allows the full electrosurgical system to be validated. Two models have been tested with the COMSOL Plasma Module. One is a four-species, four-reaction model based on the local field approximation technique. The second simulates the underlying air chemistry using 30 species, 151 chemical reactions, and a coupled electron energy distribution function. Experimental output voltage and current samples have been collected and compared to both models.

  16. Short term dynamic aperture with AC dipoles

    Mönig, Saskia; Persson, Tobias Hakan Bjorn; Coello De Portugal, Jaime; Langner, Andy; Tomas, Rogelio; CERN. Geneva. ATS Department

    2015-01-01

    The dynamic aperture of an accelerator is determined by its non-linear components and errors. Control of the dynamic aperture is important for a good understanding and operation of the accelerator. The AC dipole, installed in the LHC for the diagnostic of linear and non-linear optics, could serve as a tool for the determination of the dynamic aperture. However, since the AC dipole itself modifies the non-linear dynamics, the dynamic aperture with and without AC dipole are expected to differ. The effect of the AC dipole on the dynamic aperture is studied within this note.

  17. ac electroosmosis in rectangular microchannels.

    Campisi, Michele; Accoto, Dino; Dario, Paolo

    2005-11-22

    Motivated by the growing interest in ac electroosmosis as a reliable no moving parts strategy to control fluid motion in microfluidic devices for biomedical applications, such as lab-on-a-chip, we study transient and steady-state electrokinetic phenomena (electroosmosis and streaming currents) in infinitely extended rectangular charged microchannels. With the aid of Fourier series and Laplace transforms we provide a general formal solution of the problem, which is used to study the time-dependent response to sudden ac applied voltage differences in case of finite electric double layer. The Debye-Huckel approximation has been adopted to allow for an algebraic solution of the Poisson-Boltzmann problem in Fourier space. We obtain the expressions of flow velocity profiles, flow rates, streaming currents, as well as expressions of the complex hydraulic and electrokinetic conductances. We analyze in detail the dependence of the electrokinetic conductance on the extension of linear dimensions relative to the Debye length, with an eye on finite electric double layer effects. PMID:16351310

  18. DESARROLLO RURAL A.C.

    Alfredo Aguilar Valdés

    2015-01-01

    Full Text Available El objetivo de este trabajo fue analizar el diagnostico situacional de una Empresa de Servicios Profesionales en el caso de: Instituto de Promoción Para el Desarrollo Rural A.C., a través de la Metodología “UALAE” así como la oportunidad que como empresa presenta. Este estudio se realizó en el municipio de Saltillo, Coahuila, México. Adoptó esta Metodología UALAE y se difundió su opinión. El Instituto de Promoción Para el Desarrollo Rural A.C., está formado por profesionistas y productores cuya finalidad es la de contribuir al desarrollo del medio rural con proyectos de viabilidad técnica, económica y social, sobre la base de necesidades reales y al aprovechamiento sustentable del potencial de los recursos naturales. Su buen funcionamiento es indispensable e importante para el desarrollo de los productores agropecuarios principalmente, debido a que se ven muy beneficiados con todos los servicios que se les brinda, se han logrado buenos proyectos, buenas capacitaciones y un gran crecimiento de sus productos. Mediante el proceso de asistencia técnica a organizaciones de productores, se induce la formulación adecuada de proyectos viables desde el punto visto del mercado, la rentabilidad económica, las tecnologías disponibles y de la organización social.

  19. AcEST: BP920845 [AcEST

    Full Text Available 45|Adiantum capillus-veneris mRNA, clone: YMU001_000142_D08. (514 letters) Database: uniprot_sprot.fasta 412,525 seq...P7 OS=Magnapor... 33 1.0 sp|Q7VF68|SYH_HELHP Histidyl-tRNA synthetase OS=Helicobacter hep... 31 3.8 sp|P1305...90 FTGFLVLHSEPRQQPQVDL 1608 >sp|A4QX49|DBP7_MAGGR ATP-dependent RNA helicase DBP7 OS=Magnaporthe grise...T PT VT+H + T+ AC+ A+TT+ H H Sbjct: 481 PPKETKPTK------PVTNHTESTVGKACYITSAANTTITLHKLH 519 >sp|Q7VF68|SYH_HELHP His...rot_trembl.fasta 7,341,751 sequences; 2,391,615,440 total letters Searching.................................

  20. AcEST: DK960083 [AcEST

    Full Text Available ome P450 71D7 OS=Solanum chacoense ... 96 1e-19 sp|Q9SAB6|C71AI_ARATH Cytochrome ...... 96 2e-19 sp|P93530|C71D6_SOLCH Cytochrome P450 71D6 OS=Solanum chacoense ... 94 5e-19 sp|Q9T0K2|C71AK_AR... paten... 176 1e-42 tr|Q9AXP9|Q9AXP9_POPJC Cinnamate 4-hydroxylase OS=Populus jackii... 176 2e-42 tr|Q40907|Q40907_POPKI Cinnamic ac...8 KVVQQSRGAWEDEALRVIQDLKA 160 >tr|Q9AXP9|Q9AXP9_POPJC Cinnamate 4-hydroxylase OS=Populus jackii GN=C4H PE=2 ...e-42 tr|A9PBZ7|A9PBZ7_POPTR Putative uncharacterized protein OS=Popul... 176 2e-4

  1. AcEST: DK955376 [AcEST

    Full Text Available TST39A01NGRL0022_O23 611 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0022_O23. 5' end seq ... LMDETRAAGIKL 210 Query: 602 AIC 610 A+C Sbjct: 211 AVC ... 213 >tr|A9SM81|A9SM81_PHYPA Predicted protein OS=P ... C 610 VLELMD A+ KGLKVA+C Sbjct: 196 VLELMDAAREKGLKVAVC ... 213 >tr|Q8L7U1|Q8L7U1_ARATH AT4g39970/T5J17_140 OS ... LKVAIC 610 LMDEA+A G K+A+C Sbjct: 182 RLMDEAKAAGKKLAVC ... 197 >tr|Q680K2|Q680K2_ARATH MRNA, complete cds, cl ... LKVAIC 610 LMDEA+A G K+A+C Sbjct: 182 RLMDEAKAAGKKLAVC ... 197 >tr|Q8LAS1|Q8LAS1_ARATH Putative uncharacteriz ...

  2. AcEST: BP913416 [AcEST

    Full Text Available GCATGTAGTTTGGA CAGAGATG ■■Homology search results ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swi...AC_BACFN Uronate isomerase OS=Bacteroides fragilis (... 30 4.5 sp|Q3ITT7|SYA_NATPD Alanyl-tRNA synthetase OS=Natronomonas phar...C++ N IP+ M C Sbjct: 417 LSYPRHEYFRRTLCNLLGCDVENGEIPLSEMERVC 451 >sp|Q3ITT7|SYA_NATPD Alanyl-tRNA synthetase OS=Natronomonas phar...ng, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database searc...148,809,765 total letters Searching..................................................done Score E Sequences

  3. AcEST: DK947388 [AcEST

    Full Text Available Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Ac...ids Res. 25:3389-3402. Query= DK947388|Adiantum capillus-veneris mRNA, clone: YMU02A01NGRL0015_L18, 5' (587 letters) Databa... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK947388|Adiantum c...apillus-veneris mRNA, clone: YMU02A01NGRL0015_L18, 5' (587 letters) Database: uniprot_trembl.fasta...-ribosylation factor 1 OS=Salix bakko GN... 268 1e-71 sp|P49076|ARF_MAIZE ADP-ribosylation factor OS=Zea may

  4. AcEST: BP916217 [AcEST

    Full Text Available inase kinase 7-interacting protein 3 OS=Mus musculus Align length 119 Score (bit) 35.0 E-value 0.16 Report B...visiae GN... 30 6.8 >sp|Q571K4|TAB3_MOUSE Mitogen-activated protein kinase kinase kinase 7-interacting protein 3 OS=Mus musculus...protein kinase kinase kinase 7 interacting protein 3 OS=Mus musculus GN=Map3k7ip3 PE=2 SV=1 Length = 716 Sco...(3)malignant brain tumor-like 2 prot... 31 2.3 sp|P33234|ADIY_ECOLI HTH-type transcriptional regulator adiY ...ZZC3_PSEU2 Membrane protein, putative OS=Pseudomonas... 35 2.5 tr|Q5U7D5|Q5U7D5_9BACI OpuAC OS=Halobacillus trueperi GN=opu

  5. AcEST: DK953324 [AcEST

    Full Text Available |LSRR_PHOLL Transcriptional regulator lsrR OS=Photorhab... 30 6.1 sp|A0JY64|ATPB_ARTS2 ATP synthase subunit beta OS=Arthroba...cter s... 30 6.1 sp|A1R7V3|ATPB_ARTAT ATP synthase subunit beta OS=Arthroba...ATP synthase subunit beta OS=Arthrobacter sp. (strain FB24) GN=atpD PE=3 SV=1 Len...KD 372 Query: 311 HLHFTHRGKQRL 346 H + R KQ L Sbjct: 373 HYNTAVRVKQIL 384 >sp|A1R7V3|ATPB_ARTAT ATP synthase subunit beta OS=Arthroba...T and PSI-BLAST: a new generation of protein database search programs, Nucleic Ac

  6. AcEST: DK945049 [AcEST

    Full Text Available R 148 >sp|Q9X5X3|ATCU_SINMW Copper-transporting P-type ATPase OS=Sinorhizobium medicae (strain WSM419) GN=ac...|Q4EPP8|Q4EPP8_LISMO Heavy metal-binding protein OS=Listeria m... 34 3.2 tr|A6AST1|A6AST1_VIBHA Copper-trans..... 31 2.7 sp|Q4X0S7|DPH1_ASPFU Diphthamide biosynthesis protein 1 OS=Asper... 30 4.5 sp|A2VDJ0|T131L_HUMAN Transmembran...P58342|ATCU2_RHIME Copper-transporting ATPase 2 OS=Rhizobium meliloti Align length 75 Score (bit) 34.7 E-val...sophila ... 30 7.8 >sp|P58342|ATCU2_RHIME Copper-transporting ATPase 2 OS=Rhizobium me

  7. Numerical Simulation of the Discharge Efficiency in Five-electrode AC PDP

    何锋; 李永东; 刘纯亮; 孙鉴

    2004-01-01

    A new type of AC PDP (alternating current plasma display panel) cell with a fiveelectrode structure is developed to improve the luminous efficiency of AC PDP. The discharge efficiency of this new cell structure is investigated by a 2D fluid simulation. Continuity equations and flux density equations for charged particles and excited atoms, energy balance equation for electrons are included in the model. The discharge gas is He+5%Xe. The reactions of ionization,excitation, recombination, and radiation are taken into account. The vacuum ultraviolet radiation efficiency of the five-electrode cell structure is about 20% higher than that of a conventional three-electrode cell structure.

  8. AcEST: DK958302 [AcEST

    Full Text Available TST39A01NGRL0030_K09 519 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0030_K09. 5' end seq ... 6_SALBI Plasma membrane major intrinsic protein OS=Salicornia ... bigelovii GN=PIP1 PE=2 SV=1 Length = 285 Score = 1 ...

  9. AcEST: DK958632 [AcEST

    Full Text Available TST39A01NGRL0002_I07 714 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0002_I07. 5' end seq ... 6_SALBI Plasma membrane major intrinsic protein OS=Salicornia ... bigelovii GN=PIP1 PE=2 SV=1 Length = 285 Score = 3 ...

  10. Versatile roles of V-ATPases accessory subunit Ac45 in osteoclast formation and function.

    An Qin

    Full Text Available Vacuolar-type H(+-ATPases (V-ATPases are macromolecular proton pumps that acidify intracellular cargos and deliver protons across the plasma membrane of a variety of specialized cells, including bone-resorbing osteoclasts. Extracellular acidification is crucial for osteoclastic bone resorption, a process that initiates the dissolution of mineralized bone matrix. While the importance of V-ATPases in osteoclastic resorptive function is well-defined, whether V-ATPases facilitate additional aspects of osteoclast function and/or formation remains largely obscure. Here we report that the V-ATPase accessory subunit Ac45 participates in both osteoclast formation and function. Using a siRNA-based approach, we show that targeted suppression of Ac45 impairs intracellular acidification and endocytosis, both are prerequisite for osteoclastic bone resorptive function in vitro. Interestingly, we find that knockdown of Ac45 also attenuates osteoclastogenesis owing to a reduced fusion capacity of osteoclastic precursor cells. Finally, in an effort to gain more detailed insights into the functional role of Ac45 in osteoclasts, we attempted to generate osteoclast-specific Ac45 conditional knockout mice using a Cathepsin K-Cre-LoxP system. Surprisingly, however, insertion of the neomycin cassette in the Ac45-Flox(Neo mice resulted in marked disturbances in CNS development and ensuing embryonic lethality thus precluding functional assessment of Ac45 in osteoclasts and peripheral bone tissues. Based on these unexpected findings we propose that, in addition to its canonical function in V-ATPase-mediated acidification, Ac45 plays versatile roles during osteoclast formation and function.

  11. Assembly of 1D, 2D and 3D lanthanum(iii) coordination polymers with perchlorinated benzenedicarboxylates: positional isomeric effect, structural transformation and ring-opening polymerisation of glycolide.

    Chen, Sheng-Chun; Dai, An-Qi; Huang, Kun-Lin; Zhang, Zhi-Hui; Cui, Ai-Jun; He, Ming-Yang; Chen, Qun

    2016-02-28

    Utilizing a series of positional isomers of tetrachlorinated benzenedicarboxylic acid ligands, seven La(iii)-based coordination polymers were solvothermally synthesized and structurally characterized. Their structural dimensionalities varying from 1D double chains, to the 2D 3,4,5-connected network, to 3D 6-connected pcu topological nets are only governed by the positions of carboxyl groups on the tetrachlorinated benzene ring. A comprehensive analysis and comparison reveals that the size of the carbonyl solvent molecules (DMF, DEF, DMA, and NMP) can affect the coordination geometries around the La(iii) ions, the coordination modes of carboxylate groups, the packing arrangements, and the void volumes of the overall crystal lattices. One as-synthesized framework further shows an unprecedented structural transformation from a 3D 6-connected network to a 3D 4,5-connected net through the dissolution and reformation pathway in water, suggesting that these easily hydrolyzed lanthanide complexes may serve as precursors to produce new high-dimensional frameworks. The bulk solvent-free melt polymerisation of glycolide utilizing these La(iii) complexes as initiators has been reported herein for the first time. All complexes were found to promote the polymerization of glycolide over a temperature range of 200 to 220 °C, producing poly(glycolic acid) (PGA) with a molecular weight up to 93,280. Under the same experimental conditions, the different catalytic activities for these complexes may result from their structural discrepancy. PMID:26811117

  12. ISTTOK upgrade towards AC and remote operation

    ISTTOK has performed one of the earliest experiments of AC tokamak operation showing that long discharges could be produced merely with inductive current drive. However, due to the design of the machine, the data acquisition system and the power supplies, a limit of 250 ms (six times the nominal forward shot duration) is currently imposed.In this paper the relevant constrains to attain current operation up to the limit of the stable toroidal magnetic field (3s) are discussed and the work being carried out to achieve this goal is presented.The conditions that shall be accomplished are: (i) removing the power deposited on the limiters; (ii) density control through gas puffing and monitoring the recycling from the walls; (iii) assessment of the free magnetic flux available on the iron core (Wmax=0.2 Vs); (iv) reformulation of the data acquisition system towards an event driven philosophy maintaining the actual distributed architecture but allowing a real-time control; (v) active control of the equilibrium magnetic fields implementing a digital plasma position estimator and actuator through new power supplies for the poloidal magnetic fields. As a new high level software was needed to implement all this features, the ISTTOK data acquisition system and control has been totally redesigned in JAVA/SQL database technology and time stamps events were adopted to catalogue the data. This software has been design keeping in mind the needs for remote participation and operation of the machine. Therefore, a cooperative environment has been implemented where several persons can be connected together to the platform, programming their own devices and exchanging knowledge or opinions through an embedded chat

  13. ISTTOK upgrade towards AC and remote operation

    Fernandes, H.; Silva, C.; Carvalho, B.; Sousa, J.; Valcárcel, D.; Neto, A.; Fortunato, J.; Carvalho, I.; Varandas, C. A. F.

    2006-12-01

    ISTTOK has performed one of the earliest experiments of AC tokamak operation showing that long discharges could be produced merely with inductive current drive. However, due to the design of the machine, the data acquisition system and the power supplies, a limit of 250 ms (six times the nominal forward shot duration) is currently imposed. In this paper the relevant constrains to attain current operation up to the limit of the stable toroidal magnetic field (3s) are discussed and the work being carried out to achieve this goal is presented. The conditions that shall be accomplished are: (i) removing the power deposited on the limiters; (ii) density control through gas puffing and monitoring the recycling from the walls; (iii) assessment of the free magnetic flux available on the iron core (Wmax=0.2 Vs); (iv) reformulation of the data acquisition system towards an event driven philosophy maintaining the actual distributed architecture but allowing a real-time control; (v) active control of the equilibrium magnetic fields implementing a digital plasma position estimator and actuator through new power supplies for the poloidal magnetic fields. As a new high level software was needed to implement all this features, the ISTTOK data acquisition system and control has been totally redesigned in JAVA/SQL database technology and time stamps events were adopted to catalogue the data. This software has been design keeping in mind the needs for remote participation and operation of the machine. Therefore, a cooperative environment has been implemented where several persons can be connected together to the platform, programming their own devices and exchanging knowledge or opinions through an embedded chat.

  14. Striations in Plasma Display Panel

    OUYANG Ji-Ting; CAO Jing; MIAO Jin-Song

    2005-01-01

    @@ The phenomenon of striation has been investigated experimentally in a macroscopic ac-plasma display panel (PDP). The relationship between the characteristics of striation and the operation conditions including voltage, frequency, rib, and electrode configuration, etc is obtained experimentally. The origin of the striations is considered to be the ionization waves in the transient positive column near the dielectric surface in the anode area during the discharge, and the perturbation is caused by resonance kinetic effects in inert gas.

  15. AcEST: DK952388 [AcEST

    Full Text Available hase 3 OS=Arabidopsis thaliana Align length 112 Score (bit) 88.2 E-value 3.0e-17 Report BLASTX 2.2.19 [Nov-0...A Strictosidine synthase (Fragment) OS=Rauvol... 79 3e-14 sp|Q9HDC9|APMAP_HUMAN Adipocyte plasma membrane-assoc...iated prote... 65 4e-10 sp|Q9D7N9|APMAP_MOUSE Adipocyte plasma membrane-associ... protein 1 OS=Homo sapiens ... 27 4.8 sp|Q9NZR2|LRP1B_HUMAN Low-density lipoprotein receptor-related p... 31... 5.0 sp|Q62167|DDX3X_MOUSE ATP-dependent RNA helicase DDX3X OS=Mus mu... 31 5.0 s

  16. Condensation production in comet tail plasma

    S. V. Koshevaya

    2000-01-01

    Full Text Available Los solitones producen condensaciones en la cola del cometa, como resultado de su interacci on con el viento solar. Se obtienen las condiciones de excitaci on de las ondas ion ac usticas y polvo-ac usticas. La teor a presentada, trata sobre los solitones ion-ac usticos polvosos en este plasma magnetizado. Se demuestra que la longitud de Debye y el radio de cyclotr on de las part culas de polvo cargadas, de nen la dimensi on transversal de los solitones polvo-ac usticos. Para valores t picos de los par ametros, las dimensiones estimadas de los solitones son de varios Km, lo cual concuerda con los datos obtenidos de las observaciones.

  17. SINGLE PHASE HIGH FREQUENCY AC CONVERTER FOR INDUCTION HEATING APPLICATION

    M.A INAYATHULLAAH,; Dr. R. Anita

    2010-01-01

    The proposed topology reduces the total harmonic distortion (THD) of a high frequency AC/AC Converter well below the acceptable limit. This paper deals with a novel single phase AC/DC/AC soft switching utility frequency AC to high frequency AC converter. In this paper a single phase full bridge inverter with Vienna rectifier as front end is used instead of conventional diode bridge rectifier to provide continuous sinusoidal input current with nearly unity power factor at the source side with ...

  18. Plasma properties

    This paper discusses the following topics: MHD plasma activity: equilibrium, stability and transport; statistical analysis; transport studies; edge physics studies; wave propagation analysis; basic plasma physics and fluid dynamics; space plasma; and numerical methods

  19. Characterization of AcMNPV with a deletion of ac69 gene

    Jianhao Ke

    2011-07-01

    Full Text Available ORF69 (Ac69 of Autographa californica multiple nucleopolyhedrovirus (AcMNPV is conserved in some baculovirus genomes. Although it has been shown that Ac69 has cap 0-dependent methyltransferase activity and is not required for budded virus production in Spodoptera frugiperda Sf-9 cells, its role in occlusion-derived virus synthesis and virus oral infectivity is not known. This paper describes generation of an ac69 knockout AcMNPV bacmid mutant and analyses of the influence of ac69 deletion on the viral infectivity in Sf-9 cells and Trichoplusia ni larvae so as to investigate the role of ac69 in the viral life cycle. Results indicated that ac69 deletion has little effect on the production rates and morphogenesis of budded virus and occlusion-derived virus in Sf-9 cells. In addition, animal experiment revealed that the deletion mutant did not affect AcMNPV infectivity for Trichoplusia ni larvae in LD50 and LT50 bioassay when administered orally. These results suggest that ac69 may be dispensable for viral infectivity both in vitro and in vivo.

  20. Inhibition of actin polymerisation by low concentration Latrunculin B affects endocytosis and alters exocytosis in shank and tip of tobacco pollen tubes.

    Moscatelli, A; Idilli, A I; Rodighiero, S; Caccianiga, M

    2012-09-01

    Pollen tube growth depends on the integrity of the actin cytoskeleton that regulates cytoplasmic streaming and secretion. To clarify whether actin also plays a role in pollen tube endocytosis, Latrunculin B (LatB) was employed in internalisation experiments with tobacco pollen tubes, using the lipophilic dye FM4-64 and charged nanogold. Time-lapse analysis and dissection of endocytosis allowed us to identify internalisation pathways with different sensitivity to LatB. Co-localisation experiments and ultrastructural observations using positively charged nanogold revealed that LatB significantly inhibited endocytosis in the pollen tube shank, affecting internalisation of the plasma membrane (PM) recycled for secretion, as well as that conveyed to vacuoles. In contrast, endocytosis of negatively charged nanogold in the tip, which is also conveyed to vacuoles, was not influenced. Experiments of fluorescence recovery after photobleaching (FRAP) of the apical and subapical PM revealed domains with different rates of fluorescence recovery and showed that these differences depend on the actin cytoskeleton integrity. These results show the presence of distinct degradation pathways by demonstrating that actin-dependent and actin-indepedent endocytosis both operate in pollen tubes, internalising tracts of PM to be recycled and broken down. Intriguingly, although most studies concentrate on exocytosis and distension in the apex, the present paper shows that uncharacterised, actin-dependent secretory activity occurs in the shank of pollen tubes. PMID:22288466

  1. Plasma accelerators

    Recently attention has focused on charged particle acceleration in a plasma by a fast, large amplitude, longitudinal electron plasma wave. The plasma beat wave and plasma wakefield accelerators are two efficient ways of producing ultra-high accelerating gradients. Starting with the plasma beat wave accelerator (PBWA) and laser wakefield accelerator (LWFA) schemes and the plasma wakefield accelerator (PWFA) steady progress has been made in theory, simulations and experiments. Computations are presented for the study of LWFA. (author)

  2. Noise reduction in AC-coupled amplifiers

    Serrano Finetti, Roberto Ernesto; Pallàs Areny, Ramon

    2014-01-01

    AC-coupled amplifiers are noisier than dc-coupled amplifiers because of the thermal noise of the resistor(s) in the ac-coupling network and the increased contribution of the amplifier input noise current i(n). Both contributions, however, diminish if the corner frequency f(c) of the high-pass filter observed by the signal is lowered, the cost being a longer transient response. At the same time, the presence of large resistors in the ac-coupling network suggests that the use of FET-input ampli...

  3. Plasma harmonics

    Ganeev, Rashid A

    2014-01-01

    Preface; Why plasma harmonics? A very brief introduction Early stage of plasma harmonic studies - hopes and frustrations New developments in plasma harmonics studies: first successes Improvements of plasma harmonics; Theoretical basics of plasma harmonics; Basics of HHG Harmonic generation in fullerenes using few-cycle pulsesVarious approaches for description of observed peculiarities of resonant enhancement of a single harmonic in laser plasmaTwo-colour pump resonance-induced enhancement of odd and even harmonics from a tin plasmaCalculations of single harmonic generation from Mn plasma;Low-o

  4. AcEST: DK960680 [AcEST

    Full Text Available 9 AALYHVIVIRAIPFKSR 285 >sp|Q7XSQ9|PIP12_ORYSJ Probable aquaporin PIP1-2 OS=Oryza sativa subsp. japonica GN=...RD 236 A +YHVV+IRALPFKSRD Sbjct: 271 AAIYHVVIIRALPFKSRD 288 >sp|Q9SXF8|PIP13_ORYSJ Aquaporin PIP 1-3 OS=Oryza sativa subsp. japonic...80368_RAPSA Plasma membrane aquaporin (PAQ1) OS=Rapha... 147 3e-34 tr|A9NV12|A9NV12_PICSI Putative uncharacterized protein OS=Pic...Q9MBA0|Q9MBA0_RAPSA Plasma membrane aquaporin 1b OS=Raphanus ... 146 4e-34 tr|Q9FUL1|Q9FUL1_BRAOL Aquaporin PIP1b1 OS=Brassic...o BlastX Result : Swiss-Prot sp_hit_id Q9AR14 Definition sp|Q9AR14|PIP15_MAIZE Aquaporin PIP1-5 OS=Zea mays

  5. Comparison of diamond nucleation in DC and AC substrate bias mode

    Diamond films were grown by modified hot filament (HF) CVD technique, employing the double bias configuration. Prior to the diamond growth, a voltage source was connected between the substrate and the filaments placed above the substrate to enhance the diamond nucleation. The influence of DC and AC bias voltage has been systematically investigated by scanning electron microscopy, Raman spectroscopy and X-ray diffraction measurements. In the case of DC biasing, a negative voltage varied from 100 to 180 V has been applied to the Si substrate. It was found that total current depends on process duration and substrate bias. A substrate pretreatment at a bias voltage of 120 V results in optimum process conditions with tendency to (100) preferential diamond growth. In the case of AC biasing, a 50 Hz voltage source was used to achieve nucleation either on conductive or non-conductive substrate. An AC bias voltage of 160 V and higher results in a homogeneous film growth. For both bias types, a continuous diamond layer is formed at relatively low nucleation biasing (lower than 180 V) due to using the dual plasma arrangement of HF CVD reactor. Finally, the AC biasing is shown as a promising way to enhance the diamond nucleation on non-conductive substrates. Influences of the DC and/or AC substrate pretreatment and nucleation duration are discussed

  6. ISTTOK plasma control with the tomography diagnostic

    Fernandes, H.; Caralho, P.J.; Duarte, P.; Pereira, T.; Coelho, R.; Silva, C. [Association Euratom/IST, Institute of Plasmas and Nuclear Fusion, Technology Graduate Institute, P-1049-001 Lisbon (Portugal)

    2011-07-01

    A real-time plasma position control system is mandatory to achieve long duration (up to 250 ms), Alternating Current (AC) discharges on the ISTTOK tokamak. Such a system has been used for some time supported only on magnetic field diagnostic data. However, this system does not function accurately when the plasma current is low, rendering it inoperative during the plasma current reversal. A tomography diagnostic with 3 pinhole cameras and 8 silicone photodiode channels per camera was installed and customized to supply alternative plasma position to be used for plasma position control. As no filtering is applied, most of the radiation detected is in the visible/near-UV range. This system (i) executes a tomographic reconstruction, (ii) determines the average emissivity position from it, (iii) calculates the shift from the required position and (iv) supplies the vertical field power supply unit with the desired current value, all in less than 100 {mu}s. The horizontal magnetic field power supply unit is expected to be included in the system and will have no impact in the process time. This paper presents the tomography diagnostic architecture together with results of its scientific exploitation in ISTTOK AC discharges, where it has proven to be capable of supplying an accurate plasma position during the current reversal. The use of the tomography diagnostic for plasma position overcomes some limitations of the magnetic diagnostics, but poses challenges of its own such as blindness to plasma current direction. (authors)

  7. Characteristics of AC capillary discharge produced in electrically conductive water solution

    De Baerdemaeker, F.; Šimek, Milan; Schmidt, Jiří; Leys, C.

    2007-01-01

    Roč. 16, č. 2 (2007), s. 341-354. ISSN 0963-0252 R&D Projects: GA AV ČR IAA1043102 Institutional research plan: CEZ:AV0Z20430508 Keywords : water breakdown * capillary * AC discharge * conductive liquid * optical emission * decay time * vapour bubble * breakdown mechanism Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 2.120, year: 2007

  8. The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual

    Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)

  9. Guiding Principles in Selecting AC To DC Converters For Power Factor Corrections in AC Transmission System

    Ibekwe B.E

    2014-10-01

    Full Text Available The ac to dc converters’ power factors correction in ac transmission system were investigated. The studies include: phase-controlled converter; pulse width modulated (PWM converter and ac input current shaped converter. Using Fourier series, power factors of these converters were calculated and simulated using MATLAB. The resulting curves are displayed in the hard copies for practical guides in the choice of converters; and comparatively, current shaped type is the best.

  10. Resonant tunneling of interacting electrons in an AC electric field

    The problem of the effect of electron-electron interaction on the static and dynamic properties of a double-barrier nanostructure (resonant tunneling diode (RTD)) is studied in terms of a coherent tunneling model, which includes a set of Schrödinger and Poisson equations with open boundary conditions. Explicit analytical expressions are derived for dc and ac potentials and reduced (active and reactive) currents in the quasi-classical approximation over a wide frequency range. These expressions are used to analyze the frequency characteristics of RTD. It is shown that the interaction can radically change the form of these expressions, especially in the case of a hysteretic I-V characteristic. In this case, the active current and the ac potentials can increase sharply at both low and high frequencies. For this increase to occur, it is necessary to meet quantum regime conditions and to choose a proper working point in the I-V characteristic of RTD. The possibility of appearance of specific plasma oscillations, which can improve the high-frequency characteristics of RTD, is predicted. It is found that the active current can be comparable with the resonant dc current of RTD

  11. Resonant tunneling of interacting electrons in an AC electric field

    Elesin, V. F., E-mail: VFElesin@mephi.ru [National Research Nuclear University MEPhI (Russian Federation)

    2013-11-15

    The problem of the effect of electron-electron interaction on the static and dynamic properties of a double-barrier nanostructure (resonant tunneling diode (RTD)) is studied in terms of a coherent tunneling model, which includes a set of Schrödinger and Poisson equations with open boundary conditions. Explicit analytical expressions are derived for dc and ac potentials and reduced (active and reactive) currents in the quasi-classical approximation over a wide frequency range. These expressions are used to analyze the frequency characteristics of RTD. It is shown that the interaction can radically change the form of these expressions, especially in the case of a hysteretic I-V characteristic. In this case, the active current and the ac potentials can increase sharply at both low and high frequencies. For this increase to occur, it is necessary to meet quantum regime conditions and to choose a proper working point in the I-V characteristic of RTD. The possibility of appearance of specific plasma oscillations, which can improve the high-frequency characteristics of RTD, is predicted. It is found that the active current can be comparable with the resonant dc current of RTD.

  12. Waves in a 1D electrorheological dusty plasma lattice

    Rosenberg, M.

    2015-08-01

    The behavior of waves in a one-dimensional (1D) dusty plasma lattice where the dust interacts via Yukawa and electric dipole interactions is discussed theoretically. This study is motivated by recent reports on electrorheological dusty plasmas (e.g. Ivlev et al. 2008 Phys. Rev. Lett. 100, 095003) where the dipole interaction arises due to an external uniaxial AC electric field that distorts the Debye sphere surrounding each grain. Application to possible dusty plasma experimental parameters is discussed.

