WorldWideScience

Sample records for ac losses

  1. Transport AC losses in YBCO coated conductors

    Majoros, M [Ohio State University, Columbus, OH 43210 (United States); Ye, L [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Velichko, A V [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Coombs, T A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Sumption, M D [Ohio State University, Columbus, OH 43210 (United States); Collings, E W [Ohio State University, Columbus, OH 43210 (United States)

    2007-09-15

    Transport AC loss measurements have been made on YBCO-coated conductors prepared on two different substrate templates-RABiTS (rolling-assisted biaxially textured substrate) and IBAD (ion-beam-assisted deposition). RABiTS samples show higher losses compared with the theoretical values obtained from the critical state model, with constant critical current density, at currents lower than the critical current. An origin of this extra AC loss was demonstrated experimentally by comparison of the AC loss of two samples with different I-V curves. Despite a difference in I-V curves and in the critical currents, their measured losses, as well as the normalized losses, were practically the same. However, the functional dependence of the losses was affected by the ferromagnetic substrate. An influence of the presence of a ferromagnetic substrate on transport AC losses in YBCO film was calculated numerically by the finite element method. The presence of a ferromagnetic substrate increases transport AC losses in YBCO films depending on its relative magnetic permeability. The two loss contributions-transport AC loss in YBCO films and ferromagnetic loss in the substrate-cannot be considered as mutually independent.

  2. AC losses in filamentary YBCO/hastelloy

    Full text: The AC hysteresis loss of a long YBCO thin-film superconducting strip in a perpendicular AC magnetic field can be reduced by subdividing the film into narrow parallel strips (filaments). The hysteresis loss depends on the film critical current density Jc, the film thickness d, the filament width 2a and the lateral spacing L between filaments as well as on the AC magnetic field amplitude Hm. In addition, if the film is deposited onto a YSZ/hastelloy substrate to form a flexible tape, eddy current loss occurs in the hastelloy metal. The eddy current loss depends on the resistivity p of the hastelloy, the width 2w and thickness dm of the hastelloy substrate as well as on the frequency f and amplitude Hm. We have calculated the hysteresis and eddy current losses as a function of Jc, d, 2a, L, p, w, dm, f, and Hm to find optimal design parameters for a YBCO/hastelloy tape. As the AC loss is related to the loss component X'' of the AC susceptibility, we have measured X'' at different frequencies f and amplitudes Hm for several filamentary designs of YBCO/hastelloy tapes and compared our experimental results with our model calculations

  3. AC loss in superconducting tapes and cables

    Oomen, Marijn Pieter

    High-temperature superconductors are developed for use in power-transmission cables, transformers and motors. The alternating magnetic field in these devices causes AC loss, which is a critical factor in the design. The study focuses on multi-filament Bi-2223/Ag tapes exposed to a 50-Hz magnetic field at 77 K. The AC loss is measured with magnetic, electric and calorimetric methods. The results are compared to theoretical predictions based mainly on the Critical-State Model. The loss in high- temperature superconductors is affected by their characteristic properties: increased flux creep, high aspect ratio and inhomogeneties. Filament intergrowths and a low matrix resistivity cause a high coupling-current loss especially when the filaments are fully coupled. When the wide side of the tape is parallel to the external magnetic field, the filaments are decoupled by twisting. In a perpendicular field the filaments can be decoupled only by combining a short twist pitch with a transverse resistivity much higher than that of silver. The arrangement of the inner filaments determines the transverse resistivity. Ceramic barriers around the filaments cause partial decoupling in perpendicular magnetic fields at power frequencies. The resultant decrease in AC loss is greater than the accompanying decrease in critical current. With direct transport current in alternating magnetic field, the transport-current loss is well described with a new model for the dynamic resistance. The Critical- State Model describes well the magnetisation and total AC loss in parallel magnetic fields, at transport currents up to 0.7 times the critical current. When tapes are stacked face-to-face in a winding, the AC-loss density in perpendicular fields is greatly decreased due to the mutual shielding of the tapes. Coupling currents between the tapes in a cable cause an extra AC loss, which is reduced by a careful cable design. The total AC loss in complex devices with many tapes is generally well

  4. AC loss performance of CS insert coil

    The ITER Central Solenoid (CS) model coil and the CS insert coil were fabricated, and the test was carried out. The AC loss measurement of the coil is one of the most important tests to determine coil performance. The AC loss of a short sample conductor for the CS insert coil was measured by using the calorimetric method, and the coupling time constants of the conductor were estimated to be 30 ms and 20 ms for pulse and discharge tests, respectively. The AC loss of the CS insert coil was measured by using the calorimetric method for pulse and discharge tests. The coupling time constant estimated from the result of the pulse tests was 34 ms and almost equal to that of the short sample. The coupling time constant for the discharge test was estimated to be 140 ms and about 4 times that of the pulse test. (author)

  5. AC loss in superconducting tapes and cables

    Oomen, Marijn Pieter

    2000-01-01

    The present study discusses the AC loss in high-temperature superconductors. Superconducting materials with a relatively high critical temperature were discovered in 1986. They are presently developed for use in large-scale power-engineering devices such as power-transmission cables, transformers an

  6. The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual

    Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)

  7. Development of YBCO HTS cable with low AC loss

    High temperature superconducting (HTS) cables using YBCO tapes are expected to be more economical because AC losses will be much smaller than conventional cables. To reduce AC loss, 10 mm wide YBCO tapes were divided into five strips using a YAG laser. Using narrower strips and optimizing the space between the strips were effective in reducing AC loss. A 1 m conductor was fabricated, and AC loss was 0.048 W/m at 1 kA and 50 Hz. Based on the successful AC loss reduction in the 1 m conductor, we will fabricate a 10 m HTS cable with a three-layer HTS conductor, electrical insulation, and a one-layer HTS shield and cupper protection layer for overcurrent. In addition, we have developed a prototype of the HTS cable joint that can withstand an overcurrent condition of 31.5 kA for 2 s

  8. Numerical estimation of AC loss in superconductors with ripple current

    Highlights: •The loss energy density with ripple current is numerically calculated. •Irie–Yamafuji model is used for magnetic field dependence of critical current. •Calculated result of cylindrical superconductor agrees with theoretical result. •AC loss of strip superconductor becomes large at small ripple current amplitude. •Strip superconductor should be used as a form of hollow cylinder to reduce AC loss. -- Abstract: The loss energy density (AC loss) with ripple current is numerically calculated by finite element method for cylindrical and strip superconductors based on Irie–Yamafuji model in which the magnetic field dependence of the critical current density is taken into account for design of DC transmission cable system. It is confirmed that calculated result of the AC loss in the cylindrical superconductor with the ripple current agrees well with theoretical estimation which was reported in the previous work. On the contrary, the AC loss in the strip superconductor with the ripple current is obtained only by numerical calculation. It is found that the AC loss in the strip superconductor of the ripple current becomes larger than that without DC current at small ripple current amplitude, since the penetration depth of magnetic field becomes large. Therefore, it is recommended that strip superconductor is better to use as cylindrical hollow superconductor for DC transmission cable system to reduce the AC loss

  9. Analytical description of AC losses for high temperature superconductors

    Full text: AC losses for high temperature superconductors have been calculated by considering the effects of the temperature distribution and the flux flow resistance. Maxwell's equations and thermal diffusion equation are used to calculate the distribution of magnetic field and the temperature inside the superconductors, respectively. The flux flow effect on the AC losses is calculated by using the extended critical state model. An analytical expression of the AC losses is obtained using a superposition approximation in which the cases of complete and incomplete magnetic field penetration have been distinguished. The expression can well explain the experimental observations of the frequency dependence of the AC losses per cycle in high temperature superconductors. It is clearly shown from the analytical expression that the effect of the thermal distribution inside the superconductors is different from the effect caused by flux flow resistance. In the case of incomplete magnetic penetration, the temperature distribution results in the increase of the AC losses per cycle upon frequency whereas the flux flow leads to the decrease of the AC losses per cycle upon frequency. In the case of complete magnetic penetration the results are opposite to those in the previous case. Due to the extremely strong flux flow in high temperature superconducting materials, the effect of the flux flow on the AC losses is dominant, and the overall dependence of AC losses per cycle upon frequency is controlled by the flux flow. On the other hand, because the inhomogeneous distribution of the temperature inside the superconductors which is normal higher in the center than near the edge, there is an upper limit for the frequency beyond which the superconductivity will be totally destroyed by AC losses. Analytical expressions for the critical frequency, distributions of magnetic field and critical current density are also obtained

  10. AC losses in a HTS coil carrying DC current in AC external magnetic field

    We electrically measured AC losses in a Bi2223/Ag-sheathed pancake coil excited by a DC current in AC external magnetic field. Losses in the coil contain two kinds of loss components that are the magnetization losses and dynamic resistance losses. In the measurement, current leads to supply a current to the coil were specially arranged to suppress electromagnetic coupling between the coil current and the AC external magnetic field. A double pick-up coils method was used to suppress a large inductive voltage component contained in voltage signal for measuring the magnetization losses. It was observed that the magnetization losses were dependent on the coil current and that a peak of a curve of the loss factor vs. amplitude of the AC external magnetic field shifted to lower amplitude of the AC magnetic field as the coil current increased. This result suggests the full penetration magnetic field of the coil tape decreases as the coil current increases. The dynamic resistance losses were measured by measuring a DC voltage appearing between the coil terminals. It was observed that the DC voltage appearing in the coil subject to the AC external magnetic field was much larger than that in the coil subject to DC magnetic field

  11. Theoretical analysis of ac losses in high temperature superconducting bulks

    Ac loss behavior in HTS bulk materials is studied by developing an analytic method. The self-heating effect on the distributions of temperature in HTS bulks has been calculated. A critical frequency which sets the upper limit for driving frequency of the external field in sustaining a superconducting state is obtained. Our model provides useful information of understanding the experimental phenomena, including an anomalous ac loss behavior, a retardation of the inner field respect to the external ac field, etc., in HTS bulk materials

  12. Power Loss Modeling of Isolated AC/DC Converter

    Ahmad Khan, Naveed

    2012-01-01

    Several research activities at KTH are carried out related to Isolated AC/DC converters in order to improve the design and efficiency. Concerning the improvement in the mentioned constraints, losses of the elements in the prototype converter are modeled in this thesis work. The obtained loss model is capable of calculating the losses under different circumstances. The individual contribution of losses for each element at different conditions can be obtained, which is further useful in improvi...

  13. A.C. losses in current-carrying superconductors

    The feasibility of superconductors for alternating current use depends on successful reduction of losses. Moreover, the demand for large field amplitudes is a stimulation for investigating the nature of a.c. losses (e.g. in the set of poloidal coils in a TOKAMAK). In this thesis, measurements are performed at a.c. superconductivity. Attention is given to various external field conditions as well as to self-field instability. Measurements are performed on different types of wires. A type of wire is searched for with both low losses and a good stabilization under self-field conditions. (G.J.P.)

  14. AC power losses in Bi-2223/Ag HTS tapes

    Full text: We report measurements at 77 K of the transport ac losses of Bi-2223/Ag composite tapes. The investigated tapes vary from single filament to multifilament construction and include both conventional tapes and other conductor shapes with twisted filaments. The self-field ac losses were determined at 77 K and 60 Hz as a function of ac current amplitude (0 - 100 A). We observe different behaviour among tapes depending on their quality and strain history. For 'good' virgin tapes the experimental data are well described by the Norris equations for the dependence of power loss P on the amplitude Im of the transport current. The data of good monofilament tapes are fitted to the Norris equation P ∼ Imn for an elliptical cross section (ie. n = 3) and the data of good multifilament tapes are fitted to the Norris equation for a rectangular strip (ie. n = 4). Many specimens, however, show a range of behaviour with lower values of n. Based on our work on the effect of strain on the dc transport properties of tapes, we carried out detailed investigations of the effect of controlled applied bend strain on the ac loss. Our results show that irreversible damage to superconducting filaments (ie. cracks) cause the ac loss to rise and n to decrease with increasing strain. In addition, applied strains much greater than the irreversible strain limit cause the ac loss to increase by several orders of magnitude and become ohmic in character with n = 2. Theoretical work is in progress to model the observed behaviour

  15. AC Loss Analysis on the Superconducting Coupling Magnet in MICE

    Wu, Hong; Wang, Li; Green, Michael; Li, LanKai; Xu, FengYu; Liu, XiaoKun; Jia, LinXinag

    2008-07-08

    A pair of coupling solenoids is used in MICE experiment to generate magnetic field which keeps the muons within the iris of thin RF cavity windows. The coupling solenoids have a 1.5-meter inner diameter and will produce 7.4 T peak magnetic field. Three types of AC losses in coupling solenoid are discussed. The affect of AC losses on the temperature distribution within the cold mass during charging and rapid discharging process is analyzed also. The analysis result will be further confirmed by the experiment of the prototype solenoid for coupling solenoid, which will be designed, fabricated and tested at ICST.

  16. Analysis of AC loss in superconducting power devices calculated from short sample data

    Rabbers, J.J.; Haken, ten, Bennie; Kate, ten, F.J.W.

    2003-01-01

    A method to calculate the AC loss of superconducting power devices from the measured AC loss of a short sample is developed. In coils and cables the magnetic field varies spatially. The position dependent field vector is calculated assuming a homogeneous current distribution. From this field profile and the transport current, the local AC loss is calculated. Integration over the conductor length yields the AC loss of the device. The total AC loss of the device is split up in different compone...

  17. AC losses in circular arrangements of parallel superconducting tapes

    Kühle (fratrådt), Anders Van Der Aa; Træholt, Chresten; Däumling, Manfred; Olsen, Søren Krüger; Tønnesen, Ole

    The DC and AC properties of superconducting tapes connected in parellel and arranged in a single closed layer on two tubes (correspondig to power cable models with infinite pitch) with different diameters are compared. We find that the DC properties, i.e. the critical currents of the two arrangem......The DC and AC properties of superconducting tapes connected in parellel and arranged in a single closed layer on two tubes (correspondig to power cable models with infinite pitch) with different diameters are compared. We find that the DC properties, i.e. the critical currents of the two...... arrangements, scale with the number of tapes and hence appear to be independent of the diameter.However, the AC loss per tape (for a given current per tape) appears to decrease with increasing diameter of the circular arrangement. Compared to a model for the AC loss in a continuous superconducting layer...... (Monoblock model) the measured values are about half an order of magnitude higher than expected for the small diameter arrangement. When compared to the AC loss calculated for N individual superconducting tapes using a well known model ( Norris elliptical) the difference is slightly smaller....

  18. AC losses in circular arrangements of parallel superconducting tapes

    Kühle (fratrådt), Anders Van Der Aa; Træholt, Chresten; Däumling, Manfred;

    1998-01-01

    The DC and AC properties of superconducting tapes connected in parellel and arranged in a single closed layer on two tubes (correspondig to power cable models with infinite pitch) with different diameters are compared. We find that the DC properties, i.e. the critical currents of the two arrangem......The DC and AC properties of superconducting tapes connected in parellel and arranged in a single closed layer on two tubes (correspondig to power cable models with infinite pitch) with different diameters are compared. We find that the DC properties, i.e. the critical currents of the two...... arrangements, scale with the number of tapes and hence appear to be independent of the diameter.However, the AC loss per tape (for a given current per tape) appears to decrease with increasing diameter of the circular arrangement. Compared to a model for the AC loss in a continuous superconducting layer...... (Monoblock model) the measured values are about half an order of magnitude higher than expected for the small diameter arrangement. When compared to the AC loss calculated for N individual superconducting tapes using a well known model ( Norris elliptical) the difference is slightly smaller....

  19. AC loss calculation of central solenoid model coil

    The AC loss of Central Solenoid Model Coil of ITER is calculated in order to be able to determine the allowable excitation current shape in time with respect to the available cooling capacity at liquid helium temperature. In Part A the theory is summarized essential to present calculation. This covers a semianalytical integral formulation to calculate the magnetic field distribution in the cross-section of a coil and also 2D and 3D differential formulations for eddy current calculation of jackets and structural steel components, respectively. In Part B the conditions and results of calculation are described in detail. Losses are calculated separately in different components. Also the different types of losses are separated, and only one of the followings is considered in the same time; eddy current loss, ferromagnetic hysteresis loss, superconducting hysteresis loss, coupling loss. The followings are concluded. The coupling loss was found to be the largest 83% of the total AC loss supposing 50 msec characteristic time constant. Also significant amount of heat is generated in structural steels, cooling is required for stainless steel structural components. The loss of joints is not large, however concentrated, therefore joints should receive attention. Specially Lap-type joints are critical components. The eddy current and coupling power losses can be significantly decreased by increasing the ramp-up time since they are proportional to the square of flux change rate, while superconducting and ferromagnetic hysteresis power losses decrease linearly with decreasing flux change rate. Joule losses are produced in joints even after the energizing process of the magnet, when it is driven by a constant excitation current. This propose us to keep the time of full power operation short. (J.P.N.)

  20. Total loss of AC power analysis for EPR reactor

    Darnowski, Piotr, E-mail: piotr.darnowski@itc.pw.edu.pl [Warsaw University of Technology, Institute of Heat Engineering, Nowowiejska 21/25, 00-665 Warsaw (Poland); Skrzypek, Eleonora, E-mail: eleonora.skrzypek@ncbj.gov.pl [Warsaw University of Technology, Institute of Heat Engineering, Nowowiejska 21/25, 00-665 Warsaw (Poland); National Centre for Nuclear Research (NCBJ), A. Sołtana 7, 05-400 Otwock-Świerk (Poland); Mazgaj, Piotr, E-mail: piotr.mazgaj@itc.pw.edu.pl [Warsaw University of Technology, Institute of Heat Engineering, Nowowiejska 21/25, 00-665 Warsaw (Poland); Świrski, Konrad [Warsaw University of Technology, Institute of Heat Engineering, Nowowiejska 21/25, 00-665 Warsaw (Poland); Gandrille, Pascal [AREVA NP SAS, Tour AREVA, 1 place Jean Millier, 92084 Paris La Défense (France)

    2015-08-15

    Highlights: • Total loss of AC power (Station Blackout) was simulated for the EPR reactor model. • In-vessel phase of the accident is under consideration. • Comparison of MELCOR and MAAP results is presented. • MELCOR and MAAP results are comparable. - Abstract: In this paper the results of severe accident simulations for the EPR reactor in the case of loss of offsite power combined with total failure of all diesel generators (total loss of AC power) are presented. Calculations were performed with MELCOR 2.1 computer code for in-vessel phase of the accident. In this scenario, the unavailability of all offsite and onsite power sources and the lack of cooling leads directly to core degradation, material relocation to the lower plenum and rupture of the reactor pressure vessel. MELCOR results were compared qualitatively and quantitatively with MAAP4 code results and show a good agreement.

  1. Measurement of AC losses in different former materials

    Olsen, Søren Krüger; Træholt, Chresten; Kühle, Anders Van Der Aa;

    1998-01-01

    candidates separately; for example copper tubes, stainless steel braid, copper braid, corrugated stainless steel tubes, etc. The measured data are compared with the predictions of a theoretical model. Our results show that in most cases, the losses induced by eddy currents in the former are negligible......A high temperature superconducting cable may be based on a centrally located cylindrical support, a so-called former. If electrically conductive, the former can contribute to the AC losses through eddy current losses caused by unbalanced axial and tangential magnetic fields. With these measurements...... we aim at investigating the eddy current losses of commonly used former materials. A one layer cable conductor was wound on a glass fibre reinforced polymer (GRFP) former. By inserting a variety of materials into this, it was possible to measure the eddy current losses of each of the former...

  2. Measurement of AC losses in different former materials

    Olsen, Søren Krüger; Træholt, Chresten; Kühle, Anders Van Der Aa;

    1998-01-01

    A high temperature superconducting cable may be based on a centrally located cylindrical support, a so-called former. If electrically conductive, the former can contribute to the AC losses through eddy current losses caused by unbalanced axial and tangential magnetic fields. With these measurements...... we aim at investigating the eddy current losses of commonly used former materials. A one layer cable conductor was wound on a glass fibre reinforced polymer (GRFP) former. By inserting a variety of materials into this, it was possible to measure the eddy current losses of each of the former...... candidates separately; for example copper tubes, stainless steel braid, copper braid, corrugated stainless steel tubes, etc. The measured data are compared with the predictions of a theoretical model. Our results show that in most cases, the losses induced by eddy currents in the former are negligible...