  13. Research on using dielectric barrier discharges for plasma generation

    In this paper a method that generation atmospheric plasma using dielectric barrier discharges (DBD) is given. Through the experiments, discharges current curves are obtained separately at 10 kHz and 500 kHz AC supply. The curves show that there are floating ions (plasma) between two dielectric plates. The floating ions can be blown out by airflow. The density of ions in plasma blown is measured

  14. AcEST: DK958197 [AcEST

    Full Text Available n Myb4 OS=Oryza sativa su... 30 7.5 sp|Q9LZJ8|ARR20_ARATH Putative two-component response regulator ... 30 7...Q5KFP3|PRM1_CRYNE Plasma membrane fusion protein PRM1 OS=Cryp... 30 9.6 sp|Q5DTT4|RGAG4_MOUSE Retrotransposon gag domain-co...GN=mybH PE=3 SV=1 Length = 1217 Score = 36.2 bits (82), Expect = 0.14 Identities = 14/35 (40%), Positives = ...lium discoideum GN=mybJ PE=3 SV=1 Length = 734 Score = 34.7 bits (78), Expect = 0.40 Identities = 16/35 (45%), Posit...o sapiens GN=OR4N2 PE=2 SV=1 Length = 307 Score = 30.8 bits (68), Expect = 5.6 Identities = 22/63 (34%), Positives

  15. AcEST: DK961559 [AcEST

    Full Text Available TX 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zh...ang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein databas..._ASPCL Autophagy-related protein 2 OS=Aspergillus ... 35 0.15 sp|Q1AXQ5|ACSA_RUBXD Acetyl-coenzyme A synthetase OS=Rubrobacter...SIF2_DROME Protein still life, isoforms C/SIF type 2 O... 29 6.5 sp|P17460|RDRP_TCV Probable RNA-directed RNA polymeras...KGSRTKRKFSSPGLENL 164 >sp|Q5KFP3|PRM1_CRYNE Plasma membrane fusion protein PRM1 OS=Cryptococcus neoformans G

  16. AcEST: BP916124 [AcEST

    Full Text Available OS=Cas-Br-E murine leukemia virus GN=env PE=1 SV=1 Length = 661 Score = 35.8 bits (81), Expect...LVLB Envelope glycoprotein OS=Feline leukemia virus (strain B/lambda-B1) GN=env PE=1 SV=1 Length = 662 Score = 30.8 bits (68), Expect...ALCNRT 396 >sp|P03388|ENV_MCFF3 Envelope glycoprotein OS=Mink cell focus-forming murine leukemia...plasma laidlawii... 31 3.1 sp|P11261|ENV_FLVLB Envelope glycoprotein OS=Feline leukemia vir... 31 3.1 sp|Q76....9 sp|Q2GZU7|DBP7_CHAGB ATP-dependent RNA helicase DBP7 OS=Chaetomi... 30 6.9 sp|Q87BE2|TILS_XYLFT tRNA(Ile)-lysidine

  17. AcEST: BP911585 [AcEST

    Full Text Available CJ92|SRB8_ASPCL Mediator of RNA polymerase II transcription... 33 0.44 sp|A5E4A8|MYO1_LODEL Myosin-1 OS=Lodderomyces elongispo...9.9) Link to BlastX Result : TrEMBL tr_hit_id Q2S368 Definition tr|Q2S368|Q2S368_SALRD Putative DNA polymera...11585 - Show BP911585 Clone id YMU001_000006_F12 Library YMU01 Length 324 Definition Adiantum capillus-veneris mRNA. clon...c translation initiation factor 3... 32 0.77 >sp|Q6SPE9|SAMD1_RABIT Atherin OS=Oryctolagus cuniculu....83 tr|Q9LIE8|Q9LIE8_ARATH Similarity to cell wall-plasma membrane l... 36 0.83 tr|Q6SSE6|Q6SSE6_CHLRE Plus aggluti

  18. A Simple Load Power Estimator For Quasi-Direct AC-AC Converter System

    Marian GAICEANU; Emil ROSU

    2003-01-01

    In this paper a simple load power estimator for the three-phase quasi-direct acac converter system is reported. Since the ac-ac converter control by means of pulsewidth modulation (PWM) is based on the power balance concept, its load power should be known. Two control boards, based on the dSMC (digital Smart Motion Controller) 30 MIPS 32-bit fixed-point digital signal processor (DSP), were involved in the ac-ac system driving. By using the power balance control, the DC link voltage variation ...

  19. Engineering Design of the ITER AC/DC Power Supplies

    To design high power pulse power supplies, especially in huge power supplies have not designed till now, it is necessary to analyze a system's characteristics and relations with another systems as well as to know high voltage, high current control technologies. Contents of this project are; - Study for the engineering designs changed recently by ITER Organization(IO) and writing specifications for the power supplies to reduce project risk. - Detailed analysis of the AC/DC Converters and writing subtask reports on the Task Agreement. - Study for thyristor numbers, DCR's specifications for Korea-China sharing meetings. - Study for the grounding systems of the ITER power supply system. The results may used as one of reference for practical designs of the high power coil power supplies and also may used in various field such as electroplating, plasma arc furnaces, electric furnaces

  20. Transport AC losses in YBCO coated conductors

    Majoros, M [Ohio State University, Columbus, OH 43210 (United States); Ye, L [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Velichko, A V [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Coombs, T A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Sumption, M D [Ohio State University, Columbus, OH 43210 (United States); Collings, E W [Ohio State University, Columbus, OH 43210 (United States)

    2007-09-15

    Transport AC loss measurements have been made on YBCO-coated conductors prepared on two different substrate templates-RABiTS (rolling-assisted biaxially textured substrate) and IBAD (ion-beam-assisted deposition). RABiTS samples show higher losses compared with the theoretical values obtained from the critical state model, with constant critical current density, at currents lower than the critical current. An origin of this extra AC loss was demonstrated experimentally by comparison of the AC loss of two samples with different I-V curves. Despite a difference in I-V curves and in the critical currents, their measured losses, as well as the normalized losses, were practically the same. However, the functional dependence of the losses was affected by the ferromagnetic substrate. An influence of the presence of a ferromagnetic substrate on transport AC losses in YBCO film was calculated numerically by the finite element method. The presence of a ferromagnetic substrate increases transport AC losses in YBCO films depending on its relative magnetic permeability. The two loss contributions-transport AC loss in YBCO films and ferromagnetic loss in the substrate-cannot be considered as mutually independent.

  1. Diagnostics for characterisation of plasma actuators

    Kotsonis, Marios

    2015-09-01

    The popularity of plasma actuators as flow control devices has sparked a flurry of diagnostic efforts towards their characterisation. This review article presents an overview of experimental investigations employing diagnostic techniques specifically aimed at AC dielectric barrier discharge, DC corona and nanosecond pulse plasma actuators. Mechanical, thermal and electrical characterisation techniques are treated. Various techniques for the measurement of induced velocity, body force, heating effects, voltage, current, power and discharge morphology are presented and common issues and challenges are described. The final part of this report addresses the effect of ambient conditions on the performance of plasma actuators.

  2. Effect of plasma disruption on superconducting magnet system in TRIAM-1M

    The high field superconducting toroidal field (TF) coils in TRIAM-1M have been successfully operated for more than 10 years. The effect of the plasma disruption on the superconducting TF coils has been studied, since the plasma disruption can give a serious effect such as coil quench. In the actual plasma disruption, the alternative current (AC) loss of the superconducting TF coils increased in proportion to the square of the plasma current just before the disruption. The dependence of the AC loss on the plasma current is in good agreement with the calculation. The AC loss of the TF coil was also measured using external pulse coils with three kinds of characteristic times of variation in the coil current (0.06, 0.5 and 6 ms). The AC loss increased in proportion to the square of the total current of the external pulse coil. The increase in the AC loss depends on the characteristic time of the magnetic field variation. It means that the AC loss due to the disruption can be reduced using the dependence of the AC loss on the characteristic time of the magnetic field variation. (orig.)

  3. AcEST: DK955269 [AcEST

    Full Text Available iss-Prot sp_hit_id Q9FWV6 Definition sp|Q9FWV6|TIP31_ORYSJ Probable aquaporin TIP3-1 OS=Oryza sativa subsp. japonic...HLNPA++ A L AGF Sbjct: 67 GAHLNPAVSIALWLFAGF 84 >sp|Q9SXF8|PIP13_ORYSJ Aquaporin PIP 1-3 OS=Oryza sativa subsp. japonic...7 tr|B6HGT0|B6HGT0_PENCH Pc20g03670 protein OS=Penicillium chrysog... 54 5e-06 tr|B8MJX8|B8MJX8_9EURO Aquaporin transpo...utative uncharacterized protein OS=Dicty... 50 7e-05 tr|B6QIR3|B6QIR3_PENMA Aquaporin transporter, putative OS=Penic...SV=2 50 1e-04 tr|Q1L642|Q1L642_PHYPA Plasma membrane aquaporin OS=Physcomitrel... 50 1e-04 tr|A9RBK8|A9RBK8_PHYPA Predic

  4. Laser plasma and relativistic effects

    In the case of laser-matter interaction on solid targets or on pre-formed plasmas, the X-spectroscopy permits us to observe a microscopic state of matter which is far from being in thermodynamical equilibrium. The quick evolution of these plasmas provides a valuable ground to test kinetic models and to shed light on some important aspects of the modeling of dense and hot plasmas. The last generation of lasers can deliver impulses of several tens of joules in less than a picosecond. The focusing of such light beams produces a place where laser and matter interact aggressively. The article describes the different mechanisms occurring in laser-matter interaction particularly the self-induced transparency and the self-focusing. The movement of a single electron submitted to an ultra-intense but brief electromagnetic wave is quantitatively discussed. (A.C.)

  5. The Sloan Lens ACS Survey. V. The full ACS strong-lens sample

    Bolton, Adam S.; Burles, Scott; Koopmans, Leon V. E.; Treu, Tommaso; Gavazzi, Raphael; Moustakas, Leonidas A.; Wayth, Randall; Schlegel, David J.

    2008-01-01

    We present the definitive data for the full sample of 131 strong gravitational lens candidates observed with the Advanced Camera for Surveys (ACS) aboard the Hubble Space Telescope by the Sloan Lens ACS (SLACS) Survey. All targets were selected for higher redshift emission lines and lower redshift c

  6. Aerosol formation and decomposition of dilute benzene derivatives by AC/DC corona discharge

    Zhang, X.; Chen, W.; Zhu, J.; Feng, W.; Yan, K. [Zhejiang Univ., Hangzhou (China). Industrial Ecology and Environment Research Inst.

    2010-07-01

    The most common treatment methods for removing volatile organic compounds (VOCs) include thermal decomposition, catalytic oxidation, carbon adsorption, destruction in non-thermal plasma (NTP) and condensation. Among these technologies, the use of NTP is gaining considerable attention, particularly AC/DC energized corona plasma systems because of their reliable operation, low cost and high efficiency. One of the ideal NTP based processes is to convert VOCs to environmentally sound compounds, such as water. However, since the plasma-initialed reactions are difficult to control, some undesirable products such as aerosols are often observed from VOC removal. The formation of aerosol must therefore be considered in structure-dependent VOC removal characteristics. This study examined the decomposition of three benzene derivatives by novel AC/DC corona discharge with a closed loop flow system in air. The experiments focused primarily on aerosol formation and the individual removal efficiency of benzene, toluene and styrene. The removal process of styrene, benzene and toluene were found to be different from each other because of their different reactivity with radicals. The generated radicals of styrene were efficiently used for the removal process, but the generated radicals of benzene and toluene were mainly quenched by bulk gases. The study showed that a large concentration of aerosols can be generated in humid air. The generated aerosols can be collected by electrostatic precipitation in the AC/DC energized plasma system. It was concluded that the chemical structure is one of most important factors that influence the removal process of VOCs for non-thermal plasma processing. 17 refs., 7 figs.

  7. AC losses in filamentary YBCO/hastelloy

    Full text: The AC hysteresis loss of a long YBCO thin-film superconducting strip in a perpendicular AC magnetic field can be reduced by subdividing the film into narrow parallel strips (filaments). The hysteresis loss depends on the film critical current density Jc, the film thickness d, the filament width 2a and the lateral spacing L between filaments as well as on the AC magnetic field amplitude Hm. In addition, if the film is deposited onto a YSZ/hastelloy substrate to form a flexible tape, eddy current loss occurs in the hastelloy metal. The eddy current loss depends on the resistivity p of the hastelloy, the width 2w and thickness dm of the hastelloy substrate as well as on the frequency f and amplitude Hm. We have calculated the hysteresis and eddy current losses as a function of Jc, d, 2a, L, p, w, dm, f, and Hm to find optimal design parameters for a YBCO/hastelloy tape. As the AC loss is related to the loss component X'' of the AC susceptibility, we have measured X'' at different frequencies f and amplitudes Hm for several filamentary designs of YBCO/hastelloy tapes and compared our experimental results with our model calculations

  8. Plasma waves

    Swanson, DG

    1989-01-01

    Plasma Waves discusses the basic development and equations for the many aspects of plasma waves. The book is organized into two major parts, examining both linear and nonlinear plasma waves in the eight chapters it encompasses. After briefly discussing the properties and applications of plasma wave, the book goes on examining the wave types in a cold, magnetized plasma and the general forms of the dispersion relation that characterize the waves and label the various types of solutions. Chapters 3 and 4 analyze the acoustic phenomena through the fluid model of plasma and the kinetic effects. Th

  9. Plasma astrophysics

    Kaplan, S A; ter Haar, D

    2013-01-01

    Plasma Astrophysics is a translation from the Russian language; the topics discussed are based on lectures given by V.N. Tsytovich at several universities. The book describes the physics of the various phenomena and their mathematical formulation connected with plasma astrophysics. This book also explains the theory of the interaction of fast particles plasma, their radiation activities, as well as the plasma behavior when exposed to a very strong magnetic field. The text describes the nature of collective plasma processes and of plasma turbulence. One author explains the method of elementary

  10. AC loss performance of CS insert coil

    The ITER Central Solenoid (CS) model coil and the CS insert coil were fabricated, and the test was carried out. The AC loss measurement of the coil is one of the most important tests to determine coil performance. The AC loss of a short sample conductor for the CS insert coil was measured by using the calorimetric method, and the coupling time constants of the conductor were estimated to be 30 ms and 20 ms for pulse and discharge tests, respectively. The AC loss of the CS insert coil was measured by using the calorimetric method for pulse and discharge tests. The coupling time constant estimated from the result of the pulse tests was 34 ms and almost equal to that of the short sample. The coupling time constant for the discharge test was estimated to be 140 ms and about 4 times that of the pulse test. (author)

  11. ac propulsion system for an electric vehicle

    Geppert, S.

    1980-01-01

    It is pointed out that dc drives will be the logical choice for current production electric vehicles (EV). However, by the mid-80's, there is a good chance that the price and reliability of suitable high-power semiconductors will allow for a competitive ac system. The driving force behind the ac approach is the induction motor, which has specific advantages relative to a dc shunt or series traction motor. These advantages would be an important factor in the case of a vehicle for which low maintenance characteristics are of primary importance. A description of an EV ac propulsion system is provided, taking into account the logic controller, the inverter, the motor, and a two-speed transmission-differential-axle assembly. The main barrier to the employment of the considered propulsion system in EV is not any technical problem, but inverter transistor cost.

  12. Thrombolytic effect of rAcAP5 and its mechanism%rAcAP5的溶栓作用及作用机制研究

    丁双; 刘晓岩; 朱元军; 王银叶

    2012-01-01

    犬钩虫抗凝肽(Ancylostoma caninum anticoagulant peptide,AcAP5)是一种已报道的FXa抑制剂,它对防止血栓溶解的TAFIa具有很强的抑制作用,本文进一步研究rAcAP5的纤溶活性和溶栓活性.采用发色产物法测定rAcAP5对TAFIa的抑制作用,用比浊法测定rAcAP5对尿激酶(UK)诱导的纤维蛋白溶解时间的影响,通过血栓称重法进行体外溶栓实验和体内动静脉旁路溶栓实验.采用常规方法测定正常大鼠优球蛋白溶解时间(ELT),血浆纤维蛋白原含量和纤维蛋白降解产物(FDP)含量.rAcAP5浓度依赖地抑制TAFIa活性,其IC50为63.7 nmol/L,为一个强的TAFIa抑制剂.rAcAP5 (5-40 nmol/L)能够显著地加速尿激酶诱导纤维蛋白的溶解,缩短纤溶时间.rAcAP5能够提高尿激酶诱导的血栓减重(P<0.05),单独使用rAcAP5也能显著增加体外实验的血栓减重(P<0.05).在大鼠体内的动静脉旁路模型中,单次静脉给予rAcAP5 (50-200 μg/kg)能够剂量依赖地增加血栓减重(P<0.01).rAcAP5在有效剂量对正常大鼠的ELT、血浆纤维蛋白原含量和FDP含量均无明显影响.研究结果提示:rAcAP5是一个强效溶栓多肽,它可能通过抑制TAFIa的活性而在血栓表面具有溶栓活性,而不影响循环血液中的纤溶活性和纤维蛋白原含量.%Ancylostoma caninum anticoagulant peptide 5 (AcAP5) has been reported as an FXa inhibitor.We found that this peptide showed potent inhibitory activity on activated thrombin-activatable fibrinolysis inhibitor (TAFIa),which protects the fibrin clot against lysis.This study investigated the effects of recombinant AcAP5 (rAcAP5) on fibrinolytic activity in vitro and on thrombolytic activity in vitro and in vivo.In addition,euglobulin lysis time (ELT),fibrinogen content and fibrin degradation product (FDP) in normal rat plasma were all determined to evaluate the influence of rAcAP5 on fibrinolytic activity in circulation blood.TAFIa activity was detected by colorimetry

  13. Plasma device

    A method is described of providing electron beam heating of a high-density plasma to drive a fast liner to implode a structured microsphere. An annular relativistic electron beam is used to heat an annular plasma to kilovolt temperatures through streaming instabilities in the plasma. Energy deposited in the annular plasma then converges on a fast liner to explosively or ablatively drive the liner to convergence to implode the structured microsphere. (U.K.)

  14. AC loss in superconducting tapes and cables

    Oomen, Marijn Pieter

    High-temperature superconductors are developed for use in power-transmission cables, transformers and motors. The alternating magnetic field in these devices causes AC loss, which is a critical factor in the design. The study focuses on multi-filament Bi-2223/Ag tapes exposed to a 50-Hz magnetic field at 77 K. The AC loss is measured with magnetic, electric and calorimetric methods. The results are compared to theoretical predictions based mainly on the Critical-State Model. The loss in high- temperature superconductors is affected by their characteristic properties: increased flux creep, high aspect ratio and inhomogeneties. Filament intergrowths and a low matrix resistivity cause a high coupling-current loss especially when the filaments are fully coupled. When the wide side of the tape is parallel to the external magnetic field, the filaments are decoupled by twisting. In a perpendicular field the filaments can be decoupled only by combining a short twist pitch with a transverse resistivity much higher than that of silver. The arrangement of the inner filaments determines the transverse resistivity. Ceramic barriers around the filaments cause partial decoupling in perpendicular magnetic fields at power frequencies. The resultant decrease in AC loss is greater than the accompanying decrease in critical current. With direct transport current in alternating magnetic field, the transport-current loss is well described with a new model for the dynamic resistance. The Critical- State Model describes well the magnetisation and total AC loss in parallel magnetic fields, at transport currents up to 0.7 times the critical current. When tapes are stacked face-to-face in a winding, the AC-loss density in perpendicular fields is greatly decreased due to the mutual shielding of the tapes. Coupling currents between the tapes in a cable cause an extra AC loss, which is reduced by a careful cable design. The total AC loss in complex devices with many tapes is generally well

  15. ACS air bearing test-bed design

    Glitt, Sascha

    2010-01-01

    This thesis is about the construction and design of a new air bearing test-bed to verify the programmed ACS attitude control algorithm and to validate the ACS MATLAB/SimuLink¬ model of NPSAT1, the second small satellite currently under development at the Naval Postgraduate School Space Systems Academic Group. The software was already verified and validated using a comparable air bearing test-bed. But due to changes in hardware from commercial magnetic torque rods to custom, NPS-built, magneti...

  16. The Effective AC Response of Nonlinear Composites

    WEI En-Bo; GU Guo-Qing

    2001-01-01

    A perturbative approach is used to study the AC response of nonlinear composite media, which obey a current-field relation of the form J = σ E + χ|E|2 E with components having nonlinear response at finite frequencies. For a sinusoidal applied field, we extend the local potential in terms of sinusoidal components at fundamental frequency and high-order harmonic frequencies to treat the nonlinear composites. For nonlinear composite media vith a low concentrations of spherical inclusions, we give the formulae of the nonlinear effective AC susceptibility χ*3ω at the third harmonic frequency.

  17. YBCO thin films in ac and dc films

    Shahzada, S

    2001-01-01

    We report studies on the dc magnetization of YBCO thin films in simultaneously applied dc and ac fields. The effect of the ac fields is to decrease the irreversible magnetization drastically leading to complete collapse of the hysteresis loops for relatively small ac fields (250e). The magnitude of the decrease depends on the component of the ac field parallel to the c-axis. The decrease is non-linear with ac amplitude and is explained in the framework of the critical state response of ultra thin films in perpendicular geometry. The ac fields increase the relaxation rapidly at short times while the long time response appears unaffected. (author)

  18. SINGLE PHASE HIGH FREQUENCY AC CONVERTER FOR INDUCTION HEATING APPLICATION

    M.A INAYATHULLAAH,

    2010-12-01

    Full Text Available The proposed topology reduces the total harmonic distortion (THD of a high frequency AC/AC Converter well below the acceptable limit. This paper deals with a novel single phase AC/DC/AC soft switching utility frequency AC to high frequency AC converter. In this paper a single phase full bridge inverter with Vienna rectifier as front end is used instead of conventional diode bridge rectifier to provide continuous sinusoidal input current with nearly unity power factor at the source side with extremely low distortion.. This power converter is more suitable and acceptable for cost effective high frequency (HF consumer induction heating applications.

  19. AcsA-AcsB: The core of the cellulose synthase complex from Gluconacetobacter hansenii ATCC23769.

    McManus, John B; Deng, Ying; Nagachar, Nivedita; Kao, Teh-hui; Tien, Ming

    2016-01-01

    The gram-negative bacterium, Gluconacetobacter hansenii, produces cellulose of exceptionally high crystallinity in comparison to the cellulose of higher plants. This bacterial cellulose is synthesized and extruded into the extracellular medium by the cellulose synthase complex (CSC). The catalytic component of this complex is encoded by the gene AcsAB. However, several other genes are known to encode proteins critical to cellulose synthesis and are likely components of the bacterial CSC. We have purified an active heterodimer AcsA-AcsB from G. hansenii ATCC23769 to homogeneity by two different methods. With the purified protein, we have determined how it is post-translationally processed, forming the active heterodimer AcsA-AcsB. Additionally, we have performed steady-state kinetic studies on the AcsA-AcsB complex. Finally through mutagenesis studies, we have explored the roles of the postulated CSC proteins AcsC, AcsD, and CcpAx. PMID:26672449

  20. Comparison of diamond nucleation in DC and AC substrate bias mode

    Diamond films were grown by hybrid HF CVD technique, employing the double bias configuration [1]. Prior to diamond growth, a voltage source was connected between the substrate and filaments placed above them to enhance diamond nucleation. The influence of DC and/or AC bias voltage has been systematically investigated by scanning electron microscopy, Raman spectroscopy and X-ray diffraction measurements. In case of DC bias, a negative voltage varied from 100 to 180 V has been applied to Si substrate. It was found that total current depends on process duration and substrate bias. Nucleation at -140 V results in optimal process conditions with tendency to (100) preferential diamond growth. In the case of AC bias, a 50 Hz voltage source was used to achieve nucleation either on conductive or non-conductive substrate. AC bias of 160 V and higher results in homogenous film growth. For both bias types, a homogenous diamond growth is achieved at relatively low nucleation bias (lower than 180 V) due to using the dual plasma arrangement of HF CVD reactor. Finally, AC bias is shown as a promising way to enhance diamond nucleation also on non-conductive substrates. (Authors)

  1. Plasma antennas

    Anderson, Theodore

    2011-01-01

    The plasma antenna is an emerging technology that partially or fully utilizes ionized gas as the conducting medium instead of metal to create an antenna. The key advantages of plasma antennas are that they are highly reconfigurable and can be turned on and off. The disadvantage is that the plasma antennas require energy to be ionized. This unique resource provides you with a solid understanding of the efficient design and prototype development of plasma antennas, helping you to meet the challenge of reducing the power required to ionize the gas at various plasma densities. You also find thorou

  2. AC power generation from microbial fuel cells

    Lobo, Fernanda Leite; Wang, Heming; Forrestal, Casey; Ren, Zhiyong Jason

    2015-11-01

    Microbial fuel cells (MFCs) directly convert biodegradable substrates to electricity and carry good potential for energy-positive wastewater treatment. However, the low and direct current (DC) output from MFC is not usable for general electronics except small sensors, yet commercial DC-AC converters or inverters used in solar systems cannot be directly applied to MFCs. This study presents a new DC-AC converter system for MFCs that can generate alternating voltage in any desired frequency. Results show that AC power can be easily achieved in three different frequencies tested (1, 10, 60 Hz), and no energy storage layer such as capacitors was needed. The DC-AC converter efficiency was higher than 95% when powered by either individual MFCs or simple MFC stacks. Total harmonic distortion (THD) was used to investigate the quality of the energy, and it showed that the energy could be directly usable for linear electronic loads. This study shows that through electrical conversion MFCs can be potentially used in household electronics for decentralized off-grid communities.

  3. Performance of Halbach magnetized brushless AC motors

    Zhu, Z.Q.; Xia, Z.P.; Shi, Y.F.; Howe, D.; Pride, A.; X. J. Chen

    2003-01-01

    The steady-state performance of Halbach magnetized brushless ac machines when operated in constant torque and flux-weakening modes is investigated both theoretically and experimentally, with particular emphasis on the influence of cross-coupling magnetic saturation on the torque capability.

  4. Ac-dc converter firing error detection

    Each of the twelve Booster Main Magnet Power Supply modules consist of two three-phase, full-wave rectifier bridges in series to provide a 560 VDC maximum output. The harmonic contents of the twelve-pulse ac-dc converter output are multiples of the 60 Hz ac power input, with a predominant 720 Hz signal greater than 14 dB in magnitude above the closest harmonic components at maximum output. The 720 Hz harmonic is typically greater than 20 dB below the 500 VDC output signal under normal operation. Extracting specific harmonics from the rectifier output signal of a 6, 12, or 24 pulse ac-dc converter allows the detection of SCR firing angle errors or complete misfires. A bandpass filter provides the input signal to a frequency-to-voltage converter. Comparing the output of the frequency-to-voltage converter to a reference voltage level provides an indication of the magnitude of the harmonics in the ac-dc converter output signal

  5. AC loss in superconducting tapes and cables

    Oomen, Marijn Pieter

    2000-01-01

    The present study discusses the AC loss in high-temperature superconductors. Superconducting materials with a relatively high critical temperature were discovered in 1986. They are presently developed for use in large-scale power-engineering devices such as power-transmission cables, transformers an

  6. Popcorn polymerisation of chloroprene. A kinetic investigation

    The project was sponsored by Du Font Dow Elastomers Ltd (Maydown, N. Ireland), in whose neoprene plant the popcorn polymers are found. The material itself has no commercial value, but grows rapidly and has the ability to block pipes and halt production. Therefore the production equipment containing monomers is all scheduled for 'popcorn search' inspections at intervals that differ according to the prevailing temperatures and monomer concentrations; a process which adds to costs. Prior work within the Queen's University of Belfast has identified the factors which affect the initiation of chlorobutadiene popcorn polymers, but available published and unpublished kinetic studies are in conflict concerning their rate of growth, and there is no data on the dichlorobutadiene popcorn polymer. In consequence, current relief system design procedures are based on a worst case scenario about popcorn growth rates and thus the design may be unduly expensive. The research obtained reliable kinetic data to allow these 'popcorn search' schedules to be rationalised and relief system designs to be improved and as a result to reduce the company's expenditure and improve operational safety margins. The proposed research was to investigate the kinetic behaviour of chlorinated butadiene monomers in the formation of omega- or 'popcorn' polymers. The growth rates of the chloroprene popcorn polymer were investigated at various temperatures in the liquid phase in the pure chloroprene monomer, mixed with other monomers and diluted with toluene in what we term 'Korean' type experiments. In these experiments the growth of popcorn polymer was terminated in a set of identically prepared ampoules after a fixed time. The growth rates of popcorn polymer seeds were obtained over various time periods, namely 24, 43 and 54 hours, at temperatures ranging from 10 deg C to 60 deg C. It was observed that the results differ greatly from those obtained by J.Op.Li. In particular, in the present work it was found that rates rise continuously with temperature. For measurements in the vapour phase we have introduced the McBain balance technique to chemical kinetics. The growth rate of the popcorn polymers was determined in vitro at various temperatures between the ranges +3 deg C and +40 deg C. It was found that the first order growth rates of the seeds increased as the temperature was increased. Initial exposure of the popcorn polymer to the atmosphere produced various effects on the induction and initial growth period. The effect and inhibition of certain gases such as CO2, O2, NO2, SO2 and air on the subsequent growth of the chloroprene popcorn polymer in the vapour phase were also investigated. The effect of these gases on the popcorn polymers was investigated with infra red spectroscopy to show the structures that formed. The development of the chloroprene nodules and the copolymers with dichlorobutadiene were examined using the scanning electron microscope. The initiation of the dichlorobutadiene popcorn in the liquid/vapour phase was investigated using techniques and conditions previously employed by Poon, though only the addition of chloroprene produced popcorn like material. The growth of this material in the mixed monomers was found to be far greater than that observed in chloroprene. Mixtures of the two monomers produced a maximum growth of the chloroprene popcorn polymer at 70% chloroprene which was about 20 times as fast as that of normal chloroprene popcorn polymer in pure chloroprene monomer. (author)

  7. A novel adjuvant: polymerised serum albumin beads

    There is an ongoing need to develop new vaccine formulations. To complement accumulating knowledge on the structure of antigens and their interaction with cells of the immune system, new vaccine vehicles to optimise the immunogenic potential of the antigen must be developed. Associated with this adjuvanticity, should be minimal adverse side effects. This study was initiated to develop a vaccine vehicle, consisting of covalently cross-linked serum albumin beads, themselves non-immunogenic, containing virus. Following inoculation, in vivo proteolysis of the beads would allow a gradual release of antigen for sustained immunostimulation. This system might have application in virus vaccine programmes to improve low immunogenic vaccines, to allow optimal delivery of the recently derived synthetic virus subunit peptides as well as for inactivated virus vaccine preparations. 35S-methionine labelled Blue Tongue Virus was used in this study

  8. Digital model for harmonic interactions in AC/DC/AC systems

    Guarini, A.P.; Rangel, R.D.; Pilotto, L.A.S.; Pinto, R.J.; Passos Junior, R. [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)

    1994-12-31

    The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.

  9. A Comparison Between Two Average Modelling Techniques of AC-AC Power Converters

    Pawel Szczesniak

    2015-03-01

    Full Text Available In this paper, a comparative evaluation of two modelling tools for switching AC-AC power converters is presented. Both of them are based on average modelling techniques. The first approach is based on the circuit averaging technique and consists in the topological manipulations, applied to a converters states. The second approach makes use of state-space averaged model of the converter and is based on analytical manipulations using the different state representations of a converter. The two modelling techniques are applied to a same AC-AC converter called matrix-reactance frequency converter based on buck-boost topology. These techniques are compared on the basis of their rapidity, quantity of calculations and transformations and its limitations.

  10. High voltage AC/AC electrochemical capacitor operating at low temperature in salt aqueous electrolyte

    Abbas, Qamar; Béguin, François

    2016-06-01

    We demonstrate that an activated carbon (AC)-based electrochemical capacitor implementing aqueous lithium sulfate electrolyte in 7:3 vol:vol water/methanol mixture can operate down to -40 °C with good electrochemical performance. Three-electrode cell investigations show that the faradaic contributions related with hydrogen chemisorption in the negative AC electrode are thermodynamically unfavored at -40 °C, enabling the system to work as a typical electrical double-layer (EDL) capacitor. After prolonged floating of the AC/AC capacitor at 1.6 V and -40°C, the capacitance, equivalent series resistance and efficiency remain constant, demonstrating the absence of ageing related with side redox reactions at this temperature. Interestingly, when temperature is increased back to 24 °C, the redox behavior due to hydrogen storage reappears and the system behaves as a freshly prepared one.

  11. Rapid cycling synchrotron magnet with separate ac and dc circuit

    In present rapid cycling synchrotron magnets ac and dc currents flow in the same coil to give the desired field. The circuit reactance is made zero at dc and the operating frequency by running the magnet in series with an external parallel resonant LC current. We propose to return the ac flux in a gap next to the synchrotron. The dc coil encloses the ac magnetic circuit and thus links no ac flux. A shorted turn between the dc coil and ac flux enhances the separation of the two circuits. Several interesting developments are possible. The dc coil could be a stable superconductor to save power. The ac flux return gap could be identical with the synchrotron gap and contain a second synchrotron. This would double the output of the system. If the return flux gap were used for a booster, the ac coil power could be greatly reduced or radiation hardening of the ac coil could be simplified

  12. Plasma dynamics of a laser filamentation-guided spark

    Point, Guillaume; Carbonnel, Jérôme; Mysyrowicz, André; Houard, Aurélien

    2016-01-01

    We investigate experimentally the plasma dynamics of a centimeter-scale, laser filamentation-guided spark discharge. Using electrical and optical diagnostics to study monopolar discharges with varying current pulses we show that plasma decay is dominated by free electron recombination if the current decay time is shorter than the recombination characteristic time. In the opposite case, the plasma electron density closely follows the current evolution. We demonstrate that this criterion holds true in the case of damped AC sparks, and that alternative current is the best option to achieve a long plasma lifetime for a given peak current.

  13. Design of Three Phase Matrix Converter AC-AC Utility Power Supply using SPWM Technique

    Sagar.S.Pawar; Prakash.T.Patil

    2015-01-01

    This paper describes the control analysis and design of an three phase matrix AC-AC utility power supply .The SPWM modulation techniques is used to control the desired output voltage and gives the control output voltage and reduced input harmonic distortions .In this Matrix converter Input is directly connected to output no DC link components is required. Simulation had been done using mat lab simulink and Simulated results are observed

  14. Design of Three Phase Matrix Converter AC-AC Utility Power Supply using SPWM Technique

    Sagar. S. Pawar

    2015-04-01

    Full Text Available This paper describes the control analysis and design of an three phase matrix AC-AC utility power supply .The SPWM modulation techniques is used to control the desired output voltage and gives the control output voltage and reduced input harmonic distortions .In this Matrix converter Input is directly connected to output no DC link components is required. Simulation had been done using mat lab simulink and Simulated results are observed

  15. A Comparison Between Two Average Modelling Techniques of AC-AC Power Converters

    Pawel Szczesniak

    2015-01-01

    In this paper, a comparative evaluation of two modelling tools for switching AC-AC power converters is presented. Both of them are based on average modelling techniques. The first approach is based on the circuit averaging technique and consists in the topological manipulations, applied to a converters states. The second approach makes use of state-space averaged model of the converter and is based on analytical manipulations using the different state representations of a converter. The two m...

  16. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    Ljusev, P.; Andersen, Michael A.E.

    2005-07-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration. (au)

  17. Implementation of Low Frequency Ac to High Frequency Ac with Single Stage Zvs-Pwm Inverter

    S. Arumugam S. Ramareddy M. Sridhar

    2011-01-01

    This paper presents a novel soft-switching pulse width modulation (PWM) utility frequency AC to high frequency (HF) AC power conversion circuit incorporating boost-active clamp single stage inverter topology. This power converter is more suitable and acceptable for cost effective HF consumer induction heating applications. Its operating principle is presented. The operating performances of this high frequency inverter using the latest insulated gate bipolar transistors are illustrated, which ...

  18. Adaptive Nonlinear Control of Induction Motors through AC/DC/AC Converters

    Elfadili, Abderrahim; Giri, Fouad; El Magri, Abdelmounime; Dugard, Luc; Chaoui, Fatima Zara

    2012-01-01

    The problem of controlling induction motors, together with associated AC/DC rectifiers and DC/AC inverters, is addressed. The control objectives are threefold: (i) the motor speed should track any reference signal despite mechanical parameter uncertainties and variations; (ii) the DC Link voltage must be tightly regulated; (iii) the power factor correction (PFC) w.r.t. the power supply net must be performed in a satisfactory way. First, a nonlinear model of the whole controlled system is deve...

  19. Robust control of synchronous motors through AC/DC/AC converters

    El Magri, Abdelmounime; Giri, Fouad; Abouloifa, Abdelmajid; Chaoui, Fatima Zara

    2010-01-01

    The problem of controlling synchronous motors, driven through AC/DC rectifiers and DC/AC inverters is addressed. The control objectives are three fold: (i) forcing the motor speed to track a varying reference signal in presence of motor parameter uncertainties;(ii) regulating the DC Link voltage; (iii )assuring a satisfactory power factor correction (PFC) with respect to the power supply net .First, a nonlinear model of the whole controlled system is developed in the Park-coordinates. Then, a...

  20. A new class of hybrid AC/AC direct power converters

    Klumpner, Christian; Wijekoon, Thiwanka; Wheeler, Patrick

    2005-01-01

    Variable voltage and variable frequency conversion of electrical energy from an AC source to an AC load is done in traditional power converters via a DC-link where an energy storage element (electrolytic capacitors) is situated. Despite its well-known benefits, it has the disadvantage of being bulky and to limit the converter lifetime. On the other hand, Direct Power Conversion (DPC) is an attractive concept, which doesn’t need an energy storage buffer, but has two main disadvantages: reduced...

  1. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...... will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration....

  2. A New Method for Measuring the Wall Charge Waveforms of AC PDP

    梁志虎; 刘祖军; 刘纯亮

    2004-01-01

    A new method is developed to measure the wall charge waveforms in coplanar alternating current plasma display panel (AC PDP). In the method, two groups of display electrodes are selected from a coplanar AC PDP and two capacitors are respectively connected with these two groups of display electrodes in series, and a measuring circuit and a reference circuit are thus constructed. With the help of special processing, discharge takes place in the cells included in the measuring circuit under a normal drive voltage but no discharge takes place in the cells included in the reference circuit under a normal drive voltage. The wall charge waveforms are obtained from the voltage difference between the two capacitors. Using the method, the wall charge waveforms are measured during resetting period, addressing period and sustaining period for the 304.8 mm (12-inch) test PDP panel. The result shows that the wall voltage is about 96 V during the sustaining period.

  3. AC losses in a HTS coil carrying DC current in AC external magnetic field

    We electrically measured AC losses in a Bi2223/Ag-sheathed pancake coil excited by a DC current in AC external magnetic field. Losses in the coil contain two kinds of loss components that are the magnetization losses and dynamic resistance losses. In the measurement, current leads to supply a current to the coil were specially arranged to suppress electromagnetic coupling between the coil current and the AC external magnetic field. A double pick-up coils method was used to suppress a large inductive voltage component contained in voltage signal for measuring the magnetization losses. It was observed that the magnetization losses were dependent on the coil current and that a peak of a curve of the loss factor vs. amplitude of the AC external magnetic field shifted to lower amplitude of the AC magnetic field as the coil current increased. This result suggests the full penetration magnetic field of the coil tape decreases as the coil current increases. The dynamic resistance losses were measured by measuring a DC voltage appearing between the coil terminals. It was observed that the DC voltage appearing in the coil subject to the AC external magnetic field was much larger than that in the coil subject to DC magnetic field

  4. Increased plasma citrulline in mice marks diet-induced obesity and may predict the development of the metabolic syndrome

    Sailer, M.; Dahlhoff, C.; Giesbertz, P.; Eidens, M.K.; Wit, de N.J.W.; Rubio-Aliaga, I.; Boekschoten, M.V.; Müller, M.R.; Daniel, H.

    2013-01-01

    Article About the Authors Metrics Comments Related Content Abstract Introduction Results Discussion Materials and Methods Supporting Information Acknowledgments Author Contributions References Reader Comments (0) Figures Abstract In humans, plasma amino acid concentrations of branched-chain amino ac

  5. 21 CFR 880.5500 - AC-powered patient lift.

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered patient lift. 880.5500 Section 880.5500... Devices § 880.5500 AC-powered patient lift. (a) Identification. An AC-powered lift is an electrically powered device either fixed or mobile, used to lift and transport patients in the horizontal or...

  6. AC LED的研究现状与发展%Current research and development of AC LED

    满瑞; 李秋俊

    2012-01-01

    介绍了AC LED的特征及其工作原理,分析了AC LED相比于DC LED的优缺点,概述了AC LED在国内外的研究进展及其应用现状,讨论了AC LED技术发展过程中面临的挑战,并展望了其发展趋势.%The characteristics and operation principles of AC LED were presented.The advantages and disadvantages of AC LED compared with the DC LED were analyzed.The development and the latest application of AC LED were described.The challenges of the competition with the traditional light source were discussed,as well as the development trend of AC LED.

  7. The anti-inflammatory peptide Ac-SDKP is released from thymosin-β4 by renal meprin-α and prolyl oligopeptidase.

    Kumar, Nitin; Nakagawa, Pablo; Janic, Branislava; Romero, Cesar A; Worou, Morel E; Monu, Sumit R; Peterson, Edward L; Shaw, Jiajiu; Valeriote, Frederick; Ongeri, Elimelda M; Niyitegeka, Jean-Marie V; Rhaleb, Nour-Eddine; Carretero, Oscar A

    2016-05-15

    N-acetyl-seryl-aspartyl-lysyl-proline (Ac-SDKP) is a natural tetrapeptide with anti-inflammatory and antifibrotic properties. Previously, we have shown that prolyl oligopeptidase (POP) is involved in the Ac-SDKP release from thymosin-β4 (Tβ4). However, POP can only hydrolyze peptides shorter than 30 amino acids, and Tβ4 is 43 amino acids long. This indicates that before POP hydrolysis takes place, Tβ4 is hydrolyzed by another peptidase that releases NH2-terminal intermediate peptide(s) with fewer than 30 amino acids. Our peptidase database search pointed out meprin-α metalloprotease as a potential candidate. Therefore, we hypothesized that, prior to POP hydrolysis, Tβ4 is hydrolyzed by meprin-α. In vitro, we found that the incubation of Tβ4 with both meprin-α and POP released Ac-SDKP, whereas no Ac-SDKP was released when Tβ4 was incubated with either meprin-α or POP alone. Incubation of Tβ4 with rat kidney homogenates significantly released Ac-SDKP, which was blocked by the meprin-α inhibitor actinonin. In addition, kidneys from meprin-α knockout (KO) mice showed significantly lower basal Ac-SDKP amount, compared with wild-type mice. Kidney homogenates from meprin-α KO mice failed to release Ac-SDKP from Tβ4. In vivo, we observed that rats treated with the ACE inhibitor captopril increased plasma concentrations of Ac-SDKP, which was inhibited by the coadministration of actinonin (vehicle, 3.1 ± 0.2 nmol/l; captopril, 15.1 ± 0.7 nmol/l; captopril + actinonin, 6.1 ± 0.3 nmol/l; P urinary Ac-SDKP after actinonin treatment. We conclude that release of Ac-SDKP from Tβ4 is mediated by successive hydrolysis involving meprin-α and POP. PMID:26962108

  8. Generation of radiation by intense plasma and electromagnetic undulators

    We examine the characteristics of the classical radiation emission resulting from the interaction of a relativistic electron beam that propagates perpendicularly through a large amplitude relativistic plasma wave. Such a study is useful for evaluating the feasibility of using relativistic plasma waves as extremely short wavelength undulators for generating short wavelength radiation. The electron trajectories in a plasma wave undulator and in an ac FEL undulator are obtained using perturbation techniques. The spontaneous radiation frequency spectrum and angular distribution emitted by a single electron oscillating in these two undulators are then calculated. The radiation gain of a copropagating electromagnetic wave is calculated. The approximate analytic results for the trajectories, spontaneous radiation and gain are compared with 3-D simulation results. The characteristics of the plasma wave undulator are compared with the ac FEL undulator and linearly polarized magnetic undulator. 50 refs., 26 figs., 3 tabs

  9. Dicty_cDB: FCL-AC08 [Dicty_cDB

    Full Text Available FCL (Link to library) FCL-AC08 (Link to dictyBase) - - - Contig-U15080-1 FCL-AC08P ...(Link to Original site) FCL-AC08F 616 FCL-AC08Z 291 FCL-AC08P 907 - - Show FCL-AC08 Library FCL (Link to library) Clone ID FCL-...-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-AC08Q....Seq.d/ Representative seq. ID FCL-AC08P (Link to Original site) Representative DNA sequence >FCL-AC08 (FCL-AC08Q) /CSM/FCL/FCL-...ignificant alignments: (bits) Value FCL-AC08 (FCL-AC08Q) /CSM/FCL/FCL-AC/FCL-AC08Q.Seq.d/ 1322 0.0 SFA226 (S

  10. Plasma theory and simulation. Quarterly progress report I, II, January 1-June 30, 1984

    Our group uses theory and simulation as tools in order to increase the understanding of instabilities, heating, transport, and other phenomena in plasmas. We also work on the improvement of simulation both theoretically and practically. Research in plasma theory and simulation has centered on the following: (1) electron Bernstein wave investigations; (2) simulation of plasma-sheath region, including ion reflection; (3) single ended plasma device, general behavior dc or ac; (4) single ended plasma device, unstable states; (5) corrections to time-independent Q-machine equilibria; (6) multifluid derivation of the Alfven ion-cyclotron linear dispersion relation; and (7) potential barrier between hot and cool plasmas

  11. Plasma physics

    Drummond, James E

    2013-01-01

    A historic snapshot of the field of plasma physics, this fifty-year-old volume offers an edited collection of papers by pioneering experts in the field. In addition to assisting students in their understanding of the foundations of classical plasma physics, it provides a source of historic context for modern physicists. Highly successful upon its initial publication, this book was the standard text on plasma physics throughout the 1960s and 70s.Hailed by Science magazine as a ""well executed venture,"" the three-part treatment ranges from basic plasma theory to magnetohydrodynamics and microwa

  12. Plasma undulator

    Two types of the undulator which is developed as a generator of the highly brilliant light for the synchrotron radiation sources and the free electron lasers, are newly proposed using the array of slender plasmas columns. One is the magnetic field type, in which the undulator force on the relativistic electron beam is generated with the electric current flowing through the plasma columns. The other is the electric field type, in which the undulator force is generated with the periodic variation of the density between the slender plasma columns. The production methods and stabilization ones of plasma columns are discussed. (author)

  13. Radioligand assay on β-adrenoreceptor, AC and cAMP levels during myocardial ischemia

    To investigate β-adrenoreceptor (β-AR) signal transduction during myocardial ischemia and the effect of Sini Decoction, the β-AR was blocked by propranolol, myocardial ischemia was induced by giving a booster dose of pituitrin in rats. The density of β-AR was detected by radioligand binding assay. The AC activity on cardiac cellular membranes and cAMP level in plasma and myocardium was detected by RIA. The results showed that the density of β-AR in myocardial ischemia groups was up-regulated (P < 0.01), but the AC activity and cAMP levels in plasma and myocardium in myocardial ischemia group were lower than normal control group (P < 0.01). The Sini Decoction (SD) can increase the density of β-AR on cardiac cellular membranes and cAMP levels in plasma (P < 0.01). Sini Decoction can reduce the desensitization of β-AR during myocardial ischemia and improve signal transduction of β-AR

  14. Investigation of the influence of divertor recycling on global plasma confinement in JET

    Tamain, P.; Joffrin, E.; Bufferand, H.; Brezinsek, S.; Beurskens, M.; Ciraolo, G.; Clever, M.; Giroud, C.; Dejarnac, Renaud; Drewelow, P.; Delabie, E.; Devaux, S.; Groth, M.; Hacquin, S.; Lipschutz, B.; Marsen, S.; Meigs, A.; Lomas, P.; Nunes, I.; Oberkofler, M.; Solano, E.; Wiesen, S.

    Toki City : National Institute for Fusion Science, 2014. O33-O33. [International Conference on Plasma Surface Interactions 2014/21./. 26.05.2014-30.05.2014, Kanazawa] Institutional support: RVO:61389021 Keywords : Confinement * JET * recycling * ILW Subject RIV: BL - Plasma and Gas Discharge Physics http://psi2014.nifs.ac.jp/Files/Files/Abstracts/O33_Tamain_PSI2014.pdf

  15. Fractional ac Josephson effect in unconventional superconductors

    For certain orientations of Josephson junctions between two px-wave or two d-wave superconductors, the subgap Andreev bound states produce a 4π-periodic relation between the Josephson current I and the phase difference ψ: I propor to sin(ψ/2) . Consequently, the ac Josephson current has the fractional frequency eV/h where V is the dc voltage. In the tunneling limit, the Josephson current is proportional to the first power (not square) of the electron tunneling amplitude. Thus, the Josephson current between unconventional superconductors is carried by single electrons, rather than by Cooper pairs. The fractional ac Josephson effect can be observed experimentally by measuring frequency spectrum of microwave radiation from the junction

  16. AC motor drive system for electric cars

    Morohoshi, Yukinobu; Yoshinori, Naoto; Naito, Hironobu (Fuji Electric Co., Ltd., Tokyo, (Japan))

    1989-08-10

    Various main circuit equipment with large capacity GTO thyristors are outlined for AC and DC electric cars. The configuration of a PWM converter system is presented for the AC main motor drive system of the Shinkansen trains, and its following features are described: the high power factor control capable of keeping a power factor 100% constantly, energy saving by power regenerative braking, the small triple structure with large capacity reverse-conducting GTO thyristors of 4,500V/3,000A, and the reduction of equivalent interfering current and harmonic current by three phase-triple phase difference operation. Furthermore, a control logic equipment with 16 bit MPU and a main transformer are outlined, and the verification test results of the control logic equipment by an analog model simulation and the combinational test results of the commercial equipment are reported. Prototype VVVF inverter system for DC electric cars is also presented. 6 refs., 13 figs., 3 tabs.

  17. β-delayed fission from 230Ac

    ThO2 is irradiated with 60 MeV/u 18O beams. 230Ra is produced via the multi-nucleon transfer and dissipative fragmentation reactions of the target. 230Ra is radio-chemical separated from ThO2 and the other reaction products. The thin Ra sources are prepared. The mica fission track detectors are exposed to the Ra sources. γ-rays of Ra decay in the sources are measured by a HPGe detector. The mica foil is etched in HF solution. The etched mica foil is scanned with an optical microscope. The fission tracks that should come from β-delayed fission of 230Ac are observed. The β-delayed fission probability of 230Ac is determined to be (1.19 +- 0.85) x 10-8

  18. Comparison of the characteristics of atmospheric pressure plasma jets using different working gases and applications to plasma-cancer cell interactions

    Hea Min Joh; Sun Ja Kim; Chung, T. H.; Leem, S H

    2013-01-01

    Atmospheric pressure plasma jets employing nitrogen, helium, or argon gases driven by low-frequency (several tens of kilohertz) ac voltage and pulsed dc voltage were fabricated and characterized. The changes in discharge current, optical emission intensities from reactive radicals, gas temperature, and plume length of plasma jets with the control parameters were measured and compared. The control parameters include applied voltage, working gas, and gas flow rate. As an application to plasma-c...

  19. AC Dielectrophoresis Using Elliptic Electrode Geometry

    S. M. Rezaul Hasan; Aanan Khurma

    2011-01-01

    This paper presents negative AC dielectrophoretic investigations using elliptic electrode geometry. Simulations of the electric field gradient variation using various ratios of the semimajor and the semiminor axis were carried out to determine the optimum elliptic geometry for the dielectrophoretic electrokinetics of specimen in an assay with laminar (low Reynolds number) fluid flow. Experimental setup of the elliptic electrode assembly using PCB fabrication and electrokinetic accumulation of...

  20. Lazy AC-Pattern Matching for Rewriting

    Belkhir, Walid; 10.4204/EPTCS.82.3

    2012-01-01

    We define a lazy pattern-matching mechanism modulo associativity and commutativity. The solutions of a pattern-matching problem are stored in a lazy list composed of a first substitution at the head and a non-evaluated object that encodes the remaining computations. We integrate the lazy AC-matching in a strategy language: rewriting rule and strategy application produce a lazy list of terms.

  1. Entropy production in ac-calorimetry

    Garden, Jean-Luc; Richard, Jacques

    2007-01-01

    In calorimetry and particularly in heat capacity measurements, different characteristic relaxation time constants may perturb the experiment which cannot be considered at thermodynamic equilibrium. In this case, thermodynamics of irreversible processes has to be taken into account and the calorimetric measurements must be considered as dynamic. In a temperature modulated experiment, such as ac-calorimetry, these non-equilibrium experiments give rise to the notion of frequency dependent comple...

  2. Plasma reactor

    Molina Mansilla, Ricardo; Erra Serrabasa, Pilar; Bertrán Serra, Enric

    2008-01-01

    [EN] A plasma reactor that can operate in a wide pressure range, from vacuum and low pressures to atmospheric pressure and higher pressures. The plasma reactor is also able to regulate other important settings and can be used for processing a wide range of different samples, such as relatively large samples or samples with rough surfaces.

  3. Plasma properties

    The Magneto-Fluid Dynamics Division continues to study a broad range of problems originating in plasma physics. Its principal focus is fusion plasma physics, and most particularly topics of particular significance for the world magnetic fusion program. During the calendar year 1990 we explored a wide range of topics including RF-induced transport as a plasma control mechanism, edge plasma modelling, further statistical analysis of L and H mode tokamak plasmas, antenna design, simulation of the edge of a tokamak plasma and the L-H transition, interpretation of the CCT experimental results at UCLA, turbulent transport, studies in chaos, the validity of moment approximations to kinetic equations and improved neoclassical modelling. In more basic studies we examined the statistical mechanisms of Coulomb systems and applied plasma ballooning mode theory to conventional fluids in order to obtain novel fluid dynamics stability results. In space plasma physics we examined the problem of reconnection, the effect of Alfven waves in space environments, and correct formulation of boundary conditions of the Earth for waves in the ionosphere

  4. Development of a hardware-based AC microgrid for AC stability assessment

    Swanson, Robert R.

    As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.

  5. PLASMA DEVICE

    Baker, W.R.

    1961-08-22

    A device is described for establishing and maintaining a high-energy, rotational plasma for use as a fast discharge capacitor. A disc-shaped, current- conducting plasma is formed in an axinl magnetic field and a crossed electric field, thereby creating rotational kinetic enengy in the plasma. Such energy stored in the rotation of the plasma disc is substantial and is convertible tc electrical energy by generator action in an output line electrically coupled to the plasma volume. Means are then provided for discharging the electrical energy into an external circuit coupled to the output line to produce a very large pulse having an extremely rapid rise time in the waveform thereof. (AE C)

  6. Plasma universe

    Traditionally the views in our cosmic environment have been based on observations in the visual octave of the electromagnetic spectrum, during the last half-century supplemented by infrared and radio observations. Space research has opened the full spectrum. Of special importance are the X-ray-gamma-ray regions, in which a number of unexpected phenomena have been discovered. Radiations in these regions are likely to originate mainly from magnetised cosmic plasma. Such a medium may also emit synchrotron radiation which is observable in the radio region. If we try to base a model of the universe on the plasma phenomena mentioned we find that the plasma universe is drastically different from the traditional visual universe. Information about the plasma universe can also be obtained by extrapolation of laboratory experiments and magnetospheric in situ measurements of plasma. This approach is possible because it is likely that the basic properties of plasma are the same everywhere. In order to test the usefulness of the plasma universe model we apply it to cosmogony. Such an approach seems to be rather successful. For example, the complicated structure of the Saturnian C ring can be accounted for. It is possible to reconstruct certain phenomena 4-5 bilions years ago with an accuracy of better than 1 percent

  7. Implementation of Low Frequency Ac to High Frequency Ac with Single Stage Zvs-Pwm Inverter

    S. Arumugam S. Ramareddy M. Sridhar

    2011-12-01

    Full Text Available This paper presents a novel soft-switching pulse width modulation (PWM utility frequency AC to high frequency (HF AC power conversion circuit incorporating boost-active clamp single stage inverter topology. This power converter is more suitable and acceptable for cost effective HF consumer induction heating applications. Its operating principle is presented. The operating performances of this high frequency inverter using the latest insulated gate bipolar transistors are illustrated, which includes HFAC power regulation ranges and actual efficiency characteristics based on zero voltage soft switching operation ranges.. The simulation circuits are models are developed and they are simulated using ORCAD.

  8. Implementation and Control of an AC/DC/AC Converter for Double Wound Flywheel Application

    Oliveira, J. G.; Schettino, H.; Gama, V; Carvalho, R.; H. Bernhoff

    2012-01-01

    An all-electric driveline based on a double wound flywheel, connected in series between main energy storage and a wheel motor, is presented. The flywheel works as a power buffer, allowing the battery to deliver optimized power. It also separates electrically the system in two sides, with the battery connected to the low voltage side and the wheel motor connected to the high voltage side. This paper presents the implementation and control of the AC/DC/AC converter, used to connect the flywheel...

  9. GRID-CONNECTECD DOUBLE-STAGE AC-AC POWER CONVERTER FOR CSP RENEWABLE ENERGY SYSTEMS

    Sorrentino, Vincenzo

    2015-01-01

    In the last years the renewable energy sources have known a state of their advanced diffusion considering their advantages compared to the traditional energy sources like fossil fuels. For this reason the combined heat and power (CHP) plant fueled by renewable sources are widely used. The purpose of this Ph.D. thesis is the design of a new Grid-connected Double-Stage AC-DC/DC-AC Power Converter (DSACPC) for a Concentrating Solar plant for Combined generation of Heat and Power (CS-CHP), th...

  10. AcEST Contig - AcEST | LSDB Archive [Life Science Database Archive metadata

    Full Text Available [ Credit s ] BLAST Search Image Search Home About Archive Update History Contact us AcEST AcEST C ... c.jp/togodb/view/archive_acestcontig#en Data acquisit ion method - Data analysis method - Number of data ... entries 4,298 entries Data it em Description Contig ID ID of contig sequence of A ... ris Number of clones The number of EST clones constit uting the contig sequence of Adiantum capillus-vene ... ris Definit ion Definit ion Link to clone list In the TogoDB edi ...

  11. Realization of a Direct Soft Switching AC/AC Converter for Wireless Power Transfer Applications

    Vuorsalo, Simo

    2015-01-01

    This thesis describes the design, realization and testing of a three-phase to one-phase direct AC/AC converter, also known as the matrix converter. The switching is using the soft-switching strategy which is also known in the literature as the Zero Current Switching strategy. To achieve ZCS, the circuit needs resonant behavior which is achieved by the transmitter primary side that is an LC circuit. This circuit acts as a tank circuit and the switching frequency is the resonant frequency of th...

  12. Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count

    Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin;

    2007-01-01

    This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled to...... low cost alternative to sensitive applications that need to ride-through frequent input voltage sags. For confirming the converter performance, experimental testing using a constructed laboratory prototype is performed with its captured results presented in a later section of the paper....

  13. Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count

    Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin;

    2009-01-01

    This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low-cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled to...... semiconductor commutations, and hence, no increase in switching losses. The proposed converter therefore offers a low-cost alternative to applications that need to ride through frequent input voltage sags. For confirming the converter performance, experimental testing using a constructed laboratory prototype is...

  14. Plasma physics

    This report contains the papers delivered at the AEB - Natal University summer school on plasma physics held in Durban during January 1979. The following topics were discussed: Tokamak devices; MHD stability; trapped particles in tori; Tokamak results and experiments; operating regime of the AEB Tokamak; Tokamak equilibrium; high beta Tokamak equilibria; ideal Tokamak stability; resistive MHD instabilities; Tokamak diagnostics; Tokamak control and data acquisition; feedback control of Tokamaks; heating and refuelling; neutral beam injection; radio frequency heating; nonlinear drift wave induced plasma transport; toroidal plasma boundary layers; microinstabilities and injected beams and quasilinear theory of the ion acoustic instability

  15. Theoretical study of electromagnetic electron cyclotron waves in the presence of AC field in Uranian magnetosphere

    Pandey, R. S.; Kaur, Rajbir

    2015-10-01

    Electromagnetic electron cyclotron (EMEC) waves with temperature anisotropy in the magnetosphere of Uranus have been studied in present work. EMEC waves are investigated using method of characteristic solution by kinetic approach, in presence of AC field. In 1986, Voyager 2 encounter with Uranus revealed that magnetosphere of Uranus exhibit non-Maxwellian high-energy tail distribution. So, the dispersion relation, real frequency and growth rate are evaluated using Lorentzian Kappa distribution function. Effect of temperature anisotropy, AC frequency and number density of particles is found. The study is also extended to oblique propagation of EMEC waves in presence and absence of AC field. Through comprehensive mathematical analysis it is found that when EMEC wave propagates parallel to intrinsic magnetic field of Uranus, its growth is more enhanced than in case of oblique propagation. Results are also discussed in context to magnetosphere of Earth and also gives theoretical explanation to existence of high energetic particles observed by Voyager 2 in the magnetosphere of Uranus. The results can present a further insight into the nature of electron-cyclotron instability condition for the whistler mode waves in the outer radiation belts of Uranus or other space plasmas.

  16. Plasma carnitine concentrations after chronic alcohol intoxication 

    Alina Kępka

    2013-05-01

    Full Text Available Background: Carnitine transports fatty acids from the cytoplasm to the mitochondrial matrix, where the fatty acids are oxidized. Chronic alcohol consumption reduces the concentration of carnitine and interferes with oxidative processes occurring in the cell.Aim: The assessment of carnitine concentrations in plasma of chronically intoxicated alcohol dependent persons in a 49-day abstinence period.Material/Methods: The study included 31 patients (5 women and 27 men aged from 26 to 60 years (44.6± 8.9 and 32 healthy subjects (15 women and 17 men aged 22-60 years (39.8± 9.4. The patients’ alcohol dependence ranged from 2 to 30 years (13.6± 7.5. Examined subjects consumed 75-700 g of ethanol/day (226.9± 151.5. Plasma concentrations of free and total carnitine were measured three times: at the first (T0, 30th (T30 and 49th (T49 day of hospital detoxification. Free (FC and total (TC carnitine were determined by the spectrophotometric method. Plasma acylcarnitine (AC concentration was calculated from the difference between TC and FC; then the AC/FC ratio was calculated. To determine statistically significant differences for related variables, Student’s t-test was used.Results: At T0, alcoholics had significantly lower concentration of FC and TC (p < 0.05 in plasma, as compared to the control group. In comparison to controls, at T30, plasma TC and FC (p < 0.01 as well as AC (p < 0.001 were reduced. The lowest concentration of TC, FC and AC (p < 0.001was found at T49. The ratio of AC/FC at T0 had a tendency to be higher in alcoholics than in the control group (p = 0.05, whereas at T49 it was significantly lower in alcoholics as compared to the control subjects (p < 0.05.Conclusions: Chronic alcohol intoxication causes a plasma deficiency of carnitine. Forty-nine days of abstinence showed a significant decrease in the concentration of TC, FC and AC. Further research is necessary to clarify whether a low level of plasma carnitine

  17. How cholesterol homeostasis is regulated by plasma membrane cholesterol in excess of phospholipids

    Lange, Yvonne; Ye, Jin; Steck, Theodore L.

    2004-01-01

    How do cells sense and control their cholesterol levels? Whereas most of the cell cholesterol is located in the plasma membrane, the effectors of its abundance are regulated by a small pool of cholesterol in the endoplasmic reticulum (ER). The size of the ER compartment responds rapidly and dramatically to small changes in plasma membrane cholesterol around the normal level. Consequently, increasing plasma membrane cholesterol in vivo from just below to just above the basal level evoked an ac...

  18. AC electric trapping of neutral atoms

    Schlunk, S.

    2008-01-01

    Several types of diamond layers have been deposited on molybdenum tiles by chemical vapour deposition techniques, and exposed under erosion-dominated conditions in the SOL of TEXTOR in order to assess them as a suitable candidate for plasma-facing material. Post-exposure characterisation of physical properties and surface modification induced by the plasma was performed by SEM imaging, investigation of diamond surface by micro-Raman spectroscopy and deuterium retention measurements by NRA. Th...

  19. Dicty_cDB: FCL-AC03 [Dicty_cDB

    Full Text Available FCL (Link to library) FCL-AC03 (Link to dictyBase) - - - Contig-U16477-1 FCL-AC03P ...(Link to Original site) FCL-AC03F 538 FCL-AC03Z 570 FCL-AC03P 1108 - - Show FCL-AC03 Library FCL (Link to library) Clone ID FCL-...7-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-AC03Q....Seq.d/ Representative seq. ID FCL-AC03P (Link to Original site) Representative DNA sequence >FCL-AC03 (FCL-AC03Q) /CSM/FCL/FCL-...AC/FCL-AC03Q.Seq.d/ AATTTTTAAAAAAAAAAGAAAATAAAAAAAAAAATAATATTTTATTAGTCATTATAAAAT TGTGAAT

  20. Dicty_cDB: FCL-AC20 [Dicty_cDB

    Full Text Available FCL (Link to library) FCL-AC20 (Link to dictyBase) - - - Contig-U15117-1 FCL-AC20Z ...(Link to Original site) - - FCL-AC20Z 600 - - - - Show FCL-AC20 Library FCL (Link to library) Clone ID FCL-A... http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-AC20Q.Seq.d/ Representative seq. ID FCL-...AC20Z (Link to Original site) Representative DNA sequence >FCL-AC20 (FCL-AC20Q) /CSM/FCL/FCL-AC/FCL-...Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FCL-AC20 (FCL-AC20Q) /CSM/FCL/FCL-AC/FCL-

  1. C/NOFS Observations of AC Electric Field Fields Associated with Equatorial Spread-F

    Pfaff, R.; Liebrecht, C.