  3. Design and AC loss analysis of a superconducting synchronous motor

    Jiang, Q [Cambridge University Engineering Department, Trumpington Street, Cambridge CB2 1PZ (United Kingdom); Majoros, M [Department of Materials Science and Engineering, Ohio State University (United States); Hong, Z [Cambridge University Engineering Department, Trumpington Street, Cambridge CB2 1PZ (United Kingdom); Campbell, A M [Cambridge University Engineering Department, Trumpington Street, Cambridge CB2 1PZ (United Kingdom); Coombs, T A [Cambridge University Engineering Department, Trumpington Street, Cambridge CB2 1PZ (United Kingdom)

    2006-11-15

    This paper gives a conceptual design of a superconducting synchronous motor consisting of both high-temperature superconducting rotating field winding and armature winding. The AC losses of the armature winding of the motor have been investigated experimentally and numerically, by considering the self-field of the superconducting coils and the rotating magnetic field exposed on the armature winding. The recent developments of YBCO-coated conductors present the possibility of achieving a wholly superconducting machine of significantly smaller size and weight than a conventional machine. Both the rotating field winding and the armature winding are composed of YBCO high-temperature superconducting (HTS) coils. A low AC loss armature winding design has been developed for this superconducting synchronous motor. The performance of the machine was investigated by modelling with the finite-element method. The machine's torque is calculated from first principles by considering the angle between the field and the armature main flux lines.

  4. Design and AC loss analysis of a superconducting synchronous motor

    This paper gives a conceptual design of a superconducting synchronous motor consisting of both high-temperature superconducting rotating field winding and armature winding. The AC losses of the armature winding of the motor have been investigated experimentally and numerically, by considering the self-field of the superconducting coils and the rotating magnetic field exposed on the armature winding. The recent developments of YBCO-coated conductors present the possibility of achieving a wholly superconducting machine of significantly smaller size and weight than a conventional machine. Both the rotating field winding and the armature winding are composed of YBCO high-temperature superconducting (HTS) coils. A low AC loss armature winding design has been developed for this superconducting synchronous motor. The performance of the machine was investigated by modelling with the finite-element method. The machine's torque is calculated from first principles by considering the angle between the field and the armature main flux lines

  5. Narrow strand YBCO Roebel cable for lowered AC loss

    We have constructed test lengths of Roebel cable from wide strips of second generation YBCO wire. The strand width is 2mm to allow for lowered AC losses in comparison with standard HTS wires. Up to 10 strands can be cut from the 40mm wide strip and assembled into a 10 strand cable with a transposition length of 90mm. Electrical measurements show good retention of critical current through the cutting and cabling processes. Initial AC loss measurements confirm the reduction expected from full width wire. Results from mechanical modeling are presented which have been used to optimise strand geometry to reduce stress concentrations. Manufacturing capability to produce up to 100m lengths has been demonstrated

  6. Experimental investigation of a.c. losses in cabled superconductors

    A.c. losses in multifilamentary composite superconducting strands and cables have been measured in adiabatic conditions for transverse field sweep rates up to 50 T s-1. Measurements were performed on NbTi and Nb3Sn conductors of several configurations and surface preparations: single strands, soldered strands and cables of varying degrees of compaction composed of bare strands, with CuNi barriers and strands with chrome plating. The experimental data agree well with existing loss models. The data suggests that the total cable loss grows as approx.= 1/(void)3 below void fractions of 40%. This observed cable loss dependence on void fraction does not agree well with a previously proposed model. (author)

  7. AC losses and transient field stability of PF-FSJS sample

    This series of 17 slides deals with AC losses and transient field stability of poloidal field full-size-joint sample) which is relevant to the poloidal field coils of ITER. The topic is divided into 6 parts: 1) general - AC losses, 2) conductor magnetization, 3) conductor calorimetry, 4) conclusion on AC losses, 5) stability, and 6) conclusion on stability

  8. AC losses and transient field stability of PF-FSJS sample

    Zani, L

    2003-07-01

    This series of 17 slides deals with AC losses and transient field stability of poloidal field full-size-joint sample) which is relevant to the poloidal field coils of ITER. The topic is divided into 6 parts: 1) general - AC losses, 2) conductor magnetization, 3) conductor calorimetry, 4) conclusion on AC losses, 5) stability, and 6) conclusion on stability.

  9. AC magnetization losses in striated YBCO-123/Hastelloy coated conductors

    In this work we present experimental results of reductions in AC magnetization losses due to a striation process in YBCO-123/Hastelloy coated conductors. The measurements were carried out in a sinusoidally varying external magnetic field, with amplitudes up to 100 mT, in a frequency range of 8.5-85.4 Hz, and at a temperature of 77 K. The field was oriented perpendicularly to the face of the tapes. Sample tapes were successively patterned into the form of narrow parallel strips, by means of a photoresist lithography and chemical wet etching technique. Experimental results are discussed in the framework of existing theoretical models for energy dissipation in thin films in perpendicular AC magnetic fields

  10. AC Losses in the MICE Channel Magnets -- Is This a Curse or aBlessing?

    Green, M.A.; Wu, H.; Wang, L.; Kai, L.L.; Jia, L.X.; Yang, S.Q.

    2008-01-31

    This report discusses the AC losses in the MICE channelmagnets during magnet charging and discharging. This report talks aboutthe three types of AC losses in the MICE magnets; the hysteretic AC lossin the superconductor, the coupling AC loss in the superconductor and theeddy current AC loss in the magnet mandrel and support structure. AClosses increase the heat load at 4 K. The added heat load increases thetemperature of the second stage of the cooler. In addition, AC losscontributes to the temperature rise between the second stage cold headand the high field point of the magnet, which is usually close to themagnet hot spot. These are the curses of AC loss in the MICE magnet thatcan limit the rate at which the magnet can be charge or discharged. Ifone is willing to allow some of the helium that is around the magnet toboil away during a magnet charge or discharge, AC losses can become ablessing. The boil off helium from the AC losses can be used to cool theupper end of the HTS leads and the surrounding shield. The AC losses arepresented for all three types of MICE magnets. The AC loss temperaturedrops within the coupling magnet are presented as an example of how boththe curse and blessing of the AC losses can be combined.

  11. Development of Low AC Loss TFA-MOD Coated Conductors

    Katayama, K.; Machi, T.; Nakamura, T.; Takagi, Y.; Nakaoka, K.; Yoshizumi, M.; Izumi, T.; Shiohara, Y.

    TFA-MOD process is expected to be promising for future applications since it can produce high performance YBCO coated conductors (CCs) with low cost. Applying YBCO CCs to the power electric devices such as transformers and power cables, the reduction of alternating current (AC) loss for long wire is necessary. Multi-filamentation process, which is one of the most effective approaches for AC loss reduction, has been developed by the scribing process. We have developed the filamentation process using chemical etching. MOD derived CCs are, however, easily damaged in the chemical etching process due to existence of pores in a YBCO layer, resulting in critical current (Ic)-degradation and weak delamination strength. Consequently, it is difficult to scribe MOD derived CCs into 1mm-wide filaments for long length using the chemical etching process. Accordingly, we have studied a scribing process using an excimer laser without chemical etching. We defined P' value in this study as a function of irradiated laser power [J] divided by processing speed[m/s]. We studied relationship between the P' value and the results of scribing. It was found that we could scribe the C.C. with a sufficient depth in the condition of large P' value. Furthermore, we found that the Ic was degraded with further increase of the P' value. A 5 mm wide short sample was divided into 10 filaments by the excimer laser scribing process at the P' of 9[J/(m/s)]. The sample revealed reduction of the hysteresis loss down to 1/10 which could be expected from a theoretical prediction using the numbers of the filaments. Ic-degradation was suppressed as 28%, which was smaller than that of the scribed sample using chemical etching (Ic degradation was 38%). Subsequently, we applied the technique to a 100m long YBCO CC. The hysteresis loss of the 100m long MOD derived CC was reduced down to 1/10 (1/the number of filaments) after the multi-filamentation.

  12. Evaluation of AC losses for HT-7U CICC on plasma disruption

    AC loss is one of the main issues in the design of the CICC used for PF and TF coils of superconducting tokamak. A preliminary calculation of AC loss for the designed HT-7U CICCs used for TF magnets is given. The authors only consider the hysteresis and coupling losses related to transversal and longitudinal kinds. In addition to the strand resistive barriers (Pb-30Sn-2Sb coating for NbTi strands), a stainless steel strip has been used inside these cables to reduce the AC loss in this kind of conductor. The available theory has enabled to emphasize the role played by the stainless steel strip in the reduction of total AC losses in this kind of conductor. It was shown that AC losses of cable were affected by the structure and change rate of magnetic field

  13. Modelling of AC loss in coils made of thin tapes under DC bias current

    Pardo, Enric

    2013-01-01

    Many applications, such as magnets and SMES, are usually charged and discharged under a bias DC current, which may increase the AC loss. For their design, it is necessary to understand and predict the AC loss. This article analises the AC loss in magnet-like coils under DC bias contribution super-imposed to the AC current. The analysis is based on a numerical model that takes the interaction between magnetization currents in all turns into account. The studied example is a stack of 32 pancake...

  14. AC Losses and Their Thermal Effect in High-Temperature Superconducting Machines

    Song, Xiaowei (Andy); Mijatovic, Nenad; Zou, Shengnan;

    2016-01-01

    approximation and solves the H formulation. Afterward, the computed ac losses are considered as the heat source in a thermal model to study the temperature profile in HTS windings. The method proposed is able to evaluate ac losses and their thermal effect, thus providing a reference to design an HTS machine and...

  15. AC Losses and Their Thermal Effect in High Temperature Superconducting Machines

    Song, Xiaowei (Andy); Mijatovic, Nenad; Zou, Shengnan;

    2015-01-01

    homogeneous approximation and solves the H formulation. Afterwards, the computed AC losses are considered as the heat source in a thermal model to study the temperature profile in HTS windings. The method proposed is able to evaluate AC losses and their thermal effect, thus providing a reference to design an...

  16. Complex study of transport AC loss in various 2G HTS racetrack coils

    Chen, Yiran, E-mail: yc315@cam.ac.uk [University of Cambridge, 9 JJ Thomson Avenue, Cambridge CB3 0FA (United Kingdom); Zhang, Min; Chudy, Michal; Matsuda, Koichi; Coombs, Tim [University of Cambridge, 9 JJ Thomson Avenue, Cambridge CB3 0FA (United Kingdom)

    2013-04-15

    Highlights: ► Comparing transport AC losses of two types of 2G HTS racetrack coils. ► The magnetic substrate in the MAG RABITS coil is the main difference. ► Experimental data agree well with simulation results. ► The transport AC loss in the MAG RABITS coil is 36% higher than that in the IBAD coil. ► It is better to keep all the substrate non-magnetic. -- Abstract: HTS racetrack coils are becoming important elements of an emerging number of superconducting devices such as generators or motors. In these devices the issue of AC loss is crucial, as performance and cooling power are derived from this quantity. This paper presents a comparative study of transport AC loss in two different types of 2G HTS racetrack coils. In this study, both experimental measurements and computer simulation approaches were employed. All the experiments were performed using classical AC electrical method. The finite-element computer model was used to estimate electromagnetic properties and calculate transport AC loss. The main difference between the characterized coils is covered inside tape architectures. While one coil uses tape based on RABITS magnetic substrate, the second coil uses a non-magnetic tape. Ferromagnetic loss caused by a magnetic substrate is an important issue involved in the total AC loss. As a result, the coil with the magnetic substrate surprised with high AC loss and rather low performance.

  17. Analysis of AC loss in superconducting power devices calculated from short sample data

    Rabbers, J.J.; Haken, ten B.; Kate, ten H.H.J.

    2003-01-01

    A method to calculate the AC loss of superconducting power devices from the measured AC loss of a short sample is developed. In coils and cables the magnetic field varies spatially. The position dependent field vector is calculated assuming a homogeneous current distribution. From this field profile

  18. AC loss measurements in HTS coil assemblies with hybrid coil structures

    Jiang, Zhenan; Long, Nicholas J.; Staines, Mike; Badcock, Rodney A.; Bumby, Chris W.; Buckley, Robert G.; Amemiya, Naoyuki

    2016-09-01

    Both AC loss and wire cost in coil windings are critical factors for high temperature superconductor (HTS) AC machinery applications. We present AC loss measurement results in three HTS coil assemblies at 77 K and 65 K which have a hybrid coil structure comprising one central winding (CW) and two end windings (EWs) wound with ReBCO and BSCCO wires with different self-field I c values at 77 K. All AC loss results in the coil assemblies are hysteretic and the normalized AC losses in the coil assemblies at different temperatures can be scaled with the I c value of the coil assemblies. The normalised results show that AC loss in a coil assembly with BSCCO CW can be reduced by using EWs wound with high I c ReBCO wires, whilst further AC loss reduction can be achieved by replacing the BSCCO CW with ReBCO CW. The results imply that a flexible hybrid coil structure is possible which considers both AC loss and wire cost in coil assemblies.

  19. Reducing AC-Winding Losses in High-Current High-Power Inductors

    Nymand, Morten; Madawala, Udaya K.; Andersen, Michael Andreas E.;

    2009-01-01

    Foil windings are preferable in high-current high-power inductors to realize compact designs and to reduce dc-current losses. At high frequency, however, proximity effect will cause very significant increase in ac resistance in multi-layer windings, and lead to high ac winding losses. This paper...... presents design, analysis and experimental verification of a two winding technique, which significantly reduces ac winding losses without compromising dc losses. The technique uses an inner auxiliary winding, which is connected in parallel with an outer main winding. The auxiliary winding is optimally...

  20. The scaling of transport AC losses in Roebel cables with varying strand parameters

    A Roebel cable is a good candidate for low-voltage windings in a high-temperature superconductor (HTS) transformer because of its high current-carrying capability and low AC loss. Transport AC loss measurements were carried out in 1.8 m long 15/5 (fifteen 5 mm wide strands) and 15/4 Roebel cables. The results were compared with those in many Roebel cables composed of 2 mm wide Roebel strands. Comparison of the AC losses hinted that the intrinsic difference in normalized transport AC losses is due to differences in the g/w (ratio of the horizontal gap between the Roebel strands over the Roebel strand width) values. The intrinsic difference was confirmed by measuring transport AC loss in a series of horizontally arranged parallel conductor pairs with various g values. A method to scale transport AC losses in Roebel cables with varying strand parameters was developed. The scaling method will be useful for a rough assessment of AC loss in one-layer solenoid winding coils, such as in a HTS transformer. (papers)

  1. Calorimetric method of ac loss measurement in a rotating magnetic field

    Ghoshal, P. K. [Oxford Instruments NanoScience, Abingdon, Oxfordshire OX13 5QX (United Kingdom); Coombs, T. A.; Campbell, A. M. [Department of Engineering, Electrical Engineering, University of Cambridge, Cambridge CB3 0FA (United Kingdom)

    2010-07-15

    A method is described for calorimetric ac-loss measurements of high-T{sub c} superconductors (HTS) at 80 K. It is based on a technique used at 4.2 K for conventional superconducting wires that allows an easy loss measurement in parallel or perpendicular external field orientation. This paper focuses on ac loss measurement setup and calibration in a rotating magnetic field. This experimental setup is to demonstrate measuring loss using a temperature rise method under the influence of a rotating magnetic field. The slight temperature increase of the sample in an ac-field is used as a measure of losses. The aim is to simulate the loss in rotating machines using HTS. This is a unique technique to measure total ac loss in HTS at power frequencies. The sample is mounted on to a cold finger extended from a liquid nitrogen heat exchanger (HEX). The thermal insulation between the HEX and sample is provided by a material of low thermal conductivity, and low eddy current heating sample holder in vacuum vessel. A temperature sensor and noninductive heater have been incorporated in the sample holder allowing a rapid sample change. The main part of the data is obtained in the calorimetric measurement is used for calibration. The focus is on the accuracy and calibrations required to predict the actual ac losses in HTS. This setup has the advantage of being able to measure the total ac loss under the influence of a continuous moving field as experienced by any rotating machines.

  2. Calorimetric method of ac loss measurement in a rotating magnetic field

    Ghoshal, P. K.; Coombs, T. A.; Campbell, A. M.

    2010-07-01

    A method is described for calorimetric ac-loss measurements of high-Tc superconductors (HTS) at 80 K. It is based on a technique used at 4.2 K for conventional superconducting wires that allows an easy loss measurement in parallel or perpendicular external field orientation. This paper focuses on ac loss measurement setup and calibration in a rotating magnetic field. This experimental setup is to demonstrate measuring loss using a temperature rise method under the influence of a rotating magnetic field. The slight temperature increase of the sample in an ac-field is used as a measure of losses. The aim is to simulate the loss in rotating machines using HTS. This is a unique technique to measure total ac loss in HTS at power frequencies. The sample is mounted on to a cold finger extended from a liquid nitrogen heat exchanger (HEX). The thermal insulation between the HEX and sample is provided by a material of low thermal conductivity, and low eddy current heating sample holder in vacuum vessel. A temperature sensor and noninductive heater have been incorporated in the sample holder allowing a rapid sample change. The main part of the data is obtained in the calorimetric measurement is used for calibration. The focus is on the accuracy and calibrations required to predict the actual ac losses in HTS. This setup has the advantage of being able to measure the total ac loss under the influence of a continuous moving field as experienced by any rotating machines.

  3. Calorimetric method of ac loss measurement in a rotating magnetic field

    A method is described for calorimetric ac-loss measurements of high-Tc superconductors (HTS) at 80 K. It is based on a technique used at 4.2 K for conventional superconducting wires that allows an easy loss measurement in parallel or perpendicular external field orientation. This paper focuses on ac loss measurement setup and calibration in a rotating magnetic field. This experimental setup is to demonstrate measuring loss using a temperature rise method under the influence of a rotating magnetic field. The slight temperature increase of the sample in an ac-field is used as a measure of losses. The aim is to simulate the loss in rotating machines using HTS. This is a unique technique to measure total ac loss in HTS at power frequencies. The sample is mounted on to a cold finger extended from a liquid nitrogen heat exchanger (HEX). The thermal insulation between the HEX and sample is provided by a material of low thermal conductivity, and low eddy current heating sample holder in vacuum vessel. A temperature sensor and noninductive heater have been incorporated in the sample holder allowing a rapid sample change. The main part of the data is obtained in the calorimetric measurement is used for calibration. The focus is on the accuracy and calibrations required to predict the actual ac losses in HTS. This setup has the advantage of being able to measure the total ac loss under the influence of a continuous moving field as experienced by any rotating machines.

  4. Segmented superconducting tape having reduced AC losses and method of making

    Foltyn, Stephen R. (Los Alamos, NM); Jia, Quanxi (Los Alamos, NM); Arendt, Paul N. (Los Alamos, NM); Holesinger, Terry G. (Los Alamos, NM); Wang, Haiyan (Los Alamos, NM)

    2009-09-22

    A superconducting tape having reduced AC losses. The tape has a high temperature superconductor layer that is segmented. Disruptive strips, formed in one of the tape substrate, a buffer layer, and the superconducting layer create parallel discontinuities in the superconducting layer that separate the current-carrying elements of the superconducting layer into strips or filament-like structures. Segmentation of the current-carrying elements has the effect of reducing AC current losses. Methods of making such a superconducting tape and reducing AC losses in such tapes are also disclosed.

  5. Effect of combining a DC bias current with an AC transport current on AC losses in a High Temperature Superconductor

    Dolez, Patricia; Ligneris, Benoit des; Aubin, Marcel; Zhu, When; Cave, Julian

    1998-01-01

    Creating complex flux configurations by superposing a dc current or magnetic field onto the ac current in a type II superconducting tape should lead to a variety of peculiar behaviors. An example is the appearance of the Clem valley, a minimum in the ac losses as a function of the dc bias amplitude, which has been theoretically studied by LeBlanc et al., in the continuation of Clem's calculations. These situations have been investigated by applying a dc current to a silver-gold sheathed Bi-22...

  6. Dissipation and AC loss in high Tc superconductors destined for power applications

    Full text: Superconductivity, which was discovered at the beginning of this century, has long been promoted as a solution to many power engineering problems. This was because a superconductor exhibits zero resistance to DC currents and a very low resistance to AC currents. Historically however, power utility applications, whilst technically feasible, were not economically viable. With the discovery of high temperature superconductors in the late 80's there has been a resurgence of interest in the use of superconductivity for power applications: cables, motors, generators, transformers, fault current limiters. In order for power applications of superconductors to be realized, in addition to a high current density, low AC losses and transient stability are also necessary. Whilst much work worldwide has been devoted to increasing critical current densities of high Tc materials, reliable AC loss characterisation of power applications and low loss conductor designs optimized for each application still remain to be developed. Here, calorimetric methods for the measurement of AC losses for high Tc wires will be compared to electric and magnetization methods. The relative merits of each method will be discussed. One of the key differences between high and low Tc superconductors is in the nature of E-J curves. In high Tc materials these curves are extended, i.e. E increases gradually with J. This has consequences for both AC losses and stability. In this article the nature of AC losses and stability in high temperature superconducting wires will be discussed: hysteretic losses, eddy current losses, role of flux creep, anisotropy, dimensional effects ..., and compared to those for low temperature wires such as multifilamentary NbTi and NbSn. In conclusion, the key requirements will be discussed that must be achieved in order that superconducting technologies gain acceptance in power engineering applications: current density, AC losses, transient response, mechanical

  7. Ac loss characteristics of YBCO superconducting tapes fabricated by TFA-MOD technique

    We investigated the ac loss properties of a YBCO superconducting tape fabricated by TFA-MOD technique. The thickness of the YBCO layer is 1.2 μm. A 6-tape stack of 50 mm in length and 10 mm in width was inserted into a saddle-shaped pickup coil. The ac loss was measured at 35-77 K by applying an external ac magnetic field. The magnetic field angle was changed by rotating the sample stack around its longitudinal axis. The effective penetration field, which corresponds to the breaking point of an ac loss curve, decreased with increasing field angle though it was much smaller than that which was estimated for a superconducting slab with the same thickness as the width of a tape. As a result, the ac loss increased monotonically with an increasing field angle against the wide surface for any amplitude. The observed field angular dependence of the ac loss agreed with the theoretically predicted one by using the observed ac losses in perpendicular magnetic field. Anyway the ac loss for a larger amplitude than the effective penetration field was proportional to the critical current density and the projective width of a tape in the direction of the applied magnetic field for any field angle and any temperature as well known. In addition we estimated the magnetic field, B, dependence of the critical current, I c, from the observed magnetization curves. It was shown that zero-field I c appeared to be a linear function of temperature and I c-B characteristics was scaled with zero-field I c. We also discussed a difference in I c-B characteristics and its temperature dependence between TFA-MOD tapes and IBAD-PLD ones

  8. Ac loss characteristics of YBCO superconducting tapes fabricated by TFA-MOD technique

    Iwakuma, Masataka; Nigo, Masahiro; Inoue, Daisuke; Miyamoto, Naoya; Kiss, Takanobu; Funaki, Kazuo; Iijima, Yasuhiro; Saitoh, Takashi; Izumi, Teruo; Yamada, Yutaka; Shiohara, Yuu

    2005-10-01

    We investigated the ac loss properties of a YBCO superconducting tape fabricated by TFA-MOD technique. The thickness of the YBCO layer is 1.2 μm. A 6-tape stack of 50 mm in length and 10 mm in width was inserted into a saddle-shaped pickup coil. The ac loss was measured at 35-77 K by applying an external ac magnetic field. The magnetic field angle was changed by rotating the sample stack around its longitudinal axis. The effective penetration field, which corresponds to the breaking point of an ac loss curve, decreased with increasing field angle though it was much smaller than that which was estimated for a superconducting slab with the same thickness as the width of a tape. As a result, the ac loss increased monotonically with an increasing field angle against the wide surface for any amplitude. The observed field angular dependence of the ac loss agreed with the theoretically predicted one by using the observed ac losses in perpendicular magnetic field. Anyway the ac loss for a larger amplitude than the effective penetration field was proportional to the critical current density and the projective width of a tape in the direction of the applied magnetic field for any field angle and any temperature as well known. In addition we estimated the magnetic field, B, dependence of the critical current, Ic, from the observed magnetization curves. It was shown that zero-field Ic appeared to be a linear function of temperature and Ic-B characteristics was scaled with zero-field Ic. We also discussed a difference in Ic-B characteristics and its temperature dependence between TFA-MOD tapes and IBAD-PLD ones.

  9. Structural and AC loss study for pure and doped MgB{sub 2} superconductor

    Hansdah, J. S.; Sarun, P. M., E-mail: sarun.res@gmail.com [Functional Ceramics Lab, Department of Applied Physics, Indian School of Mines (ISM), Dhanbad – 826004 (India)

    2015-06-24

    Superconducting polycrystalline bulk MgB{sub 2} samples doped with n-C, n-Y{sub 2}O{sub 3} and n-Ho{sub 2}O{sub 3} were prepared by powder-in-sealed (PIST) method. XRD measurement shows the influence of dopants on phase and lattice parameters of samples. The ac susceptibility measurement reveals ac loss and activation energy of the samples. Nano-C doped sample shows less ac loss in all frequency (208 Hz – 999 Hz) among the doped samples; whereas n-Ho{sub 2}O{sub 3} doped sample shows highest ac loss. The activation energy is high for rare earth (n-Y{sub 2}O{sub 3} and n-Ho{sub 2}O{sub 3}) doped samples as compare to n-C doped samples which reveals the enhancement in flux-pinning properties of these materials.

  10. Transport ac losses in Bi-2223 multifilamentary tapes - conductor materials aspect

    Transport ac losses in technical superconductors based on Bi-2223 tape material are influenced by many parameters. The major factors that define the ac performance of such conductors are the following: the size and number of filaments, their geometrical arrangement in the cross-section of the conductor, the twist pitch length, the resistivity of the matrix, the presence of oxide barriers around the filaments and deformation procedures such as sequential pressing or rolling followed by appropriate thermal treatment. In the present paper the above aspects are addressed from the viewpoint of the materials science of technical conductor design. Transport ac losses at power frequencies in different types of Bi-2223 conductor are presented and analysed. The results of conductor design analysis with respect to the coexistence of the superconductor with other materials in the conductor structure are presented. New concepts for minimization of the transport ac losses are discussed in detail. (author)

  11. AC loss in high-temperature superconducting conductors, cables and windings for power devices

    High-temperature superconducting (HTS) transformers and reactor coils promise decreased weight and volume and higher efficiency. A critical design parameter for such devices is the AC loss in the conductor. The state of the art for AC-loss reduction in HTS power devices is described, starting from the loss in the single HTS tape. Improved tape manufacturing techniques have led to a significant decrease in the magnetization loss. Transport-current loss is decreased by choosing the right operating current and temperature. The role of tape dimensions, filament twist and resistive matrix is discussed and a comparison is made between state-of-the-art BSCCO and YBCO tapes. In transformer and reactor coils the AC loss in the tape is influenced by adjacent tapes in the coil, fields from other coils, overcurrents and higher harmonics. These factors are accounted for by a new AC-loss prediction model. Field components perpendicular to the tape are minimized by optimizing the coil design and by flux guidance pieces. High-current windings are made of Roebel conductors with transposed tapes. The model iteratively finds the temperature distribution in the winding and predicts the onset of thermal instability. We have fabricated and tested several AC windings and used them to validate the model. Now we can confidently use the model as an engineering tool for designing HTS windings and for determining the necessary tape properties

  12. Distribution of AC loss in a HTS magnet for SMES with different operating conditions

    Xu, Y., E-mail: xuyinghust@163.com [State Key Laboratory of Advanced Electromagnetic Engineering and Technology, R and D Center of Applied Superconductivity, Huazhong University of Science and Technology, Wuhan 430074 (China); Tang, Y.; Ren, L.; Jiao, F. [State Key Laboratory of Advanced Electromagnetic Engineering and Technology, R and D Center of Applied Superconductivity, Huazhong University of Science and Technology, Wuhan 430074 (China); Song, M.; Cao, K.; Wang, D. [Yunnan Electric Power Research Institute, Kunming City 650217 (China); Wang, L.; Dong, H. [State Key Laboratory of Advanced Electromagnetic Engineering and Technology, R and D Center of Applied Superconductivity, Huazhong University of Science and Technology, Wuhan 430074 (China)

    2013-11-15

    Highlights: •We present a model to calculate the distribution of AC loss for a storage magnet. •Comparative analysis of AC loss with different operating conditions has done. •The nonuniform distribution factor “d” is proposed to estimate the inhomogeneity of a storage magnet. •The model predicts the loss distribution and crucial areas which are suffering from the high AC loss. This is significant for the conduction-cooled structure design. -- Abstract: The AC loss induced in superconducting tape may affect the performance of a superconducting device applied to power system, such as transformer, cable, motor and even Superconducting Magnetic Energy Storage (SMES). The operating condition of SMES is changeable due to the need of compensation to the active or reactive power according to the demand of a power grid. In this paper, it is investigated that the distribution of AC loss for a storage magnet on different operating conditions, which is based on finite element method (FEM) and measured properties of BSCCO/Ag tapes. This analytical method can be used to optimize the SMES magnet.

  13. Test results of the 100 kWh SMES model coil. AC loss performance

    In order to establish a technology needed for a small-scale 100 kWh SMES device, a SMES model coil was fabricated. Performance tests were carried out at the Japan Atomic Energy Research Institute (JAERI) in 1996. After that, the coil was installed in facilities of the Lawrence Livermore National Laboratory (LLNL) and tested in 1998, in collaboration between Japan and the United States. The AC loss results at LLNL were in good agreement with those at JAERI. It was reconfirmed from the results that the coupling loss of the coil consists of two components with short and long time constants. We found out from the signals of Hall probes that the current loops with long decay time constants were induced in the CIC conductor. These loops could enhance additional AC loss in the coil. To reduce the AC loss, we made small-sized CIC conductor of strands having a CuNi surface, a fabricated the small coil. The measured AC loss of the small coil was reduced to about 1/6. The CuNi surface on the strands was demonstrated to be effective to reduce AC loss in the coil. (author)

  14. Theory of AC Loss in Cables with 2G HTS Wire

    Clem, J.R.; Malozemoff, A.P.

    2009-09-13

    While considerable work has been done to understand AC losses in power cables made of first generation (1G) high temperature superconductor (HTS) wires, use of second generation (2G) HTS wires brings in some new considerations. The high critical current density of the HTS layer 2G wire reduces the surface superconductor hysteretic losses. Instead, gap and polygonal losses, flux transfer losses in imbalanced two layer cables and ferromagnetic losses for wires with NiW substrates constitute the principal contributions. Current imbalance and losses associated with the magnetic substrate can be minimized by orienting the substrates of the inner winding inward and the outer winding outward.

  15. Modelling and measurement of ac loss in BSCCO/Ag-tape windings

    High-temperature superconducting (HTS) transformers promise decreased weight and volume and higher efficiency. A 1 MVA HTS railway transformer was built and tested at Siemens AG. This paper deals with the prediction of ac loss in the BSCCO/Ag-tape windings. In a railway transformer the tape carries ac current in alternating field, the temperature differs from 77 K, tapes are stacked or cabled and overcurrents and higher harmonics occur. In ac-loss literature these issues are treated separately, if at all. We have developed a model that predicts the ac loss in sets of BSCCO/Ag-tape coils, and deals with the above-mentioned issues. The effect of higher harmonics on the loss in HTS tapes is considered for the first time. The paper gives a complete overview of the model equations and required input parameters. The model is validated over a wide range of the input parameters, using the measured critical current and ac loss of single tapes, single coils and sets of coils in the 1 MVA transformer. An accuracy of around 25% is achieved in all relevant cases. Presently the model is developed further, in order to describe other HTS materials and other types of applications

  16. Modelling and measurement of ac loss in BSCCO/Ag-tape windings

    Oomen, M. P.; Nanke, R.; Leghissa, M.

    2003-03-01

    High-temperature superconducting (HTS) transformers promise decreased weight and volume and higher efficiency. A 1 MVA HTS railway transformer was built and tested at Siemens AG. This paper deals with the prediction of ac loss in the BSCCO/Ag-tape windings. In a railway transformer the tape carries ac current in alternating field, the temperature differs from 77 K, tapes are stacked or cabled and overcurrents and higher harmonics occur. In ac-loss literature these issues are treated separately, if at all. We have developed a model that predicts the ac loss in sets of BSCCO/Ag-tape coils, and deals with the above-mentioned issues. The effect of higher harmonics on the loss in HTS tapes is considered for the first time. The paper gives a complete overview of the model equations and required input parameters. The model is validated over a wide range of the input parameters, using the measured critical current and ac loss of single tapes, single coils and sets of coils in the 1 MVA transformer. An accuracy of around 25% is achieved in all relevant cases. Presently the model is developed further, in order to describe other HTS materials and other types of applications.

  17. A numerical method to estimate AC loss in superconducting coated conductors by finite element modelling

    Hong, Z; Jiang, Q; Pei, R; Campbell, A M; Coombs, T A [Engineering Department, University of Cambridge, Trumpington Street, Cambridge CB2 1PZ (United Kingdom)

    2007-04-15

    A finite element method code based on the critical state model is proposed to solve the AC loss problem in YBCO coated conductors. This numerical method is based on a set of partial differential equations (PDEs) in which the magnetic field is used as the state variable. The AC loss problems have been investigated both in self-field condition and external field condition. Two numerical approaches have been introduced: the first model is configured on the cross-section plane of the YBCO tape to simulate an infinitely long superconducting tape. The second model represents the plane of the critical current flowing and is able to simulate the YBCO tape with finite length where the end effect is accounted. An AC loss measurement has been done to verify the numerical results and shows a good agreement with the numerical solution.

  18. Measurement of AC losses in a racetrack superconducting coil made from YBCO coated conductor

    Seiler, Eugen; Abrahamsen, Asger Bech; Kovac, Jan;

    2012-01-01

    We present the results of transport measurements of AC losses in a racetrack shaped superconducting coil made from coated conductor tape. The outer dimensions of the coil are approximately 24 cm × 12 cm and it has 57 turns. The coil is impregnated with epoxy resin and fiberglass tape is used to...... insulate the individual turns and to improve the mechanical properties of the epoxy when exposed to thermal cycling. The coil is manufactured as a part of the field winding of a small synchronous generator; therefore stainless steel frames are installed on the inner and outer side of the winding to...... reinforce it. The AC loss is measured versus the transport current Ia with the coil immersed in liquid nitrogen. Measurements at frequencies 21 Hz, 36 Hz and 72 Hz are compared. The AC losses follow I2 a dependence at low current amplitudes and I3 a at high amplitudes. After cutting the inner steel frame...

  19. Low AC Loss YBCO Coated Conductor Geometry by Direct Inkjet Printing

    Rupich, Martin, Dr. [American Superconductor Corporation; Duckworth, Robert, Dr. [Oak Ridge National Laboratory

    2009-10-01

    The second generation (2G) high temperature superconductors (HTS) wire offers potential benefits for many electric power applications, including ones requiring filamentized conductors with low ac loss, such as transformers and fault current limiters. However, the use of 2G wire in these applications requires the development of both novel multi-filamentary conductor designs with lower ac losses and the development of advanced manufacturing technologies that enable the low-cost manufacturing of these filamentized architectures. This Phase I SBIR project focused on testing inkjet printing as a potential low-cost, roll-to-roll manufacturing technique to fabricate potential low ac loss filamentized architectures directly on the 2G template strips.

  20. AC losses in superconductors with a power-law constitutive relation

    Highlights: • Derivation of power-law constitutive-relation from distributed Anderson–Kim theory. • The electric-field for HTS constitutive-relation satisfies nonlinear heat-equation. • For slab, AC losses scale as B0m, m = 3–4 and I3 with field-amplitude and current, respectively. • Calculated pinning potential, AC-losses scaling is consistent with BSCCO data. - Abstract: The observed constitutive relation between the electrical field and current density in cuprates high temperature superconductors is a power-law of the current. This functional dependence is presumably related to the giant flux-creep domain. It is shown that this constitutive relation reflects the statistical spread of the pinning potential associated with creep motion of vortex bundles. The AC losses emanating from a power-law constitutive relation are calculated in an approach focused on the superconductor’s electric field. For a slab geometry in the presence of a parallel AC magnetic field or transport current, the calculated AC-loss scaling laws are consistent with BSCCO data and the critical state model. Extensions of the approach are briefly discussed

  1. AC losses in superconductors with a power-law constitutive relation

    Agassi, Y.D., E-mail: yehoshua.agassi@navy.mil

    2015-10-15

    Highlights: • Derivation of power-law constitutive-relation from distributed Anderson–Kim theory. • The electric-field for HTS constitutive-relation satisfies nonlinear heat-equation. • For slab, AC losses scale as B{sub 0}{sup m}, m = 3–4 and I{sup 3} with field-amplitude and current, respectively. • Calculated pinning potential, AC-losses scaling is consistent with BSCCO data. - Abstract: The observed constitutive relation between the electrical field and current density in cuprates high temperature superconductors is a power-law of the current. This functional dependence is presumably related to the giant flux-creep domain. It is shown that this constitutive relation reflects the statistical spread of the pinning potential associated with creep motion of vortex bundles. The AC losses emanating from a power-law constitutive relation are calculated in an approach focused on the superconductor’s electric field. For a slab geometry in the presence of a parallel AC magnetic field or transport current, the calculated AC-loss scaling laws are consistent with BSCCO data and the critical state model. Extensions of the approach are briefly discussed.

  2. Distribution of AC loss in a HTS magnet for SMES with different operating conditions

    Xu, Y.; Tang, Y.; Ren, L.; Jiao, F.; Song, M.; Cao, K.; Wang, D.; Wang, L.; Dong, H.

    2013-11-01

    The AC loss induced in superconducting tape may affect the performance of a superconducting device applied to power system, such as transformer, cable, motor and even Superconducting Magnetic Energy Storage (SMES). The operating condition of SMES is changeable due to the need of compensation to the active or reactive power according to the demand of a power grid. In this paper, it is investigated that the distribution of AC loss for a storage magnet on different operating conditions, which is based on finite element method (FEM) and measured properties of BSCCO/Ag tapes. This analytical method can be used to optimize the SMES magnet.

  3. A Simplified Model to Calculate AC Losses in Large 2G HTS Coils

    Song, Xiaowei (Andy); Mijatovic, Nenad; Jensen, Bogi Bech;

    2015-01-01

    AC losses are of great significance to quantify the performance of high temperature superconducting (HTS) devices. This paper presents a simplified model to calculate AC losses in large 2G HTS coils, which serves as a baseline to study HTS large scale applications such as electric machines. The....... The model presented uses H formulation which directly solves magnetic fields, and the general partial differential equations (PDEs) module in Comsol Multiphysics is used to implement the model. Afterwards, the model is used to simulate the excitation stage of a racetrack HTS coil with 350 tapes. The...

  4. AC-loss considerations of a pulse SMES for an accelerator

    Lyly, M.; Hiltunen, I.; Järvelä, J.; Korpela, A.; Lehti, L.; Stenvall, A.; Mikkonen, R.

    2010-06-01

    In particle accelerators quasi-DC superconducting magnets are used to keep particles in desired tracks. The needed rapid field variations of these high energy magnets require large energy bursts. If these bursts are taken from and fed back to the utility grid, its voltage is distorted and the quality of the electricity degrades. In addition, these bursts may decrease operation life time of generators and extra arrangements may be required by the electricity producers. Thus, an energy storage is an essential component for a cost-effective particle accelerator. Flywheels, capacitors and superconducting magnetic energy storage (SMES) are possible options for these relatively large and high power energy storages. Here we concentrate on AC-loss of a pulse SMES aiming to demonstrate the feasibility of NbTi SMES in a particle accelerator. The designing of a SMES requires highly reliable AC-loss simulations. In this paper, calorimetric AC-loss measurements of a NbTi magnet have been carried out to consider conductor's suitability in a pulse SMES. In addition, the measured results are compared with AC-loss simulations.