    2009-01-01

    The Vector Electric Field Investigation (VEFI) on the C/NOFS equatorial satellite provides a unique data set in which to acquire detailed knowledge of irregularities associated with the equatorial ionosphere and in particular with spread-F depletions. We present vector AC electric field observations, primarily gathered within the ELF band (1 Hz to 250 Hz) on C/NOFS that address a variety of key questions regarding how plasma irregularities, from meter to kilometer scales, are created and evolve. The data will be used to explore the anisotropy/isotropy of the waves, their wavelength and phase velocity, as well as their spectral distributions. When analyzed in conjunction with the driving DC electric fields and detailed plasma number density measurements, the combined data reveal important information concerning the instability mechanisms themselves. We also present high resolution, vector measurements of intense lower hybrid waves that have been detected on numerous occasions by the VEFI burst memory VLF electric field channels.

  2. Levantamiento del campo acústico de una fuente sonora subacuática en el tanque hidroacústico del Instituto de Acústica

    Ranz Guerra, Carlos; Cobo, Pedro

    2000-01-01

    6 pp.-- PACS nrs.: 43.30.Jx, 43.30.Sf.-- Comunicación presentada en los siguientes congresos: Acústica 2000, II Congreso Iberoamericano de Acústica. XXXI Congreso Nacional de Acústica: TecniAcústica 2000. II Congreso Ibérico de Acústica. II Jornadas Iberoamericanas de Acústica. EAA Symposium on Architectural Acoustics.

  3. Plasma Cleaning

    Hintze, Paul E.

    2016-01-01

    NASA's Kennedy Space Center has developed two solvent-free precision cleaning techniques: plasma cleaning and supercritical carbon dioxide (SCCO2), that has equal performance, cost parity, and no environmental liability, as compared to existing solvent cleaning methods.

  4. Plasma technology

    IREQ was contracted by the Canadian Electrical Association to review plasma technology and assess the potential for application of this technology in Canada. A team of experts in the various aspects of this technology was assembled and each team member was asked to contribute to this report on the applications of plasma pertinent to his or her particular field of expertise. The following areas were examined in detail: iron, steel and strategic-metals production; surface treatment by spraying; welding and cutting; chemical processing; drying; and low-temperature treatment. A large market for the penetration of electricity has been identified. To build up confidence in the technology, support should be provided for selected R and D projects, plasma torch demonstrations at full power, and large-scale plasma process testing

  5. DC injection into low voltage AC networks

    NONE

    2005-07-01

    This report summarises the results of a study investigating the impact of levels of injected DC current injections on a low voltage AC distribution network systems in order to recommend acceptable limits of DC from microgeneration. Relevant literature is reviewed, and the impact of DC levels in distribution transformers, transformer modelling, and instrumental transformers are discussed. The impact of DC in residual current devices (RCD) and in domestic electricity watt hour meters is examined along with DC enhanced corrosion, corrosion failure, and the measurement of DC current injection. Sources of DC injection outlined include DC from computer power supplies, network faults, geomagnetic phenomena, lighting circuits/dimmers, and embedded generators.

  6. Mapa acústico parcial de Benetusser

    MORILLA CASTELLANOS, EMILIO

    2012-01-01

    Se establece el mapa de ruido del municipio de Benetússer para evaluar y conocer su exposición al ruido ambiental y así poder dar cumplimiento a la Directiva Europea sobre Gestión y Evaluación de Ruido Ambiental (2002/49/CE) y a la Ley nacional 37/2003 del Ruido. Los mapas estratégicos de ruido nos aportan la información fundamental para diagnosticar la situación acústica y para la gestión del ruido ambiental.

  7. An ac biased superconducting flux transformer

    The coupled motion of the vortex lattice of two electrically insulated, superimposed, superconducting thin films (primary and secondary) in a perpendicular magnetic field, is predicted to exhibit a Josephson-like behavior. For a dc applied current flowing in the primary film, the voltage difference between the time-averaged primary and secondary flux flow voltages obeys the equations of a resistively shunted junction model. If an ac current is superimposed on the dc current. Shapiro-type steps are predicted in the current-voltage characteristic. In contrast to the conventional Josephson effect, the voltage positions of these steps can be tuned by the applied magnetic field. (orig.)

  8. Flexible AC transmission systems modelling and control

    Zhang, Xiao-Ping; Pal, Bikash

    2012-01-01

    The extended and revised second edition of this successful monograph presents advanced modeling, analysis and control techniques of Flexible AC Transmission Systems (FACTS). The book covers comprehensively a range of power-system control problems: from steady-state voltage and power flow control, to voltage and reactive power control, to voltage stability control, to small signal stability control using FACTS controllers. In the six years since the first edition of the book has been published research on the FACTS has continued to flourish while renewable energy has developed into a mature and

  9. Plasma confinement

    Hazeltine, R D

    2003-01-01

    Detailed and authoritative, this volume examines the essential physics underlying international research in magnetic confinement fusion. It offers readable, thorough accounts of the fundamental concepts behind methods of confining plasma at or near thermonuclear conditions. Designed for a one- or two-semester graduate-level course in plasma physics, it also represents a valuable reference for professional physicists in controlled fusion and related disciplines.

  10. Plasma Diagnostics

    The success in achieving peaceful fusion power depends on the ability to control a high temperature plasma, which is an object with unique properties, possibly the most complicated object created by humans. Over years of fusion research a new branch of science has been created, namely plasma diagnostics, which involves knowledge of almost all fields of physics, from electromagnetism to nuclear physics, and up-to-date progress in engineering and technology (materials, electronics, mathematical methods of data treatment). Historically, work on controlled fusion started with pulsed systems and accordingly the methods of plasma parameter measurement were first developed for short lived and dense plasmas. Magnetically confined hot plasmas require the creation of special experimental techniques for diagnostics. The diagnostic set is the most scientifically intensive part of a plasma device. During many years of research operation some scientific tasks have been solved while new ones arose. New tasks often require significant changes in the diagnostic system, which is thus a very flexible part of plasma machines. Diagnostic systems are designed to solve several tasks. As an example here are the diagnostic tasks for the International Thermonuclear Experimental Reactor - ITER: (1) Measurements for machine protection and basic control; (2) Measurements for advanced control; (3) Additional measurements for performance evaluation and physics. Every new plasma machine is a further step along the path to the main goal - controlled fusion - and nobody knows in advance what new phenomena will be met on the way. So in the planning of diagnostic construction we should keep in mind further system upgrading to meet possible new scientific and technical challenges. (author)

  11. Plasma Speaker

    Kovář, J

    2015-01-01

    The article describes the design and construction of one-channel plasma speaker. Absence of mechanical membrane gives the plasma speaker no frequency limitation. The design consists of power source to supply control electronic for signal modulation, converter and output transformer. Modulation of audio signal is realized by integrated circuit TL 594 that provides the PWM modulation. Duty cycle and frequency is adjusted by potentiometers. Dual forward converter is used to voltage amplification...

  12. Plasma turbulence

    This paper presents an overview of the progress made in understanding plasma turbulence. It has relied heavily on numerical simulations to gain some intuition on the physical processes underlying nonlinear interaction and as a cross check for quantitative estimates derived from weak turbulence theory or DIA-based strong turbulence theory. The mathematical description of plasmas, especially those confined in a magnetic bottle, is far more complex than the Navier-Stokes fluid. Yet because of the dispersion of the plasma eigenmodes, the DIA perhaps has greater validity in a plasma than in a Navier-Stokes fluid. Recent developments in dynamical-systems theory have not yet been implemented in plasma turbulence at the level discussed in other studies for boundary-layer turbulence. This technique has promise for evaluating the behavior of large eddies, which may dominate plasma transport as a low-order system. In the collisionless, kinetic regime, where turbulence in x, v phase space has to be addressed, the new methods involving noneigenmode entities called clumps and holes, need further evolution to gain complete acceptability. For the future, a combination of analytical tools and numerical methods may afford the optimum route. Some examples of this are revireviewed

  13. Enhancement of adhesion by a transition layer: Deposition of a-C film on ultrahigh molecular weight polyethylene (UHMWPE) by magnetron sputtering

    He, F. F.; Bai, W. Q.; Li, L. L.; Wang, X. L.; Xie, Y. J.; Jin, G.; Tu, J. P.

    2016-02-01

    An amorphous carbon (a-C) film is deposited on the plasma-treated UHMWPE substrate using a closed field unbalanced magnetron sputtering to improve its tribological properties. During the plasma treatment period, a transition layer is prepared by high energy ion bombardment at a bias voltage of -500 V to enhance the adhesion between the a-C film and the substrate. The mechanical and tribological properties of the a-C film were evaluated by nano-indentation and ball-on-disk tribometer. After deposition of a-C film with a thickness 900 nm, the nano-hardness of UHMWPE significantly increases from 47 MPa to 720 MPa and the wear rate decreases from 9.82 × 10-15 m3 N-1 m-1 to 4.78 × 10-15 m3 N-1 m-1 in bovine calf serum solution. The formation of the transition layer is believed to be the reason why the vertical adhesion between the a-C film and the UHMWPE substrate is enhanced.

  14. Plasma photonics in ICF & HED conditions

    Michel, Pierre; Turnbull, David; Divol, Laurent; Pollock, Bradley; Chen, Cecilia Y.; Tubman, Eleanor; Goyon, Clement S.; Moody, John D.

    2015-11-01

    Interactions between multiple high-energy laser beams and plasma can be used to imprint refractive micro-structures in plasmas via the lasers' ponderomotive force. For example, Inertial confinement fusion (ICF) experiments at the National Ignition Facility already rely on the use of plasma gratings to redirect laser light inside an ICF target and tune the symmetry of the imploded core. More recently, we proposed new concepts of plasma polarizer and waveplate, based on two-wave mixing schemes and laser-induced plasma birefringence. In this talk, we will present new experimental results showing the first demonstration of a fully tunable plasma waveplate, which achieved near-perfect circular laser polarization. We will discuss further prospects for novel ``plasma photonics'' concepts based on two- and four-wave mixing, such as optical switches, bandpass filters, anti-reflection blockers etc. These might find applications in ICF and HED experiments by allowing to manipulate the lasers directly in-situ (i.e. inside the targets), as well as for the design of high power laser systems. This work was performed under the auspices of the U.S. Department of Energy by Lawrence Livermore National Laboratory under Contract DE-AC52-07NA27344.

  15. Thermal Plasma Gasification of Biomass for Fuel Gas Production

    Hrabovský, Milan; Hlína, Michal; Konrád, Miloš; Kopecký, Vladimír; Kavka, Tetyana; Chumak, Oleksiy; Mašláni, Alan

    2009-01-01

    Roč. 13, č. 3-4 (2009), s. 299-313. ISSN 1093-3611 R&D Projects: GA ČR GA202/08/1084 Institutional research plan: CEZ:AV0Z20430508 Keywords : Thermal plasma * plasma gasification * syngas * biomass Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 0.333, year: 2009 http://www.begellhouse.com/journals/57d172397126f956,5cbc272245f24168,0ac09d02537962cf.html

  16. An MHD Rotating Machine: A New Type of a.c. Magnetohydrodynamic Power Generator and Turbine

    A new type of MHD machine is proposed in this paper. The conceptual structure of the machine is very similar to that of the conventional three-phase rotating synchronous machine, which consists of the rotor, for exciting the mechanically rotating d. c. magnetic field, and the stator with conventional three-phase a.c. windings. The only difference in concept is the existence of the MHD working fluid flowing in the duct space between the rotor- and the stator in the direction of rotation of the rotor. The paper presents the results of the preliminary theoretical analysis of the machine. It is shown that the machine may be operated as an a.c. MHD electrical power generator or as an electrically- controlled MHD turbine or as the combination of those. As an a.c. generator, the machine may be regarded as the combination of the synchronous and asynchronous generator, and can be operated under such conditions that the rotor is in the self-rotating condition at the synchronous speed, or in other words, that no external drive is required for the rotor. Thus all the energy of the MHD working fluid, except the Joule loss in the fluid itself, is converted into the a.c. electrical power. On the other hand, as an MHD turbine, the d.c. magnetic field of the rotor plays the role of the turbine blades, and in this case a small a.c. current in the stator windings can control the mechanical power output transferred from the working fluid to the turbine rotor. The very interesting results as an a.c. electrical power generator from the practical viewpoint are that (1) under the self- rotating condition the lagging power- factor operation (0.8∼1.0) is possible, cf. the MHD induction generator, and (2) the machine is practically feasible not only by using a liquid metal working fluid together with a relatively low d.c. exciting magnetic field, but also by using the gaseous plasma with a very high d.c. magnetic field excitation. (author)

  17. Estudio acústico del Conservatorio de Piles

    VILLA MORANT, SARA

    2014-01-01

    El objetivo de este proyecto es realizar un estudio acústico general de la "Casa de la Cultura" de Piles, sobre todo de los recintos que más lo requieren, como la sala principal de música. El edificio, al tratarse de una construcción antigua, no reúne las especificaciones acústicas establecidas en el Código Técnico vigente en la actualidad. En primer lugar, se realiza el estudio del acondicionamiento acústico de la sala principal, entendiéndose como acondicionamiento acústico la definición de...

  18. AC Own Motion Percentage of Randomly Sampled Cases

    Social Security Administration — Longitudinal report detailing the numbers and percentages of Appeals Council (AC) own motion review actions taken on un-appealed favorable hearing level decisions...

  19. AC electric motors control advanced design techniques and applications

    Giri, Fouad

    2013-01-01

    The complexity of AC motor control lies in the multivariable and nonlinear nature of AC machine dynamics. Recent advancements in control theory now make it possible to deal with long-standing problems in AC motors control. This text expertly draws on these developments to apply a wide range of model-based control designmethods to a variety of AC motors. Contributions from over thirty top researchers explain how modern control design methods can be used to achieve tight speed regulation, optimal energetic efficiency, and operation reliability and safety, by considering online state var

  20. Study of AC electrical conduction mechanisms in an epoxy polymer

    Jilani, Wissal; Mzabi, Nissaf; Gallot-Lavallée, Olivier; Fourati, Najla; Zerrouki, Chouki; Zerrouki, Rachida; Guermazi, Hajer

    2015-11-01

    The AC conductivity of an epoxy resin was investigated in the frequency range 10^{-1} - 106 Hz at temperatures ranging from -100 to 120 °C. The frequency dependence of σ_{ac} was described by the law: σ_{ac}=ω \\varepsilon0\\varepsilon^''_{HN}+Aωs. The study of temperature variation of the exponent (s) reveals two conduction models: the AC conduction dependence upon temperature is governed by the small polaron tunneling mechanism (SPTM) at low temperature (-100 -60 °C) and the correlated barrier hopping (CHB) model at high temperature (80-120 °C).

  1. Djungle power. A more remote AC bus

    Boehnke, Heinz W. [Technosol, Jork (Germany)

    2010-07-01

    The Dzanga-Sangha Reserve in the Central African Republic is probably one of the world's most remote protected rainforest areas, much to the benefit of the rare species of lowland gorilla, forest elephant and local pygmy population Ba'Aka. The park is co-managed by the ''WWF-World Wide Fund for Nature'' with sponsoring from the German Regenwald-Stiftung. In 2008 wwf decided to switch from the old, failing generator supply to a solar hybrid mini-grid, along with stringent measures of energy conservation and management. After a careful energy audit Technosol designed an AC-bus system with a 22 kWp PV generator which should overcome the dependency on the old generators and their fuel demands. For 15 buildings, an entirely new distribution network was installed, state of the art energy saving devices introduced and an energy metering system deviced. The installation is operating since August 2009. In such remote locations, the reliability of the AC-bus over other generator-based solutions will be demonstrated and with the support of international organisations like the wwf the practical application of solar hybrid supply becomes a landmark of sustainable energy concepts. (orig.)

  2. An improved AC-amplifier for electrophysiology

    Jorgovanović Nikola

    2009-01-01

    Full Text Available We present the design, simulation and test results of a new AC amplifier for electrophysiological measurements based on a three op-amp instrumentation amplifier (IA. The design target was to increase the common mode rejection ratio (CMRR, thereby improving the quality of the recorded physiological signals in a noisy environment. The new amplifier actively suppresses the DC component of the differential signal and actively reduces the common mode signal in the first stage of the IA. These functions increase the dynamic range of the amplifier's first stage of the differential signal. The next step was the realization of the amplifier in a single chip technology. The design and tests of the new AC amplifier with a differential gain of 79.2 dB, a CMRR of 130 dB at 50 Hz, a high-pass cutoff frequency at 0.01 Hz and common mode reduction in the first stage of the 49.8 dB are presented in this paper.

  3. Dicty_cDB: FCL-AC29 [Dicty_cDB

    Full Text Available FCL (Link to library) FCL-AC29 (Link to dictyBase) - - - Contig-U15392-1 FCL-AC29P ...(Link to Original site) FCL-AC29F 104 FCL-AC29Z 591 FCL-AC29P 695 - - Show FCL-AC29 Library FCL (Link to library) Clone ID FCL-...-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-AC29Q....Seq.d/ Representative seq. ID FCL-AC29P (Link to Original site) Representative DNA sequence >FCL-AC29 (FCL-AC29Q) /CSM/FCL/FCL-...roducing significant alignments: (bits) Value VSC293 (VSC293Q) /CSM/VS/VSC2-D/VSC293Q.Seq.d/ 1063 0.0 FCL-AC29 (FCL-

  4. Plasma metallization

    Crowther, J M

    1997-01-01

    Many methods are currently used for the production of thin metal films. However, all of these have drawbacks associated with them, for example the need for UHV conditions, high temperatures, exotic metal precursors, or the inability to coat complex shaped objects. Reduction of supported metal salts by non-isothermal plasma treatment does not suffer from these drawbacks. In order to produce and analyse metal films before they become contaminated, a plasma chamber which could be attached directly to a UHV chamber with XPS capability was designed and built. This allowed plasma treatment of supported metal salts and surface analysis by XPS to be performed without exposure of the metal film to the atmosphere. Non-equilibrium plasma treatment of Nylon 66 supported gold(lll) chloride using hydrogen as the feed gas resulted in a 95% pure gold film, the remaining 5% of the film being carbon. If argon or helium were used as the feed gases during plasma treatment the resultant gold films were 100% pure. Some degree of s...

  5. Plasma properties

    The topics of active research in the calendar year 1989 included: RF induced plasma transport, not only for its effects on the mean particle distribution function but also as a means to enhance confinement of particles and to eliminate relatively cold alpha particle ash; thorough statistical analysis of tokamak data; improved neoclassical transport analysis; deeper analysis of two-fluid Braginskii transport in a tokamak; modelling of the plasma edge and wall interaction problem; reformulation of ballooning mode stability analysis in particularly strong and general terms; MHD modelling of tokamak phenomena, such as H-mode transition, and giant sawteeth, description of highly elongated tokamaks; and analysis of edge plasma RF antenna interactions. Our basic plasma physics studies include: statistical mechanics of Coulomb gases in bounded domains; theory of MHD instabilities with flow; numerical scheme for kinetic equations with nontrivial collision operators, and heat flow in particle simulations induced by discreteness effects. In addition, there is a modest space plasma physics effort funded by non-DOE sources. The studies of heating of the solar corona are strongly affected by work from the fusion program. Equally, work on ballooning modes led to work in magnetotail instabilities and additional solar corona heating mechanisms. We except to keep some research effort in this area. We do not include in this proposal plans for any new work in this field

  6. A Non-linear Controller for Single-Phase AC-AC Power Converter to meet UPS Performance Index

    Abdelhafid Ait Elmahjoub

    2012-07-01

    Full Text Available This article focuses on AC-AC power converter that can be used for uninterruptible power supply (UPS. The converter is built on two stages: a AC-DC input stage and a DC-AC output stage. The two blocks are connected by an intermediate DC bus. The aim of control is threefold: i power factor correction ii regulation of DC bus iii generating a sinusoidal voltage at the output. The synthesis of controllers has been achieved through the technique of nonlinear backstepping control. A detailed analysis of the stability control system is presented. The performances of regulators have been validated by numerical simulation in MATLAB / SIMULINK.

  7. Excitation dynamics of micro-structured atmospheric pressure plasma arrays

    Boettner, H; Waskoenig, J.; Connell, D O '; Winter, J; Schulz-von der Gathen, V

    2010-01-01

    Abstract The spatial dynamics of the optical emission from an array of 50 times 50 individual micro cavity plasma devices are investigated. The array is operated in argon and argon-neon mixtures close to atmospheric pressure with an AC voltage. The optical emission is analysed with phase and space resolution. It has been found that the emission is not continuous over the entire AC period, but occurs once per half period. Each of the observed emission phases shows a self-pulsing of the disc...

  8. The quark gluon plasma

    The quark-gluon plasma (QGP) is a state of matter in which the universe was expected to be a few micro-seconds after the big-bang. Violent collisions of heavy ions are supposed to re-create this state in particle accelerators. Numerous signatures of this fugacious state have already been observed at the RHIC (relativistic heavy ion collider). The first evidence of the violence of collisions is the number of generated particles: about 6000 per collision, mostly hadrons. This figure seems high but in fact is less than theoretically expected and is the first sign of the formation of a QGP that saturates the density of gluons. Another sign, observed at the RHIC is the damping of the particle jets that are produced in the collision. This damping is consistent with the crossing of a medium whose density is so high that it can not be made of hadrons but of partons. In the RHIC experiments the collective behaviour of quarks and gluons shows that they are strongly interacting with one another. This fact supports the idea that the QGP is more a perfect liquid rather than an ideal gas in which quarks and gluons move freely. (A.C.)

  9. Hot electron production, anomalous absorption, and effect of intense electromagnetic fields on inverse bremsstrahlung absorption near the electron plasma frequency

    Anomalous heating was studied on a well-controlled low-density plasma subjected to short microwave pulses. Absorption measurements along with parametric instabilities are described. The influence of intense ac electric fields on the electron-ion collision rate in the plasma is also discussed

  10. Plasma dynamo

    Rincon, F; Schekochihin, A A; Valentini, F

    2015-01-01

    Magnetic fields pervade the entire Universe and, through their dynamical interactions with matter, affect the formation and evolution of astrophysical systems from cosmological to planetary scales. How primordial cosmological seed fields arose and were further amplified to $\\mu$Gauss levels reported in nearby galaxy clusters, near equipartition with kinetic energy of plasma motions and on scales of at least tens of kiloparsecs, is a major theoretical puzzle still largely unconstrained by observations. Extragalactic plasmas are weakly collisional (as opposed to collisional magnetohydrodynamic fluids), and whether magnetic-field growth and its sustainment through an efficient dynamo instability driven by chaotic motions is possible in such plasmas is not known. Fully kinetic numerical simulations of the Vlasov equation in a six-dimensional phase space necessary to answer this question have until recently remained beyond computational capabilities. Here, we show by means of such simulations that magnetic-field a...

  11. [Intestinal occlusion and abdominal compartment syndrome (ACS)].

    Stagnitti, Franco

    2009-01-01

    Intestinal occlusion is defined as an independent predictive factor of intra-abdominal hypertension (IAH) which represents an independent predictor of mortality. Baggot in 1951 classified patients operated with intestinal occlusion as being at risk for IAH ("abdominal blow-out"), recommending them for open abdomen surgery proposed by Ogilvie. Abdominal surgery provokes IAH in 44.7% of cases with mortality which, in emergency, triples with respect to elective surgery (21.9% vs 6.8%). In particular, IAH is present in 61.2% of ileus and bowel distension and is responsible for 52% of mortality (54.8% in cases with intra-abdominal infection). These patients present with an increasing intra-abdominal pressure (IAP) which, over 20-25 mmHg, triggers an Abdominal Compartment Syndrome (ACS) with altered functions in some organs arriving at Multiple Organ Dysfunction Syndrome (MODS). The intestine normally covers 58% of abdominal volume but when there is ileus distension, intestinal pneumatosis develops (third space) which can occupy up to 90% of the entire cavity. At this moment, Gastro Intestinal Failure (GIF) can appear, which is a specific independent risk factor of mortality, motor of "Organ Failure". The pathophysiological evolution has many factors in 45% of cases: intestinal pneumatosis is associated with mucosal and serous edema, capillary leakage with an increase in extra-cellular volume and peritoneal fluid collections (fourth space). The successive loss of the mucous barrier permits a bacterial translocation which includes bacteria, toxins, pro-inflammatory factors and oxygen free radicals facilitating the passage from an intra-abdominal to inter-systemic vicious cyrcle. IAH provokes the raising of the diaphragm, and vascular and visceral compressions which induce hypertension in the various spaces with compartmental characteristics. These trigger hypertension in the renal, hepatic, pelvic, thoracic, cardiac, intracranial, orbital and lower extremity areas, giving

  12. Plasma properties

    A cursory examination of the research activities of the Magneto-Fluid Dynamics Division for the calendar year 1988 shows the effects of the gradual transformation of the group. Although our principal activity, fusion plasma physics research, is unchanged, the work shows closer ties to problems relevant to present experiments than previously. Most notable is the concentrated effort on tokamak equilibrium and transport. We are exploring the implication of turbulence induced transport, resistive MHD effects, neoclassical transport, and possible interpretations of transport based on classical phenomena. In addition, one of our members has chosen to focus on problems of enhanced statistical methods for interpretation of experiments. All of this activity preceded the Tokamak Transport Initiative and reflects our active involvement and concern with the world-wide tokamak program. Since equilibrium and transport are by no means the only theoretical plasma physics problems affecting fusion devices we continue substantial efforts in wave propagation and heating, particle simulation of plasmas, stability theory, enhancement of numerical algorithms, and general plasma physics. We are attempting to develop effective numerical schemes for the Boltzmann equation, adaptive grid methods for MHD, and particle simulation of boundary and antenna effects. Many of these topics reflect our continuing concern to maintain a modest effort in the development of theoretical models and tools for problems of real significance to fusion, but not necessarily of immediate highest priority. We select problems which we expect to become extremely important in the future. Our space plasma physics activities, funded by agencies other than DOE, transfers knowledge learned in fusion plasma physics to another area and conversely stimulates work also relevant to fusion problems

  13. Minijet plasma sources for the build-up of an array of plasma generators for surface processing

    An array of miniature size plasma jet generators might become an important tool for surface processing especially if the minijet plasma generator can operate at atmospheric pressures. Our efforts started with the design and construction of a d.c. miniature plasma jet generator but components' heating and unstable operation excluded this solution and imposed its change. In the present paper we report a successful development of an a.c. operated miniature type plasma jet generator. The frequency of the applied a.c. voltage was around 10 kHz, the value of the peak to peak voltages being up to 700 V for nitrogen gas at atmospheric pressure. The obtained time dependence of the discharge current and voltage drop over the discharge space, prove that the discharge was not of barrier type but an alternating d.c. type discharge with the mentioned frequency. The measured discharge current was of 55 mA, the measured power value being of the order of a few watts. It is important to mention that the gas flux is passing through a central hole of 0.5 mm diameter of the minijet generator, the obtained jet being very stable and operating hours without failure. In the case of an array of such minijets, due to radial expansion of plasma minijets after going out of hole, at a few millimeter distance, the jets will unite, building up a large area of uniform plasma, ideal for surface treatment at low plasma temperature. (authors)

  14. Plasma physics and engineering

    Fridman, Alexander

    2011-01-01

    Part I: Fundamentals of Plasma Physics and Plasma ChemistryPlasma in Nature, in the Laboratory, and in IndustryOccurrence of Plasma: Natural and Man MadeGas DischargesPlasma Applications, Plasmas in IndustryPlasma Applications for Environmental ControlPlasma Applications in Energy ConversionPlasma Application for Material ProcessingBreakthrough Plasma Applications in Modern TechnologyElementary Processes of Charged Species in PlasmaElementary Charged Particles in Plasma and Their Elastic and Inelastic CollisionsIonization ProcessesMechanisms of Electron Losses: The Electron-Ion RecombinationEl

  15. ''Dusty plasmas''

    The field of ''dusty plasmas'' promises to be a very rewarding topic of research for the next decade or so, not only from the academic point of view where the emphasis is on developing the theory of the often complex collective and non-linear processes, but also from the point of view of applications in astrophysics, space physics, environmental and energy research. In this ''comment'' we should like to sketch the current development of this fast growing and potentially very important research area. We will discuss the new features of ''dusty'' plasmas in the most general terms and then briefly mention some successful applications and effects which have already been examined. (author)

  16. Cooperative Frequency Control for Autonomous AC Microgrids

    Shafiee, Qobad; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.; Nasirian, Vahidreza; Davoudi, Ali

    2015-01-01

    Distributed secondary control strategies have been recently studied for frequency regulation in droop-based AC Microgrids. Unlike centralized secondary control, the distributed one might fail to provide frequency synchronization and proportional active power sharing simultaneously, due to having...... different control parameters. This paper introduces a cooperative algorithm that regulates the system frequency while maintaining the power sharing properties of droop control. Dynamic consensus protocol is used to estimate the average of normalized active powers in the entire MG. This estimation is then...... added to primary control, compensating the frequency drop caused by the droop mechanism. The proposed controller is fully distributed, meaning that each source exchange information with only its direct neighbors through a sparse communication network. This controller has a unique feature that it does...

  17. Mapa Acústico del Gran Madrid

    Santiago Páez, José Salvador; Perera, P

    2006-01-01

    El desarrollo urbanístico de Madrid desde los años 1980 a finales de la década de los 90 hizo que su Ayuntamiento, que ya había promovido la realización entre 1985 y 1991 de un Mapa Acústico parcial de la ciudad, pensase en extender el ámbito de éste a todo el término municipal. Siguiendo el mismo criterio anterior, se superpuso una cuadrícula sobre el plano de Madrid, y se llevaron a cabo registros sonoros de 5 minutos en cada vértice de la misma, en los puntos de medición fuera del área ant...

  18. Josephson arrays for dc and ac metrology

    Large series arrays of underdamped SIS tunnel junctions are the basic element of the primary dc voltage standards used at present. The development of versatile quantum voltmeters for dc and ac metrology requires the preparation of large and perfect series arrays of overdamped Josephson junctions. Overdamped junctions can be realized by externally shunted SIS junctions or by internally shunted SNS or SINIS junctions. Arrays of up to 8000 SINIS junctions or 30000 SNS junctions were successfully operated at the 1 V dc level. In addition to being used in large arrays for voltage metrology and oscillators, the described junction types may become very useful for the preparation of highly integrated single-flux-quantum digital devices. (author)

  19. An ac bridge readout for bolometric detectors

    Rieke, F. M.; Lange, A. E.; Beeman, J. W.; Haller, E. E.

    1989-01-01

    The authors have developed a bolometer readout circuit which greatly improves the low-frequency stability of bolometric detectors. The circuit uses an ac bias voltage and two matched bolometers and allows stable dc bolometer operation for integration times greater than 10 s. In astronomical applications the readout allows for qualitatively different observation modes (e.g. staring or slow-drift scanning) which are particularly well suited for space observations and for the use of arrays. In many applications the readout can increase sensitivity. The authors present noise spectra for 4He temperature bolometers with no excess noise at frequencies greater than 0.1 Hz. The measured optical responsivity of a bolometer operated with the present readout is the same as that of a bolometer operated with a conventional readout.

  20. Composite Based EHV AC Overhead Transmission Lines

    Sørensen, Thomas Kjærsgaard

    Overhead lines at transmission level are the backbone of any national power grid today. New overhead line projects however are at the same time subject to ever greater public resistance due to the lines environmental impact. As full undergrounding of transmission lines at extra high voltage (EHV......) levels are still not seen as possibility, the future expansion of transmission grids are dependent on new solutions with lessened environment impact, especially with regard to the visual impact. In the present Thesis, composite materials and composite based overhead line components are presented and...... analysed with regard to the possibilities, limitations and risks widespread application of composite materials on EHV AC overhead transmission lines may present. To form the basis for evaluation of the useability of composite materials, dierent overhead line projects aimed at reducing the environmental...

  1. Effective ac response in weakly nonlinear composites

    Wei Enbo [Institute of Oceanology, Chinese Academy of Sciences, Qingdao 266071 (China); Yang Zidong [College of Power Engineering, University of Shanghai Science and Technology, Shanghai 200093 (China); Gu Guoqing [Information College of Science and Technology, East China Normal University, Shanghai 200062 (China)

    2004-01-07

    The perturbation method is developed to deal with the problem of determining the effective nonlinear conductivity of Kerr-like nonlinear media under an external ac electric field. As an example, we have considered the cylindrical inclusion embedded in a host under the sinusoidal external field E{sub 1} sin (<{omega}t) + E{sub 3} sin (3<{omega}t) with frequencies{omega} and 3{omega}. The potentials of composites at higher harmonics are derived in both local inclusion particle and host regions. The effective responses of bulk nonlinear composites at basic frequency and harmonics are given for cylindrical composites in the dilute limit. Moreover, the relationships between the nonlinear effective responses at the basic frequency and the third harmonics are derived.

  2. Modeling of long High Voltage AC Underground

    Gudmundsdottir, Unnur Stella; Bak, Claus Leth; Wiechowski, W. T.