  5. AC-loss considerations of a pulse SMES for an accelerator

    Lyly, M; Hiltunen, I; Jaervelae, J; Korpela, A; Lehti, L; Stenvall, A; Mikkonen, R, E-mail: mika.lyly@tut.f [Tampere University of Technology, Electromagnetics, PO Box 692, FI-33101 (Finland)

    2010-06-01

    In particle accelerators quasi-DC superconducting magnets are used to keep particles in desired tracks. The needed rapid field variations of these high energy magnets require large energy bursts. If these bursts are taken from and fed back to the utility grid, its voltage is distorted and the quality of the electricity degrades. In addition, these bursts may decrease operation life time of generators and extra arrangements may be required by the electricity producers. Thus, an energy storage is an essential component for a cost-effective particle accelerator. Flywheels, capacitors and superconducting magnetic energy storage (SMES) are possible options for these relatively large and high power energy storages. Here we concentrate on AC-loss of a pulse SMES aiming to demonstrate the feasibility of NbTi SMES in a particle accelerator. The designing of a SMES requires highly reliable AC-loss simulations. In this paper, calorimetric AC-loss measurements of a NbTi magnet have been carried out to consider conductor's suitability in a pulse SMES. In addition, the measured results are compared with AC-loss simulations.

  6. AC loss in superconducting wires operating in a wind turbine like generator

    Seiler, Eugen; Zirngibl, Thomas; Mijatovic, Nenad;

    2010-01-01

    We have manufactured a small circular superconducting coil impregnated with epoxy fibreglass. The coil was wound from a Bi-2223/Ag superconducting wire and it was tested in liquid nitrogen at 77 K. Current-voltage characteristic and the AC losses of the coil were measured and compared with the...

  7. AC losses in arrays of superconducting strips on buffered metallic substrates

    Full text: The effect of subdividing superconducting YBCO films on YSZ-buffered hastelloy substrates into arrays of parallel strips on the AC loss was investigated theoretically and experimentally. The hysteretic and eddy current contributions to the AC loss of such arrays were calculated as a function of temperature and applied AC magnetic field amplitude and frequency for different width and lateral separation of the strips as well as substrate and film thickness. It is shown that subdivision of a strip into sub-strips reduces the hysteretic loss proportional to the number of sub-strips. Measurements of the loss component of the AC susceptibility, X'', confirm the theoretical predictions. When the film is subdivided into N parallel strips, the frequency-independent hysteretic contribution to X'', which is dominant at lower frequencies (f ∼ 100 Hz), decreases to 1/N of its original value. As the strips become wider or their separation becomes smaller, the hysteretic X'' increases. The eddy current contribution to X'', which originates from the metallic substrate, becomes prominent as the frequency increases, approaching a linear frequency dependence at high frequencies. Its weak temperature dependence reflects that of the hastelloy resistivity

  8. AC loss performance of cable-in-conduit conductor. Influence of cable mechanical property on coupling loss reduction

    The ITER Central Solenoid (CS) model coil, CS Insert and Nb3Al Insert were developed and tested from 2000 to 2002. The AC loss performances of these coils were investigated in various experiments. In addition, the AC losses of the CS and Nb3Al Insert conductors were measured using short CS and Nb3Al Insert conductors before the coil tests. The coupling time constants of these conductors were estimated to be 30 and 120 ms, respectively. On the other hand, the test results of the CS and Nb3Al Inserts show that the coupling currents induced in these conductors had multiple decay time constants. In fact, the existence of the coupling currents with long decay time constants, the order of which was in the thousands of seconds, was directly observed with hall sensors and voltage taps. Moreover, the AC loss test results show that electromagnetic force decreases coupling losses with exponential decay constants. This is because the weak sinter among the strands, which originated during heat treatment, was broken due to the electromagnetic force, and then the contact resistance among strands increased. It was found that this exponential decay constant was the function of a gap (i.e., a mechanical property of the cable) created between the cable and conduit due to electromagnetic force. The gap can be estimated by pressure drop, measured under the electromagnetic force. The pressure drop can easily be measured at an initial trial charge, and then it is possible to estimate the exponential decay constant before normal coil operation. Accordingly, it is possible to predict promptly how many times the trial operations are necessary to decrease the coupling losses to the designed value by measuring the coupling losses and the pressure drop during the initial coil operation trial. (author)

  9. Theory of ac loss in power transmission cables with second generation high temperature superconductor wires

    While a considerable amount of work has been done in an effort to understand ac losses in power transmission cables made of first generation high temperature superconductor (HTS) wires, use of second generation (2G) HTS wires brings in some new considerations. The high critical current density of the HTS layer in 2G wires reduces the surface superconductor hysteretic losses, for which a new formula is derived. Instead, gap and polygonal losses, flux transfer losses in imbalanced two-layer cables and ferromagnetic losses for wires with NiW substrates constitute the principal contributions. A formula for the flux transfer losses is also derived with a paramagnetic approximation for the substrate. Current imbalance and losses associated with the magnetic substrate can be minimized by orienting the substrates of the inner winding inward and the outer winding outward.

  10. Numerical and theoretical evaluations of AC losses for single and infinite numbers of superconductor strips with direct and alternating transport currents in external AC magnetic field

    Kajikawa, K., E-mail: kajikawa@sc.kyushu-u.ac.j [Research Institute of Superconductor Science and Systems, Kyushu University, 744 Motooka, Nishi-ku, Fukuoka 819-0395 (Japan); Funaki, K. [Research Institute of Superconductor Science and Systems, Kyushu University, 744 Motooka, Nishi-ku, Fukuoka 819-0395 (Japan); Shikimachi, K.; Hirano, N.; Nagaya, S. [Chubu Electric Power Co., Inc., 20-1 Kitasekiyama, Ohdaka-cho, Midori-ku, Nagoya 459-8522 (Japan)

    2010-11-01

    AC losses in a superconductor strip are numerically evaluated by means of a finite element method formulated with a current vector potential. The expressions of AC losses in an infinite slab that corresponds to a simple model of infinitely stacked strips are also derived theoretically. It is assumed that the voltage-current characteristics of the superconductors are represented by Bean's critical state model. The typical operation pattern of a Superconducting Magnetic Energy Storage (SMES) coil with direct and alternating transport currents in an external AC magnetic field is taken into account as the electromagnetic environment for both the single strip and the infinite slab. By using the obtained results of AC losses, the influences of the transport currents on the total losses are discussed quantitatively.

  11. Numerical and theoretical evaluations of AC losses for single and infinite numbers of superconductor strips with direct and alternating transport currents in external AC magnetic field

    Kajikawa, K.; Funaki, K.; Shikimachi, K.; Hirano, N.; Nagaya, S.

    2010-11-01

    AC losses in a superconductor strip are numerically evaluated by means of a finite element method formulated with a current vector potential. The expressions of AC losses in an infinite slab that corresponds to a simple model of infinitely stacked strips are also derived theoretically. It is assumed that the voltage-current characteristics of the superconductors are represented by Bean’s critical state model. The typical operation pattern of a Superconducting Magnetic Energy Storage (SMES) coil with direct and alternating transport currents in an external AC magnetic field is taken into account as the electromagnetic environment for both the single strip and the infinite slab. By using the obtained results of AC losses, the influences of the transport currents on the total losses are discussed quantitatively.

  12. Artificial neural networks for AC losses prediction in superconducting round filaments

    Leclerc, J.; Makong Hell, L.; Lorin, C.; Masson, P. J.

    2016-06-01

    An extensive and fast method to estimate superconducting AC losses within a superconducting round filament carrying an AC current and subjected to an elliptical magnetic field (both rotating and oscillating) is presented. Elliptical fields are present in rotating machine stators and being able to accurately predict AC losses in fully superconducting machines is paramount to generating realistic machine designs. The proposed method relies on an analytical scaling law (ASL) combined with two artificial neural network (ANN) estimators taking 9 input parameters representing the superconductor, external field and transport current characteristics. The ANNs are trained with data generated by finite element (FE) computations with a commercial software (FlexPDE) based on the widely accepted H-formulation. After completion, the model is validated through comparison with additional randomly chosen data points and compared for simple field configurations to other predictive models. The loss estimation discrepancy is about 3% on average compared to the FEA analysis. The main advantages of the model compared to FE simulations is the fast computation time (few milliseconds) which allows it to be used in iterated design processes of fully superconducting machines. In addition, the proposed model provides a higher level of fidelity than the scaling laws existing in literature usually only considering pure AC field.

  13. Theoretical and experimental study of AC loss in high temperature superconductor single pancake coils

    The electromagnetic properties of a pancake coil in an AC regime as a function of the number of turns is studied theoretically and experimentally. Specifically, the AC loss, the coil critical current and the voltage signal are discussed. The coils are made of Bi2Sr2Ca2Cu3O10/Ag (BiSCCO) tape, although the main qualitative results are also applicable to other kinds of superconducting tape, such as coated conductors. The AC loss and the voltage signal are electrically measured using different pick-up coils with the help of a transformer. One of them avoids dealing with the huge coil inductance. In addition, the critical current of the coils is experimentally determined by conventional DC measurements. Furthermore, the critical current, the AC loss and the voltage signal are simulated, showing a good agreement with the experiments. For all simulations, the field dependent critical current density inferred from DC measurements on a short tape sample is taken into account.

  14. AC transport current loss analysis for a face-to-face stack of superconducting tapes

    Yoo, Jaeun [Dept. of Physics, Chonbuk National University, Jeonju (Korea, Republic of); Youm, Dojun [Dept. of Physics, Korea Advanced Institute of Science and Technology, Daejeon (Korea, Republic of); Oh, Sang Soo [Superconducting Materials Research Group, KERI, Changwon (Korea, Republic of)

    2013-06-15

    AC Losses for face to face stacks of four identical coated conductors (CCs) were numerically calculated using the H-formulation combined with the E-J power law and the Kim model. The motive sample was the face to face stack of four 2 mm-wide CC tapes with 2 μm thick superconducting layer of which the critical current density, J{sub c}, was 2.16 x 10{sup 6} A/cm{sup 2} on IBAD-MgO template, which was suggested for the mitigation of ac loss as a round shaped wire by Korea Electrotechnology Research Institute. For the calculation the cross section of the stack was simply modeled as vertically aligned 4 rectangles of superconducting (SC) layers withE=E{sub o}(J(x,y,t)/J{sub c}(B)){sup n} in x-y plane where E{sub o} was 10{sup -6} V/cm, J{sub c} (B) was the field dependence of current density and n was 21. The field dependence of the critical current of the sample measured in four-probe method was employed for J{sub c} (B) in the equation. The model was implemented in the finite element method program by commercial software. The ac loss properties for the stacks were compared with those of single 4 cm-wide SC layers with the same critical current density or the same critical current. The constraint for the simulation was imposed in two different ways that the total current of the stack obtained by integrating J(x,y,t) over the cross sections was the same as that of the applied transport current: one is that one fourth of the external current was enforced to flow through each SC. In this case, the ac loss values for the stacks were lower than those of single wide SC layer. This mitigation of the loss is attributed to the reduction of the normal component of the magnetic field near the SC layers due to the strong expulsion of the magnetic field by the enforced transport current. On the contrary, for the other case of no such enforcement, the ac loss values were greater than those of single 4cm-wide SC layer and. In this case, the phase difference of the current flowing

  15. Self-field ac losses in biaxially aligned Y endash Ba endash Cu endash O tape conductors

    Self-field ac losses were measured by the conventional ac four-probe method in biaxially aligned Y endash Ba endash Cu endash O tapes using polycrystalline Hastelloy tapes with textured yttria-stabilized-zirconia buffer layers. The ac losses increased in proportion to the fourth power of transport current in the high Jc sample, and agreed well with Norris close-quote equation for thin strip conductors. However, the low Jc sample had rather higher losses than Norris close-quote prediction, suggesting excessive magnetic flux penetration caused by percolated current paths. The results confirmed Norris close-quote prediction of the low ac losses for thin strip conductors, and indicated the importance of removing percolated structures of current paths to avoid higher ac losses than the theoretical predictions based on uniform conductors. copyright 1997 American Institute of Physics

  16. Transport and AC loss properties of the repaired multifilamentary REBCO superconducting tapes

    Yamasaki, S.; Iwakuma, M.; Funaki, K.; Kato, J.; Chikumoto, T.; Tanabe, K.; Nakao, K.; Izumi, T.; Yamada, Y.; Shiohara, Y.; Saito, T.

    2010-11-01

    For near-future applications of REBa 2Cu 3O 7 (REBCO) coated conductors to electric power cables, transformers and Superconducting Magnetic Energy Storage (SMES), the long taped wires with high performance in the transport properties have been designed and fabricated. Moreover, in order to drastically reduce AC losses in perpendicular field configuration, advanced multifilament YBCO coated conductors (MFYCCs) fabricated with technique of a laser scribing process have been also developed. In the present study, from engineering viewpoints to utilize such advanced conductors, we evaluated the transport and AC loss properties of short MFYCCs with a repaired part or a joint by a diffusion joint technique with the saddle-shaped pickup coil method.

  17. Transport and AC loss properties of the repaired multifilamentary REBCO superconducting tapes

    Yamasaki, S. [Research Institute of Superconductor Science and Systems, Kyushu University, 744 Motooka, Nishi-ku, Fukuoka 819-0395 (Japan); Iwakuma, M., E-mail: iwakuma@sc.kyushu-u.ac.j [Research Institute of Superconductor Science and Systems, Kyushu University, 744 Motooka, Nishi-ku, Fukuoka 819-0395 (Japan); Funaki, K. [Research Institute of Superconductor Science and Systems, Kyushu University, 744 Motooka, Nishi-ku, Fukuoka 819-0395 (Japan); Kato, J.; Chikumoto, T.; Tanabe, K.; Nakao, K.; Izumi, T.; Yamada, Y.; Shiohara, Y. [International Superconductivity Technology Center, ISTEC, 1-10-13 Shinonome, Koto-ku, Tokyo 135-0062 (Japan); Saito, T. [Fujikura Ltd., 1-5-1 Kiba, Koto-ku, Tokyo 135-8512 (Japan)

    2010-11-01

    For near-future applications of REBa{sub 2}Cu{sub 3}O{sub 7} (REBCO) coated conductors to electric power cables, transformers and Superconducting Magnetic Energy Storage (SMES), the long taped wires with high performance in the transport properties have been designed and fabricated. Moreover, in order to drastically reduce AC losses in perpendicular field configuration, advanced multifilament YBCO coated conductors (MFYCCs) fabricated with technique of a laser scribing process have been also developed. In the present study, from engineering viewpoints to utilize such advanced conductors, we evaluated the transport and AC loss properties of short MFYCCs with a repaired part or a joint by a diffusion joint technique with the saddle-shaped pickup coil method.

  18. Loss optimizing low power 50 Hz transformers intended for AC/DC standby power supplies

    Nielsen, Nils

    2004-01-01

    This paper presents the measured efficiency on selected low power conventional 50 Hz/230 V-AC transformers. The small transformers are intended for use in 1 W@5 V-DC series- or buck-regulated power supplies for standby purposes. The measured efficiency is compared for cheap off-the-self transformer...... and for some which are optimized for a lower no-load loss. The optimization is done by simple and low cost means....

  19. Loss optimizing low power 50 Hz transformers intended for AC/DC standby power supplies

    Nielsen, Nils

    2004-01-01

    This paper presents the measured efficiency on selected low power conventional 50 Hz/230 V-AC transformers. The small transformers are intended for use in 1 W@5 V-DC series- or buck-regulated power supplies for standby purposes. The measured efficiency is compared for cheap off-the-self transformer and for some which are optimized for a lower no-load loss. The optimization is done by simple and low cost means.

  20. Evaluation of Core Loss in Magnetic Materials Employed in Utility Grid AC Filters

    Beres, Remus Narcis; Wang, Xiongfei; Blaabjerg, Frede;

    2016-01-01

    the core, depending on the magnetic material of choice and current ripple specifications. Additionally, shunt or series reactors that exists in LCL or trap filters and which are subjected to sinusoidal excitations have different specifications and requirements. Therefore, the core losses of different...... magnetic materials adopted in utility grid ac filters have been investigated and measured for both sinusoidal and rectangular excitation, with and without dc bias condition. The core loss information can ensure cost effective passive filter designs and may avoid trial-error design procedures of the passive...

  1. Fabrication and AC transport losses for Ag-sheathed Bi-2223 tapes using rectangular deformation process

    The AC transport losses in self-field at 77 K have been investigated for the Ag-sheathed Bi-2223 multifilamentary tapes prepared by rectangular deformation process. The rectangular wires with 20 (5 x 4 arrangement) filaments and different aspect ratio of their cross-section were fabricated by two-axial rolling machine, and subsequently they were converted to the tape-form conductors by the one-axial flat rolling and heat treatments. The initial configurations of rectangular wires before applying the flat rolling affect the filament shape near the tape edge in the final tapes. Furthermore, transport loss behaviors for investigated tapes also depend on the initial configurations of rectangular wires, although the main contribution to the losses comes from the hysteresis loss of the superconductor. This may be caused by the difference in filament shape and lateral Jc distributions in the cross-section of each tape samples

  2. AC loss reduction of TFA-MOD coated conductors in long length by laser scribing technique

    Katayama, K.; Hirano, H.; Machi, T.; Takagi, Y.; Takahashi, Y.; Izumi, T.

    TFA-MOD process is expected to be promising for future applications since it can produce high performance YBCO coated conductors with low cost. Applying YBCO coated conductors to the power electric devices such as transformer, cable, motors, reduction of AC loss for long wire is necessary. Multifilamentation, which is one of the effective approaches for AC loss reduction, has been developed by the scribing process. YBCO coated conductors produced by our standard TFA-MOD process delaminated into two parts by the laser scribing. The delamination was clarified to occur within the superconducting layer caused by the defects such as pores in the superconducting layer. In order to reduce the defects in the superconducting layer, we modify the heat treatment profile performed on the decomposed precursor films by applying the interim annealing(550-600°C) before crystallization heat treatment(740-770°C). The interim annealed samples had much less and smaller pores than the standard processed ones. The peel strength measured by transverse tensile test was as high as the PLD derived coated conductors which was successfully scribed into five filaments resulting in 1/5 AC loss. A 50m long YBCO coated conductor with the characteristics of 398A/cmwidth was obtained and cut into 5 mm width, followed by the laser scribing process into five filaments. The multifilamentation process was successfully performed without delamination throughout the wire. The hysteresis loss was down to 1/N (N: number of filaments), as we aimed. The IC properties of the filaments were 29±4A, indicating the wire was uniformly fabricated.

  3. Modelling and computation of AC fields and losses in high temperature superconductors

    This thesis is concerned with the modelling and the computation of the AC losses and electromagnetic fields in high temperature superconducting tapes using an E - J characteristic diffusion model. The AC losses in high temperature superconductors are modelled as a highly non-linear diffusion process. An empirical expression for modelling effective resistivity of the tape is extracted from the Rhyner's model and then used in the build up of the diffusion model. Formulation in terms of electric field E is used extensively and comprehensive explanations of why this model is used are given. Using the E formulation three different models that describe three different cases of the problem are developed. To understand the physical and the numerical phenomena that occur when a superconducting tape carries an alternating current or is exposed to an external variable magnetic field a one-dimensional model has been developed first. Comprehensive details and results of the principle and formulation of the primary model are given. The solid basis created by the one-dimensional model and the necessity of the model to be closer to the real tape drive us to two more realistic models, one where a silver layer is added on the top of the superconducting core, and the second one is the two-dimensional model where the edge effects and importance of non-linearity is emphasised. For both of these models comprehensive formulations and results are given. A collection of programs that solves the models has been created and tested, and the results obtained where successfully compared with results obtained by other authors through numerical and experimental means. The research demonstrates that the models developed are useful in exploring the mechanism of AC losses in superconducting tapes, the numerical programs allow prediction of losses under particular conditions and the applicability of different models (one and two-dimensional, the ''sandwich model'' and the critical state model

  4. Comparison between measured and numerically calculated AC losses in second-generation high temperature superconductor pancake coils

    The critical current and alternating current loss of HTS coil are not equal in different parts of HTS coil. AC loss inside the magnet forms a certain distribution which makes the winding loss calculation very complex. The analytical expressions are established based on Kim's model and the Clem model. The AC loss of HTS coil is measured by electrical method at 77 K and numerical calculation model is resolved by Matlab. The theoretical results and measurement data were compared and analyzed. As a high temperature superconductor (HTS) coil is a complex electromagnetic system, the critical current and alternating current loss are not equal in different parts of HTS coil. AC loss inside the magnet forms a certain distribution which makes the winding loss calculation very complex. The analytical expressions are established based on Kim's model and the Clem model. The AC loss of high-temperature superconductor pancake coil is generally obtained from experimental measurements and numerical calculations. The AC loss of high-temperature superconductor pancake coil is measured by electrical method at the temperature of liquid nitrogen. Numerical calculation model, which is set up and resolved by Matlab, was given as the theory equation in this study, where the theoretical results and measurement data were compared and analyzed.

  5. AC loss in stacks of Bi-2223/Ag tapes modified with ferromagnetic covers at the edges

    Safran, S; Goemoery, F [Institute of Electrical Engineering, Slovak Academy of Sciences, Dubravska cesta 9, 842 39 Bratislava (Slovakia); Gencer, Ali [Physics Department, Faculty of Sciences, Ankara University, Tandogan, 06100 Ankara (Turkey)

    2010-10-15

    We investigated the magnetization loss of stacked Bi-2223/Ag tapes with a ferromagnetic cover on the edges. Such modification has been found recently to reduce the AC loss of a single tape; however, the behavior in a coil winding could be different. With experiments and numerical calculations we show that a ferromagnetic cover on the edges of a superconducting tape could reduce its magnetization loss also when the tapes are arranged in a stack. The effect is weaker for larger numbers of tapes but nevertheless remained significant in a stack of four tapes, which was the maximum number studied here. The effects observed experimentally are nicely explained by the results of numerical calculations.

  6. Measuring ac losses in superconducting cables using a resonant circuit:Resonant current experiment (RESCUE)

    Däumling, Manfred; Olsen, Søren Krüger; Rasmussen, Carsten;

    1998-01-01

    A simple way to obtain true ac losses with a resonant circuit containing a superconductor, using the decay of the circuit current, is described. For the measurement a capacitor is short circuited with a superconducting cable. Energy in the circuit is provided by either charging up the capacitors...... with a certain voltage, or letting a de flow in the superconductor. When the oscillations are started-either by opening a switch in case a de is flowing or by closing a switch to connect the charged capacitors with the superconductor-the current (via a Rogowski coil) or the voltage on the capacitor can...

  7. ESBWR response to an extended station blackout/loss of all AC power

    U.S. federal regulations require light water cooled nuclear power plants to cope with Station Blackouts for a predetermined amount of time based on design factors for the plant. U.S. regulations define Station Blackout (SBO) as a loss of the offsite electric power system concurrent with turbine trip and unavailability of the onsite emergency AC power system. According to U.S. regulations, typically the coping period for an SBO is 4 hours and can be as long as 16 hours for currently operating BWR plants. Being able to cope with an SBO and loss of all AC power is required by international regulators as well. The U.S. licensing basis for the ESBWR is a coping period of 72 hours for an SBO based on U.S. NRC requirements for passive safety plants. In the event of an extended SBO (viz., greater than 72 hours), the ESBWR response shows that the design is able to cope with the event for at least 7 days without AC electrical power or operator action. ESBWR is a Generation III+ reactor design with an array of passive safety systems. The ESBWR primary success path for mitigation of an SBO event is the Isolation Condenser System (ICS). The ICS is a passive, closed loop, safety system that initiates automatically on a loss of power. Upon Station Blackout or loss of all AC power, the ICS begins removing decay heat from the Reactor Pressure Vessel (RPV) by (i) condensing the steam into water in heat exchangers located in pools of water above the containment, and (ii) transferring the decay heat to the atmosphere. The condensed water is then returned by gravity to cool the reactor again. The ICS alone is capable of maintaining the ESBWR in a safe shutdown condition after an SBO for an extended period. The fuel remains covered throughout the SBO event. The ICS is able to remove decay heat from the RPV for at least 7 days and maintains the reactor in a safe shutdown condition. The water level in the RPV remains well above the top of active fuel for the duration of the SBO event

  8. Transport ac loss in a rectangular thin strip with power-law E(J) relation

    Highlights: • Transport ac loss in a thin strip with power-law E(J) is systematically computed. • The scaled results can be accurately used for strips with any critical current and frequency. • Experiments may be unambiguously compared with modeling results at a critical frequency. - Abstract: Transport ac losses of a rectangular thin strip obeying relation E/Ec=(J/Jc)n with a fixed critical current Ic and n=5,10,20,30, and 40 are accurately computed at a fixed frequency f as functions of the current amplitude Im. The results may be interpolated and scaled to those at any values of Ic,f, and 5⩽n⩽40. Normalized in the same way as that in Norris’ analytical formula derived from the critical-state model and converting f to a critical frequency fc, the modeling results may be better compared with the Norris formula and experimental data. A complete set of calculated modeling data are given with necessary formulas to be easily used by experimentalists in any particular case

  9. Transport ac loss in a rectangular thin strip with power-law E(J) relation

    Li, Shuo [School of Electrical Engineering, Beijing Jiaotong University, Beijing 100044 (China); Chen, Du-Xing, E-mail: chendx3008@hotmail.com [Departament de Física, Universitat Autònoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Fan, Yu; Fang, Jin [School of Electrical Engineering, Beijing Jiaotong University, Beijing 100044 (China)

    2015-01-15

    Highlights: • Transport ac loss in a thin strip with power-law E(J) is systematically computed. • The scaled results can be accurately used for strips with any critical current and frequency. • Experiments may be unambiguously compared with modeling results at a critical frequency. - Abstract: Transport ac losses of a rectangular thin strip obeying relation E/E{sub c}=(J/J{sub c}){sup n} with a fixed critical current I{sub c} and n=5,10,20,30, and 40 are accurately computed at a fixed frequency f as functions of the current amplitude I{sub m}. The results may be interpolated and scaled to those at any values of I{sub c},f, and 5⩽n⩽40. Normalized in the same way as that in Norris’ analytical formula derived from the critical-state model and converting f to a critical frequency f{sub c}, the modeling results may be better compared with the Norris formula and experimental data. A complete set of calculated modeling data are given with necessary formulas to be easily used by experimentalists in any particular case.

  10. A two-dimensional finite element method to calculate the AC loss in superconducting cables, wires and coated conductors

    In order to utilize HTS conductors in AC electrical devices, it is very important to be able to understand the characteristics of HTS materials in the AC electromagnetic conditions and give an accurate estimate of the AC loss. A numerical method is proposed in this paper to estimate the AC loss in superconducting conductors including MgB2 wires and YBCO coated conductors. This method is based on solving a set of partial differential equations in which the magnetic field is used as the state variable to get the current and electric field distributions in the cross sections of the conductors and hence the AC loss can be calculated. This method is used to model a single-element and a multi-element MgB2 wires. The results demonstrate that the multi-element MgB2 wire has a lower AC loss than a single-element one when carrying the same current. The model is also used to simulate YBCO coated conductors by simplifying the superconducting thin tape into a one-dimensional region where the thickness of the coated conductor can be ignored. The results show a good agreement with the measurement

  11. A two-dimensional finite element method to calculate the AC loss in superconducting cables, wires and coated conductors

    Hong, Z; Jiang, Y; Pei, R; Coombs, T A [Electronic, Power and Energy Conversion Group, Engineering Department, University of Cambridge, CB2 1PZ (United Kingdom); Ye, L [Department of Electrical Power Engineering, CAU, P. O. Box 210, Beijing 100083 (China); Campbell, A M [Interdisciplinary Research Centre in Superconductivity, University of Cambridge, CB3 0HE (United Kingdom)], E-mail: Zh223@cam.ac.uk

    2008-02-15

    In order to utilize HTS conductors in AC electrical devices, it is very important to be able to understand the characteristics of HTS materials in the AC electromagnetic conditions and give an accurate estimate of the AC loss. A numerical method is proposed in this paper to estimate the AC loss in superconducting conductors including MgB{sub 2} wires and YBCO coated conductors. This method is based on solving a set of partial differential equations in which the magnetic field is used as the state variable to get the current and electric field distributions in the cross sections of the conductors and hence the AC loss can be calculated. This method is used to model a single-element and a multi-element MgB{sub 2} wires. The results demonstrate that the multi-element MgB{sub 2} wire has a lower AC loss than a single-element one when carrying the same current. The model is also used to simulate YBCO coated conductors by simplifying the superconducting thin tape into a one-dimensional region where the thickness of the coated conductor can be ignored. The results show a good agreement with the measurement.

  12. Hysteretic ac loss in a coated superconductor subjected to oscillating magnetic fields: ferromagnetic effect and frequency dependence

    Numerical simulations of the hysteretic ac loss in a coated superconductor with a more realistic version of the architecture were performed via the finite-element technique in the presence of an oscillating magnetic field. The coated superconductor was electromagnetically modeled by resorting to the quasistatic approximation of a vector potential approach in conjunction with nonlinear descriptions of the superconducting layer and the ferromagnetic substrate therein by a power-law model and the Langevin equation, respectively. A diverse effect of the ferromagnetic substrate on the hysteretic ac loss, depending on the strength of the applied magnetic field, was displayed, and its underlying cause was identified. The dependence of the hysteretic ac loss on the applied frequency is found to be related to a critical amplitude of the applied magnetic field, and the eddy-current loss dissipated in the metal coatings becomes prominent as the frequency increases only at high applied magnetic fields. (paper)

  13. The effect of surface grain reversal on the AC losses of sintered Nd–Fe–B permanent magnets

    Moore, Martina, E-mail: m.moore@ifw-dresden.de [Leibniz Institute for Solid State and Materials Research (IFW) Dresden, 01171 Dresden (Germany); Roth, Stefan; Gebert, Annett [Leibniz Institute for Solid State and Materials Research (IFW) Dresden, 01171 Dresden (Germany); Schultz, Ludwig [Leibniz Institute for Solid State and Materials Research (IFW) Dresden, 01171 Dresden (Germany); TU Dresden, Institute for Materials Science, 01062 Dresden (Germany); Gutfleisch, Oliver [TU Darmstadt, Department of Materials Science, Alarich-Weiß-Str. 16, 64287 Darmstadt (Germany); Fraunhofer Project Group for Materials Recycling and Resource Strategies IWKS, 63457 Hanau (Germany)

    2015-02-01

    Sintered Nd–Fe–B magnets are exposed to AC magnetic fields in many applications, e.g. in permanent magnet electric motors. We have measured the AC losses of sintered Nd–Fe–B magnets in a closed circuit arrangement using AC fields with root mean square-values up to 80 mT (peak amplitude 113 mT) over the frequency range 50 to 1000 Hz. Two magnet grades with different dysprosium content were investigated. Around the remanence point the low grade material (1.7 wt% Dy) showed significant hysteresis losses; whereas the losses in the high grade material (8.9 wt% Dy) were dominated by classical eddy currents. Kerr microscopy images revealed that the hysteresis losses measured for the low grade magnet can be mainly ascribed to grains at the sample surface with multiple domains. This was further confirmed when the high grade material was subsequently exposed to DC and AC magnetic fields. Here a larger number of surface grains with multiple domains are also present once the step in the demagnetization curve attributed to the surface grain reversal is reached and a rise in the measured hysteresis losses is evident. If in the low grade material the operating point is slightly offset from the remanence point, such that zero field is not bypassed, its AC losses can also be fairly well described with classical eddy current theory. - Highlights: • The eddy current losses of sintered Nd–Fe–B magnets were measured. • Field amplitudes up to 113 mT over the frequency range 50 to 1000 Hz were applied. • The Nd–Fe–B magnets showed significant hysteresis losses at low amplitudes (∼100 mT). • The source of such hysteresis losses in sintered Nd–Fe–B magnets was identified. • Two magnet grades with different dysprosium content were investigated.

  14. A model for calculating the AC losses of second-generation high temperature superconductor pancake coils

    A model is presented for calculating the AC losses of a stack of second-generation high temperature superconductor tapes. This model takes as a starting point the model of Clem and co-workers for a stack in which each tape carries the same current. It is based on the assumption that the magnetic flux lines lie parallel to the tapes within the part of the stack where the flux has not penetrated. In this paper we allow for the depth of penetration of field to vary across the stack, and use the Kim model to allow for the variation of Jc with B. The model is applied to the cases of a transport current and an applied field. For a transport current the calculated result differs from the Norris expression for a single tape carrying a uniform current and it does not seem possible to define a suitable average Jc which could be used. Our method also gives a more accurate value for the critical current of the stack than other methods. For an applied field the stack behaves as a solid superconductor with the Jc averaged locally over several tapes, but still allowed to vary throughout the stack on a larger scale. For up to about ten tapes the losses rise rapidly with the number of tapes, but in thicker stacks the tapes shield each other and the losses become that of a slab with a field parallel to the faces.

  15. A model for calculating the AC losses of second-generation high temperature superconductor pancake coils

    Yuan Weijia; Campbell, A M; Coombs, T A [Electronic, Power and Energy Conversion Group, Engineering Department, University of Cambridge, Cambridge CB2 1PZ (United Kingdom)], E-mail: wy215@cam.ac.uk

    2009-07-15

    A model is presented for calculating the AC losses of a stack of second-generation high temperature superconductor tapes. This model takes as a starting point the model of Clem and co-workers for a stack in which each tape carries the same current. It is based on the assumption that the magnetic flux lines lie parallel to the tapes within the part of the stack where the flux has not penetrated. In this paper we allow for the depth of penetration of field to vary across the stack, and use the Kim model to allow for the variation of J{sub c} with B. The model is applied to the cases of a transport current and an applied field. For a transport current the calculated result differs from the Norris expression for a single tape carrying a uniform current and it does not seem possible to define a suitable average J{sub c} which could be used. Our method also gives a more accurate value for the critical current of the stack than other methods. For an applied field the stack behaves as a solid superconductor with the J{sub c} averaged locally over several tapes, but still allowed to vary throughout the stack on a larger scale. For up to about ten tapes the losses rise rapidly with the number of tapes, but in thicker stacks the tapes shield each other and the losses become that of a slab with a field parallel to the faces.

  16. Transport ac loss of elliptical thin strips with a power-law E(J) relation

    Jia, Chen-Xi; Chen, Du-Xing; Li, Shuo; Fang, Jin

    2015-10-01

    The transport ac loss Q of an elliptical thin strip of critical current I c with a power-law relation E\\propto {J}n is accurately computed as a function of current amplitude I m and frequency f. The resulting Q({I}m) is normalized to q({i}m) following the Norris critical-state formula, and converted to {q}*({i}m*) at a critical frequency f c based on a transport scaling law. Having a set of {q}*({i}m*) at several values of n as a base, a general expression of {q}*({i}m*,n) is obtained, which can be used to easily calculate q({i}m) for any practical purposes.

  17. ac losses and field and current density distribution during a full cycle of a stack of superconducting tapes

    Yuan, Weijia; Campbell, A. M.; Coombs, T. A.

    2010-05-01

    Starting from an existing model by Clem et al., this paper has analyzed how the current density and magnetic field distribution of a stack of superconducting tapes with ac transport currents or applied fields will change in a full cycle. This paper assumes when the ac current or field starts to change in the other direction, a new penetrated region will begin to penetrate from the superconductor surface. If we assume Jc is constant in the critical region, this paper demonstrates that the Claassen formula (7) can be used to calculate the exact ac losses. If Jc depends on local Bz, we can use Eq. (9) to quickly predict the ac losses. This approach does not need to calculate a complete ac cycle. This saves considerably computation time while gives a result which is in close agreement with that calculated from a complete ac cycle. The calculation method can be applied for calculating a superconducting pancake coil if the coil radius is much larger than the tape width.

  18. Ac loss modelling and measurement of superconducting transformers with coated-conductor Roebel-cable in low-voltage winding

    Pardo, Enric; Staines, Mike; Jiang, Zhenan; Glasson, Neil

    2015-11-01

    Power transformers using a high temperature superconductor (HTS) ReBCO coated conductor and liquid nitrogen dielectric have many potential advantages over conventional transformers. The ac loss in the windings complicates the cryogenics and reduces the efficiency, and hence it needs to be predicted in its design, usually by numerical calculations. This article presents detailed modelling of superconducting transformers with Roebel cable in the low-voltage (LV) winding and a high-voltage (HV) winding with more than 1000 turns. First, we model a 1 MVA 11 kV/415 V 3-phase transformer. The Roebel cable solenoid forming the LV winding is also analyzed as a stand-alone coil. Agreement between calculations and experiments of the 1 MVA transformer supports the model validity for a larger tentative 40 MVA 110 kV/11 kV 3-phase transformer design. We found that the ac loss in each winding is much lower when it is inserted in the transformer than as a stand-alone coil. The ac loss in the 1 and 40 MVA transformers is dominated by the LV and HV windings, respectively. Finally, the ratio of total loss over rated power of the 40 MVA transformer is reduced below 40% of that of the 1 MVA transformer. In conclusion, the modelling tool in this work can reliably predict the ac loss in real power applications.

  19. AC loss of HTS magnet for AMR refrigerator using magnetic field formulation and edge element in cylindrical coordinates

    Kim, Seo Ho; Park, Minwon [Changwon National University, Changwon (Korea, Republic of); Jeong, Sang Kwon [KAIST, Daejeon (Korea, Republic of)

    2013-05-15

    AMR (Active Magnetic Regenerative) refrigerators require the large variation of the magnetic field and a HTS magnet can be used. The amount of AC loss is very important considering the overall efficiency of the AMR refrigerator. However, it is very hard to estimate the precise loss of the HTS magnet because the magnetic field distribution around the conductor itself depends on the coil configuration and the neighboring HTS wires interact each other through the distorted magnetic field by the screening current Therefore, the AC loss of HTS magnet should be calculated using the whole configuration of the HTS magnet with superconducting characteristic. This paper describes the AC loss of the HTS magnet by an appropriate FEM approach, which uses the non-linear characteristic of HTS conductor. The analysis model is based on the 2-D FEM model, called as 'magnetic field formulation and edge-element model', for whole coil configuration in cylindrical coordinates. The effects of transport current and stacked conductors on the AC loss are investigated considering the field-dependent critical current. The PDE model of 'Comsol multiphysics' is used for the FEM analysis with properly implemented equations for axisymmetric model.

  20. How filaments can reduce AC losses in HTS coated conductors: a review

    Grilli, Francesco; Kario, Anna

    2016-08-01

    Second-generation high-temperature superconductor (HTS) tapes, known also as coated conductors, are very promising tapes for HTS applications, in virtue of their extremely high critical current density, in-field behavior, and mechanical strength. Yet, the extremely large (typically in the range 1000–10 000) width-to-thickness ratio of the superconducting material makes them prone to high power dissipation in the presence of time-varying magnetic fields perpendicular to their flat face—a condition frequently met in several applications. Since the dissipation is directly proportional to the square of the superconductor's width, an obvious way of reducing it is by striating the superconductor into narrow filaments (stripes): in that case, provided that the filaments are electromagnetically uncoupled, the losses are reduced by a factor equal to the number of filaments. In the past two decades, many researchers from groups around the world have tried to apply this idea to practical conductors using different techniques. The aim of this paper is to provide a review of such efforts, focusing on the different approaches to make filamentized conductors, on the effectiveness of the AC loss reduction, and on the applicability of those techniques to long lengths.

  1. Detailed modelling of screening currents, their magnetic field and AC loss in coated conductor magnets containing up to 40000 turns

    Pardo, Enric

    2016-01-01

    Screening currents caused by varying magnetic fields degrade the homogeneity and stability of the magnetic fields created by $RE$BCO coated conductor coils. They are responsible for the AC loss, which is also important for other power applications containing windings. Since real magnets contain coils exceeding 10000 turns, accurate modeling tools for this number of turns are necessary for magnet design. This article presents a fast numerical method to model coils with no loss of accuracy. We ...

  2. Interstrand and AC-loss measurements on Rutherford-type cables for accelerator magnet applications

    Otmani, R; Tixador, P

    2001-01-01

    One of the main issues for particle accelerator magnets is the control of interstrand resistances. Too low resistances result in large coupling currents during ramping, which distort field quality, while too large resistances may prevent current redistribution among cable strands, resulting in degraded quench performance. In this paper, we review a series of interstrand resistance and AC-loss measurements performed on four Rutherford-type cables. The four cables have the same number of strands and similar outer dimensions, corresponding to LHC quadrupole cable specifications. The first cable is made from NbTi strands, coated with silver-tin alloy, the second one is made from bare Nb/sub 3/Sn strands, the third one is made also from bare Nb/sub 3/Sn strands but includes a 25- mu m-thick stainless steel core between the strand layers, and the last one is made from Nb/sub 3/Sn strands plated with chromium. To cross-check the two measurement types and assess their consistency, we compare the coupling-current time...