    2010-01-01

    This paper presents the work and findings of a PhD project focused on accurate high frequency modelling of long High Voltage AC Underground cables. The project is cooperation between Aalborg University and Energinet.dk. The objective of the project is to investigate the accuracy of most up to date...... cable models, perform highly accurate field measurements for validating the model and identifying possible disadvantages of the cable model. Furthermore the project suggests and implements improvements and validates them against several field measurements. It is shown in this paper how a new method for...... calculating the frequency dependent cables impedance greatly improves the modeling procedure and gives a highly accurate result for high frequency simulations....

  3. Nonlinear ac conductivity of interacting 1d electron systems

    Rosenow, Bernd; Nattermann, Thomas

    2004-01-01

    We consider low energy charge transport in one-dimensional (1d) electron systems with short range interactions under the influence of a random potential. Combining RG and instanton methods, we calculate the nonlinear ac conductivity and discuss the crossover between the nonanalytic field dependence of the electric current at zero frequency and the linear ac conductivity at small electric fields and finite frequency.

  4. Flexible AC transmission systems: the state of the art

    Edris, Abdel-Aty [Electric Power Research Inst., Palo Alto, CA (United States). Electric Systems Division

    1994-12-31

    Flexible AC transmission systems (FACTS) is a concept promoting the use of power electronic controllers to enhance the controllability and usable capacity of AC transmission. This paper presents the state of the art of FACTS and the status of the current projects for the application of the FACTS controllers in transmission systems. (author) 8 refs., 8 figs.

  5. 78 FR 39345 - ACS Wireless, Inc.; Notice of Application

    2013-07-01

    ... will transfer to AWN all remaining tangible and intangible assets owned, leased or held by ACS Wireless.... \\6\\ ACS Group will cause certain of its other subsidiaries to transfer wireless spectrum licenses and...'' as the power to exercise a controlling influence over the management or policies of a company,...

  6. Operation of AC Adapters Visualized Using Light-Emitting Diodes

    Regester, Jeffrey

    2016-01-01

    A bridge rectifier is a diamond-shaped configuration of diodes that serves to convert alternating current(AC) into direct current (DC). In our world of AC outlets and DC electronics, they are ubiquitous. Of course, most bridge rectifiers are built with regular diodes, not the light-emitting variety, because LEDs have a number of disadvantages. For…

  7. Search for β-delayed fission of 228Ac

    Radium was radiochemically separated from natural thorium. Thin 228Ra→β-228Ac sources were prepared and exposed to mica fission track detectors, and measured by an HPGe γ-ray detector. The β-delayed fission events of 228Ac were observed and its β-delayed fission probability was found to be (5±2)x10-12

  8. Improved Design Methods for Robust Single- and Three-Phase ac-dc-ac Power Converters

    Qin, Zian

    proposed new active power decoupling method, the ripple power in the converter can be compensated in a more efficient and more compact way. Then, Chapter 5 changes the scope of the thesis to three-phase converters, and the nine-switch converter, as a reduced switch version of two three-phase full......-bridges connected back-to-back, is studied. Application criteria of the nine-switch converter are investigated for reducing the relatively high stress introduced by the less number of switches. In Chapter 6 a rotating speed controller design method is proposed for improving the thermal loading of the three...... to users. Their performances including cost, efficiency, reliability, and so on, therefore are more important concerns than they were. The objective of this thesis is to study and propose advanced design methods for robust ac-dc-ac converters, which are widely used interfaces in energy conversion...

  9. Proteomic Analysis of Circulating Monocytes Identifies Cathepsin D as A Potential Novel Plasma Marker of Acute Coronary Syndromes

    Fernando Vivanco

    2008-01-01

    Full Text Available We have performed a proteomic analysis of peripheral blood monocytes from ACS patients in comparison with healthy subjects and stable coronary patients in order to search novel biomarkers of ACS in circulating monocytes. Monocytes were isolated from blood of patients with non-ST elevation ACS (n = 27 at day 0, 2 and 6 months, and from patients with stable coronary disease (n = 10 and matched healthy controls (n = 11. The proteomic analysis of monocytes from ACS patients at day 0 showed that cathepsin D is differentially expressed compared to healthy subjects and stable coronary patients. Western blot analysis indicated that the mature form of cathepsin D at day 0 was overexpressed in monocytes of ACS patients in relation to healthy subjects. In contrast, the precursor of this enzyme, absent at day 0 in ACS patients, was highly expressed in monocytes of healthy subjects. Furthermore, the upregulation of the mature form of cathepsin D diminished along the time, while the expression of the precursor increased. ACS patients also showed significantly increased plasma cathepsin D levels on admission compared to healthy subjects and stable patients. Cathepsin D plasma levels diminished at 2 and 6 months to control values. Finally, cathepsin D levels were independent of the existence of coronary risk factors and CRP levels, correlating only with CD40L. Since this protease participates in the genesis and rupture of atherosclerotic plaques, it could represent a potential marker of ACS.

  10. 40 CFR 86.162-00 - Approval of alternative air conditioning test simulations and descriptions of AC1 and AC2.

    2010-07-01

    ... Procedures § 86.162-00 Approval of alternative air conditioning test simulations and descriptions of AC1 and AC2. The alternative air conditioning test procedures AC1 and AC2 are approved by the Administrator... requirements of paragraph (a) of this section and meet the requirements of § 86.163-00. Air conditioning...

  11. Determination for β-delayed fission probability of 230Ac

    袁双贵; 杨维凡; 徐岩冰; 肖永厚; 罗亦孝

    2002-01-01

    The 230Ra has been produced via 232Th-2p reaction induced by 60 MeV/u 18O ion irradia-tion of natural thorium. The radium was radiochemically separated from the mixture of thorium andreaction products. Thin Ra sources in which 230Ac was got through 230Ra β- → 230Ac were pre-pared for observing fission fragments from β-delayed fission of 230Ac. The sources were exposedto the mica fission track detectors and measured by the HPGe γ detector. The precursor 230Ac wasidentified by means of observed two fission events as well as γ spectra, and the β-delayed fissionprobability of 230Ac was obtained to be (1.19±0.85) × 10-8.

  12. Development of YBCO HTS cable with low AC loss

    High temperature superconducting (HTS) cables using YBCO tapes are expected to be more economical because AC losses will be much smaller than conventional cables. To reduce AC loss, 10 mm wide YBCO tapes were divided into five strips using a YAG laser. Using narrower strips and optimizing the space between the strips were effective in reducing AC loss. A 1 m conductor was fabricated, and AC loss was 0.048 W/m at 1 kA and 50 Hz. Based on the successful AC loss reduction in the 1 m conductor, we will fabricate a 10 m HTS cable with a three-layer HTS conductor, electrical insulation, and a one-layer HTS shield and cupper protection layer for overcurrent. In addition, we have developed a prototype of the HTS cable joint that can withstand an overcurrent condition of 31.5 kA for 2 s

  13. Importance of Attenuation Correction (AC) for Small Animal PET Imaging

    El Ali, Henrik H.; Bodholdt, Rasmus Poul; Jørgensen, Jesper Tranekjær;

    2012-01-01

    performed. Methods: Ten NMRI nude mice with subcutaneous implantation of human breast cancer cells (MCF-7) were scanned consecutively in small animal PET and CT scanners (MicroPETTM Focus 120 and ImTek’s MicroCATTM II). CT-based AC, PET-based AC and uniform AC methods were compared. Results: The activity...... bladder 18 ± 3% (15–21%). The FBP reconstructed images showed almost the same attenuation levels as the MAP reconstructed images for all organs. Conclusions: The annihilation photons are suffering attenuation even in small subjects. Both PET-based and CT-based are adequate as AC methods. The amplitude of...... the AC recovery could be overestimated using the uniform map. Therefore, application of a global attenuation factor on PET data might not be accurate for attenuation correction....

  14. Ac response of a coupled double quantum dot

    Xu Jie; W.Z. Shangguan; Zhan Shi-Chang

    2005-01-01

    The effect of phase-breaking process on the ac response of a coupled double quantum dot is studied in this paper based on the nonequilibrium Green function formalism. A general expression is derived for the ac current in the presence of electron-phonon interaction. The ac conductance is numerically computed and the results are compared with those in [Anatram M P and Datts S 1995 Phys. Rev. B 51 7632]. Our results reveal that the inter-dot electron tunnelling interplays with that between dots and electron reservoirs, and contributes prominently to the ac current when inter-dot tunnelling coupling is much larger than the tunnelling coupling between dots and electron reservoirs. In addition, the phase-breaking process is found to have a significant effect on the ac transport through the coupled double dot.

  15. A Simple Load Power Estimator For Quasi-Direct AC-AC Converter System

    Marian GAICEANU

    2003-12-01

    Full Text Available In this paper a simple load power estimator for the three-phase quasi-direct acac converter system is reported. Since the ac-ac converter control by means of pulsewidth modulation (PWM is based on the power balance concept, its load power should be known. Two control boards, based on the dSMC (digital Smart Motion Controller 30 MIPS 32-bit fixed-point digital signal processor (DSP, were involved in the ac-ac system driving. By using the power balance control, the DC link voltage variation at the load changes can be reduced. In this way a small DC link capacitor is required to handle the dc voltage error control. The feed-forward (Sul and Lipo, 1990 current component provides fast correction of the reference control to load power variation. In order to obtain the feed-forward current component, the load power must to be known. In this paper the load power is estimated from the dc link, indirectly, through a dc load current estimator. In this way the author overcomes the use of the serial communication between control boards (Gaiceanu, 2004 in order to deliver the load power information from the inverter side. The load current estimator is based on the DC link voltage and on the load current of the supply converter. This method presents certain advantages instead of using measured method, which requires a low pass filter: no time delay, the feed-forward current component has no ripple, no additional hardware, and more fast control response. Through simulation and experimental results the performances of the proposed load current estimator scheme are demonstrated.

  16. Burning plasmas

    Furth, H.P.; Goldston, R.J.; Zweben, S.J. (Princeton Univ., NJ (USA). Plasma Physics Lab.); Sigmar, D.J. (Massachusetts Inst. of Tech., Cambridge, MA (USA))

    1990-10-01

    The fraction of fusion-reaction energy that is released in energetic charged ions, such as the alpha particles of the D-T reaction, can be thermalized within the reacting plasma and used to maintain its temperature. This mechanism facilitates the achievement of very high energy-multiplication factors Q, but also raises a number of new issues of confinement physics. To ensure satisfactory reaction operation, three areas of energetic-ion interaction need to be addressed: single-ion transport in imperfectly symmetric magnetic fields or turbulent background plasmas; energetic-ion-driven (or stabilized) collective phenomena; and fusion-heat-driven collective phenomena. The first of these topics is already being explored in a number of tokamak experiments, and the second will begin to be addressed in the D-T-burning phase of TFTR and JET. Exploration of the third topic calls for high-Q operation, which is a goal of proposed next-generation plasma-burning projects. Planning for future experiments must take into consideration the full range of plasma-physics and engineering R D areas that need to be addressed on the way to a fusion power demonstration.

  17. HVDC-AC system interaction from AC harmonics. Volume 1. Harmonic impedance calculations. Final report

    Breuer, G D; Chow, J H; Lindh, C B; Miller, N W; Numrich, F H; Price, W W; Turner, A E; Whitney, R R

    1982-09-01

    Improved methods are needed to characterize ac system harmonic behavior for ac filter design for HVDC systems. The purpose of this General Electric Company RP1138 research is to evaluate the present filter design practice and to investigate methods for calculating system harmonic impedances. An overview of ac filter design for HVDC systems and a survey of literature related to filter design have been performed. Two methods for calculating system harmonic impedances have been investigated. In the measurement method, an instrumentation system for measuring system voltage and current has been assembled. Different schemes of using the measurements to calculate system harmonic impedances have been studied. In the analytical method, a procedure to include various operating conditions has been proposed. Computer programs for both methods have been prepared, and the results of the measurement and analytical methods analyzed. A conclusion of the project is that the measurement and analytical methods both provided reasonable results. There are correlations between the measured and analytical results for most harmonics, although there are discrepancies between the assumptions used in the two methods. A sensitivity approach has been proposed to further correlate the results. From the results of the analysis, it is recommended that both methods should be tested further. For the measurement method, more testing should be done to cover different system operating conditions. In the analytical method, more detailed models for representing system components should be studied. In addition, alternative statistical and sensitivity approaches should be attempted.

  18. Sustainable AC/AC hybrid electrochemical capacitors in aqueous electrolyte approaching the performance of organic systems

    Abbas, Qamar; Babuchowska, Paulina; Frąckowiak, Elżbieta; Béguin, François

    2016-09-01

    A high energy hybrid AC/AC electrochemical capacitor has been realized in aqueous Li2SO4+KI electrolyte mixture. Owing to the redox processes associated with the 2I-/I2 system, the positive electrode operates in narrow potential range and displays high capacity. During prolonged potentiostatic floating at 1.6 V, the hybrid cell demonstrates remarkably stable capacitance and resistance. Analyses by temperature programmed desorption after floating at 1.6 V proved that oxidation of the positive AC electrode is prevented by the use of Li2SO4+KI, which enables the maximum potential of this electrode to be shifted below the water oxidation potential. When charged at 0.2 A g-1 up to U = 1.6 V, the hybrid cell displays a high capacitance of 75 F g-1 (300 F g-1 per mass of one electrode) compared to 47 F g-1 (188 F g-1 per mass of one electrode) for a symmetric cell in Li2SO4. At 0.2 A g-1 up to 1.6 V, the hybrid capacitor in Li2SO4+KI displays an energy density of 26 Wh kg-1 which approaches the energy density of 30.9 Wh kg-1 measured when the same carbon is implemented in a capacitor using TEABF4/ACN electrolyte and charged up to 2.5 V.

  19. Physics of collisional plasmas. Application to high frequency discharges

    This book is an introduction to collisional plasmas, these plasmas are more and more often used in industrial applications such as thermonuclear fusion, surface treatments, plasma screens or ions sources. The authors aim at an audience of third year physics students. This book is made up of 4 chapters. The first chapter is devoted to the definition of a plasma and to the description of its main features. The second chapter details the motion of a charged particle in different configurations of electric and magnetic fields, underlining the energy transfer between the electric field and the particle and the cyclotron gyration due to the magnetic field. In the third chapter the authors show how to infer the hydrodynamics equations from the Boltzmann's kinetic equation. The last chapter is dedicated to the physics processes that occur in high frequency discharges for both low and high pressure plasmas. (A.C.)

  20. Overview of plasma technology used in medicine

    Ryan, Thomas P.; Stalder, Kenneth R.; Woloszko, Jean

    2013-02-01

    Plasma Medicine is a growing field that is having an impact in several important areas in therapeutic patient care, combining plasma physics, biology, and clinical medicine. Historically, plasmas in medicine were used in electrosurgery for cautery and non-contact hemostasis. Presently, non-thermal plasmas have attained widespread use in medicine due to their effectiveness and compatibility with biological systems. The paper will give a general overview of how low temperature, non-equilibrium, gas plasmas operate, both from physics and biology perspectives. Plasma is commonly described as the fourth state of matter and is typically comprised of charged species, active molecules and atoms, as well as a source of UV and photons. The most active areas of plasma technology applications are in wound treatment; tissue regeneration; inactivation of pathogens, including biofilms; treating skin diseases; and sterilization. There are several means of generating plasmas for use in medical applications, including plasma jets, dielectric barrier discharges, capacitively or inductively coupled discharges, or microplasmas. These systems overcome the former constraints of high vacuum, high power requirements and bulky systems, into systems that use room air and other gases and liquids at low temperature, low power, and hand-held operation at atmospheric pressure. Systems will be discussed using a variety of energy sources: pulsed DC, AC, microwave and radiofrequency, as well as the range of frequency, pulse duration, and gas combinations in an air environment. The ionic clouds and reactive species will be covered in terms of effects on biological systems. Lastly, several commercial products will be overviewed in light of the technology utilized, health care problems being solved, and clinical trial results.

  1. Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach it is not...

  2. La acústica submarina y su desarrollo desde la creación del Instituto de Acústica

    Ranz Guerra, Carlos; Cobo, Pedro; Carbó, Rafael; Santiago Páez, José Salvador; Soler, A. M.; Briones, J. M.; Jimeno, I.; Muñoz, N; Camarasa, M.; Recuero López, Manuel

    2000-01-01

    PACS: 43.30.Xm; 43.30.Yj; 43.30.Vh; 43.30.Nb; 43.30.Ma.-- Publicado en el Vol. XXXI, núm. 3-4, tercer y cuarto trimestre 2000 de la Revista de Acústica: Número especial dedicado al XXV Aniversario del Instituto de Acústica del C.S.I.C.

  3. Magnetoresistive waves in plasmas

    The self-generated magnetic field of a current diffusing into a plasma between conductors can magnetically insulate the plasma. Propagation of magnetoresistive waves in plasmas is analyzed. Applications to plasma opening switches are discussed

  4. A new probe for measuring small electric fields in plasmas

    Stenzel, R. L.

    1991-01-01

    A dipolar double probe has been developed for in situ measurements of small electric fields in laboratory plasmas. The probe measures dc to ac electric fields (f values between 0 and 20 MHz) with high sensitivity (Emin about 10 microV/cm) and responds to both space charge electric fields and inductive electric fields. Using voltage-to-frequency conversion, the probe signal is obtained free of errors and loading effects by a transmission line. Various examples of useful applications for the new probe are presented, such as measurements of dc ambipolar fields, ac space-charge fields of ion acoustic waves, ac inductive fields of whistler waves, and mixed inductive and space-charge electric fields in current-carrying magnetoplasmas.

  5. Numerical estimation of AC loss in superconductors with ripple current

    Highlights: •The loss energy density with ripple current is numerically calculated. •Irie–Yamafuji model is used for magnetic field dependence of critical current. •Calculated result of cylindrical superconductor agrees with theoretical result. •AC loss of strip superconductor becomes large at small ripple current amplitude. •Strip superconductor should be used as a form of hollow cylinder to reduce AC loss. -- Abstract: The loss energy density (AC loss) with ripple current is numerically calculated by finite element method for cylindrical and strip superconductors based on Irie–Yamafuji model in which the magnetic field dependence of the critical current density is taken into account for design of DC transmission cable system. It is confirmed that calculated result of the AC loss in the cylindrical superconductor with the ripple current agrees well with theoretical estimation which was reported in the previous work. On the contrary, the AC loss in the strip superconductor with the ripple current is obtained only by numerical calculation. It is found that the AC loss in the strip superconductor of the ripple current becomes larger than that without DC current at small ripple current amplitude, since the penetration depth of magnetic field becomes large. Therefore, it is recommended that strip superconductor is better to use as cylindrical hollow superconductor for DC transmission cable system to reduce the AC loss

  6. Importance of Attenuation Correction (AC for Small Animal PET Imaging

    Henrik H. El Ali

    2012-10-01

    Full Text Available The purpose of this study was to investigate whether a correction for annihilation photon attenuation in small objects such as mice is necessary. The attenuation recovery for specific organs and subcutaneous tumors was investigated. A comparison between different attenuation correction methods was performed. Methods: Ten NMRI nude mice with subcutaneous implantation of human breast cancer cells (MCF-7 were scanned consecutively in small animal PET and CT scanners (MicroPETTM Focus 120 and ImTek’s MicroCATTM II. CT-based AC, PET-based AC and uniform AC methods were compared. Results: The activity concentration in the same organ with and without AC revealed an overall attenuation recovery of 9–21% for MAP reconstructed images, i.e., SUV without AC could underestimate the true activity at this level. For subcutaneous tumors, the attenuation was 13 ± 4% (9–17%, for kidneys 20 ± 1% (19–21%, and for bladder 18 ± 3% (15–21%. The FBP reconstructed images showed almost the same attenuation levels as the MAP reconstructed images for all organs. Conclusions: The annihilation photons are suffering attenuation even in small subjects. Both PET-based and CT-based are adequate as AC methods. The amplitude of the AC recovery could be overestimated using the uniform map. Therefore, application of a global attenuation factor on PET data might not be accurate for attenuation correction.

  7. Plasmas Granulares

    Conde López, Luis; Donoso Vargas, Jose Manuel; Sánchez Torres, Antonio; Tkachenko, Igor Mijail; Cal, Eduardo de la; Carralero Ortiz, Daniel; Pablos, José Luis

    2011-01-01

    Los plasmas granulares son gases total o parcialmente ionizados que, además de iones electrones y átomos neutros, contienen partículas sólidas con carga eléctrica. Dichas partículas cargadas, de tamaño mesoscópico, dan lugar a nuevos fenómenos colectivos con una dinámica característica. Este tipo de plasmas aparecen en sistemas físicos tan diversos como son los reactores de fusión por confinamiento magnético, los sistemas de procesado de semiconductores o en medios astrofísicos. Se presenta u...

  8. Analytical description of AC losses for high temperature superconductors

    Full text: AC losses for high temperature superconductors have been calculated by considering the effects of the temperature distribution and the flux flow resistance. Maxwell's equations and thermal diffusion equation are used to calculate the distribution of magnetic field and the temperature inside the superconductors, respectively. The flux flow effect on the AC losses is calculated by using the extended critical state model. An analytical expression of the AC losses is obtained using a superposition approximation in which the cases of complete and incomplete magnetic field penetration have been distinguished. The expression can well explain the experimental observations of the frequency dependence of the AC losses per cycle in high temperature superconductors. It is clearly shown from the analytical expression that the effect of the thermal distribution inside the superconductors is different from the effect caused by flux flow resistance. In the case of incomplete magnetic penetration, the temperature distribution results in the increase of the AC losses per cycle upon frequency whereas the flux flow leads to the decrease of the AC losses per cycle upon frequency. In the case of complete magnetic penetration the results are opposite to those in the previous case. Due to the extremely strong flux flow in high temperature superconducting materials, the effect of the flux flow on the AC losses is dominant, and the overall dependence of AC losses per cycle upon frequency is controlled by the flux flow. On the other hand, because the inhomogeneous distribution of the temperature inside the superconductors which is normal higher in the center than near the edge, there is an upper limit for the frequency beyond which the superconductivity will be totally destroyed by AC losses. Analytical expressions for the critical frequency, distributions of magnetic field and critical current density are also obtained

  9. Plasma chromograninx

    Goetze, Jens P; Hilsted, Linda M; Rehfeld, Jens F;

    2014-01-01

    Cardiovascular risk assessment remains difficult in elderly patients. We examined whether chromogranin A (CgA) measurement in plasma may be valuable in assessing risk of death in elderly patients with symptoms of heart failure in a primary care setting. A total of 470 patients (mean age 73 years......) were followed for 10 years. For CgA plasma measurement, we used a two-step method including a screening test and a confirmative test with plasma pre-treatment with trypsin. Cox multivariable proportional regression and receiver-operating curve (ROC) analyses were used to assess mortality risk....... Assessment of cardiovascular mortality during the first 3 years of observation showed that CgA measurement contained useful information with a hazard ratio (HR) of 5.4 (95% CI 1.7-16.4) (CgA confirm). In a multivariate setting, the corresponding HR was 5.9 (95% CI 1.8-19.1). WHEN ADDING N-TERMINAL PROBNP (NT...

  10. Plasma physics

    Cairns, R A

    1985-01-01

    This book is intended as an introduction to plasma physics at a level suitable for advanced undergraduates or beginning postgraduate students in physics, applied mathematics or astrophysics. The main prerequisite is a knowledge of electromagnetism and of the associated mathematics of vector calculus. SI units are used throughout. There is still a tendency amongst some plasma physics researchers to· cling to C.g.S. units, but it is the author's view that universal adoption of SI units, which have been the internationally agreed standard since 1960, is to be encouraged. After a short introductory chapter, the basic properties of a plasma con­ cerning particle orbits, fluid theory, Coulomb collisions and waves are set out in Chapters 2-5, with illustrations drawn from problems in nuclear fusion research and space physics. The emphasis is on the essential physics involved and (he theoretical and mathematical approach has been kept as simple and intuitive as possible. An attempt has been made to draw attention t...

  11. The density and velocity of plasma bullets propagating along one dielectric tube

    Longfei Ji

    2015-08-01

    Full Text Available This study shows that the propagation of plasma bullets along one dielectric tube is strongly affected by many discharge parameters, such as the waveform of applied voltage (AC or pulsed DC, peak voltage, He flow rate, and the frequency of AC voltage. Analysis indicates that the density and velocity of plasma bullets are mainly determined by the electric field at the front of plasma bullets. These discharge parameters may significantly influence the distribution of plasma potential along the tube, thus control the electric field at the front of plasma bullets and their propagation. An increase in the pulsed DC voltage with its rise time of <40-50 ns can lead to an obvious improvement in the electric field at the front of plasma bullets, resulting in generation of a plasma in the high density gas and a fast propagation of plasma bullets. He flowing through the tube can contribute to the surface diffusion of charged species, and greatly increase the electric field at the front of plasma bullets. During the propagation of plasma bullets, their density is decreased due to the surface recombination of charged species, such as electrons and ions.

  12. The density and velocity of plasma bullets propagating along one dielectric tube

    Ji, Longfei; Xia, Yang; Bi, Zhenhua; Niu, Jinhai; Liu, Dongping

    2015-08-01

    This study shows that the propagation of plasma bullets along one dielectric tube is strongly affected by many discharge parameters, such as the waveform of applied voltage (AC or pulsed DC), peak voltage, He flow rate, and the frequency of AC voltage. Analysis indicates that the density and velocity of plasma bullets are mainly determined by the electric field at the front of plasma bullets. These discharge parameters may significantly influence the distribution of plasma potential along the tube, thus control the electric field at the front of plasma bullets and their propagation. An increase in the pulsed DC voltage with its rise time of <40-50 ns can lead to an obvious improvement in the electric field at the front of plasma bullets, resulting in generation of a plasma in the high density gas and a fast propagation of plasma bullets. He flowing through the tube can contribute to the surface diffusion of charged species, and greatly increase the electric field at the front of plasma bullets. During the propagation of plasma bullets, their density is decreased due to the surface recombination of charged species, such as electrons and ions.

  13. The density and velocity of plasma bullets propagating along one dielectric tube

    This study shows that the propagation of plasma bullets along one dielectric tube is strongly affected by many discharge parameters, such as the waveform of applied voltage (AC or pulsed DC), peak voltage, He flow rate, and the frequency of AC voltage. Analysis indicates that the density and velocity of plasma bullets are mainly determined by the electric field at the front of plasma bullets. These discharge parameters may significantly influence the distribution of plasma potential along the tube, thus control the electric field at the front of plasma bullets and their propagation. An increase in the pulsed DC voltage with its rise time of <40-50 ns can lead to an obvious improvement in the electric field at the front of plasma bullets, resulting in generation of a plasma in the high density gas and a fast propagation of plasma bullets. He flowing through the tube can contribute to the surface diffusion of charged species, and greatly increase the electric field at the front of plasma bullets. During the propagation of plasma bullets, their density is decreased due to the surface recombination of charged species, such as electrons and ions

  14. The density and velocity of plasma bullets propagating along one dielectric tube

    Ji, Longfei; Xia, Yang; Bi, Zhenhua; Niu, Jinhai; Liu, Dongping [Liaoning Key Lab of Optoelectronic Films & Materials, School of Physics and Materials Engineering, Dalian Nationalities University, Dalian 116600 (China)

    2015-08-15

    This study shows that the propagation of plasma bullets along one dielectric tube is strongly affected by many discharge parameters, such as the waveform of applied voltage (AC or pulsed DC), peak voltage, He flow rate, and the frequency of AC voltage. Analysis indicates that the density and velocity of plasma bullets are mainly determined by the electric field at the front of plasma bullets. These discharge parameters may significantly influence the distribution of plasma potential along the tube, thus control the electric field at the front of plasma bullets and their propagation. An increase in the pulsed DC voltage with its rise time of <40-50 ns can lead to an obvious improvement in the electric field at the front of plasma bullets, resulting in generation of a plasma in the high density gas and a fast propagation of plasma bullets. He flowing through the tube can contribute to the surface diffusion of charged species, and greatly increase the electric field at the front of plasma bullets. During the propagation of plasma bullets, their density is decreased due to the surface recombination of charged species, such as electrons and ions.

  15. The Plasma Discharge System For Effective Sterilization Of Water And Solid Surfaces

    The different areas such as medicine, surgery, food production need efficient sterilization system since they are directly related to human health. In this work a new plasma system is described in order to present its effectiveness in sterilization. This is a different method from conventional methods such as: chemicals and heat addition, UV irradiation etc. The developed plasma system produces cold plasma working under atmospheric pressure. To generate the plasma both AC and DC high voltage power supplies were used. The developed system is cheap and very effective for sterilization. The light emission for both AC and DC coronas for the plasmas were investigated to understand the nature of generated plasma ionization. Different parameters like temperature, voltage, application time were changed during the plasma application and the optimization for killing the micro-organisms were investigated. To understand the biological effect of plasma on the organisms comparisons were done by using the scanning electron microscope and absorption spectrometer. The plasma was applied on the bacteria like Escherichia coli, Bacillus subtilis, Streptococcus mutans , the yeasts such as Candida albicans, and green algae. The efficiency, the non toxic nature, the affordable price make this plasma discharge method a very efficient one for sterilization.

  16. Operation of AC Adapters Visualized Using Light-Emitting Diodes

    Regester, Jeffrey

    2016-01-01

    A bridge rectifier is a diamond-shaped configuration of diodes that serves to convert alternating current (AC) into direct current (DC). In our world of AC outlets and DC electronics, they are ubiquitous. Of course, most bridge rectifiers are built with regular diodes, not the light-emitting variety, because LEDs have a number of disadvantages. For educational purposes, however, an LED-based rectifier is ideal because it allows students to literally see the rectifier operating. Here I'll discuss the practical aspects of building a full AC adapter incorporating an LED-based rectifier and ideas on how to use it in class.

  17. Theoretical analysis of ac losses in high temperature superconducting bulks

    Ac loss behavior in HTS bulk materials is studied by developing an analytic method. The self-heating effect on the distributions of temperature in HTS bulks has been calculated. A critical frequency which sets the upper limit for driving frequency of the external field in sustaining a superconducting state is obtained. Our model provides useful information of understanding the experimental phenomena, including an anomalous ac loss behavior, a retardation of the inner field respect to the external ac field, etc., in HTS bulk materials

  18. Advanced DC/AC inverters applications in renewable energy

    Luo, Fang Lin

    2013-01-01

    DC/AC inversion technology is of vital importance for industrial applications, including electrical vehicles and renewable energy systems, which require a large number of inverters. In recent years, inversion technology has developed rapidly, with new topologies improving the power factor and increasing power efficiency. Proposing many novel approaches, Advanced DC/AC Inverters: Applications in Renewable Energy describes advanced DC/AC inverters that can be used for renewable energy systems. The book introduces more than 100 topologies of advanced inverters originally developed by the authors,

  19. Analysis of Input and Output Ripples of PWM AC Choppers

    Pekik Argo Dahono

    2008-11-01

    Full Text Available This paper presents an analysis of input and output ripples of PWM AC choppers. Expressions of input and output current and voltage ripples of single-phase PWM AC choppers are first derived. The derived expressions are then extended to three-phase PWM AC choppers. As input current and output voltage ripples specification alone cannot be used to determine the unique values of inductance and capacitance of the LC filters, an additional criterion based on the minimum reactive power is proposed. Experimental results are included in this paper to show the validity of the proposed analysis method.

  20. An Improved AC-BM Algorithm for Monitoring Watch List

    Mo Yiwen

    2013-07-01

    Full Text Available With the expanding of database of the watch list of anti-money laundering, improving the speed in matching between the watch list and the database of account holders and clients’ transaction is especially important. This paper proposes an improved AC-BM Algorithm, a matching algorithm of subsection, to improve the speed of matching. Experiment results show the time performance of the improved algorithm is better than traditional BM algorithm, AC algorithm and the AC-BM algorithm. It can improve the efficiency of on-line monitoring of anti-money laundering.  

  1. DC and AC biasing of a transition edge sensor microcalorimeter

    We are developing AC-biased transition edge sensor (TES) microcalorimeters for use in large arrays with frequency-domain multiplexing. Using DC bias, we have achieved a resolution of 17 eV FWHM at 2.6 keV with a decay time of 90 μs and an effective detector diameter of 300 μm. We have successfully measured thermal pulses with a TES microcalorimeter operated with an AC bias. We present here preliminary results from a single pixel detector operated under DC and AC bias conditions

  2. Study on radioimmunoassay of Bt Cry1Ac protein

    Bt Cry1Ac protein was extracted from incubation of Bacillus thuringiensis HD-73, and cutting into more specific protein segment with high insect-resistance. High-affinity multi-colonial antibodies of Bt Cry1 Ac protein were obtained after injected it into New Zealand rabbits. By 125I labeling of Bt Cry1 Ac protein, a RIA kit was established. In this method, centrifuge for separation was not necessary due to the use of magnetic micro-particle and the specifications of the kit were found equal to those of imported ELISA. (authors)

  3. Stochastic Dynamics of DC and AC Driven Dislocation Kinks

    Vardanyan, A.; Kteyan, A.