  3. Effect of wire arrangements on AC transport losses in cylindrical conductors composed of Ag-sheathed Bi2223 tapes

    The AC transport self-field losses at 77 K were investigated on the double-layer cylindrical conductors composed of Ag-sheathed Bi2223 tapes. The multifilamentary tapes as the strands are arranged in a parallel way on the cylindrical former with a diameter of 10.5 mm. The loss values are strongly influenced by the arrangements of tape strands in the conductors. The loss generation in conductors enhances with increasing of the separation between the layers and gap length between the adjacent tapes in the outer-layer. From the numerical calculations of the loss density distributions per-cycle in the conductors, it is suggested that the difference in loss values for each conductor is attributed to the magnetic flux distributions due to self-field and loss generations in tape strands, varying with the arrangement of tape strands in the conductors

  4. AC Transport Losses Calculation in a Bi-2223 Current Lead Using Thermal Coupling With an Analytical Formula

    Berger, Kévin; Lévêque, Jean; Netter, Denis; Douine, Bruno; Rezzoug, Abderrezak

    2005-01-01

    When a superconductor is fed with an alternating current, the temperature rise created by the losses tends to reduce the current carrying capacity. If the amplitude of the current exceeds the value of the critical current, then the losses become particularly high and the thermal heating considerable. In this paper, a numerical and an analytical model which allow to estimate AC transport losses are presented. These models, which use the expression of Ic(T) and n(T), are available for any appli...

  5. Numerical models for ac loss calculation in large-scale applications of HTS coated conductors

    Quéval, Loïc; Zermeño, Víctor M. R.; Grilli, Francesco

    2016-02-01

    Numerical models are powerful tools to predict the electromagnetic behavior of superconductors. In recent years, a variety of models have been successfully developed to simulate high-temperature-superconducting (HTS) coated conductor tapes. While the models work well for the simulation of individual tapes or relatively small assemblies, their direct applicability to devices involving hundreds or thousands of tapes, e.g., coils used in electrical machines, is questionable. Indeed, the simulation time and memory requirement can quickly become prohibitive. In this paper, we develop and compare two different models for simulating realistic HTS devices composed of a large number of tapes: (1) the homogenized model simulates the coil using an equivalent anisotropic homogeneous bulk with specifically developed current constraints to account for the fact that each turn carries the same current; (2) the multi-scale model parallelizes and reduces the computational problem by simulating only several individual tapes at significant positions of the coil’s cross-section using appropriate boundary conditions to account for the field generated by the neighboring turns. Both methods are used to simulate a coil made of 2000 tapes, and compared against the widely used H-formulation finite-element model that includes all the tapes. Both approaches allow faster simulations of large number of HTS tapes by 1-3 orders of magnitudes, while maintaining good accuracy of the results. Both models can therefore be used to design and optimize large-scale HTS devices. This study provides key advancement with respect to previous versions of both models. The homogenized model is extended from simple stacks to large arrays of tapes. For the multi-scale model, the importance of the choice of the current distribution used to generate the background field is underlined; the error in ac loss estimation resulting from the most obvious choice of starting from a uniform current distribution is revealed.

  6. The magnetisation profiles and ac magnetisation losses in a single layer YBCO thin film caused by travelling magnetic field waves

    Wang, Wei; Coombs, Timothy

    2015-05-01

    This paper studies the magnetisation and ac magnetisation losses caused by a travelling magnetic wave on a single-layer YBCO thin film. This work provides thorough investigations on how the critical magnetic field gradient has been changed by the application of a travelling wave. Several conditions were studied such as zero-field cooling (ZFC), field cooling (FC) and a delta-shaped trapped field. It was found that the travelling wave tends to attenuate the existing critical magnetic field gradients in all these conditions. This interesting magnetic behaviour can be well predicted by the finite element (FEM) software with the E-J power law and Maxwell’s equations. The numerical simulations show that the existing critical current density has been compromised after applying the travelling wave. The magnetisation profile caused by the travelling wave is very different from the standing wave, while the magnetisation based on the standing wave can be interpreted by the Bean model and constant current density assumption. Based on the numerical method, which has reliability that has been solidly proven in the study, we have extended the study to the ac magnetisation losses. Comparisons were made between the travelling wave and the standing wave for this specific YBCO sample. It was found that by applying the magnetic wave of the same amplitude, the ac magnetisation loss caused by the travelling wave is about 1/3 of that caused by the standing wave. These results are helpful in understanding the general magnetism problems and ac magnetisation loss in the travelling magnetic wave conditions such as inside a high temperature superconducting (HTS) rotating machine, etc.

  7. AC loss in striped (filamentary) YBCO coated conductors leading to designs for high frequencies and field-sweep amplitudes

    AC losses of YBCO coated conductors are investigated by calculation and experiment for the higher frequency regime. Previous research using YBCO film deposited onto single-crystal substrates demonstrated the effectiveness of 'striping' or filamentary subdivision as a technique for AC loss reduction. As a result of these studies the idea of subdividing YBCO 'coated conductors' (YBCO, overlayer, and even underlayer) into such stripes suggested itself. The suggestion was implemented by burning grooves into samples of coated conductor using laser micromachining. Various machining parameters were investigated, and the striping and slicing characteristics are presented. Loss measurements were performed on unstriped as well as striped samples by the pick-up coil technique at frequencies from 50 to 200 Hz at field sweep amplitudes of up to 150 mT. The effect of soft ferromagnetic Fe shielding was also investigated. The results of the experiments form a starting point for a more general study of reduced-loss coated conductor design (including hysteretic, coupling, normal eddy current, and transport losses) projected into higher ranges of frequency and field-sweep amplitude with transformer and all-cryogenic-motor/generator applications in mind

  8. Magnetic Properties and AC Losses in AFe2O4 (A = Mn, Co, Ni, Zn Nanoparticles Synthesized from Nonaqueous Solution

    Oleksandr Yelenich

    2015-01-01

    Full Text Available Nanosized particles of AFe2O4 (A = Mn, Co, Ni, or Zn spinel ferrites were synthesized by coprecipitation from nonaqueous solutions using nitrate salts as starting reagents. The particles were characterized by X-ray diffraction, transmission electron microscopy, and magnetic measurements. Quasistatic magnetic measurements show superparamagnetic behavior with blocking temperature below room temperature for cobalt, nickel, and zinc spinel ferrite nanoparticles. Characteristic magnetic parameters of the particles including average magnetic moment of an individual nanoparticle and blocking temperature have been determined. The specific loss power which is released on the exposure of an ensemble of synthesized particles to a magnetic field is calculated and measured experimentally. It is shown that among all nanoferrites under study, the ZnFe2O4 nanoparticles demonstrate the highest heating efficiency in AC magnetic fields. The key parameters responsible for the heating efficiency in AC magnetic field have been determined. The directions to enhance the SLP value have been outlined.

  9. Low AC Loss in a 3 kA HTS Cable of the Dutch Project

    Chevtchenko, Oleg; Zuijderduin, Roy; Smit, Johan; Willén, Dag; Lentge, Heidi; Thidemann, Carsten; Traeholt, Chresten; Melnik, Irina; Geschiere, Alex

    2012-01-01

    Requirements for a 6km long high temperature superconducting (HTS) AC power cable of the Amsterdam project are: a cable has to fit in an annulus of 160mm, with two cooling stations at the cable ends only. Existing solutions for HTS cables would lead to excessively high coolant pressure drop in th...

  10. Economic simplified boiling water reactor (ESBWR) response to an extended station blackout/ loss of all AC power

    U.S. federal regulations require light water cooled nuclear power plants to cope with Station Blackout for a predetermined amount of time based on design factors for the plant. U.S. regulations define Station Blackout (SBO) as a loss of the offsite electric power system concurrent with turbine trip and unavailability of the onsite emergency AC power system. According to U.S. regulations, typically the coping period for an SBO is 4 hours and can be as long as 16 hours for currently operating BWR plants. Being able to cope with an SBO and loss of all AC power is required by international regulators as well. The U.S. licensing basis for the ESBWR is a coping period of 72 hours for an SBO based on U.S. NRC requirements for passive safety plants. In the event of an extended SBO (viz., greater than 72 hours), the ESBWR response shows that the design is able to cope with the event for at least 7 days without AC electrical power or operator action. ESBWR is a Generation III+ reactor design with an array of passive safety systems. The ESBWR primary success path for mitigation of an SBO event is the Isolation Condenser System (ICS). The ICS is a passive, closed loop, safety system that initiates automatically on a loss of power. Upon Station Blackout or loss of all AC power, the ICS begins removing decay heat from the Reactor Pressure Vessel (RPV) by (i) condensing the steam into water in heat exchangers located in pools of water above the containment, and (ii) transferring the decay heat to the atmosphere. The condensed water is then returned by gravity to cool the reactor again. The ICS alone is capable of maintaining the ESBWR in a safe shutdown condition after an SBO for an extended period. The fuel remains covered throughout the SBO event. The ICS is able to remove decay heat from the RPV for at least 7 days and maintains the reactor in a safe shutdown condition. The water level in the RPV remains well above the top of active fuel for the duration of the SBO event

  11. Effects of Formvar coating and copper-nickel outer sheath on the ac losses of multi-strand subsize cables

    Ac losses of two subcables, one with Formvar coating on the strands of the BNL 12-ml NbTi/Cu/CuNi conductor and another without the coating, were measured using the ANL Subcable Test Facility. The results indicate that couplings among the strands with and without the Formvar coating were quite weak. Weak coupling of the bare strands is due to the high resistance of the copper-nickel outer sheath. In the regime of B(dot) = 0 approx. 1.2 T/s and B = 0 approx. 4 T, the magnetic diffusion time constant was (3.8 - 5.7) x 10-3 s

  12. Iron loss in permanent-magnet brushless AC machines under maximum torque per ampere and flux weakening control

    Zhu, Z.Q.; Chen, Y. S.; Howe, D.

    2002-01-01

    The airgap flux density distribution, flux density loci in the stator core, and the associated iron loss in two topologies of brushless AC motor, having a surface-mounted magnet rotor and an interior-mounted magnet rotor, respectively, are investigated when operated under maximum torque per ampere control in the constant torque mode and maximum power control in the flux-weakening mode. It is shown that whilst the interior magnet topology is known to be eminently suitable for flux-weakening op...

  13. Technique for reduction of mechanical losses in AC superconducting coils due to thermal expansion properties of various FRP bobbins

    Sekine, N.; Tada, S.; Higuchi, T.; Furumura, Y.; Takao, T.; Yamanaka, A.

    2005-10-01

    We reported about reduction of mechanical losses in AC superconducting coils. The method is the use of FRP bobbins fabricated with special fibers. Since their FRPs have negative thermal expansion coefficient to the fiber direction, the FRP bobbins expand to the circumferential direction during cooling down. In case of the superconducting coils with such FRP bobbins, the winding tensions do not decrease during cooling down. Therefore, the mechanical losses are reduced by the suppression of wire's vibration. Their special FRPs are a Dyneema® fiber reinforced plastic (DFRP), a Dyneema and glass fiber reinforced plastic (DGFRP), and a Zylon® fiber reinforced plastic (ZFRP). These materials have negative thermal expansion coefficient to the fiber direction, however, the amplitudes of thermal expansion are various by the quantity or quality of the fiber. In this paper, the values of thermal expansion were actually measured, and it was discussed about the influence on the mechanical losses. At the experimental results, the mechanical loss was small, so that the thermal strain to the circumferential direction on the coil was large. Moreover, in case of the coils with sufficiently strong winding tensions at coil-operating temperature, the mechanical losses vanished.

  14. Technique for reduction of mechanical losses in AC superconducting coils due to thermal expansion properties of various FRP bobbins

    Sekine, N. [Tsukamoto Laboratory, Faculty of Engineering, Yokohama National University, 79-5, Tokiwadai, Hodogaya-ku, Yokohama 240-8501 (Japan)]. E-mail: n-sekine@tsukalab.dnj.ynu.ac.jp; Tada, S. [Sophia University, 7-1, Kioicho, Chiyoda-ku, Tokyo 102-8554 (Japan); Higuchi, T. [Sophia University, 7-1, Kioicho, Chiyoda-ku, Tokyo 102-8554 (Japan); Furumura, Y. [Sophia University, 7-1, Kioicho, Chiyoda-ku, Tokyo 102-8554 (Japan); Takao, T. [Sophia University, 7-1, Kioicho, Chiyoda-ku, Tokyo 102-8554 (Japan); Yamanaka, A. [Research Center, Toyobo, Co., Ltd, 2-1-1, Katata, Otsu, Shiga 520-0292 (Japan)

    2005-10-01

    We reported about reduction of mechanical losses in AC superconducting coils. The method is the use of FRP bobbins fabricated with special fibers. Since their FRPs have negative thermal expansion coefficient to the fiber direction, the FRP bobbins expand to the circumferential direction during cooling down. In case of the superconducting coils with such FRP bobbins, the winding tensions do not decrease during cooling down. Therefore, the mechanical losses are reduced by the suppression of wire's vibration. Their special FRPs are a Dyneema[reg] fiber reinforced plastic (DFRP), a Dyneema and glass fiber reinforced plastic (DGFRP), and a Zylon[reg] fiber reinforced plastic (ZFRP). These materials have negative thermal expansion coefficient to the fiber direction, however, the amplitudes of thermal expansion are various by the quantity or quality of the fiber. In this paper, the values of thermal expansion were actually measured, and it was discussed about the influence on the mechanical losses. At the experimental results, the mechanical loss was small, so that the thermal strain to the circumferential direction on the coil was large. Moreover, in case of the coils with sufficiently strong winding tensions at coil-operating temperature, the mechanical losses vanished.

  15. Technique for reduction of mechanical losses in AC superconducting coils due to thermal expansion properties of various FRP bobbins

    We reported about reduction of mechanical losses in AC superconducting coils. The method is the use of FRP bobbins fabricated with special fibers. Since their FRPs have negative thermal expansion coefficient to the fiber direction, the FRP bobbins expand to the circumferential direction during cooling down. In case of the superconducting coils with such FRP bobbins, the winding tensions do not decrease during cooling down. Therefore, the mechanical losses are reduced by the suppression of wire's vibration. Their special FRPs are a Dyneema[reg] fiber reinforced plastic (DFRP), a Dyneema and glass fiber reinforced plastic (DGFRP), and a Zylon[reg] fiber reinforced plastic (ZFRP). These materials have negative thermal expansion coefficient to the fiber direction, however, the amplitudes of thermal expansion are various by the quantity or quality of the fiber. In this paper, the values of thermal expansion were actually measured, and it was discussed about the influence on the mechanical losses. At the experimental results, the mechanical loss was small, so that the thermal strain to the circumferential direction on the coil was large. Moreover, in case of the coils with sufficiently strong winding tensions at coil-operating temperature, the mechanical losses vanished

  16. Fast-ion losses induced by ACs and TAEs in the ASDEX Upgrade tokamak

    Garcia-Munoz, M.; Hicks, N.; van Voornveld, R.; Classen, I.G.J.; Bilato, R.; Bobkov, V.; Brambilla, M.; Bruedgam, M.; Fahrbach, H. U.; Igochine, V.; Jaemsae, S.; Maraschek, M.; Sassenberg, K.

    2010-01-01

    The phase-space of convective and diffusive fast-ion losses induced by shear Alfven eigenmodes has been characterized in the ASDEX Upgrade tokamak. Time-resolved energy and pitch-angle measurements of fast-ion losses correlated in frequency and phase with toroidal Alfven eigenmodes (TAEs) and Alfven

  17. A new approach for AC loss reduction in HTS transformer using auxiliary windings, case study: 25 kA HTS current injection transformer

    AC loss is one of the important parameters in HTS (high temperature superconducting) AC devices. Among the HTS AC power devices, the transformer is an essential part in the electrical power system. The AC losses in an HTS tape depend on the magnetic field. One of the techniques usually adopted to mitigate the unwanted magnetic field is using a system of coils that produce a magnetic field opposite to the incident one, reducing the total magnetic field. In this paper adding two auxiliary windings to the HTS transformer to produce this opposite magnetic field is proposed. The proper use of these auxiliary windings could reduce the leakage flux and, therefore, the AC loss. A mathematical model is used to describe the behaviour of a transformer operating with auxiliary windings, based on the theory of electromagnetic coupled circuits. The influence of the auxiliary windings on the leakage field is studied by the finite element method (FEM) and the AC loss of an HTS transformer was calculated. Also, the simulation results show that employing auxiliary windings will improve the HTS transformer efficiency

  18. AC loss characteristics of simulated CIC-type conductors having plastic conduit

    When alternating current superconducting coils having cable-in-conduit conductors are fabricated, non-metallic conduit materials are necessary to avoid eddy current losses in the conduits. Using two kinds of non-metallic tapes made of glass fiber reinforced plastics (GFRPs) and Dyneema fiber reinforced plastics (DFRPs), we made the conductors with the GFRP conduits and DFRP conduits, and experimentally studied the total losses of the conductors. The measured results showed that the total loss of the conductor with the GFRP conduit was smaller than that with the DFRP conduit at the same value of the void ratio, the transport current, the external magnetic field, and so on. When the void ratios become high, the superconducting bundle cable can easily move in the conduit. Hence the measured total losses increased with the void ratios of the conductors

  19. Loss Prediction and Thermal Analysis of Surface-Mounted Brushless AC PM Machines for Electric Vehicle Application Considering Driving Duty Cycle

    Tianxun Chen; Xiaopeng Wu; Yugang Dong; Chengning Zhang; Haipeng Liu

    2016-01-01

    This paper presents a computationally efficient loss prediction procedure and thermal analysis of surface-mounted brushless AC permanent magnet (PM) machine considering the UDDS driving duty cycle by using a lumped parameters’ thermal model. The accurate prediction of loss and its variation with load are essential for thermal analysis. Employing finite element analysis (FEA) to determine loss at every load point would be computationally intensive. Here, the finite element analysis and/or expe...

  20. AC transport current loss analysis for anti-parallel current flow in face to face stacks of superconducting tapes

    In this study we investigated ac transport current losses in the face to face stack for the anti-parallel current flow, and compared the electromagnetic properties with those of the single SC tape as well as those of the same stack for the parallel current path. The gap between the SC tapes in the stack varied in order to verify the electromagnetic influence of the neighbors when current flows in opposite direction, and the model was implemented in the finite element method program by the commercial software, COMSOL Multiphysics 4.2a. Conclusively speaking, the loss was remarkably decreased for the anti-parallel current case, which is attributed the magnetic flux compensation between the SC layers due to the opposite direction of the current flows. As the gap between SC tapes was increased, the loss mitigation became less effective. Besides, the current density distribution is very flat cross the sample width for the narrower gap case, which is believed to be benefit for the power electric system. These results are all in good agreement with those predicted theoretically for an infinite bifilar stack.

  1. AC transport current loss analysis for anti-parallel current flow in face to face stacks of superconducting tapes

    Yoo, Ja Eun; Han, Young Hee; Kim, Hey Rim; Park, Byung Jun; Yang, Seong Eun; Kim, Hee Sun; Yu, Seung Duck; Park, Ki Jun [Future Technology Laboratory, KEPCO Research Institute, Daejeon (Korea, Republic of)

    2014-06-15

    In this study we investigated ac transport current losses in the face to face stack for the anti-parallel current flow, and compared the electromagnetic properties with those of the single SC tape as well as those of the same stack for the parallel current path. The gap between the SC tapes in the stack varied in order to verify the electromagnetic influence of the neighbors when current flows in opposite direction, and the model was implemented in the finite element method program by the commercial software, COMSOL Multiphysics 4.2a. Conclusively speaking, the loss was remarkably decreased for the anti-parallel current case, which is attributed the magnetic flux compensation between the SC layers due to the opposite direction of the current flows. As the gap between SC tapes was increased, the loss mitigation became less effective. Besides, the current density distribution is very flat cross the sample width for the narrower gap case, which is believed to be benefit for the power electric system. These results are all in good agreement with those predicted theoretically for an infinite bifilar stack.

  2. Prediction of temperature and water level in a spent fuel pit during loss of all AC powers

    A prediction method for water temperature in a spent fuel pit of a PWR has been developed to calculate the increase in water temperature during the shutdown of cooling systems. In this study, the prediction method was extended to calculate the water level in a spent fuel pit during loss of all AC powers, and predicted results were compared with data of spent fuel pools in the Fukushima Daiichi Nuclear Power Station. The calculations gave reasonable results, but overestimated the decreasing rate of the water level and water temperature. This result indicated that decay heat was overestimated and evaporation heat transfer from the water surface was underestimated. Results of calculations with 80% decay heat and 155% (No. 4 pool) or 230% (No. 2 pool) evaporation heat flux were in good agreement with data. The data-fitted evaporation heat fluxes agreed rather well with the evaporation heat transfer correlation proposed by Fujii et al. (author)

  3. Prediction of temperature and water level in a spent fuel pit during loss of all AC power supplies

    A prediction method for water temperature in a spent fuel pit of a pressurized water reactor (PWR) has been developed to calculate the increase in water temperature during the shutdown of cooling systems. In this study, the prediction method was extended to calculate the water level in a spent fuel pit during loss of all AC power supplies, and predicted results were compared with measured values of spent fuel pools in the Fukushima Daiichi Nuclear Power Station. The calculations gave reasonable results, but overestimated the decreasing rate of the water level and the water temperature. This indicated that decay heat was overestimated and evaporation heat transfer from the water surface was underestimated. Results of calculations with 80% decay heat and 155% (Unit 4 pool) or 230% (Unit 2 pool) evaporation heat flux were in good agreement with measured values. The data-fitted evaporation heat fluxes agreed rather well with the evaporation heat transfer correlation proposed by Fujii et al. (author)

  4. An improved FEM model for computing transport AC loss in coils made of RABiTS YBCO coated conductors for electric machines

    Ainslie, Mark D; Yuan Weijia; Flack, Timothy J; Coombs, Timothy A [Department of Engineering, University of Cambridge, 9 J J Thomson Avenue, Cambridge CB3 0FA (United Kingdom); Rodriguez-Zermeno, Victor M [Department of Mathematics, Technical University of Denmark, Kongens Lyngby 2800 (Denmark); Hong Zhiyong, E-mail: mda36@cam.ac.uk [School of Electronic, Information and Electrical Engineering, Shanghai Jiao Tong University, Shanghai (China)

    2011-04-15

    AC loss can be a significant problem for any applications that utilize or produce an AC current or magnetic field, such as an electric machine. The authors investigate the electromagnetic properties of high temperature superconductors with a particular focus on the AC loss in superconducting coils made from YBCO coated conductors for use in an all-superconducting electric machine. This paper presents an improved 2D finite element model for the cross-section of such coils, based on the H formulation. The model is used to calculate the transport AC loss of a racetrack-shaped coil using constant and magnetic field-dependent critical current densities, and the inclusion and exclusion of a magnetic substrate, as found in RABiTS (rolling-assisted biaxially textured substrate) YBCO coated conductors. The coil model is based on the superconducting stator coils used in the University of Cambridge EPEC Superconductivity Group's all-superconducting permanent magnet synchronous motor design. To validate the modeling results, the transport AC loss of a stator coil is measured using an electrical method based on inductive compensation by means of a variable mutual inductance. Finally, the implications of the findings on the performance of the motor are discussed.

  5. An improved FEM model for computing transport AC loss in coils made of RABiTS YBCO coated conductors for electric machines

    AC loss can be a significant problem for any applications that utilize or produce an AC current or magnetic field, such as an electric machine. The authors investigate the electromagnetic properties of high temperature superconductors with a particular focus on the AC loss in superconducting coils made from YBCO coated conductors for use in an all-superconducting electric machine. This paper presents an improved 2D finite element model for the cross-section of such coils, based on the H formulation. The model is used to calculate the transport AC loss of a racetrack-shaped coil using constant and magnetic field-dependent critical current densities, and the inclusion and exclusion of a magnetic substrate, as found in RABiTS (rolling-assisted biaxially textured substrate) YBCO coated conductors. The coil model is based on the superconducting stator coils used in the University of Cambridge EPEC Superconductivity Group's all-superconducting permanent magnet synchronous motor design. To validate the modeling results, the transport AC loss of a stator coil is measured using an electrical method based on inductive compensation by means of a variable mutual inductance. Finally, the implications of the findings on the performance of the motor are discussed.

  6. Hysteresis losses in MgB2 superconductors exposed to combinations of low AC and high DC magnetic fields and transport currents

    Highlights: • A method for calculating hysteresis losses in the low AC – high DC magnetic field and transport current range has been shown. • The method can be used in the design of wind turbine generators for calculating the losses in the generator DC rotor. • First estimates indicate tolerable current ripple in the 0.1% range for a 4 T DC MgB2 generator rotor coil. - Abstract: MgB2 superconductors are considered for generator field coils for direct drive wind turbine generators. In such coils, the losses generated by AC magnetic fields may generate excessive local heating and add to the thermal load, which must be removed by the cooling system. These losses must be evaluated in the design of the generator to ensure a sufficient overall efficiency. A major loss component is the hysteresis losses in the superconductor itself. In the high DC – low AC current and magnetic field region experimental results still lack for MgB2 conductors. In this article we reason towards a simplified theoretical treatment of the hysteresis losses based on available models in the literature with the aim of setting the basis for estimation of the allowable magnetic fields and current ripples in superconducting generator coils intended for large wind turbine direct drive generators. The resulting equations use the DC in-field critical current, the geometry of the superconductor and the magnitude of the AC magnetic field component as parameters. This simplified approach can be valuable in the design of MgB2 DC coils in the 1–4 T range with low AC magnetic field and current ripples

  7. Superconducting-magnetic heterostructures: a method of decreasing AC losses and improving critical current density in multifilamentary conductors.

    Glowacki, B A; Majoros, M

    2009-06-24

    Magnetic materials can help to improve the performance of practical superconductors on the macroscale/microscale as magnetic diverters and also on the nanoscale as effective pinning centres. It has been established by numerical modelling that magnetic shielding of the filaments reduces AC losses in self-field conditions due to decoupling of the filaments and, at the same time, it increases the critical current of the composite. This effect is especially beneficial for coated conductors, in which the anisotropic properties of the superconductor are amplified by the conductor architecture. However, ferromagnetic coatings are often chemically incompatible with YBa(2)Cu(3)O(7) and (Pb,Bi)(2)Sr(2)Ca(2)Cu(3)O(9) conductors, and buffer layers have to be used. In contrast, in MgB(2) conductors an iron matrix may remain in direct contact with the superconducting core. The application of superconducting-magnetic heterostructures requires consideration of the thermal and electromagnetic stability of the superconducting materials used. On one hand, magnetic materials reduce the critical current gradient across the individual filaments but, on the other hand, they often reduce the thermal conductivity between the superconducting core and the cryogen, which may cause destruction of the conductor in the event of thermal instability. A possible nanoscale method of improving the critical current density of superconducting conductors is the introduction of sub-micron magnetic pinning centres. However, the volumetric density and chemical compatibility of magnetic inclusions has to be controlled to avoid suppression of the superconducting properties. PMID:21828430

  8. Loss Prediction and Thermal Analysis of Surface-Mounted Brushless AC PM Machines for Electric Vehicle Application Considering Driving Duty Cycle

    Tianxun Chen

    2016-01-01

    Full Text Available This paper presents a computationally efficient loss prediction procedure and thermal analysis of surface-mounted brushless AC permanent magnet (PM machine considering the UDDS driving duty cycle by using a lumped parameters’ thermal model. The accurate prediction of loss and its variation with load are essential for thermal analysis. Employing finite element analysis (FEA to determine loss at every load point would be computationally intensive. Here, the finite element analysis and/or experiment based computationally efficient winding copper and iron loss and permanent magnet (PM power loss models are employed to calculate the electromagnetic loss at every operation point, respectively. Then, the lumped parameter thermal method is used to analyse the thermal behaviour of the driving PM machine. Experiments have been carried out to measure the temperature distribution in a motor prototype. The calculation and experiment results are compared and discussed.

  9. Hysteresis losses in MgB2 superconductors exposed to combinations of low AC and high DC magnetic fields and transport currents

    Magnusson, N.; Abrahamsen, Asger Bech; Liu, Dawei;

    2014-01-01

    MgB2 superconductors are considered for generator field coils for direct drive wind turbine generators. In such coils, the losses generated by AC magnetic fields may generate excessive local heating and add to the thermal load, which must be removed by the cooling system. These losses must be...... simplified theoretical treatment of the hysteresis losses based on available models in the literature with the aim of setting the basis for estimation of the allowable magnetic fields and current ripples in superconducting generator coils intended for large wind turbine direct drive generators. The resulting...

  10. AC Losses of High Temperature Superconducting Tapes and Coils%高温超导带材及线圈的交流损耗

    张国民; 林良真

    2006-01-01

    将描述超导体各向异性的有效质量理论,即各向异性Ginzburg-Landau理论(G-L理论),与临界态模型(CS模型)相结合,建立了高温超导带材的交流损耗与临界电流的各向异性理论模型;利用不可逆应变的定义,给出了临界电流与应变的关系,并利用临界电流与应变的关系及Norris方程,导出了高温超导带材的交流损耗与应变的关系;利用所建立的交流损耗与临界电流的各向异性理论公式,建立了依据超导短样带材的特性(临界电流,交流损耗),计算高温超导线圈交流损耗的数值计算模型.%Anisotropic theoretical models of critical current and AC loss of high temperature superconducting (HTS) tape in both DC and AC background fields were established based on the effective mass theory (the anisotropy Ginzburg--Landau theory) and the critical state model (CS model). A formula to describe the relationship between critical current and stress/strain was proposed by using the definition of irreversible strain. The relation between AC loss and stress/strain was developed based on the critical current-strain relation and Norris' formula. A numerical model to calculate AC loss of HTS coil was developed from the anisotropy theory of AC loss and critical current of short sample.

  11. Voltage-probe-position dependence and magnetic-flux contribution to the measured voltage in AC transport measurements: which measuring circuit determines the real losses?

    The voltage Vab measured between two voltage taps a and b during magnetic flux transport in a type-II superconductor carrying current I is the sum of two contributions, the line integral from a to b of the electric field along an arbitrary path Cs through the superconductor and a term proportional to the time rate of change of magnetic flux through the area bounded by the path Cs and the measuring circuit leads. When the current I(t) is oscillating with time t, the apparent AC loss (the time average of the product IVab) depends upon the measuring circuit used. Only when the measuring-circuit leads are brought out far from the surface does the apparent power dissipation approach the real (or true) AC loss associated with the length of sample probed. Calculations showing comparisons between the apparent and real AC losses in a flat strip of rectangular cross section will be presented, showing the behavior as a function of the measuring-circuit, dimensions. Corresponding calculations also are presented for a sample of elliptical cross section. (orig.)

  12. Voltage-probe-position dependence and magnetic-flux contribution to the measured voltage in ac transport measurements: which measuring circuit determines the real losses?

    The voltage Vab measured between two voltage taps a and b during magnetic flux transport in a type-II superconductor carrying current I is the sum of two contributions, the line integral from a to b of the electric field along an arbitrary path Cs through the superconductor and a term proportional to the time rate of change of magnetic flux through the area bounded by the path Cs and the measuring circuit leads. When the current I(t) is oscillating with time t, the apparent ac loss (the time average of the product IVab) depends upon the measuring circuit used. Only when the measuring-circuit leads are brought out far from the surface does the apparent power dissipation approach the real (or true) ac loss associated with the length of sample probed. Calculations showing comparisons between the apparent and real ac losses in a flat strip of rectangular cross section will be presented, showing the behavior as a function of the measuring-circuit dimensions. Corresponding calculations also are presented for a sample of elliptical cross section

  13. AC losses of mono- and multifilamentary high-Tc superconducting (Bi,Pb)2Sr2Ca2Cu3O10/Ag tapes

    In this thesis the ac losses of high-temperature superconductors (HTSC) were measured and analyzed by means of model calculations. The investigated silver sheathed Mono- and Multifilamentary tapes are based on the HTSC material (Bi,Pb)2Sr2Ca2Cu3O10 (Bi-2223/Ag). The losses were investigated in externally applied magnetic field changes as well as in the self-field of a transport current at temperatures of 4.2 K and 77 K. A detailed knowledge of the ac loss dependence on frequency and amplitude of these tapes is important for future transformer or magnet applications. While measuring the amplitude dependence we found - depending on the sample - a strong influence of the degree of the grain alignment (granularity) in the superconducting material upon the magnetization and hysteresis losses Qh. We could explain these effects which are not known in the technical relevant low-temperature superconductors by a superposition of the magnetic moments of the grain- and sample currents (intra- and intergranular screening currents). In the frame of this model we were able to divide the total measured losses into their inter-and intragranular contributions and we could quantitatively describe the losses of the grain and the sample system separately. The frequency dependence of the losses, depending on the extremely nonlinear voltage-current (E-j) characteristics of the high-temperature materials could be explained with a newly developed extension of the Critical State model. From the directly measured E-j relations we also calculated the internal current- and field distributions in the samples with the field change velocity B as a parameter. (author) figs., tabs., refs

  14. Comparison of AC losses, magnetic field/current distributions and critical currents of superconducting circular pancake coils and infinitely long stacks using coated conductors

    A model is presented for calculating the AC losses, magnetic field/current density distribution and critical currents of a circular superconducting pancake coil. The assumption is that the magnetic flux lines will lie parallel to the wide faces of tapes in the unpenetrated area of the coil. Instead of using an infinitely long stack to approximate the circular coil, this paper gives an exact circular coil model using elliptic integrals. A new efficient numerical method is introduced to yield more accurate and fast computation. The computation results are in good agreement with the assumptions. For a small value of the coil radius, there is an asymmetry along the coil radius direction. As the coil radius increases, this asymmetry will gradually decrease, and the AC losses and penetration depth will increase, but the critical current will decrease. We find that if the internal radius is equal to the winding thickness, the infinitely long stack approximation overestimates the loss by 10% and even if the internal radius is reduced to zero, the error is still only 60%. The infinitely long stack approximation is therefore adequate for most practical purposes. In addition, the comparison result shows that the infinitely long stack approximation saves computation time significantly.

  15. Comparison of AC losses, magnetic field/current distributions and critical currents of superconducting circular pancake coils and infinitely long stacks using coated conductors

    Yuan Weijia; Campbell, A M; Hong, Z; Ainslie, M D; Coombs, T A, E-mail: wy215@cam.ac.u [Electronic, Power and Energy Conversion Group, Electrical Engineering Division, Engineering Department, University of Cambridge, Cambridge CB3 0FA (United Kingdom)

    2010-08-15

    A model is presented for calculating the AC losses, magnetic field/current density distribution and critical currents of a circular superconducting pancake coil. The assumption is that the magnetic flux lines will lie parallel to the wide faces of tapes in the unpenetrated area of the coil. Instead of using an infinitely long stack to approximate the circular coil, this paper gives an exact circular coil model using elliptic integrals. A new efficient numerical method is introduced to yield more accurate and fast computation. The computation results are in good agreement with the assumptions. For a small value of the coil radius, there is an asymmetry along the coil radius direction. As the coil radius increases, this asymmetry will gradually decrease, and the AC losses and penetration depth will increase, but the critical current will decrease. We find that if the internal radius is equal to the winding thickness, the infinitely long stack approximation overestimates the loss by 10% and even if the internal radius is reduced to zero, the error is still only 60%. The infinitely long stack approximation is therefore adequate for most practical purposes. In addition, the comparison result shows that the infinitely long stack approximation saves computation time significantly.

  16. 高温超导YBCO薄膜中的传输交流损耗%TRANSPORT AC LOSSES IN THIN FILM OF YBCO

    赵玉峰; 何天虎; 冯旺军; 李世荣; 周又和

    2011-01-01

    基于Norris方程和Bean临界态模型,考虑薄膜超导体内的磁场和电流密度分布特性,通过解析求解的方法推导出薄膜超导体在传输外加电流时其内部的磁场和电流密度以及传输交流损耗的解析表达式,从定量的角度研究超导体截面几何形状对传输交流损耗的影响.结果表明薄膜超导体边缘处的剧烈变化的磁场和电流的分布以及无场区的电流承载能力是影响传输交流损耗的主要原因.%Based on Norris equations and Bean model, by considering the characteristics of magnetic field and current density in thin film, the magnetic field and current density in thin film are analytically derived, as well as the transport ac losses. The effect of the geometry of thin film on the transport ac losses is studied quantitatively. The results indicate that the dramatic change of magnetic field and current density at edge of thin film and the current capacity of the field-free region are the main reasons which affect the transport ac losses of thin film.

  17. Very low field ac-response at the loss of long range magnetic order in amorphous Fe90Zr10

    Low temperature ac-susceptibility measurements over 5 decades of ac-field (0.08-8000 A/m) have been carried out on amorphous ribbons of Fe90Zr10 and Fe91Zr9. The authors find that at very low fields (0.8 to 24 A/m) ac-response measurements eliminate the influence of domain and domain wall motion, the well known Hopkinson peak effects, to reveal clearly the reentrant characteristics. With such studies a reentrant freezing temperature Taf is unambiguously revealed with an evident knee in χ'(T) and a corresponding well defined peak in χ double-prime(T). The latter is found to be independent of the applied field (0.8 to 8 A/m) while being weakly dependent on the frequency (10--1,000 Hz). They thus find Tsf to be 25 K and 40 K respectively for Fe90Zr10 and Fe91Zr9 amorphous ribbons

  18. One-region model predicting water temperature and level in a spent fuel pit during loss of all AC power supplies

    A prediction system with a one-region model was developed to predict water temperature in a spent fuel pit (SFP) after the shutdown of its cooling systems based on three-dimensional (3D) thermal hydraulic behavior calculated by using the CFD software, FLUENT 6.3.26. The system was extended to calculate the water level in the SFP during loss of all AC power supplies. In the prediction system, decay heat calculated by using the burn-up calculation software, ORIGEN 2.2, and the previously proposed correlation for evaporation heat fluxes from the water surface to air were used. Predicted results were compared with 3D calculations and measured temperatures for the shutdown of cooling systems and with the water temperature and level measured in SFPs at the Fukushima Daiichi Nuclear Power Station for loss of all AC power supplies. As a result, the predicted temperatures were found to agree well with the 3D calculations and it was confirmed that ORIGEN 2.2 well predicted decay heat for fuel assemblies with large decay heat which had been taken relatively recently from the shutdown reactor core. However, it was shown that decay heat predicted by ORIGEN 2.2 was overestimated for longtime cooled fuel assemblies with small decay heat and the previously proposed evaporation heat flux correlation overestimated the water temperature in the SFP, too. (author)

  19. Scaling law and general expression for transport ac loss of a rectangular thin strip with power-law E(J) relation

    Chen, Du-Xing; Li, Shuo; Fang, Jin

    2015-12-01

    Transport ac loss Q of a superconducting rectangular thin strip obeying a power-law relation E∝Jn as a function of current amplitude Im may be, following Norris, expressed by normalized quantities as q(im). A scaling law is deduced that if Icf, Ic and f being the critical current and frequency, is multiplied by a positive constant C, then im and qm are multiplied by C 1 /(n - 1)and C 2 /(n - 1) , respectively. Based on this scaling law and the well-known Norris formula, the general function of q(im, n, f) is obtained graphically or analytically for any practical purpose, after accurate numerical computations on a set of q(im) at several values of n and a fixed value of f.