    2013-02-01

    Dynamics of a pinned dislocation kink controlled by the acting DC and AC forces is studied analytically. The motion of the kink, described by sine-Gordon (sG) equation, is explored within the framework of McLaughlin-Scott perturbation theory. Assuming weakness of the acting AC force, the equation of motion of the dislocation kink in the pinning potential is linearized. Based on the equations derived, we study stochastic behavior of the kink, and determine the probability of its depinning. The dependencies of the depinning probability on DC and AC forces are analyzed in detail.

  4. Observation of β-delayed fission from 230Ac

    β-delayed fission for 230Ac was searched. 230Ra was produced via multinucleon transfer reaction by 60 MeV/u 18O ion irradiation of 232Th target. Thin 230Ra→230Ac sources of 108 atoms were acquired through radiochemical separations. The mica track detectors were used to record the fission events. The β-delayed fission nucleus 230Ac was identified via the observed two fission events and the measured γ-ray spectra. Its β-delayed fission probability was obtained to be (1.19 +- 0.85) x 10-8

  5. Neurinoma central do nervo acústico

    Paulo Pinto Pupo

    1950-03-01

    Full Text Available O autor apresenta o caso de uma paciente com 45 anos, com hipertensão arterial, queixando-se de tonturas e surdez progressiva à esquerda que, ao exame neurológico, apresentava síndrome protuberancial, com hemi-anestesia táctil e dolorosa à direita respeitando a face, hemiparesia direita, ataxia de tipo sensitivo nos membros da direita, paralisia facial de tipo periférico, hipoacusia, paresia de motor ocular externo à esquerda, síndrome vertiginosa e nistagmo horizontal ao olhar para a direita. À necrópsia foi encontrado um tumor na hemicalota protuberancial esquerda e foco malácico adjacente, secundário a distúrbio circulatório. O tumor, intimamente dependente das raízes intraprotuberanciais do nervo acústico, se apresentava com as características histológicas dos neurinomas. Além dessas particularidades, a lesão do feixe central da calota e conseqüente degeneração "hipertrófica" da oliva bulbar constituem outro aspecto de grande interêsse dêste caso.

  6. AC Impedance Behaviour of Black Diamond Films

    Haitao YE; Olivier GAUDIN; Richard B.JACKMAN

    2005-01-01

    The first measurement of impedance on free-standing diamond films from 0.1 Hz to 10 MHz up to 300℃ were reported. A wide range of chemical vapour deposition (CVD) materials were investigated, but here we concentrate are well fitted to a RC parallel circuit model and the equivalent resistance and capacitance for the diamond films have been estimated using the Zview curve fitting. The results show only one single semicircle response at each temperature measured. It was found that the resistance decreases from 62 MΩ at room temperature to 4 kΩ at300℃, with an activation energy around 0.51 eV. The equivalent capacitance is maintained at the level of 100 pF up to 300℃ suggesting that the diamond grain boundaries are dominating the conduction. At 400℃, the impedance at low frequencies shows a linear tail, which can be explained that the AC polarization of diamond/Au interface occurs.

  7. Bactericide Effect of Atmospheric Plasma of Flat and Comb Electrodes on Escherichia coli

    A. Hosseinzadeh Colagar; F. Sohbatzadeh; S. Mirzanejhad; N. Asadian

    2008-01-01

    Objective: The current study was undertaken to examine the bactericide effects of atmospheric plasma produced by flat and comb electrodes on E.coli.Materials and Methods: DC (20 W) and AC (500 W) power supplies, flat and comb electrodes, insulator and oxygen gas were used to produce atmospheric plasma. Bactericide effects of the atmospheric plasma were studied on E.coli on sterilized plate placed on ice powder, at 3 McFarland concentration.Results: Flow of the atmospheric plasma produced by f...

  8. Dicty_cDB: FCL-AC22 [Dicty_cDB

    Full Text Available FCL (Link to library) FCL-AC22 (Link to dictyBase) - G03266 DDB0186811 Contig-U14995-1 FCL-...AC22P (Link to Original site) FCL-AC22F 430 FCL-AC22Z 521 FCL-AC22P 951 - - Show FCL-AC22 Library FC...L (Link to library) Clone ID FCL-AC22 (Link to dictyBase) Atlas ID - NBRP ID G03266 dictyBase ID DDB0186811 ...Link to Contig Contig-U14995-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-...AC22Q.Seq.d/ Representative seq. ID FCL-AC22P (Link to Original site) Representative DNA sequence >FCL-

  9. Dicty_cDB: FCL-AC23 [Dicty_cDB

    Full Text Available FCL (Link to library) FCL-AC23 (Link to dictyBase) - G01760 DDB0186002 Contig-U16043-1 FCL-...AC23P (Link to Original site) FCL-AC23F 132 FCL-AC23Z 582 FCL-AC23P 714 - - Show FCL-AC23 Library FC...L (Link to library) Clone ID FCL-AC23 (Link to dictyBase) Atlas ID - NBRP ID G01760 dictyBase ID DDB0186002 ...Link to Contig Contig-U16043-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-...AC23Q.Seq.d/ Representative seq. ID FCL-AC23P (Link to Original site) Representative DNA sequence >FCL-

  10. Absorption and Attenuation Coefficients Using the WET Labs ac-s in the Mid-Atlantic Bight: Field Measurements and Data Analysis

    Ohi, Nobuaki; Makinen, Carla P.; Mitchell, Richard; Moisan, Tiffany A.

    2008-01-01

    Ocean color algorithms are based on the parameterization of apparent optical properties as a function of inherent optical properties. WET Labs underwater absorption and attenuation meters (ac-9 and ac-s) measure both the spectral beam attenuation [c (lambda)] and absorption coefficient [a (lambda)]. The ac-s reports in a continuous range of 390-750 nm with a band pass of 4 nm, totaling approximately 83 distinct wavelengths, while the ac-9 reports at 9 wavelengths. We performed the ac-s field measurements at nine stations in the Mid-Atlantic Bight from water calibrations to data analysis. Onboard the ship, the ac-s was calibrated daily using Milli Q-water. Corrections for the in situ temperature and salinity effects on optical properties of water were applied. Corrections for incomplete recovery of the scattered light in the ac-s absorption tube were performed. The fine scale of spectral and vertical distributions of c (lambda) and a (lambda) were described from the ac-s. The significant relationships between a (674) and that of spectrophotometric analysis and chlorophyll a concentration of discrete water samples were observed.

  11. Prognostic value of plasma biomarkers in patients with acute coronary syndrome: a review of advances in the past decade.

    Cao, Richard Y; Zheng, Hongchao; Guo, Junjun; Redfearn, Damian P

    2016-05-01

    Acute coronary syndrome (ACS), especially myocardial infarction, commonly known as a heart attack, is a serious life-threatening cardiovascular disease. Despite dramatic therapeutic advances, there have still been more than 20% patients with ACS suffering recurrent adverse cardiovascular events 3 years after disease onset. Therefore, the aim to prevent cardiac death caused by the heart attack remains challenging. Plasma biomarkers, originally developed to complement clinical assessment and electrocardiographic examination for the diagnosis of ACS, have been reported to play important prognostic roles in predicting adverse outcomes. These biomarkers mirror different pathophysiological mechanisms in association with ACS. In this review, we focus on advances of prognostic biomarkers in the past decade for short- and long-term risk assessment and management of patients with ACS. PMID:27089223

  12. Nonlinear self stabilization of a kinking plasma current channel

    Sears, J.; Feng, Y.; Intrator, T. P.; Swan, H.; Gao, K.; Chapdelaine, L.

    2013-10-01

    A plasma column with plasma pressure, axial magnetic field and current has helically twisted field lines that form a screw pinch. If the current density exceeds the kink threshold, this current driven ideal MHD instability is expected to grow explosively on an Alfvén time scale and destroy the equilibrium. In the Reconnection Scaling Experiment (RSX) we use a plasma gun to generate a single plasma column which terminates on an external anode. We then drive an axial plasma current at the limit of marginal kink stability. We observe a deformation to a new dynamic equilibrium with finite gyration amplitude, where the currents and magnetic fields that support the force balance have surprising axial structure. Three dimensional measurements of magnetic field B, plasma density n, plasma potential φ, and ion flow velocity vi in the deformed plasma column show variation in the axial direction of the instability parameter J . B /B2 and in the momentum balance terms J × B and ∇p . The field line curvature which should correspond to a restoring force and the pitch of the kink also vary along the axis. In addition there is an induced return current antiparallel to the driven plasma current that is localized in the axial direction. Supported by Center for Magnetic Self Organization, NASA Geospace NNHIOA044I-Basic, Department of Energy DE-AC52-06NA25369. Performed under auspices of the U.S. Department of Energy by Lawrence Livermore National Lab under Contract DE-AC52-07NA27344.

  13. A precursor of β-delayed fission:230Ac

    2002-01-01

    The 230Ra has been produced via multinucleon transfer and dissipativefragmentation of heavy target in the 60 MeV/u 18O ion reaction with natural thorium.The radium was radiochemically separated from irradiated thorium targets. 230Acwas obtained by 230Ra β-→ 230Ac. Thin Ra sources were prepared for observing fissionfragments from β-delayed fission of 230Ac. The sources were exposed to the micafission track detectors and measured by a HPGe γ detector. The two fission eventswere obtained and could been assigned to theβ-delayed fission of 230Ac. The β-delayedfission probability of 230Ac was determined to be (1.19+0.85) × 10-8.

  14. AC susceptibility of polycrystalline (Bi-Pb 2223 superconductors

    H. Salamati

    2004-06-01

    Full Text Available   The temperature dependence of ac susceptibility of (Bi-Pb2223 polycrystalline samples was measured as a function of frequency and ac field amplitude. Analysis of the temperature dependence of the AC susceptibility near the transition temperature (Tc has been done employing Bean’s critical state model. The observed variation of intergranular critical current densities (Jc with temperature indicates that the weak links are superconductor- normal metal-superconductor (SNS type for this sample. The frequency effect on AC susceptibility was also measured. As the frequency increases, (TP shifts to higher temperatures. This effect can be interpreted in terms of flux creep. The temperature T, and field, , dependence of activation energy obtained from the Arrhenius plot for the frequency ( f and ( TP , can be described as: U(Hac,T=U0(1-T/TCHac-0.18

  15. Performance of an x-ray microcalorimeter under ac biasing

    Frequency domain multiplexing (FDM) is an attractive option for the readout of imaging arrays of microcalorimeters. Implementation of FDM requires ac biasing of the individual microcalorimeters. In this letter we present a small signal model for the behavior of a microcalorimeter under ac bias. Moreover, we have measured the behavior of the same microcalorimeter under ac (at 46 kHz) and dc bias. These experiments show that the performance of the device is very similar in terms of energy resolution, pulse shapes, and current-voltage characteristics. The measured energy resolution at 5.89 keV is 6.9 eV for ac bias and 5.5 eV for dc bias. The effective time constant in both cases is 100 μs

  16. Dc to ac converter operates efficiently at low input voltages

    1965-01-01

    Self-oscillating dc to ac converter with transistor switching to produce a square wave output is used for low and high voltage power sources. The converter has a high efficiency throughout a wide range of loads.

  17. Ferromagnetic resonance driven by an ac current: a brief review

    Excitation of ferromagnetic resonance (FMR) by an ac current has been observed in macroscopic ferromagnetic films for decades and typically relies on the ac Oersted field of the current to drive magnetic moments into precession and classical rectification of ac signals to detect the resonance. Recently, current-driven ferromagnetic resonances have attracted renewed attention with the discovery of the spin-transfer torque (STT) effect due to its potential applications in magnetic memory and microwave technologies. Here STT associated with the ac current is used to drive magnetodynamics on the nanoscale that enables FMR studies in sample volumes smaller by a factor of 1000 compared to conventional resonance techniques. In this paper, we briefly review the basics of STT-FMR technique and the results of various STT-FMR experiments.

  18. c-axis ac susceptibility in high-Tc superconductors

    We have investigated the angle and magnetic field dependence of the ac susceptibility in Bi2Sr2CaCu2O8 and YBa2Cu3O7 single crystals at low external fields. The ac field was applied perpendicular to the CuO2 planes. The first and third harmonics of the ac susceptibility exhibit remarkably sharp features when the dc field component perpendicular to the CuO2 planes passes a threshold field Hth. Hth is strongly temperature dependent, but is independent of the parallel field component. We propose a simple model which excellently explains the data. Within this model the peak structures are related to the irreversibility line. We discuss the implications of the model for the interpretation of the ac susceptibility. copyright 1996 The American Physical Society

  19. Fabrication of alumina films with laminated structures by ac anodization

    Anodization techniques by alternating current (ac) are introduced in this review. By using ac anodization, laminated alumina films are fabricated. Different types of alumina films consisting of 50–200 nm layers were obtained by varying both the ac power supply and the electrolyte. The total film thickness increased with an increase in the total charge transferred. The thickness of the individual layers increased with the ac voltage; however, the anodization time had little effect on the film thickness. The laminated alumina films resembled the nacre structure of shells, and the different morphologies exhibited by bivalves and spiral shells could be replicated by controlling the rate of increase of the applied potentials. (paper)

  20. American Community Survey (ACS) 5-Year Estimates for Coastal Geographies

    National Oceanic and Atmospheric Administration, Department of Commerce — The American Community Survey (ACS) is an ongoing statistical survey that samples a small percentage of the population every year. These data have been apportioned...

  1. Strong Coupling Isotropization of Non-Abelian Plasmas Simplified

    Heller, M.P.; Mateos, D.; van der Schee, W.; Trancanelli, D.

    2012-01-01

    We study the isotropization of a homogeneous, strongly coupled, non-Abelian plasma by means of its gravity dual. We compare the time evolution of a large number of initially anisotropic states as determined, on the one hand, by the full non-linear Einstein's equations and, on the other, by the Einstein's equations linearized around the final equilibrium state. The linear approximation works remarkably well even for states that exhibit large anisotropies. For example, it predicts with a 20% ac...

  2. Muc5ac mucin expression during rat skin development

    V. Ferretti; Á. Segal-Eiras; Barbeito, C.G.; Croce, M. V.

    2015-01-01

    Some mucin genes have been detected during human embryonic and fetal organ development; however, little is known about mucin expression in epidermal development, neither in humans nor in other species. The present research was developed to explore Muc5ac skin expression during prenatal and postnatal rat development. Immunohistochemistry (IHC), Western blotting (WB) and RT-PCR were employed. By IHC, Muc5ac protein was found early in embryonic epidermis from day 13 of gestation until seven days...

  3. Dynamics of a nanowire superlattice in an ac electric field

    Zhang, Aizhen; Voon, L. C. Lew Yan; M. Willatzen

    2005-01-01

    With a one-band envelope function theory, we investigate the dynamics of a finite nanowire superlattice driven by an ac electric field by solving numerically the time-dependent Schroedinger equation. We find that for an ac electric field resonant with two energy levels located in two different minibands, the coherent dynamics in nanowire superlattices is much more complex as compared to the standard two-level description. Depending on the energy levels involved in the transitions, the coheren...

  4. Fractal AC circuits and propagating waves on fractals

    Akkermans, Eric; Dunne, Gerald; Rogers, Luke G; Teplyaev, Alexander

    2015-01-01

    We extend Feynman's analysis of the infinite ladder AC circuit to fractal AC circuits. We show that the characteristic impedances can have positive real part even though all the individual impedances inside the circuit are purely imaginary. This provides a physical setting for analyzing wave propagation of signals on fractals, by analogy with the Telegrapher's Equation, and generalizes the real resistance metric on a fractal, which provides a measure of distance on a fractal, to complex impedances.

  5. Autonomous Operation of Hybrid Microgrid With AC and DC Subgrids

    Chiang Loh, Poh; Li, Ding; Kang Chai, Yi;

    2013-01-01

    This paper investigates on power-sharing issues of an autonomous hybrid microgrid. Unlike existing microgrids which are purely ac, the hybrid microgrid studied here comprises dc and ac subgrids interconnected by power electronic interfaces. The main challenge here is to manage power flows among all...... converters. Suitable control and normalization schemes are now developed for controlling them with the overall hybrid microgrid performance already verified in simulation and experiment....

  6. AC resistivity of d-wave ceramic superconductors

    Li, Mai Suan; Dominguez, Daniel

    2000-01-01

    We model d-wave ceramic superconductors with a three-dimensional lattice of randomly distributed $\\pi$ Josephson junctions with finite self-inductance. The linear and nonlinear ac resistivity of the d-wave ceramic superconductors is obtained as function of temperature by solving the corresponding Langevin dynamical equations. We find that the linear ac resistivity remains finite at the temperature $T_p$ where the third harmonics of resistivity has a peak. The current amplitude dependence of t...

  7. Scaling and universality of ac conduction in disordered solids

    Schrøder, Thomas; Dyre, Jeppe

    2000-01-01

    Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac conduct...... conductivity arising in the extreme disorder limit of the symmetric hopping model, the "diffusion cluster approximation," is presented and compared to computer simulations and experiments....

  8. Instabilities, turbulence and transport in a magnetized plasma; Instabilites, turbulence et transport dans un plasma magnetise

    Garbet, X

    2001-06-01

    The purpose of this work is to introduce the main processes that occur in a magnetized plasma. During the last 2 decades, the understanding of turbulence has made great progress but analytical formulas and simulations are far to produce reliable predictions. The values of transport coefficients in a tokamak plasma exceed by far those predicted by the theory of collisional transport. This phenomenon is called abnormal transport and might be due to plasma fluctuations. An estimation of turbulent fluxes derived from the levels of fluctuations, is proposed. A flow description of plasma allows the understanding of most micro-instabilities. The ballooning representation deals with instabilities in a toric geometry. 3 factors play an important role to stabilize plasmas: density pinch, magnetic shear and speed shear. The flow model of plasma gives an erroneous value for the stability threshold, this is due to a bad description of the resonant interaction between wave and particle. As for dynamics, flow models can be improved by adding dissipative terms so that the linear response nears the kinetic response. The kinetic approach is more accurate but is complex because of the great number of dimensions involved. (A.C.)

  9. Simulation of the Relaxation Potential Profile of an ac-dc-ac Test

    Kerry N. Allahar

    2014-01-01

    Full Text Available The relaxation period of the accelerated ac-dc-ac test for coatings is associated with the transient electrochemistry that occurs when the immersed coated system is allowed to return to a stable open-circuit condition after being subjected to a cathodic potential. A mathematical model of the transient electrochemistry that occurs during this relaxation period is presented for coated aluminum. Expressions for the corrosion potential and corrosion current as functions of the local pH at the metal-coating interface were developed using reported experimental results. These expressions enabled the simulation of the transient electrochemistry under the constraint of balanced anodic and cathodic current densities. Regression of the transient relaxation potential profiles to exponential decay functions provided time-constant characterization of the profiles. Simulated results are presented that demonstrate the influences of the coating's porosity and thickness, the applied dc potential and the metal-coating interface condition on the time-constants associated with the relaxation profile. Interpretation of experimentally reported relaxation potential profiles supported the analysis of the simulated results.

  10. Diagnostics of the Fermilab Tevatron using an AC dipole

    Miyamoto, Ryoichi; /Texas U.

    2008-08-01

    The Fermilab Tevatron is currently the world's highest energy colliding beam facility. Its counter-rotating proton and antiproton beams collide at 2 TeV center-of-mass. Delivery of such intense beam fluxes to experiments has required improved knowledge of the Tevatron's beam optical lattice. An oscillating dipole magnet, referred to as an AC dipole, is one of such a tool to non-destructively assess the optical properties of the synchrotron. We discusses development of an AC dipole system for the Tevatron, a fast-oscillating (f {approx} 20 kHz) dipole magnet which can be adiabatically turned on and off to establish sustained coherent oscillations of the beam particles without affecting the transverse emittance. By utilizing an existing magnet and a higher power audio amplifier, the cost of the Tevatron AC dipole system became relatively inexpensive. We discuss corrections which must be applied to the driven oscillation measurements to obtain the proper interpretation of beam optical parameters from AC dipole studies. After successful operations of the Tevatron AC dipole system, AC dipole systems, similar to that in the Tevatron, will be build for the CERN LHC. We present several measurements of linear optical parameters (beta function and phase advance) for the Tevatron, as well as studies of non-linear perturbations from sextupole and octupole elements.

  11. Surface DBD for deposition of the PEO-like plasma polymers

    Gordeev, Ivan; Šimek, Milan; Prukner, Václav; Choukourov, A.; Biederman, H.

    2012-01-01

    Roč. 9, č. 1 (2012), s. 83-89. ISSN 1612-8850 R&D Projects: GA ČR(CZ) GD104/09/H080 Institutional research plan: CEZ:AV0Z20430508 Keywords : AC barrier discharges * surface discharges * plasma polymers * poly(ethylene oxide) (PEO) * UV-vis spectroscopy Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 3.730, year: 2012 http://onlinelibrary.wiley.com/doi/10.1002/ppap.201100051/pdf

  12. Nonthermally Dominated Electron Acceleration during Magnetic Reconnection in a Low-beta Plasma

    Li, Xiaocan; Guo, Fan; Hui LI; Li, Gang

    2015-01-01

    By means of fully kinetic simulations, we investigate electron acceleration during magnetic reconnection in a nonrelativistic proton--electron plasma with conditions similar to solar corona and flares. We demonstrate that reconnection leads to a nonthermally dominated electron acceleration with a power-law energy distribution in the nonrelativistic low-$\\beta$ regime but not in the high-$\\beta$ regime, where $\\beta$ is the ratio of the plasma thermal pressure and the magnetic pressure. The ac...

  13. Complement activation in plasma before and after infliximab treatment in Crohn disease

    Zimmermann-Nielsen, E; Agnholt, J; Thorlacius-Ussing, O;

    2003-01-01

    BACKGROUND: Crohn disease is characterized by up-regulated intestinal inflammation mainly caused by increased tumour necrosis factor alpha (TNF-alpha) levels. However, the complement system (C) may also have a role in maintaining inflammation. METHODS: Plasma from 26 patients with Crohn disease...... plasma from patients with Crohn disease; the decrease observed in the classical pathway-mediated C3-AC after treatment with Infliximab reflects a general down-regulation in immune activation....

  14. Controlo de um conversor AC-DC-AC para turbinas eólicas baseadas no PMSG

    Bulhosa, João Paulo Rodrigues

    2009-01-01

    A dissertação teve como objectivo o estudo e implementação do controlo de um conversor AC-DC-AC, constituído por um conversor DC/DC elevador e um inversor de tensão monofásico, para efectuar a ligação à rede de turbinas eólicas baseadas no gerador síncrono de ímanes permanentes. O controlo global do conversor AC-DC-AC seguiu uma estratégia na qual o controlo do conversor elevador e do inversor de tensão monofásico é implementado de modo independente. O primeiro visa maximizar a potência ex...

  15. Integration issues of a plasma contactor Power Electronics Unit

    Pinero, Luis R.; York, Kenneth W.; Bowers, Glen E.

    1995-01-01

    A hollow cathode-based plasma contactor is baselined on International Space Station Alpha (ISSA) for spacecraft charge control. The plasma contactor system consists of a hollow cathode assembly (HCA), a power electronics unit (PEU), and an expellant management unit (EMU). The plasma contactor has recently been required to operate in a cyclic mode to conserve xenon expellant and extend system life. Originally, a DC cathode heater converter was baselined for a continuous operation mode because only a few ignitions of the hollow cathode were expected. However, for cyclic operation, a DC heater supply can potentially result in hollow cathode heater component failure due to the DC electrostatic field. This can prevent the heater from attaining the proper cathode tip temperature for reliable ignition of the hollow cathode. To mitigate this problem, an AC cathode heater supply was therefore designed, fabricated, and installed into a modified PEU. The PEU was tested using resistive loads and then integrated with an engineering model hollow cathode to demonstrate stable steady-state operation. Integration issues such as the effect of line and load impedance on the output of the AC cathode heater supply and the characterization of the temperature profile of the heater under AC excitation were investigated.

  16. Optimization of plasma initiation scenarios in JT-60SA

    Stable plasma initiation is very important in nuclear fusion devices especially in superconducting tokamaks, because available electric field at breakdown will be limited to the range of 0.3 - 0.5 V/m for suppressing large AC losses in the superconducting magnet. However, induced current in passive structures such as vacuum vessel and stabilizing plate will increase to the comparable level of plasma current of several hundred kA even in the case of breakdown assisted by Electron Cyclotron Heating (ECH), and it will enhance the strength of error field. Therefore, optimization of the voltage waveforms of poloidal field coil is necessary to realize the stable plasma initiation. In this paper, magnetic field control method for the stable plasma initiation and cost effectively designed magnet power supply system in JT-60SA are presented. (author)

  17. Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

    Ljusev, P.; Andersen, Michael A.E.

    2005-07-01

    This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach it is not required to do any measurements, thus making it more reliable. Initial testing made on the prototype prove the feasibility of the approach. (au)

  18. Comparison of the characteristics of atmospheric pressure plasma jets using different working gases and applications to plasma-cancer cell interactions

    Hea Min Joh

    2013-09-01

    Full Text Available Atmospheric pressure plasma jets employing nitrogen, helium, or argon gases driven by low-frequency (several tens of kilohertz ac voltage and pulsed dc voltage were fabricated and characterized. The changes in discharge current, optical emission intensities from reactive radicals, gas temperature, and plume length of plasma jets with the control parameters were measured and compared. The control parameters include applied voltage, working gas, and gas flow rate. As an application to plasma-cancer cell interactions, the effects of atmospheric pressure plasma jet on the morphology and intracellular reactive oxygen species (ROS level of human lung adenocarcinoma cell (A549 and human bladder cancer cell (EJ were explored. The experimental results show that the plasma can effectively control the intracellular concentrations of ROS. Although there exist slight differences in the production of ROS, helium, argon, or nitrogen plasma jets are found to be useful in enhancing the intracellular ROS concentrations in cancer cells.

  19. Monoclonal antibodies AC-43 and AC-29 disrupt Plasmodium vivax development in the Indian malaria vector Anopheles culicifacies (Diptera: culicidae)

    Manoj Chugh; B R Gulati; S K Gakhar

    2010-03-01

    A repertoire of monoclonal antibodies (mAbs) was generated against the midgut proteins of Anopheles culicifacies mosquitoes. The mAbs AC-43 and AC-29 significantly inhibited Plasmodium vivax development inside the mosquito midgut. The number of oocysts that developed was reduced by 78.6% when mosquitoes ingested a combination of these two mAbs along with the blood meal. AC-43 mAb binds to the epitope common in 97, 80 and 43 kDa polypeptides from the midgut protein extract, as indicated by western blot analysis. Similarly, the mAb AC-29 recognized 52, 44, 40 and 29 kDa polypeptides. These female midgut-specific polypeptides are shared between An. culicifacies and An. stephensi, two major vectors of malaria in India. Deglycosylation assays revealed that -linked carbohydrates are the major components in epitopes corresponding to AC-43 and AC-29. Gold particle labelling revealed that both these mAbs preferentially bind to glycoproteins at the apical microvilli and the microvillus-associated network present inside transverse sections of the gut epithelium. These regions are particularly known to have receptors for ookinetes, which enable them to cross this epithelial barrier and provide them with certain necessary chemicals or components for further development into oocysts. Therefore, these glycoproteins appear to be potential candidates for a vectordirected transmission-blocking vaccine (TBV).

  20. The role of plasma response in divertor footprint modification by 3D fields in NSTX

    Ahn, Joonwook; Kim, Kimin; Canal, Gustavo; Gan, Kaifu; Gray, Travis; McLean, Adam; Park, Jong-Kyu; Scotti, Filippo

    2015-11-01

    In NSTX, the divertor footprints of both heat and particle fluxes are found to be significantly modified by externally applied 3D magnetic perturbations. Striations on the divertor surface, indicating separatrix splitting and formation of magnetic lobes, are observed for both n = 1 and n = 3 perturbation fields. These striations can lead to localized heating of the divertor plates and to the re-attachment of detached plasmas, both of which have to be avoided in ITER for successful heat flux management. In this work, the role of plasma response on the formation of separatrix splitting has been investigated in the ideal framework by comparing measured heat and particle flux footprints with field line tracing calculations with and without contributions from the plasma response calculated by the ideal code IPEC. Simulations show that, n = 3 fields are slightly shielded by the plasma, with the measured helical pattern of striations in good agreement with the results from the vacuum approximation. The n = 1 fields are, however, significantly amplified by the plasma response, which provides a better agreement with the measurements. Resistive plasma response calculations by M3D-C1 are also in progress and the results will be compared with those from the ideal code IPEC. This work was supported by DoE Contracts: DE-AC05-00OR22725, DE-AC52-07NA27344 and DE-AC02-09CH11466.

  1. Comparison of H2 and He carbon cleaning mechanisms in extreme ultraviolet induced and surface wave discharge plasmas

    Dolgov, A; Rachimova, T; Kovalev, A; Vasilyeva, A; Lee, C J; Krivtsun, V M; Yakushev, O; Bijkerk, F

    2013-01-01

    Cleaning of contamination of optical surfaces by amorphous carbon (a-C) is highly relevant for extreme ultraviolet (EUV) lithography. We have studied the mechanisms for a-C removal from a Si surface. By comparing a-C removal in a surface wave discharge (SWD) plasma and an EUV-induced plasma, the cleaning mechanisms for hydrogen and helium gas environments were determined. The C-atom removal per incident ion was estimated for different sample bias voltages and ion fluxes. It was found that H2 plasmas generally had higher cleaning rates than He plasmas: up to seven times higher for more negatively biased samples in EUV induced plasma. Moreover, for H2, EUV induced plasma was found to be 2-3 times more efficient at removing carbon than the SWD plasma. It was observed carbon removal during exposure to He is due to physical sputtering by He+ ions. In H2, on the other hand, the increase in carbon removal rates is due to chemical sputtering. This is a new C cleaning mechanism for EUV-induced plasma, which we call "E...

  2. Usefulness of pregnancy-associated plasma protein A in patients with acute coronary syndrome

    Iversen, Kasper K; Dalsgaard, Morten; Teisner, Ane S; Schoos, Mikkel; Teisner, Borge; Nielsen, Henrik; Clemmensen, Peter; Grande, Peer

    2009-01-01

    To investigate whether pregnancy-associated plasma protein-A (PAPP-A) is a prognostic marker in patients admitted with high-risk acute coronary syndrome. In patients admitted with high-risk non-ST-segment elevation acute coronary syndrome (NSTE-ACS) and ST-segment elevation myocardial infarction...

  3. Temas de Física para Ingeniería: Acústica

    Beléndez Vázquez, Augusto

    1992-01-01

    Acústica, fluidos y termodinámica: "Acústica". Ondas sonoras, propagación. Sonidos puros, sonidos complejos y ruidos. Velocidad de propagación del sonido. Intensidad del sonido y potencia acústica. Impedancia acústica y transmisión del sonido. Medición del campo acústico: niveles. Audición. Interferencia de ondas sonoras y pulsaciones. Tubos sonoros. Efecto Doppler.

  4. Analysis of AC loss in superconducting power devices calculated from short sample data

    Rabbers, J.J.; Haken, ten, Bennie; Kate, ten, F.J.W.

    2003-01-01

    A method to calculate the AC loss of superconducting power devices from the measured AC loss of a short sample is developed. In coils and cables the magnetic field varies spatially. The position dependent field vector is calculated assuming a homogeneous current distribution. From this field profile and the transport current, the local AC loss is calculated. Integration over the conductor length yields the AC loss of the device. The total AC loss of the device is split up in different compone...

  5. Plasma Free Metanephrines

    ... be limited. Home Visit Global Sites Search Help? Plasma Free Metanephrines Share this page: Was this page helpful? Also known as: Plasma Metanephrines Formal name: Fractionated Plasma Free Metanephrines (Metanephrine ...

  6. Multiple mirror plasma confinement

    Multiple mirror plasma confinement concept is considered. A theory of plasma diffusion through a corrugated magnetic field is developed. It is shown, that multiple mirror devices hold considerable promise for confining fusion plasmas. 75 refs.; 8 figs.; 4 tabs

  7. Improved plasma accelerator

    Cheng, D. Y.

    1971-01-01

    Converging, coaxial accelerator electrode configuration operates in vacuum as plasma gun. Plasma forms by periodic injections of high pressure gas that is ionized by electrical discharges. Deflagration mode of discharge provides acceleration, and converging contours of plasma gun provide focusing.

  8. Behaviour analysis of AC-600 passive safety systems

    Southwest Center of Reactor Engineering Research and Design has finished the first step conceptual design of 600 mwe advanced PWR (AC-600). The main research emphases of AC-600 conceptual design include the advanced reactor core, the passive safety systems and the simplification. The passive safety systems of AC-600 consist of two reactor make up water tanks, two accumulators, two emergency feedwater tanks, two emergency natural draft air condensers, a containment water jacket and an enhanced primary cycle natural circulation flow system. 25% of the rated reactor power can be removed by the natural circulation cooling. The full pressure reactor make up water tanks are able to provide enough borated water which would be injected into the reactor coolant system during small LOCA. The coolant natural circulations can be established in the primary system and the passive secondary emergency feedwater system, removing residual heat from the reactor core to the atmosphere when station blackout occurs. It is indicated from analysis that the containment diameter of AC-600 is about 35 m. The large tanks and the large vertical distances between the tanks and reactor core are the main reason of using the big containment. It is also indicated from analysis that the low head safety injection pumps are required in AC-600 design to assure the recirculation system operation when large LOCA occurs. The reliability of AC-600 engineered safety systems is increased because the function of the passive safety systems is conducted through the immutable natural laws. The paper discusses the natural circulation ability and safety behavior of the passive safety systems during LOCA or station blackout for AC-600. The passive limits to excess reactivity and thermal hydraulic transients are also preliminarily discussed. Figs and tabs

  9. Tritium Plasma Experiment Upgrade for Fusion Tritium and Nuclear Sciences

    Shimada, Masashi; Taylor, Chase N.; Kolasinski, Robert D.; Buchenauer, Dean A.

    2015-11-01

    The Tritium Plasma Experiment (TPE) is a unique high-flux linear plasma device that can handle beryllium, tritium, and neutron-irradiated plasma facing materials, and is the only existing device dedicated to directly study tritium retention and permeation in neutron-irradiated materials [M. Shimada et.al., Rev. Sci. Instru. 82 (2011) 083503 and and M. Shimada, et.al., Nucl. Fusion 55 (2015) 013008]. Recently the TPE has undergone major upgrades in its electrical and control systems. New DC power supplies and a new control center enable remote plasma operations from outside of the contamination area for tritium, minimizing the possible exposure risk with tritium and beryllium. We discuss the electrical upgrade, enhanced operational safety, improved plasma performance, and development of tritium plasma-driven permeation and optical spectrometer system. This upgrade not only improves operational safety of the worker, but also enhances plasma performance to better simulate extreme plasma-material conditions expected in ITER, Fusion Nuclear Science Facility (FNSF), and Demonstration reactor (DEMO). This work was prepared for the U.S. Department of Energy, Office of Fusion Energy Sciences, under the DOE Idaho Field Office contract number DE-AC07-05ID14517.

  10. Self-organized pattern formation of an atmospheric-pressure, ac glow discharge with an electrolyte electrode

    An atmospheric-pressure plasma sustained by an ac power supply was generated using electrolyte solution as one of the electrodes. By altering the power supply, ring-like patterns, double-ring patterns and plasma-spot patterns were observed at the electrolyte–electrode surface. Synchronous current–voltage characteristics and time-resolved images were measured. Important factors for the self-organized patterns, including the electrode gap, power, frequency and electrolyte concentration, were explored. The optical spectrum characteristics of the device were investigated. The pH of the solution after discharge was also explored and the results show that the pH of the solution is evidently reduced after the discharge, implying that acidic components are produced in the solution. This study provides an alternative discharge method for producing patterns on a water surface. (paper)

  11. An AC/AC Direct Power Conversion Topology Having Multiple Power Grid Connections with Adjustable Loading

    Klumpner, Christian; Blaabjerg, Frede

    2004-01-01

    these fraction power will be a necessary feature on a deregulated energy market. This paper presents a new topology of a power converter based on the Direct Power Conversion concept, which is able to connect to multiple grids and provide complete decoupling between without circulating power between the......Normally, a power converter has one supply port to connect to the power grid and one or multiple output ports to connect to AC loads that require variable voltage and variable frequency. As the trend on the energy market is towards deregulation, new converter topologies are needed to allow...... to minimize the overall energy cost or in case of special applications, to improve the system redundancy. Also, having a generator that can simultaneously feed fractions of its power into multiple grids which are not coupled (different voltage, frequency, displacement angle) and continuously adjust...

  12. Plasma-wall interaction; Interaction plasma paroi

    Reichle, R

    2004-07-01

    This document gathers the 43 slides presented in the framework of the week long lecture 'hot plasmas 2004' and dedicated to plasma-wall interaction in a tokamak. This document is divided into 4 parts: 1) thermal load on the wall, power extraction and particle recovery, 2) basic edge plasma physics, 3) processes that drive the plasma-solid interaction, and 4) material conditioning (surface treatment...) for ITER.

  13. Lectures in plasma diagnostics

    This paper discusses the following topics on plasma diagnostics: Electric probes in flowing and magnetized plasmas; Electron cyclotron emission absorption; Magnetic diagnostics; Spectroscopy; and Thomson Scattering

  14. Isolation of MA-ACS Gene Family and Expression Study of MA-ACS1 Gene in Musa acuminata Cultivar Pisang Ambon Lumut

    LISTYA UTAMI KARMAWAN

    2009-03-01

    Full Text Available Musa acuminata cultivar pisang ambon lumut is a native climacteric fruit from Indonesia. Climacteric fruit ripening process is triggered by the gaseous plant hormone ethylene. The rate limiting enzyme involved in ethylene biosynthesis is ACC synthase (ACS which is encoded by ACS gene family. The objective of this study is to identify MA-ACS gene family in M. acuminata cultivar pisang ambon lumut and to study the MA-ACS1 gene expression. The result showed that there were nine M. acuminata ACS gene family members called MA-ACS1–9. Two of them (MA-ACS1 and MA-ACS2 were assessed using reverse transcriptase PCR (RT-PCR for gene expression study and it was only MA-ACS1 correlated with fruit ripening. The MA-ACS1 gene fragment has been successfully isolated and characterized and it has three introns, four exons, and one stop codon. It also shows highest homology with MACS1 gene from M. acuminata cultivar Hsian Jien Chiao (GenBank accession number AF056164. Expression analysis of MA-ACS1 using quantitative PCR (qPCR showed that MA-ACS1 gene expression increased significantly in the third day, reached maximum at the fifth day, and then decreased in the seventh day after harvesting. The qPCR expression analysis result correlated with the result of physical analysis during fruit ripening.

  15. Hydrogen sulfide releasing aspirin, ACS14, attenuates high glucose-induced increased methylglyoxal and oxidative stress in cultured vascular smooth muscle cells.

    Huang, Qian; Sparatore, Anna; Del Soldato, Piero; Wu, Lingyun; Desai, Kaushik

    2014-01-01

    Hydrogen sulfide is a gasotransmitter with vasodilatory and anti-inflammatory properties. Aspirin is an irreversible cyclooxygenase inhibitor anti-inflammatory drug. ACS14 is a novel synthetic hydrogen sulfide releasing aspirin which inhibits cyclooxygenase and has antioxidant effects. Methylglyoxal is a chemically active metabolite of glucose and fructose, and a major precursor of advanced glycation end products formation. Methylglyoxal is harmful when produced in excess. Plasma methylglyoxal levels are significantly elevated in diabetic patients. Our aim was to investigate the effects of ACS14 on methylglyoxal levels in cultured rat aortic vascular smooth muscle cells. We used cultured rat aortic vascular smooth muscle cells for the study. Methylglyoxal was measured by HPLC after derivatization, and nitrite+nitrate with an assay kit. Western blotting was used to determine NADPH oxidase 4 (NOX4) and inducible nitric oxide synthase (iNOS) protein expression. Dicholorofluorescein assay was used to measure oxidative stress. ACS14 significantly attenuated elevation of intracellular methylglyoxal levels caused by incubating cultured vascular smooth muscle cells with methylglyoxal (30 µM) and high glucose (25 mM). ACS14, but not aspirin, caused a significant attenuation of increase in nitrite+nitrate levels caused by methylglyoxal or high glucose. ACS14, aspirin, and sodium hydrogen sulfide (NaHS, a hydrogen sulfide donor), all attenuated the increase in oxidative stress caused by methylglyoxal and high glucose in cultured cells. ACS14 prevented the increase in NOX4 expression caused by incubating the cultured VSMCs with MG (30 µM). ACS14, aspirin and NaHS attenuated the increase in iNOS expression caused by high glucose (25 mM). In conclusion, ACS14 has the novel ability to attenuate an increase in methylglyoxal levels which in turn can reduce oxidative stress, decrease the formation of advanced glycation end products and prevent many of the known deleterious effects

  16. Hydrogen sulfide releasing aspirin, ACS14, attenuates high glucose-induced increased methylglyoxal and oxidative stress in cultured vascular smooth muscle cells.

    Qian Huang

    Full Text Available Hydrogen sulfide is a gasotransmitter with vasodilatory and anti-inflammatory properties. Aspirin is an irreversible cyclooxygenase inhibitor anti-inflammatory drug. ACS14 is a novel synthetic hydrogen sulfide releasing aspirin which inhibits cyclooxygenase and has antioxidant effects. Methylglyoxal is a chemically active metabolite of glucose and fructose, and a major precursor of advanced glycation end products formation. Methylglyoxal is harmful when produced in excess. Plasma methylglyoxal levels are significantly elevated in diabetic patients. Our aim was to investigate the effects of ACS14 on methylglyoxal levels in cultured rat aortic vascular smooth muscle cells. We used cultured rat aortic vascular smooth muscle cells for the study. Methylglyoxal was measured by HPLC after derivatization, and nitrite+nitrate with an assay kit. Western blotting was used to determine NADPH oxidase 4 (NOX4 and inducible nitric oxide synthase (iNOS protein expression. Dicholorofluorescein assay was used to measure oxidative stress. ACS14 significantly attenuated elevation of intracellular methylglyoxal levels caused by incubating cultured vascular smooth muscle cells with methylglyoxal (30 µM and high glucose (25 mM. ACS14, but not aspirin, caused a significant attenuation of increase in nitrite+nitrate levels caused by methylglyoxal or high glucose. ACS14, aspirin, and sodium hydrogen sulfide (NaHS, a hydrogen sulfide donor, all attenuated the increase in oxidative stress caused by methylglyoxal and high glucose in cultured cells. ACS14 prevented the increase in NOX4 expression caused by incubating the cultured VSMCs with MG (30 µM. ACS14, aspirin and NaHS attenuated the increase in iNOS expression caused by high glucose (25 mM. In conclusion, ACS14 has the novel ability to attenuate an increase in methylglyoxal levels which in turn can reduce oxidative stress, decrease the formation of advanced glycation end products and prevent many of the known

  17. Modelling ac ripple currents in HTS coated conductors

    Xu, Zhihan; Grilli, Francesco

    2015-10-01

    Dc transmission using high temperature superconducting (HTS) coated conductors (CCs) offers a promising solution to the globally growing demand for effective, reliable and economic transmission of green energy up to the gigawatt level over very long distances. The credible estimation of the losses and thereby the heat dissipation involved, where ac ripples (introduced in rectification/ac-dc conversion) are viewed as a potential source of notable contribution, is highly essential for the rational design of practical HTS dc transmission cables and corresponding cryogenic systems to fulfil this demand. Here we report a targeted modelling study into the ac losses in a HTS CC subject to dc and ac ripple currents simultaneously, by solving Maxwell’s equations using the finite element method (FEM) in the commercial software package COMSOL. It is observed that the instantaneous loss exhibits only one peak per cycle in the HTS CC subject to sinusoidal ripples, given that the amplitude of the ac ripples is smaller than approximately 20% of that of the dc current. This is a distinct contrast to the usual observation of two peaks per cycle in a HTS CC subject to ac currents only. The unique mechanism is also revealed, which is directly associated with the finding that, around any local minima of the applied ac ripples, the critical state of -J c is never reached at the edges of the HTS CC, as it should be according to the Bean model. When running further into the longer term, it is discovered that the ac ripple loss of the HTS CC in full-wave rectification decays monotonically, at a speed which is found to be insensitive to the frequency of the applied ripples within our targeted situations, to a relatively low level of approximately 1.38 × 10-4 W m-1 in around 1.7 s. Comparison between this level and other typical loss contributions in a HTS dc cable implies that ac ripple currents in HTS CCs should only be considered as a minor source of dissipation in superconducting dc

  18. AC Zeeman potentials for atom chip-based ultracold atoms

    Fancher, Charles; Pyle, Andrew; Ziltz, Austin; Aubin, Seth

    2015-05-01

    We present experimental and theoretical progress on using the AC Zeeman force produced by microwave magnetic near-fields from an atom chip to manipulate and eventually trap ultracold atoms. These AC Zeeman potentials are inherently spin-dependent and can be used to apply qualitatively different potentials to different spin states simultaneously. Furthermore, AC Zeeman traps are compatible with the large DC magnetic fields necessary for accessing Feshbach resonances. Applications include spin-dependent trapped atom interferometry and experiments in 1D many-body physics. Initial experiments and results are geared towards observing the bipolar detuning-dependent nature of the AC Zeeman force at 6.8 GHz with ultracold 87Rb atoms trapped in the vicinity of an atom chip. Experimental work is also underway towards working with potassium isotopes at frequencies of 1 GHz and below. Theoretical work is focused on atom chip designs for AC Zeeman traps produced by magnetic near-fields, while also incorporating the effect of the related electric near-fields. Electromagnetic simulations of atom chip circuits are used for mapping microwave propagation in on-chip transmission line structures, accounting for the skin effect, and guiding impedance matching.

  19. Aragonite coating solutions (ACS) based on artificial seawater

    Tas, A. Cuneyt

    2015-03-01

    Aragonite (CaCO3, calcium carbonate) is an abundant biomaterial of marine life. It is the dominant inorganic phase of coral reefs, mollusc bivalve shells and the stalactites or stalagmites of geological sediments. Inorganic and initially precipitate-free aragonite coating solutions (ACS) of pH 7.4 were developed in this study to deposit monolayers of aragonite spherules or ooids on biomaterial (e.g., UHMWPE, ultrahigh molecular weight polyethylene) surfaces soaked in ACS at 30 °C. The ACS solutions of this study have been developed for the surface engineering of synthetic biomaterials. The abiotic ACS solutions, enriched with calcium and bicarbonate ions at different concentrations, essentially mimicked the artificial seawater composition and started to deposit aragonite after a long (4 h) incubation period at the tropical sea surface temperature of 30 °C. While numerous techniques for the solution deposition of calcium hydroxyapatite (Ca10(PO4)6(OH)2), of low thermodynamic solubility, on synthetic biomaterials have been demonstrated, procedures related to the solution-based surface deposition of high solubility aragonite remained uncommon. Monolayers of aragonite ooids deposited at 30 °C on UHMWPE substrates soaked in organic-free ACS solutions were found to possess nano-structures similar to the mortar-and-brick-type botryoids observed in biogenic marine shells. Samples were characterized using SEM, XRD, FTIR, ICP-AES and contact angle goniometry.

  20. AC losses in circular arrangements of parallel superconducting tapes

    Kühle (fratrådt), Anders Van Der Aa; Træholt, Chresten; Däumling, Manfred; Olsen, Søren Krüger; Tønnesen, Ole

    The DC and AC properties of superconducting tapes connected in parellel and arranged in a single closed layer on two tubes (correspondig to power cable models with infinite pitch) with different diameters are compared. We find that the DC properties, i.e. the critical currents of the two arrangem......The DC and AC properties of superconducting tapes connected in parellel and arranged in a single closed layer on two tubes (correspondig to power cable models with infinite pitch) with different diameters are compared. We find that the DC properties, i.e. the critical currents of the two...... arrangements, scale with the number of tapes and hence appear to be independent of the diameter.However, the AC loss per tape (for a given current per tape) appears to decrease with increasing diameter of the circular arrangement. Compared to a model for the AC loss in a continuous superconducting layer...... (Monoblock model) the measured values are about half an order of magnitude higher than expected for the small diameter arrangement. When compared to the AC loss calculated for N individual superconducting tapes using a well known model ( Norris elliptical) the difference is slightly smaller....

  1. AC losses in circular arrangements of parallel superconducting tapes

    Kühle (fratrådt), Anders Van Der Aa; Træholt, Chresten; Däumling, Manfred;

    1998-01-01

    The DC and AC properties of superconducting tapes connected in parellel and arranged in a single closed layer on two tubes (correspondig to power cable models with infinite pitch) with different diameters are compared. We find that the DC properties, i.e. the critical currents of the two arrangem......The DC and AC properties of superconducting tapes connected in parellel and arranged in a single closed layer on two tubes (correspondig to power cable models with infinite pitch) with different diameters are compared. We find that the DC properties, i.e. the critical currents of the two...... arrangements, scale with the number of tapes and hence appear to be independent of the diameter.However, the AC loss per tape (for a given current per tape) appears to decrease with increasing diameter of the circular arrangement. Compared to a model for the AC loss in a continuous superconducting layer...... (Monoblock model) the measured values are about half an order of magnitude higher than expected for the small diameter arrangement. When compared to the AC loss calculated for N individual superconducting tapes using a well known model ( Norris elliptical) the difference is slightly smaller....

  2. Fusion plasma physics

    Stacey, Weston M

    2012-01-01

    This revised and enlarged second edition of the popular textbook and reference contains comprehensive treatments of both the established foundations of magnetic fusion plasma physics and of the newly developing areas of active research. It concludes with a look ahead to fusion power reactors of the future. The well-established topics of fusion plasma physics -- basic plasma phenomena, Coulomb scattering, drifts of charged particles in magnetic and electric fields, plasma confinement by magnetic fields, kinetic and fluid collective plasma theories, plasma equilibria and flux surface geometry, plasma waves and instabilities, classical and neoclassical transport, plasma-materials interactions, radiation, etc. -- are fully developed from first principles through to the computational models employed in modern plasma physics. The new and emerging topics of fusion plasma physics research -- fluctuation-driven plasma transport and gyrokinetic/gyrofluid computational methodology, the physics of the divertor, neutral ...

  3. System and method for determining stator winding resistance in an AC motor using motor drives

    Lu, Bin; Habetler, Thomas G; Zhang, Pinjia

    2013-02-26

    A system and method for determining the stator winding resistance of AC motors is provided. The system includes an AC motor drive having an input connectable to an AC source and an output connectable to an input terminal of an AC motor, a pulse width modulation (PWM) converter having switches therein to control current flow and terminal voltages in the AC motor, and a control system connected to the PWM converter. The control system generates a command signal to cause the PWM converter to control an output of the AC motor drive corresponding to an input to the AC motor, selectively generates a modified command signal to cause the PWM converter to inject a DC signal into the output of the AC motor drive, and determines a stator winding resistance of the AC motor based on the DC signal of at least one of the voltage and current.

  4. On the Application of TLS Techniques to AC Electrical Drives

    M. Cirrincione

    2005-03-01

    Full Text Available This paper deals with the application of a new neuron, the TLS EXIN neuron, to AC induction motor drives. In particular, it addresses two important subjects of AC induction motor drives: the on-line estimation of the electrical parameters of the machine and the speed estimation in sensorless drives. On this basis, this work summarizes the parameter estimation and sensorless techniques already developed by the authors over these last few years, all based on the TLS EXIN. With regard to sensorless, two techniques are proposed: one based on the MRAS and the other based on the full-order Luenberger observer. The work show some of the most significant results obtained by the authors in these fields and stresses the important potentiality of this new neural technique in AC induction machine drives.

  5. Voltage drop of the SACLA AC power supply

    We installed the AC power supply of SACLA by construction. The AC power supply is connected to an inverter power supply. Because of charge and discharge to a modulator, it is necessary to supply pulsatile electricity. The total consumption electricity of approximately 70 modulators extends to 5,000kVA. A severe electric current flows, and repeats relaxing. The influence of the voltage change by the impedance of the distribution system grows big, too. In SACLA, we designed the voltage regulation at less than 10%. SACLA succeeded in laser oscillation in this June. Because we was able to put it in the predetermined voltage regulation in the machine AC power supply, I report the details. (author)

  6. Neural network based PWM AC chopper fed induction motor drive

    Venkatesan Jamuna

    2009-01-01

    Full Text Available In this paper, a new Simulink model for a neural network controlled PWM AC chopper fed single phase induction motor is proposed. Closed loop speed control is achieved using a neural network controller. To maintain a constant fluid flow with a variation in pressure head, drives like fan and pump are operated with closed loop speed control. The need to improve the quality and reliability of the drive circuit has increased because of the growing demand for improving the performance of motor drives. With the increased availability of MOSFET's and IGBT's, PWM converters can be used efficiently in low and medium power applications. From the simulation studies, it is seen that the PWM AC chopper has a better harmonic spectrum and lesser copper loss than the Phase controlled AC chopper. It is observed that the drive system with the proposed model produces better dynamic performance, reduced overshoot and fast transient response. .

  7. Microdischarges of AC-coupled silicon strip sensors

    Microdischarge at the edges of strips in AC-coupled silicon strip sensors has been investigated. A steep increase in the leakage current (breakdown) and a sudden onset of burst noise were observed at a low reverse-bias voltage when the bias potential was across the AC-coupling capacitor. This can be explained by the occurrence of microdischarges along the edges of strips. These discharges have been confirmed by observing IR light emission. A calculation of the field strength at the strip edge suggests that a fringe field of the external electrode generates the microdischarge at the strip edge when the bias voltage is 50-80 V. This is consistent with our observations. We discuss a design for AC-coupled sensors that eliminates this discharge problem. (orig.)

  8. Reliability of emergency ac power systems at nuclear power plants

    Reliability of emergency onsite ac power systems at nuclear power plants has been questioned within the Nuclear Regulatory Commission (NRC) because of the number of diesel generator failures reported by nuclear plant licensees and the reactor core damage that could result from diesel failure during an emergency. This report contains the results of a reliability analysis of the onsite ac power system, and it uses the results of a separate analysis of offsite power systems to calculate the expected frequency of station blackout. Included is a design and operating experience review. Eighteen plants representative of typical onsite ac power systems and ten generic designs were selected to be modeled by fault trees. Operating experience data were collected from the NRC files and from nuclear plant licensee responses to a questionnaire sent out for this project

  9. Analysis of ac Surface Photovoltages in Accumulation Region

    Munakata, Chusuke

    1988-05-01

    Equations for ac surface photovoltages (SPVs) excited with a chopped photon beam (PB) in the accumulation region are proposed for such semiconductors as silicon and germanium. Following the previously reported half-sided junction model for the depleted or inverted region, equations for photocurrent density and surface impedance per unit area have been newly deduced. When the surface potential is highly negative in p-type semiconductors, the maximum ac SPV in the accumulation region is limited by the conductance due to majority carrier diffusion flow. This is compared with the strong inversion region, where the mathematically maximum SPV depends upon the minority carrier diffusion flow. The voltage ratio between the two maximum ac SPVs is the same as that previously reported using the different models for dc SPVs excited with a continuous PB.

  10. Experiments on Corona Discharge Under AC and DC Composite Voltage

    ZHU Zhengyi; LI Ruihai; WANG Guoli; CHEN Can; JIA Zhidong; GUAN Zhicheng

    2012-01-01

    Converter transformers are one of the most important electrical apparatuses in the ultra high voltage(UHV) DC transmission systems.The valve side and the low voltage(LV) bushing are stressed by long-term AC and DC composite voltage leading to significant partial discharge(PD) and posing great danger to the insulation system.In this paper AC and DC composite voltage is applied on a metal needle-plate model to produce PD signal sequences,and then the pulse waveshape and frequency spectrum are analyzed and compared with PD signals under conventional AC or DC voltage.In the end,the phase-resolved distribution is analyzed to depict the new characteristics of PD under this composite voltage.

  11. Encapsulation of α-Particle–Emitting 225Ac3+ Ions Within Carbon Nanotubes

    Matson, Michael L.; Villa, Carlos H.; Ananta, Jeyarama S.; Law, Justin J.; Scheinberg, David A.; Wilson, Lon J.

    2016-01-01

    225Ac3+ is a generator of α-particle–emitting radionuclides with 4 net α-particle decays that can be used therapeutically. Targeting 225Ac3+ by use of ligands conjugated to traditional bifunctional chelates limits the amount of 225Ac3+ that can be delivered. Ultrashort, single-walled carbon nanotubes (US-tubes), previously demonstrated as sequestering agents of trivalent lanthanide ions and small molecules, also successfully incorporate 225Ac3+. Methods Aqueous loading of both 225Ac3+ ions and Gd3+ ions via bath sonication was used to construct 225Ac@gadonanotubes (225Ac@GNTs). The 225Ac@GNTs were subsequently challenged with heat, time, and human serum. Results US-tubes internally loaded with both 225Ac3+ ions and Gd3+ ions show 2 distinct populations of 225Ac3+ ions: one rapidly lost in human serum and one that remains bound to the US-tubes despite additional challenge with heat, time, and serum. The presence of the latter population depended on cosequestration of Gd3+ and 225Ac3+ ions. Conclusion US-tubes successfully sequester 225Ac3+ ions in the presence of Gd3+ ions and retain them after a human serum challenge, rendering 225Ac@GNTs candidates for radioimmunotherapy for delivery of 225Ac3+ ions at higher concentrations than is currently possible for traditional ligand carriers. PMID:25931476

  12. AC power losses in Bi-2223/Ag HTS tapes

    Full text: We report measurements at 77 K of the transport ac losses of Bi-2223/Ag composite tapes. The investigated tapes vary from single filament to multifilament construction and include both conventional tapes and other conductor shapes with twisted filaments. The self-field ac losses were determined at 77 K and 60 Hz as a function of ac current amplitude (0 - 100 A). We observe different behaviour among tapes depending on their quality and strain history. For 'good' virgin tapes the experimental data are well described by the Norris equations for the dependence of power loss P on the amplitude Im of the transport current. The data of good monofilament tapes are fitted to the Norris equation P ∼ Imn for an elliptical cross section (ie. n = 3) and the data of good multifilament tapes are fitted to the Norris equation for a rectangular strip (ie. n = 4). Many specimens, however, show a range of behaviour with lower values of n. Based on our work on the effect of strain on the dc transport properties of tapes, we carried out detailed investigations of the effect of controlled applied bend strain on the ac loss. Our results show that irreversible damage to superconducting filaments (ie. cracks) cause the ac loss to rise and n to decrease with increasing strain. In addition, applied strains much greater than the irreversible strain limit cause the ac loss to increase by several orders of magnitude and become ohmic in character with n = 2. Theoretical work is in progress to model the observed behaviour

  13. Aligned Immobilization of Proteins Using AC Electric Fields.

    Laux, Eva-Maria; Knigge, Xenia; Bier, Frank F; Wenger, Christian; Hölzel, Ralph

    2016-03-01

    Protein molecules are aligned and immobilized from solution by AC electric fields. In a single-step experiment, the enhanced green fluorescent proteins are immobilized on the surface as well as at the edges of planar nanoelectrodes. Alignment is found to follow the molecules' geometrical shape with their longitudinal axes parallel to the electric field. Simultaneous dielectrophoretic attraction and AC electroosmotic flow are identified as the dominant forces causing protein movement and alignment. Molecular orientation is determined by fluorescence microscopy based on polarized excitation of the proteins' chromophores. The chromophores' orientation with respect to the whole molecule supports X-ray crystal data. PMID:26779699

  14. AC transport in graphene-based Fabry-Perot devices

    Rocha, Claudia G; Torres, Luis E. F. Foa; Cuniberti, Gianaurelio

    2009-01-01

    We report on a theoretical study of the effects of time-dependent fields on electronic transport through graphene nanoribbon devices. The Fabry-P\\'{e}rot interference pattern is modified by an ac gating in a way that depends strongly on the shape of the graphene edges. While for armchair edges the patterns are found to be regular and can be controlled very efficiently by tuning the ac field, samples with zigzag edges exhibit a much more complex interference pattern due to their peculiar elect...

  15. A.C. losses in current-carrying superconductors

    The feasibility of superconductors for alternating current use depends on successful reduction of losses. Moreover, the demand for large field amplitudes is a stimulation for investigating the nature of a.c. losses (e.g. in the set of poloidal coils in a TOKAMAK). In this thesis, measurements are performed at a.c. superconductivity. Attention is given to various external field conditions as well as to self-field instability. Measurements are performed on different types of wires. A type of wire is searched for with both low losses and a good stabilization under self-field conditions. (G.J.P.)

  16. AC Loss Analysis on the Superconducting Coupling Magnet in MICE

    Wu, Hong; Wang, Li; Green, Michael; Li, LanKai; Xu, FengYu; Liu, XiaoKun; Jia, LinXinag

    2008-07-08

    A pair of coupling solenoids is used in MICE experiment to generate magnetic field which keeps the muons within the iris of thin RF cavity windows. The coupling solenoids have a 1.5-meter inner diameter and will produce 7.4 T peak magnetic field. Three types of AC losses in coupling solenoid are discussed. The affect of AC losses on the temperature distribution within the cold mass during charging and rapid discharging process is analyzed also. The analysis result will be further confirmed by the experiment of the prototype solenoid for coupling solenoid, which will be designed, fabricated and tested at ICST.

  17. Comportamiento acústico de espacios cubiertos con estructuras textiles

    Maya Simoes, Flavio

    2000-01-01

    En el presente trabajo estudiamos el comportamiento acústico de espacios cubiertos con textiles. Presentamos una reseña histórica de usos de textiles en la arquitectura, de la prehistoria hasta hoy. Realizamos una búsqueda bibliográfica y presentamos los resultados encontrados. Presentamos la metodología actual de análisis acústico que se utiliza en ensayos de laboratorio, simulaciones y mediciones. Estudiamos la absorción sonora de los materiales de las cubiertas textiles, en ensayos de labo...

  18. Interplay between electron overheating and ac Josephson effect

    De Cecco, A.; Le Calvez, K.; Sacépé, B.; Winkelmann, C. B.; Courtois, H.

    2016-05-01

    We study the response of high-critical-current proximity Josephson junctions to a microwave excitation. Electron overheating in such devices is known to create hysteretic dc voltage-current characteristics. Here we demonstrate that it also strongly influences the ac response. The interplay of electron overheating and ac Josephson dynamics is revealed by the evolution of the Shapiro steps with the microwave drive amplitude. Extending the resistively shunted Josephson junction model by including a thermal balance for the electronic bath coupled to phonons, a strong electron overheating is obtained.

  19. EHV AC undergrounding electrical power performance and planning

    Benato, Roberto

    2010-01-01

    EHV AC Undergrounding Electrical Power discusses methods of analysis for cable performance and for the behaviour of cable, mixed and overhead lines. The authors discuss the undergrounding of electrical power and develop procedures based on the standard equations of transmission lines. They also provide technical and economical comparisons of a variety of cables and analysis methods, in order to examine the performance of AC power transmission systems. A range of topics are covered, including: energization and de-energization phenomena of transmission lines; power quality; and cable safety cons

  20. Geodetska dela pri izgradnji AC priključka Naklo

    Pavc, Iztok

    2015-01-01

    V diplomski nalogi sem predstavil geodetska dela pri izgradnji AC priključka Naklo. Opisana so dela pred, med in po izgradnji objekta. V prvem poglavju sem predstavil smernice in načrte nove ureditve priključka na avtocesto ter obseg gradnje AC priključka Naklo. Nadaljeval sem z geodetskimi deli pred gradnjo, ki so potrebni za pripravo dobrega izhodišča za nadaljnja delo med gradnjo. Opisani so vsi postopki, ki so bili opravljeni pred pripravo projekta za gradbeno dovoljenje (PGD) in tudi pre...

  1. Dynamic conductivity of ac-dc-driven graphene superlattice

    Kukhar', E. I.; Kryuchkov, S. V.; Ionkina, E. S.

    2016-06-01

    The dynamic conductivity of graphene superlattice in the presence of ac electric field and dc electric field with longitudinal and transversal components with respect to superlattice axis was calculated. In the case of strong transversal component of dc field conductivity of graphene superlattice was shown to be such as if the electrons had got the effective mass. In the case of weak transversal component of dc field conductivity was shown to change its sign if the frequency of ac field was an integer multiple of half of Bloch frequency.

  2. Development of an AC Module System: Final Technical Report

    Suparna Kadam; Miles Russell

    2012-06-15

    The GreenRay Inc. program focused on simplifying solar electricity and making it affordable and accessible to the mainstream population. This was accomplished by integrating a solar module, micro-inverter, mounting and monitoring into a reliable, 'plug and play' AC system for residential rooftops, offering the following advantages: (1) Reduced Cost: Reduction in installation labor with fewer components, faster mounting, faster wiring. (2) Maximized Energy Production: Each AC Module operates at its maximum, reducing overall losses from shading, mismatch, or module downtime. (3) Increased Safety. Electrical and fire safety experts agree that AC Modules have significant benefits, with no energized wiring or live connections during installation, maintenance or emergency conditions. (4) Simplified PV for a Broader Group of Installers. Dramatic simplification of design and installation of a solar power system, enabling faster and more efficient delivery of the product into the market through well-established, mainstream channels. This makes solar more accessible to the public. (5) Broadened the Rooftop Market: AC Modules enable solar for many homes that have shading, split roofs, or obstructions. In addition, due to the smaller building block size of 200W vs. 1000W, homeowners with budget limitations can start small and add to their systems over time. Through this DOE program GreenRay developed the all-in-one AC Module system with an integrated PV Module and microinverter, custom residential mounting and performance monitoring. Development efforts took the product from its initial concept, through prototypes, to a commercial product sold and deployed in the residential market. This pilot deployment has demonstrated the technical effectiveness of the AC Module system in meeting the needs and solving the problems of the residential market. While more expensive than the traditional central inverter systems at the pilot scale, the economics of AC Modules become

  3. Stretched exponential relaxation and ac universality in disordered dielectrics

    Milovanov, Alexander V.; Rypdal, Kristoffer; Juul Rasmussen, Jens

    2007-01-01

    This paper is concerned with the connection between the properties of dielectric relaxation and alternating-current (ac) conduction in disordered dielectrics. The discussion is divided between the classical linear-response theory and a self-consistent dynamical modeling. The key issues are...... stretched exponential character of dielectric relaxation, power-law power spectral density, and anomalous dependence of ac conduction coefficient on frequency. We propose a self-consistent model of dielectric relaxation in which the relaxations are described by a stretched exponential decay function...

  4. L’acétaminophène chez les enfants

    Goldman, Ran D.

    2013-01-01

    Résumé Question Je suggère fréquemment aux parents d’utiliser de l’acétaminophène comme traitement de la fièvre et de la douleur pour leurs enfants. J’ai récemment reçu un enfant à mon cabinet qui s’est présenté avec une éruption cutanée sous forme de lésions en cibles une journée après avoir pris de l’acétaminophène. L’éruption s’est résorbée 3 jours après qu’on ait arrêté l’administration d’acétaminophène. L’acétaminophène comporte-t-elle des risques d’événements indésirables comme celui-ci? Réponse Comme les autres médicaments ou substances actives, les préparations d’acétaminophène pourraient poser des risques d’événements indésirables. Au cours des dernières années, on a procédé à une investigation concernant une association potentielle entre l’acétaminophène et l’asthme et la Food and Drug Administration des États-Unis a récemment publié un avertissement à propos de réactions cutanées éventuelles, graves mais rares, associées à l’acétaminophène. Même si l’acétaminophène est principalement un médicament sûr, les professionnels de la santé devraient être alertes et informer les parents à propos de la possibilité d’événements indésirables rares mais sévères.

  5. Programmable Power Supply for AC Switching Magnet of Proton Accelerator

    Jeong, Seong-Hun; Kang Heung Sik; Lee, Chi-Hwan; Lee, Hong-Gi; Park, Ki-Hyeon; Ryu, Chun-Kil; Sik Han, Hong; Suck Suh, Hyung

    2005-01-01

    The 100-MeV PEFP proton linac has two proton beam extraction lines for user' experiment. Each extraction line has 5 beamlines and has 5 Hz operating frequency. An AC switching magnet is used to distribute the proton beam to the 5 beamlines, An AC switching magnet is powered by PWM-controlled bipolar switching-mode converters. This converter is designed to operate at ±350A, 5 Hz programmable step output. The power supply is employed IGBT module and has controlled by a DSP (Digital Signal Process). This paper describes the design and test results of the power supply.

  6. Communication through plasma sheaths

    We wish to transmit messages to and from a hypersonic vehicle around which a plasma sheath has formed. For long distance transmission, the signal carrying these messages must be necessarily low frequency, typically 2 GHz, to which the plasma sheath is opaque. The idea is to use the plasma properties to make the plasma sheath appear transparent

  7. Dust-Plasma Interactions

    Our theoretical research on dust-plasma interactions has concentrated on three main areas: (a)studies of grain charging and applications; (b) waves and instabilities in weakly correlated dusty plasma with applications to space and laboratory plasmas; (c) waves in strongly coupled dusty plasmas.

  8. Plasma sweeper. [Patents

    Motley, R.W.; Glanz, J.

    1982-10-25

    A device is described for coupling RF power (a plasma sweeper) from RF power introducing means to a plasma having a magnetic field associated therewith comprises at least one electrode positioned near the plasma and near the RF power introducing means. Means are described for generating a static electric field at the electrode directed into the plasma and having a component substantially perpendicular to the plasma magnetic field such that a non-zero vector cross-product of the electric and magnetic fields exerts a force on the plasma causing the plasma to drift.

  9. Stability of collisional plasma

    As was shown experimentally, plasma obtained in rough vacuum is especially stable. Based on the simple plasma particle balance equations it was shown that the presence of sources and sinks of plasma particles leads to the undercutting of the natural oscillation spectrum in the ideal plasma. The stabilisation condition obtained indicates that the plasma stability grows as its density increases. The influence of the gas inflow into plasma is considered and it is indicated that a real plasma is stable against small perturbations. (author)

  10. Introduction to plasma dynamics

    Morozov, A I

    2013-01-01

    As the twenty-first century progresses, plasma technology will play an increasing role in our lives, providing new sources of energy, ion-plasma processing of materials, wave electromagnetic radiation sources, space plasma thrusters, and more. Studies of the plasma state of matter not only accelerate technological developments but also improve the understanding of natural phenomena. Beginning with an introduction to the characteristics and types of plasmas, Introduction to Plasma Dynamics covers the basic models of classical diffuse plasmas used to describe such phenomena as linear and shock w

  11. Dicty_cDB: FCL-AC27 [Dicty_cDB

    Full Text Available GGSILASLSTFQQMWISKEEYDESGPSIVHRKCF*tnkqktsdesashkylc kiyi**iliflfilfsc*slsdfpnikkkkkkkk Homology vs CSM-cDNA Score E Sequences pr... http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-AC27Q.Seq.d/ Representativ...e seq. ID FCL-AC27Z (Link to Original site) Representative DNA sequence >FCL-AC27 (FCL-AC27Q) /CSM/FCL/FCL-A...VDIRKDLYGNVVLSGGTTMFPGIADRMNKELTALAPSTMKIKIIAPP ERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF*tnkqktsdesas.../CSM/SF/SFJ3-A/SFJ302Q.Seq.d/ 1045 0.0 own update 2004.12.25 Homology vs DNA Score E Sequences producing sig

  12. Dicty_cDB: FCL-AC10 [Dicty_cDB

    Full Text Available http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-AC10Q.Seq.d/ Representativ...e seq. ID FCL-AC10Z (Link to Original site) Representative DNA sequence >FCL-AC10 (FCL-AC10Q) /CSM/FCL/FCL-A...LTALAPSTMKIKIIAPP ERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF*tiktsdesashtnkyi* my...GNVVLSGGTTMFPGIADRMNKELTALAPSTMKIKIIAPP ERKYSVWIGGSILASLSTFQQMWISKEEYDESGPSIVHRKCF*tiktsdesashtnkyi* mynnnki....00 m_ : 1.00 40.0 %: nuclear 36.0 %: cytoplasmic 12.0 %: cytoskeletal 8.0 %: mitochondrial 4.0 %: peroxisomal >> pre

  13. Impacts on Power Factor of AC Voltage Controllers Under Non-Sinusoidal Conditions

    Mukhtiar Ahmed Mahar

    2012-04-01

    Full Text Available AC-AC conversion is obtained with the help of Cyclo-converters, DC Link converters and AC Voltage Controllers. AC voltage controllers are also referred to as voltage regulators. Main issue concerned to these converters is that they generate harmonics due to periodic variable structure system. The generated harmonics create disturbances and degrade the performance of converter. The power factor of supply side is affected due to these harmonics. This paper focuses on source side power factor of ac voltage controllers under nonsinusoidal conditions. In order to observe the power factor, measurement tool of power factor and simulation model of ac voltage controller is also developed in MATLAB software.

  14. Plasmas for space propulsion

    Ahedo, Eduardo

    2011-12-01

    Plasma thrusters are challenging the monopoly of chemical thrusters in space propulsion. The specific energy that can be deposited into a plasma beam is orders of magnitude larger than the specific chemical energy of known fuels. Plasma thrusters constitute a vast family of devices ranging from already commercial thrusters to incipient laboratory prototypes. Figures of merit in plasma propulsion are discussed. Plasma processes and conditions differ widely from one thruster to another, with the pre-eminence of magnetized, weakly collisional plasmas. Energy is imparted to the plasma via either energetic electron injection, biased electrodes or electromagnetic irradiation. Plasma acceleration can be electrothermal, electrostatic or electromagnetic. Plasma-wall interaction affects energy deposition and erosion of thruster elements, and thus is central for thruster efficiency and lifetime. Magnetic confinement and magnetic nozzles are present in several devices. Oscillations and turbulent transport are intrinsic to the performances of some thrusters. Several thrusters are selected in order to discuss these relevant plasma phenomena.

  15. Plasma injection and evolution in CHI simulations of NSTX

    Hooper, E. B.; Sovinec, C. R.; Raman, R.

    2014-10-01

    Simulations of co-injection of helicity and plasma into a low density plasma in NSTX are compared with experiment, extending previous simulations that assumed helicity injection into a constant density plasma. The background plasma response is minimized by density-dependent artificial radiation. Helicity and plasma flow from the slot at the ExB velocity due to the applied voltage. A simple model of impurity radiation from the injected plasma improves agreement with the temperature during experimental plasma buildup and following flux closure after injection. The simulations also explore the effect of impurity concentration near the bottom plate where impurities are generated at the footprints of the currents associated with the injection. As in previous simulations, non-axisymmetric flows and currents are generated during injection but have little impact on the final closed-flux configuration. Work performed under the auspices of the U.S. Department of Energy under Contract DE-AC52-07NA27344 at LLNL.

  16. Visible camera imaging of plasmas in Proto-MPEX

    Mosby, R.; Skeen, C.; Biewer, T. M.; Renfro, R.; Ray, H.; Shaw, G. C.

    2015-11-01

    The prototype Material Plasma Exposure eXperiment (Proto-MPEX) is a linear plasma device being developed at Oak Ridge National Laboratory (ORNL). This machine plans to study plasma-material interaction (PMI) physics relevant to future fusion reactors. Measurements of plasma light emission will be made on Proto-MPEX using fast, visible framing cameras. The cameras utilize a global shutter, which allows a full frame image of the plasma to be captured and compared at multiple times during the plasma discharge. Typical exposure times are ~10-100 microseconds. The cameras are capable of capturing images at up to 18,000 frames per second (fps). However, the frame rate is strongly dependent on the size of the ``region of interest'' that is sampled. The maximum ROI corresponds to the full detector area, of ~1000x1000 pixels. The cameras have an internal gain, which controls the sensitivity of the 10-bit detector. The detector includes a Bayer filter, for ``true-color'' imaging of the plasma emission. This presentation will exmine the optimized camera settings for use on Proto-MPEX. This work was supported by the US. D.O.E. contract DE-AC05-00OR22725.

  17. The Material Plasma Exposure eXperiment (MPEX)

    Rapp, J.; Biewer, T. M.; Bigelow, T. S.; Canik, J.; Caughman, J. B. O.; Duckworth, R. C.; Goulding, R. H.; Hillis, D. L.; Lore, J. D.; Lumsdaine, A.; McGinnis, W. D.; Meitner, S. J.; Owen, L. W.; Shaw, G. C.; Luo, G.-N.

    2014-10-01

    Next generation plasma generators have to be able to access the plasma conditions expected on the divertor targets in ITER and future devices. The Material Plasma Exposure eXperiment (MPEX) will address this regime with electron temperatures of 1--10 eV and electron densities of 1021--1020 m-3. The resulting heat fluxes are about 10 MW/m2. MPEX is designed to deliver those plasma conditions with a novel Radio Frequency plasma source able to produce high density plasmas and heat electron and ions separately with Electron Bernstein Wave (EBW) heating and Ion Cyclotron Resonance Heating (ICRH). Preliminary modeling has been used for pre-design studies of MPEX. MPEX will be capable to expose neutron irradiated samples. In this concept targets will be irradiated in ORNL's High Flux Isotope Reactor (HFIR) or possibly at the Spallation Neutron Source (SNS) and then subsequently (after a sufficient long cool-down period) exposed to fusion reactor relevant plasmas in MPEX. The current state of the pre-design of MPEX including the concept of handling irradiated samples will be presented. ORNL is managed by UT-Battelle, LLC, for the U.S. DOE under Contract DE-AC-05-00OR22725.

  18. Two very long chain fatty acid acyl-CoA synthetase genes, acs-20 and acs-22, have roles in the cuticle surface barrier in Caenorhabditis elegans.

    Eriko Kage-Nakadai

    Full Text Available In multicellular organisms, the surface barrier is essential for maintaining the internal environment. In mammals, the barrier is the stratum corneum. Fatty acid transport protein 4 (FATP4 is a key factor involved in forming the stratum corneum barrier. Mice lacking Fatp4 display early neonatal lethality with features such as tight, thick, and shiny skin, and a defective skin barrier. These symptoms are strikingly similar to those of a human skin disease called restrictive dermopathy. FATP4 is a member of the FATP family that possesses acyl-CoA synthetase activity for very long chain fatty acids. How Fatp4 contributes to skin barrier function, however, remains to be elucidated. In the present study, we characterized two Caenorhabditis elegans genes, acs-20 and acs-22, that are homologous to mammalian FATPs. Animals with mutant acs-20 exhibited defects in the cuticle barrier, which normally prevents the penetration of small molecules. acs-20 mutant animals also exhibited abnormalities in the cuticle structure, but not in epidermal cell fate or cell integrity. The acs-22 mutants rarely showed a barrier defect, whereas acs-20;acs-22 double mutants had severely disrupted barrier function. Moreover, the barrier defects of acs-20 and acs-20;acs-22 mutants were rescued by acs-20, acs-22, or human Fatp4 transgenes. We further demonstrated that the incorporation of exogenous very long chain fatty acids into sphingomyelin was reduced in acs-20 and acs-22 mutants. These findings indicate that C. elegans Fatp4 homologue(s have a crucial role in the surface barrier function and this model might be useful for studying the fundamental molecular mechanisms underlying human skin barrier and relevant diseases.

  19. Plasma-surface interactions associated with electrical breakdown of water using porous ceramic-coated electrodes

    Lukeš, Petr; Člupek, Martin; Babický, Václav; Šunka, Pavel

    Vol. I-01. Matsuyama, Ehime : Ehime Yoko Co.Ltd, 2010, s. 9-10. ISBN N. [International Workshop on Plasmas with Liquids (IWPL 2010). Matsuyama (JP), 22.03.2010-24.03.2010] R&D Projects: GA AV ČR IAAX00430802 Institutional research plan: CEZ:AV0Z20430508 Keywords : corona discharge * water * ceramic * electric breakdown * surface charge Subject RIV: BL - Plasma and Gas Discharge Physics http://plasma.eng.ehime-u.ac.jp/IWPL_2010/IWPL2010_ProceedingsV3.pdf

  20. Micro patterning of cell and protein non-adhesive plasma polymerized coatings for biochip applications

    Bouaidat, Salim; Berendsen, C.; Thomsen, P.;

    2004-01-01

    Micro scale patterning of bioactive surfaces is desirable for numerous biochip applications. Polyethyleneoxide-like (PEO-like) coating with non-fouling functionality has been deposited using low frequency AC plasma polymerization. The non-fouling properties of the coating were tested with human...... cells ( HeLa) and fluorescence labeled proteins (isothiocyanate-labeled bovine serum albumin, i.e. FITC-BSA). The PEO-like coatings were fabricated by plasma polymerization of 12-crown-4 (ppCrown) with plasma polymerized hexene (ppHexene) as adhesion layer. The coatings were micro patterned using...

  1. Collisionless plasmas in astrophysics

    Belmont, Gerard; Mottez, Fabrice; Pantellini, Filippo; Pelletier, Guy

    2013-01-01

    Collisionless Plasmas in Astrophysics examines the unique properties of media without collisions in plasma physics. Experts in this field, the authors present the first book to concentrate on collisionless conditions in plasmas, whether close or not to thermal equilibrium. Filling a void in scientific literature, Collisionless Plasmas in Astrophysics explains the possibilities of modeling such plasmas, using a fluid or a kinetic framework. It also addresses common misconceptions that even professionals may possess, on phenomena such as "collisionless (Landau) damping". Abundant illustrations

  2. Industrial plasmas in academia

    The present review, written at the occasion of the 2014 EPS Innovation award, will give a short overview of the research and development of industrial plasmas within the last 30 years and will also provide a first glimpse into future developments of this important topic of plasma physics and plasma chemistry. In the present contribution, some of the industrial plasmas studied at the CRPP/EPFL at Lausanne are highlighted and their influence on modern plasma physics and also discharge physics is discussed. One of the most important problems is the treatment of large surfaces, such as that used in solar cells, but also in more daily applications, such as the packaging industry. In this contribution, the advantages and disadvantages of some of the most prominent plasmas such as capacitively- and inductively-coupled plasmas are discussed. Electromagnetic problems due to the related radio frequency and its consequences on the plasma reactor performance, and also dust formation due to chemical reactions in plasma, are highlighted. Arcing and parasitic discharges occurring in plasma reactors can lead to plasma reactor damages. Some specific problems, such as the gas supply of a large area reactor, are discussed in more detail. Other topics of interest have been dc discharges such as those used in plasma spraying where thermal plasmas are applied for advanced material processing. Modern plasma diagnostics make it possible to investigate sparks in electrical discharge machining, which surprisingly show properties of weakly-coupled plasmas. Nanosecond dielectric barrier discharge plasmas have been applied to more speculative topics such as applications in aerodynamics and will surely be important in the future for ignition and combustion. Most of the commonly-used plasma sources have been shown to be limited in their performance. Therefore new, more effective plasma sources are urgently required. With the recent development of novel resonant network antennas for new

  3. Effect of combining a DC bias current with an AC transport current on AC losses in a High Temperature Superconductor

    Dolez, Patricia; Ligneris, Benoit des; Aubin, Marcel; Zhu, When; Cave, Julian

    1998-01-01

    Creating complex flux configurations by superposing a dc current or magnetic field onto the ac current in a type II superconducting tape should lead to a variety of peculiar behaviors. An example is the appearance of the Clem valley, a minimum in the ac losses as a function of the dc bias amplitude, which has been theoretically studied by LeBlanc et al., in the continuation of Clem's calculations. These situations have been investigated by applying a dc current to a silver-gold sheathed Bi-22...

  4. HIGH-FREQUENCY QUASI-SINGLE-STAGE (QSS) ISOLATED AC-DC AND DC-AC POWER CONVERSION

    Wang, Kunrong

    1998-01-01

    The generic concept of quasi-single-stage (QSS) power conversion topology for ac-dc rectification and dc-ac inversion is proposed. The topology is reached by direct cascading and synchronized switching of two variety of buck or two variety of boost switching networks. The family of QSS power converters feature single-stage power processing without a dc-link low-pass filter, a unidirectional pulsating dc-link voltage, soft-switching capability with minimal extra commutation circuitry, simple...

  5. Context based computational analysis and characterization of ARS consensus sequences (ACS) of Saccharomyces cerevisiae genome.

    Singh, Vinod Kumar; Krishnamachari, Annangarachari

    2016-09-01

    Genome-wide experimental studies in Saccharomyces cerevisiae reveal that autonomous replicating sequence (ARS) requires an essential consensus sequence (ACS) for replication activity. Computational studies identified thousands of ACS like patterns in the genome. However, only a few hundreds of these sites act as replicating sites and the rest are considered as dormant or evolving sites. In a bid to understand the sequence makeup of replication sites, a content and context-based analysis was performed on a set of replicating ACS sequences that binds to origin-recognition complex (ORC) denoted as ORC-ACS and non-replicating ACS sequences (nrACS), that are not bound by ORC. In this study, DNA properties such as base composition, correlation, sequence dependent thermodynamic and DNA structural profiles, and their positions have been considered for characterizing ORC-ACS and nrACS. Analysis reveals that ORC-ACS depict marked differences in nucleotide composition and context features in its vicinity compared to nrACS. Interestingly, an A-rich motif was also discovered in ORC-ACS sequences within its nucleosome-free region. Profound changes in the conformational features, such as DNA helical twist, inclination angle and stacking energy between ORC-ACS and nrACS were observed. Distribution of ACS motifs in the non-coding segments points to the locations of ORC-ACS which are found far away from the adjacent gene start position compared to nrACS thereby enabling an accessible environment for ORC-proteins. Our attempt is novel in considering the contextual view of ACS and its flanking region along with nucleosome positioning in the S. cerevisiae genome and may be useful for any computational prediction scheme. PMID:27508123

  6. Autographa californica multiple nucleopolyhedrovirus gene ac81 is required for nucleocapsid envelopment.

    Dong, Fang; Wang, Jinwen; Deng, Riqiang; Wang, Xunzhang

    2016-08-01

    Autographa californica multiple nucleopolyhedrovirus (AcMNPV) is a highly pathogenic Baculoviridae that targets insects, whose core gene, ac81, has an unknown function. To determine the role of ac81 in the life cycle of AcMNPV, an ac81-knockout (Ac-81KO-GP) was constructed through homologous recombination in Escherichia coli. We determined that no budded virions were produced in Ac-81KO-GP-transfected Sf9 cells, while there was no effect on viral DNA replication. Electron microscopy (EM) analysis revealed that occlusion-derived virions (ODVs) envelopment and the subsequent embedding of virions into occlusion bodies (OBs) were aborted due to ac81 deletion. Interestingly, confocal microscopy and immunofluorescence analysis revealed that Ac81 was predominantly localized to the ring zone of nuclei during the late phase of infection. In addition, Ac81 was localized to the mature and premature ODVs in virus-infected cells within the ring zone as revealed by immuno-electron microscopy (IEM) analysis. Furthermore, we determined that Ac81 contained a functional hydrophobic transmembrane (TM) domain, whose deletion resulted in a phenotype similar to that of Ac-81KO-GP. These results suggest that Ac81 might be a TM protein that played an important role in nucleocapsid envelopment. PMID:27212683

  7. Biocontrol activity of Paenibacillus polymyxa AC-1 against Pseudomonas syringae and its interaction with Arabidopsis thaliana.

    Hong, Chi Eun; Kwon, Suk Yoon; Park, Jeong Mee

    2016-04-01

    Paenibacillus polymyxa AC-1 (AC-1) is a plant growth-promoting rhizobacterium (PGPR) that has been used as a soil inoculant for biocontrol of plant pathogenic fungi and to promote plant growth. In this study, we examine the effects of AC-1 on the bacterial phytopathogen Pseudomonas syringae and internal colonization of AC-1 by counting bacterial populations that colonize plants. AC-1 inhibited the growth of both P. syringae pv. tomato DC3000 (Pst) and P. syringae pv. tabaci (Pta) in a concentration-dependent manner in in vitro assays. Upon treatment of AC-1 dropping at root tip of axenically grown Arabidopsis, we found that most of the AC-1 was detected in interior of leaves of Arabidiopsis plants rather than roots after 5 days post infection, indicating systemic spreading of AC-1 occur. We examined further AC-1 colonization patterns in Arabidopsis mutants deficient in phytohormone signaling pathways. These results indicated that abscisic acid (ABA) and jasmonic acid (JA) signaling pathways positively and negatively contributed, respectively, to AC-1 colonization of leaves, whereas epiphytic accumulation of AC-1 around root tissues was not affected. This study shows that AC-1 is an effective biocontrol agent to suppress P. syringae growth, possibly owing to its colonization patterns as a leaf-inhabiting endophyte. The results showed in this work will help to expand our understanding of the mode of action of AC-1 as a biological control agent and consequently, its application in agriculture. PMID:26946374

  8. Expression and immunocytochemical analysis of Autographa californica nucleopolyhedrovirus (AcMNPV) orf74 gene

    SHI-HENG AN; ZHONG-JIANG GUO; XIN-MING YIN

    2006-01-01

    Autographa californica nucleopolyhedrovirus orf74 (Ac74) is located between 62 311 and 63 108bp in the AcMNPV genome, which encodes 265 amino acid residues with a predicted 31 kDa molecular weight. The homologues of Ac74 were searched using BLASTP in protein databases, GenBank/EMBL and SWISS-PROT. The result revealed that deduced Ac74 protein was homologous to the predicted products from 10 lepidoptera NPV ORFs. The multiple sequence alignments of Ac74 and its 10 homologues manifested only one amino acid residue was completely conserved. The transcript analysis revealed that the transcript of Ac74 was detected from 24-72 hours post-infection (hpi). The product of Ac74was detected at 24 hpi and lasted until 72 bpi by Western blot using anti-Ac74 antiserum,consistent with reverse transcriptase polymerase chain reaction results. These results suggested Ac74 was expressed during the later stages of infection. The product of Ac74 was 31 kDa in size, consistent with predicted molecular weight. The subcellular localization of Ac74 proteins manifested Ac74 protein in the cytoplasm, and was hardly present in the nucleus at 24 bpi. The fluorescence was also observed in polyhedra, except cytoplasm at 72hpi. Together, Ac74 is a functional protein with 31kDa molecular weight and is located in the cytoplasm and the polyhedra.

  9. Colloidal Plasmas : Basic physics of colloidal plasmas

    C B Dwivedi

    2000-11-01

    Colloidal plasma is a distinct class of the impure plasmas with multispecies ionic composition. The distinction lies in the phase distribution of the impurity-ion species. The ability to tailor the electrostatic interactions between these colloidal particles provides a fertile ground for scientists to investigate the fundamental aspects of the Coulomb phase transition behavior. The present contribution will review the basic physics of the charging mechanism of the colloidal particles as well as the physics of the collective normal mode behavior of the general multi-ion species plasmas. Emphasis will be laid on the clarification of the prevailing confusing ideas about distinct qualities of the various acoustic modes, which are likely to exist in colloidal plasmas as well as in normal multi-ion species plasmas. Introductory ideas about the proposed physical models for the Coulomb phase transition in colloidal plasma will also be discussed.

  10. Heat Transfer Analysis for Industrial AC Electric Arc Furnace

    (U)nal (C)amdali; Murat Tun(c)

    2005-01-01

    The heat transfer analysis was performed for an AC electric arc furnace (EAF). Heat losses by conduction, convection and radiation from outer surface, roof, bottom and electrodes of EAF were determined in detail. Some suggestions about decreasing heat losses were presented.

  11. Current Control of Grid Converters Connected with Series AC Capacitor

    Wang, Xiongfei; Blaabjerg, Frede; Loh, Poh Chiang;

    2015-01-01

    The series ac capacitor has recently been used with the transformerless grid-connected converters in the distribution power grids. The capacitive characteristic of the resulting series LC filter restricts the use of conventional synchronous integral or stationary resonant current controllers. Thus...

  12. Offshore windfarm connection with low frequency AC transmission technology

    Qin, Nan; Xu, Zhao; You, Shi;

    2009-01-01

    This paper investigates the feasibility of using the low frequency AC transmission (LFAC) system, e.g. fraction of 50 Hz or 60 Hz, for connecting the large offshore wind farm to the grid by modelling and simulation. The LFAC system improves the transmission capacity and distance compared to the c...

  13. AcTA: Accessdatabase Telen met toekomst - Alterra

    Smit, A.; Zwart, K.B.

    2003-01-01

    Binnen het project Telen met toekomst wordt een groot aantal metingen verricht, die op een overzichtelijke manier moeten worden opgeslagen. Er is gekozen voor en relationele database in MS-Access. De database zal AcTA worden genoemd (Access-database voor Telen met toekomst Alterra). Dit rapport bevat de beschrijving van de structuur van de database.

  14. Combined AC electroosmosis and dielectrophoresis for controlled rotation of microparticles.

    Walid Rezanoor, Md; Dutta, Prashanta

    2016-03-01

    Electrorotation is widely used for characterization of biological cells and materials using a rotating electric field. Generally, multiphase AC electric fields and quadrupolar electrode configuration are needed to create a rotating electric field for electrorotation. In this study, we demonstrate a simple method to rotate dielectrophoretically trapped microparticles using a stationary AC electric field. Coplanar interdigitated electrodes are used to create a linearly polarized nonuniform AC electric field. This nonuniform electric field is employed for dielectrophoretic trapping of microparticles as well as for generating electroosmotic flow in the vicinity of the electrodes resulting in rotation of microparticles in a microfluidic device. The rotation of barium titanate microparticles is observed in 2-propanol and methanol solvent at a frequency below 1 kHz. A particle rotation rate as high as 240 revolutions per minute is observed. It is demonstrated that precise manipulation (both rotation rate and equilibrium position) of the particles is possible by controlling the frequency of the applied electric field. At low frequency range, the equilibrium positions of the microparticles are observed between the electrode edge and electrode center. This method of particle manipulation is different from electrorotation as it uses induced AC electroosmosis instead of electric torque as in the case of electrorotation. Moreover, it has been shown that a microparticle can be rotated along its own axis without any translational motion. PMID:27014394

  15. Evolution of ac conductivity in nonequilibrium warm dense gold

    Using a chirped pulse probe technique, we have obtained single-shot measurements of temporal evolution of ac conductivity at 1.55 eV (800 nm) during electron energy relaxation in nonequilibrium warm dense gold with energy densities up to 4.1 MJ/kg (8*1010 J/m3). The results uncover important changes that have been masked in an earlier experiment. Equally significant, they provide valuable tests of an ab initio model for the calculation of electron heat capacity, electron-ion coupling, and ac conductivity in a single, first principles framework. While measurements of the real part of ac conductivity corroborate our theoretical temperature-dependent electron heat capacity, they point to an electron-ion coupling factor of 2.2*1016 W/m3K, significantly below that predicted by theory. In addition, measurements of the imaginary part of ac conductivity reveal the need to improve theoretical treatment of intraband contributions at very low photon energy. (authors)

  16. Exchange anisotropy determined by magnetic field dependence of ac susceptibility

    Rodríguez-Suárez, R. L.; Vilela Leão, L. H.; de Aguiar, F. M.; Rezende, S. M.; Azevedo, A.

    2003-10-01

    ac susceptibility measurements of ferromagnetic/antiferromagnetic (FM/AF) bilayers are usually performed as a function of the temperature. In this work we describe measurements of transverse biased ac susceptibility (χt) of FM/AF bilayers as a function of the applied magnetic field H0. The measurements were carried out at room temperature by means of an ac magneto-optical Kerr effect susceptometer. The χt-1(H0) dependence, at the saturation magnetization regime, exhibits a linear behavior with the applied field parallel and perpendicular to the exchange bias direction. The linear extrapolation of χt-1 versus H0 cuts the abscissa at asymmetrical values of field due to the exchange bias coupling. The inverse susceptibility is calculated in the saturation regime by a model, which takes into account the free energy of both layers plus a term corresponding to the interfacial coupling. The exchange coupling field (HE) and uniaxial anisotropy (HU) are extracted from the best fit to the experimental results. The results obtained are crosschecked by those obtained from ferromagnetic resonance (FMR) and dc magnetometry. The measurements of the exchange bias and the uniaxial field in all of the three analyzed bilayers gave values that are consistently lower when measured by FMR than those obtained by ac and dc magnetometry. It is argued that the apparently discrepant values of HE and HU, obtained by different techniques, might be explained by existence of unstable AF grains at the AF/FM interface.

  17. Introducing AC Inductive Reactance with a Power Tool

    Bryant, Wesley; Baker, Blane

    2016-01-01

    The concept of reactance in AC electrical circuits is often non-intuitive and difficult for students to grasp. In order to address this lack of conceptual understanding, classroom exercises compare the predicted resistance of a power tool, based on electrical specifications, to measured resistance. Once students discover that measured resistance…

  18. Droop-free Distributed Control for AC Microgrids

    Nasirian, Vahidreza; Shafiee, Qobad; Guerrero, Josep M.;

    2016-01-01

    A cooperative distributed secondary/primary control paradigm for AC microgrids is proposed. This solution replaces the centralized secondary control and the primary-level droop mechanism of each inverter with three separate regulators: voltage, reactive power, and active power regulators. A spars...

  19. On Conformal Field Theories With Extremal a/c Values

    Zhiboedov, Alexander

    2013-01-01

    Unitary conformal field theories (CFTs) are believed to have positive (non-negative) energy correlators. Energy correlators are universal observables in higher-dimensional CFTs built out of integrated Wightman functions of the stress-energy tensor. We analyze energy correlators in parity invariant four-dimensional CFTs. The goal is to use the positivity of energy correlators to further constrain unitary CFTs. It is known that the positivity of the simplest one-point energy correlator implies that 1/3 <= a/c <= 31/18 where a and c are the Weyl anomaly coefficients. We use the positivity of higher point energy correlators to show that CFTs with extremal values of a/c have trivial scattering observables. More precisely, for a/c=1/3 and a/c=31/18 all energy correlators are fixed to be the ones of the free boson and the free vector theory correspondingly. Similarly, we show that the positivity and finiteness of energy correlators together imply that the three-point function of the stress tensor in a CFT cann...

  20. Magnetophoresis of neutral particles in AC electric field

    Ovchinnikov, A. A.

    2002-01-01

    It has been shown that under joint action of DC magnetic and AC electric fields neutral particles (atoms,molecules,nano-size particles etc.) nearby interface move with permanent velocity along the surface. The driving force depends on non-linear dynamical properties of polarization of the particles and a coupling between the polarisation and the position of the particles on a surface.