  20. New approach to the ac loss measurement in the superconducting secondary circuit of an iron-core transformer

    We have developed a transformer technique to supply currents over 500 A into a tape from a high-temperature superconductor (HTS). The superconducting tape under test could form either the whole or a part of the secondary circuit winding. The ferromagnetic core, as well as the copper primary, is immersed in an LN2 bath. This results in a simple and compact design of the whole system. Our approach to the loss determination is based on the fact that the voltage on the entire secondary circuit can be easily registered with the help of a loop embracing the transformer core. In practice, it will also contain the signal from a resistive part of the secondary circuit (joint). We show how this voltage can be subtracted to obtain the pure superconductor loss signal. In our method, the problem of correctly placing the voltage signal wires in the vicinity of the superconducting object, carrying transport current, is avoided. This could be of substantial advantage in the case when the loss of a HTS object that is more complicated than the single tape (e.g. superconducting cable or coil) needs to be measured. (author)

  1. Results of intercomparison test of the critical current and AC loss measurement on superconducting strands for the ITER coil

    Round robin tests of critical and hysteresis loss measurement on superconducting strands were carried out by JAERI and Japanese company-laboratories. The test samples are a (Nb, Ti)3Sn strand for the ITER CS model coil and a Nb-Ti reference strand. The testing condition and evaluation method are based upon ITER-EDA standard. Participant company-laboratories in round robin test program are Hitachi Cable, Furukawa electric, Sumitomo electric industries, Showa electric wire and cable, Mitsubishi electric, Kobe steel, From the test results, the coefficient of variation of critical currents at 12 T in (Nb, Ti)3Sn strand was 4.5% and at 9 T in NbTi strand was 1.7%, and the coefficient of variations of hysteresis loss at ± 3 T in both (Nb, Ti)3Sn and NbTi strands were 15%. Status of critical current and hysteresis loss measurement on superconducting strands in Japanese laboratories was recognized through the round robin test. (author)

  2. Loss of vital ac power and the residual heat removal system during mid-loop operations at Vogtle Unit 1 on March 20, 1990

    On March 20, 1990, the Vogtle Electric Generating Plant Unit 1, located in Burke County, Georgia, about 25 miles southeast of Augusta, experienced a loss of all safety (vital) ac power. The plant was in cold shutdown with reactor coolant level lowered to ''mid-loop'' for various maintenance tasks. Both the containment building personnel hatch and equipment hatch were open. One emergency diesel generator and one reserve auxiliary transformer were out of service for maintenance, with the remaining reserve auxiliary transformer supplying both Unit 1 safety buses. A truck in the low voltage switchyard backed into the support column for an offsite power feed to the reserve auxiliary transformer which was supplying safety power. The insulator broke, a phase-to-ground fault occurred, and the feeder circuit breakers for the safety buses opened. The operable emergency diesel generator started automatically because of the undervoltage condition on the safety bus, but tripped off after about 1 minute. About 20 minutes later the diesel generator load sequencer was reset, causing the diesel generator to start a second time. The diesel generator operated for about 1 minute, and tripped off. The diesel generator was restarted in the manual emergency mode 36 minutes after the loss of power. The generator remained on line and provided power to its safety bus. During the 36 minutes without safety bus power, the reactor coolant system temperature rose from about 90 degree F to 136 degree F. This report documents the results of an Incident Investigation Team sent to Vogtle by the Executive Director for Operations of the US Nuclear Regulatory Commission to determine what happened, identify the probable causes, and make appropriate findings and conclusions. 79 figs., 16 tabs

  3. 分磁环对高温SMES磁体交流损耗的影响研究%The effect of flux diverters on AC losses of HTS solenoid magnet

    宋萌; 徐颖; 曹昆南; 王达达; 任丽; 何杰; 苏路顺; 王作帅; 孙黄迪

    2013-01-01

    高温SMES磁体的交流损耗是制约其投入实际应用的因素之一,交流损耗的大小与超导导线所承受的磁场位型关系紧密,加装分磁环是改变超导磁体磁场位型的手段之一,因此对交流损耗的抑制也有实际意义.文中对高温SMES螺线管磁体进行了有限元建模,阐述了分磁环对减小超导磁体交流损耗的原理,分别计算了超导磁体在加装分磁环与未装分磁环下交流损耗的大小、分布,分析了分磁环的降损率参数r随磁体电流的变化规律,并对提高分磁环降损率的关键问题进行了探讨.%The AC loss of HTS solenoid magnet is one of the factors that limits its practical application.The value of AC loss is closely associated with the magnet field type of superconducting wires bear,so as a means of changing the magnet field type,flux diverter would also share a practical significance in reducing AC loss.This article conducted the finite element modeling of HTS solenoid magnet,elaborated the principles in reducing the AC loss of superconducting magnet by flux diverters,calculated the magnitude and distribution of AC loss separately with flux diverters and without flux diverters,and the loss reduction rate r of flux diverters was analyzed.Along with the change of magnet current,the key problems to improve the loss reduction rate of flux diverters were discussed.

  4. Combined loss of primary and secondary coolant AC pump power design-basis event for the K-reactor safety analysis report

    The combined loss of alternating-current (ac) power to the primary coolant and secondary coolant system pumps has been included as a design-basis event in Chap. 15 of the safety analysis report for the K reactor at the U.S. Department of Energy's Savannah River site (SRS) nuclear materials production complex near Aiken, South Carolina. This event can arise from a disruption of the entire 115-kV SRS power grid or a lesser disturbance affecting the K-reactor area, combined with a failure of the standby emergency power sources. The first scenario is referred to as a open-quotes station blackout,close quotes and the second scenario is designated as a open-quotes mini-blackout.close quotes This is a condition-11 event (incident of moderate frequency) per the criterion (frequency of occurrence ≥ 1 x 10-6 per year) for credible eventualities in the design-basis envelope. The event causes the primary coolant flow to drop and stabilize at ∼27% of its full level (5.83 + 05 ell/min). Likewise, the secondary coolant flow drops and settles also at ∼27% of its full level (6.36 x 105 ell/min). The final primary coolant flow is maintained by the reduced pumping provided by diesel powered direct-current motors. The final secondary coolant flow is driven by gravity from the height differential between the supply and discharge basins. Both flows coast down gradually due to the action of flywheels in all of the six primary coolant pumps and in two of the ten secondary coolant pumps

  5. 不同排列下高温超导带材交流损耗的仿真计算%Calculation of AC loss in high temperature superconducting tapes under different arrangements

    堵益高; 马勇虎; 沈锦飞

    2013-01-01

    交流损耗的数值计算对于高温超导带材具有重要的现实意义.应用有限元软件模拟仿真超导体部分计算求出不同排列下的交流损耗,与实验结果以及Norris公式的计算结果相比较,得到的仿真结果符合较好.结果说明圆筒形的排列能够有效地减少交流损耗.%The calculation of AC loss in high temperature superconducting tapes has great realistic meaning.This finite element software was used to calculate AC loss under different arrangements through simulating superconductor tapes.The calculation results were in good agreements with the experimental result and the Norris equation.The results show that the AC loss depending on the cylindrical arrangements can be effectively reduced.

  6. Global loss of a nuclear lamina component, lamin A/C, and LINC complex components SUN1, SUN2, and nesprin-2 in breast cancer

    Cancer cells exhibit a variety of features indicative of atypical nuclei. However, the molecular mechanisms underlying these phenomena remain to be elucidated. The linker of nucleoskeleton and cytoskeleton (LINC) complex, a nuclear envelope protein complex consisting mainly of the SUN and nesprin proteins, connects nuclear lamina and cytoskeletal filaments and helps to regulate the size and shape of the nucleus. Using immunohistology, we found that a nuclear lamina component, lamin A/C and all of the investigated LINC complex components, SUN1, SUN2, and nesprin-2, were downregulated in human breast cancer tissues. In the majority of cases, we observed lower expression levels of these analytes in samples' cancerous regions as compared to their cancer-associated noncancerous regions (in cancerous regions, percentage of tissue samples exhibiting low protein expression: lamin A/C, 85% [n = 73]; SUN1, 88% [n = 43]; SUN2, 74% [n = 43]; and nesprin-2, 79% [n = 53]). Statistical analysis showed that the frequencies of recurrence and HER2 expression were negatively correlated with lamin A/C expression (P < 0.05), and intrinsic subtype and ki-67 level were associated with nesprin-2 expression (P < 0.05). In addition, combinatorial analysis using the above four parameters showed that all patients exhibited reduced expression of at least one of four components despite the tumor's pathological classification. Furthermore, several cultured breast cancer cell lines expressed less SUN1, SUN2, nesprin-2 mRNA, and lamin A/C compared to noncancerous mammary gland cells. Together, these results suggest that the strongly reduced expression of LINC complex and nuclear lamina components may play fundamental pathological functions in breast cancer progression

  7. Studies of superspin glass state and AC-losses in La{sub 0.7}Sr{sub 0.3}MnO{sub 3} nanoparticles obtained by high-energy ball-milling

    Phong, P.T., E-mail: ptphong.nh@khanhhoa.edu.vn [Department of Advanced Materials Chemistry, Dongguk University-Gyeongju, 707 Suckjang-dong, Gyeongbuk, Gyeongju-Si 780-714 (Korea, Republic of); Nha Trang Pedagogic College, 1 Nguyen Chanh Street, Khanh Hoa Province, Nha Trang City (Viet Nam); Manh, D.H. [Institute of Materials Science, Vietnam Academy of Science and Technology, 18 Hoang Quoc Viet Road, Cau Giay District, Ha Noi City (Viet Nam); Nguyen, L.H. [Nha Trang Pedagogic College, 1 Nguyen Chanh Street, Khanh Hoa Province, Nha Trang City (Viet Nam); Institute of Materials Science, Vietnam Academy of Science and Technology, 18 Hoang Quoc Viet Road, Cau Giay District, Ha Noi City (Viet Nam); Tung, D.K. [Institute of Materials Science, Vietnam Academy of Science and Technology, 18 Hoang Quoc Viet Road, Cau Giay District, Ha Noi City (Viet Nam); Phuc, N.X., E-mail: phucnx1949@gmail.com [Nha Trang Pedagogic College, 1 Nguyen Chanh Street, Khanh Hoa Province, Nha Trang City (Viet Nam); Lee, I.-J., E-mail: lij@dongguk.ac.kr [Department of Advanced Materials Chemistry, Dongguk University-Gyeongju, 707 Suckjang-dong, Gyeongbuk, Gyeongju-Si 780-714 (Korea, Republic of)

    2014-11-15

    Single-phase perovskite compound La{sub 0.7}Sr{sub 0.3}MnO{sub 3} was synthesized by a high-energy ball milling method. Nanoparticle nature of this manganite with the average particle diameter of 11 nm was revealed from structure and morphology characterizations. The results of ac magnetic susceptibility measurements show that the system can be described as an ensemble of interacting magnetic nanoparticles, which indicates that the dipole–dipole interactions are strong enough to create superspin glass state in the sample. Furthermore, the specific loss power which is exhausted on the irradiation of an ensemble of particles with a magnetic field has been calculated and measured experimentally. - Highlights: • LSMO nanopowder was prepared by the high-energy ball-milling method. • The superspin glass state of LSMO nanopowder was studied. • The SLP has been calculated and measured experimentally.

  8. Studies of superspin glass state and AC-losses in La0.7Sr0.3MnO3 nanoparticles obtained by high-energy ball-milling

    Single-phase perovskite compound La0.7Sr0.3MnO3 was synthesized by a high-energy ball milling method. Nanoparticle nature of this manganite with the average particle diameter of 11 nm was revealed from structure and morphology characterizations. The results of ac magnetic susceptibility measurements show that the system can be described as an ensemble of interacting magnetic nanoparticles, which indicates that the dipole–dipole interactions are strong enough to create superspin glass state in the sample. Furthermore, the specific loss power which is exhausted on the irradiation of an ensemble of particles with a magnetic field has been calculated and measured experimentally. - Highlights: • LSMO nanopowder was prepared by the high-energy ball-milling method. • The superspin glass state of LSMO nanopowder was studied. • The SLP has been calculated and measured experimentally

  9. Reliable fabrication process for long-length multi-filamentary coated conductors by a laser scribing method for reduction of AC loss

    We have developed a reliable fabrication process based on a laser scribing method for multi-filamentary coated conductors with a low alternating current loss. This process consists of shallow laser irradiation and two-step chemical etching. The shallow laser irradiation, which penetrates into only a masking polymer tape and a silver stabilizing layer, suppresses generation of dross that is formed due to melting and hardening of a metal substrate. The two-step chemical etching individually for the stabilizing and the superconducting layers prevents over-etching of the superconducting layer and thus suppresses degradation of the critical current (Ic). By using the developed laser scribing process, we realized an improvement of processing speed and a reduction of Ic degradation at the same time. Subsequently, we developed reel-to-reel equipment to apply this process to coated conductors several hundred meters long. We succeeded in fabricating 280 m and 70 m long coated conductors with 5 mm width divided into three and five filaments, respectively. It was confirmed that they had one-third and one-fifth hysteresis loss, respectively, in comparison with that before processing, and high inter-filament resistance, over 0.1 MΩ cm. The typical degradation rates of Ic in the developed laser scribing process were less than 20%. (paper)

  10. Development and mass production of bronze-processed Nb3Sn strand with low AC loss and high critical-current density for the ITER

    The development work and mass production of high-performance bronze-processed Nb3Sn superconducting strands for the ITER pulse coils were performed. Using fine hexagonal single-core rods, the undesirable deformation of filament shape was drastically improved and uniform filament-spacing was obtained. As the result, Nb3Sn strand having a bronze/Nb ratio of 2.3 and filament diameter of 3.0 μm showed a very high non-Cu Jc of 667 A/mm2 at 12 T and 4.2 K without external strain. Sufficient low hysteresis loss of 88.2 mJ/cm3 at ±3 T was also observed. These results fully satisfy ITER specifications. The maximum piece length reached 18.9 km, while average piece length was 8.5 km, thus proving excellent workability. By applying the developed technology, mass production of 1,280 km in total was successfully completed. This means that the mass-production technology for the high-performance Nb3Sn superconducting strand of the ITER was established; thus clearing the way for construction of the reactor. (author)

  11. Energy saving in ac generators

    Nola, F. J.

    1980-01-01

    Circuit cuts no-load losses, without sacrificing full-load power. Phase-contro circuit includes gate-controlled semiconductor switch that cuts off applied voltage for most of ac cycle if generator idling. Switch "on" time increases when generator is in operation.

  12. ACAC Converters for UPS

    Rusalin Lucian R. Păun

    2008-05-01

    Full Text Available This paper propose a new control technique forsingle – phase ACAC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.

  13. AC power supply systems

    An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)

  14. AcEST: DK950971 [AcEST

    Full Text Available optera acutorost... 37 0.66 tr|B1ACS6|B1ACS6_BALBN DMP1 (Fragment) OS=Balaenoptera ...bonaerens... 37 0.66 tr|B1ACS5|B1ACS5_BALED DMP1 (Fragment) OS=Balaenoptera edeni... GN=... 37 0.66 tr|B1ACS4|B1ACS4_BALBO DMP1 (Fragment) OS=Balaenoptera borealis ... 37 0.66 tr|B1ACS3|B1ACS3..._BALMU DMP1 (Fragment) OS=Balaenoptera musculus ... 37 0.86 tr|B1ACS1|B1ACS1_MEGNO DMP1 (Fragment) OS=Megapt...1ACS2_BALPH DMP1 (Fragment) OS=Balaenoptera physalus ... 37 1.1 tr|B1ACT6|B1ACT6_MESPE DMP1 (Fragment) OS=Me

  15. Loss comparison of different nine-switch and twelve-switch energy conversion systems

    Bahman, Amir Sajjad; Loh, Poh Chiang; Qin, Zian;

    2014-01-01

    answer only available after performing a thorough analysis. For that, it is the intention now to compare the nine-switch and twelve-switch converters when they are used in ac-ac, ac-dc, dc-ac or dc-dc energy conversion systems. Their losses will be compared to identify when the nine-switch converter will...

  16. AC1 Wing

    Adrian DOBRE

    2010-03-01

    Full Text Available The AC1 wing replaces the old wing of the wind tunnel model AEROTAXI, which has been made at scale 1:9. The new wing is part of CESAR program and improves the aerodynamic characteristics of the old one. The geometry of the whole wing was given by FOI Sweden and position of AC1 wing must coincide with the structure of the AEROTAXI model.

  17. AC1 Wing

    Adrian DOBRE

    2010-01-01

    The AC1 wing replaces the old wing of the wind tunnel model AEROTAXI, which has been made at scale 1:9. The new wing is part of CESAR program and improves the aerodynamic characteristics of the old one. The geometry of the whole wing was given by FOI Sweden and position of AC1 wing must coincide with the structure of the AEROTAXI model.

  18. Heat Transfer Analysis for Industrial AC Electric Arc Furnace

    (U)nal (C)amdali; Murat Tun(c)

    2005-01-01

    The heat transfer analysis was performed for an AC electric arc furnace (EAF). Heat losses by conduction, convection and radiation from outer surface, roof, bottom and electrodes of EAF were determined in detail. Some suggestions about decreasing heat losses were presented.

  19. Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count

    Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin;

    2009-01-01

    This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low-cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled to...... semiconductor commutations, and hence, no increase in switching losses. The proposed converter therefore offers a low-cost alternative to applications that need to ride through frequent input voltage sags. For confirming the converter performance, experimental testing using a constructed laboratory prototype is...

  20. ac bidirectional motor controller

    Schreiner, K.

    1988-01-01

    Test data are presented and the design of a high-efficiency motor/generator controller at NASA-Lewis for use with the Space Station power system testbed is described. The bidirectional motor driver is a 20 kHz to variable frequency three-phase ac converter that operates from the high-frequency ac bus being designed for the Space Station. A zero-voltage-switching pulse-density-modulation technique is used in the converter to shape the low-frequency output waveform.

  1. AC/RF Superconductivity

    Ciovati, G.

    2015-01-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  2. AC/RF Superconductivity

    Ciovati, Gianluigi [JLAB

    2015-02-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  3. Transport current losses in Bi2223 high temperature superconductors

    Bi2223 high temperature superconductor (HTS) tapes are expected to be used in power industry such as fault current limiter, transformer, magnets, transmission cables. For most of applications of Bi2223 tapes, the superconductor will transport ac current and/or be exposed to applied magnetic field. AC loss is one of important parameters to evaluate the economic feasibility of HTS ceramic superconductors in those applications. Extensive investigations have been done to understand the mechanism of generation of AC loss and minimize it. In this study, AC losses in Bi2223 (HTS) tapes were measured at 77 K. The effects of different factors, such as, current distribution, heat recycling, transport current wave and applied DC magnetic field, were investigated on the AC losses in Bi2223 HTS tapes. Possible explanations were presented in the paper

  4. Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition

    The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity

  5. Hermetisk AC-Krets

    Hirsch, Carl; Smirnoff, Alexander

    2007-01-01

    Under sex månader våren 2007 har ett samarbete mellan Volvo Lastvagnar och två studenter från KTH, inriktning Integrerad produktutveckling vid institutionen för maskinkonstruktion, pågått i form av ett examensarbete på 20 poäng. Dagens AC-system i Volvos lastbilar avger 20-40 g/år av köldmediet R134a som är en kraftfull växthusgas. Detta sker främst genom diffusion via slangar och tätningsmaterial. Syftet med detta examensarbete är att ta fram förslag på tekniska lösningar på ett nytt AC-syst...

  6. Low frequency ac conduction and dielectric relaxation in poly(N-methyl pyrrole)

    Amarjeet K Narula; Ramadhar Singh; Subhas Chandra

    2000-06-01

    The ac conductivity and dielectric constant of poly(N-methyl pyrrole) thin films have been investigated in the temperature range 77–350 K and in the frequency range 102–106 Hz. The well defined loss peaks have been observed in the temperature region where measured ac conductivity approaches dc conductivity. These loss peaks are associated with the hopping of the charge carriers. The frequency and temperature dependence of ac conductivity have been qualitatively explained by considering the contribution from two mechanisms; one giving a linear dependence of conductivity on frequency and other having distribution of relaxation times giving rise to broad dielectric loss peak.

  7. Hearing Loss

    ... labor & premature birth The newborn intensive care unit (NICU) Birth defects & other health conditions Loss & grief Tools & ... labor & premature birth The newborn intensive care unit (NICU) Birth defects & other health conditions Loss & grief Ask ...

  8. Modelling ac ripple currents in HTS coated conductors

    Xu, Zhihan; Grilli, Francesco

    2015-10-01

    Dc transmission using high temperature superconducting (HTS) coated conductors (CCs) offers a promising solution to the globally growing demand for effective, reliable and economic transmission of green energy up to the gigawatt level over very long distances. The credible estimation of the losses and thereby the heat dissipation involved, where ac ripples (introduced in rectification/ac-dc conversion) are viewed as a potential source of notable contribution, is highly essential for the rational design of practical HTS dc transmission cables and corresponding cryogenic systems to fulfil this demand. Here we report a targeted modelling study into the ac losses in a HTS CC subject to dc and ac ripple currents simultaneously, by solving Maxwell’s equations using the finite element method (FEM) in the commercial software package COMSOL. It is observed that the instantaneous loss exhibits only one peak per cycle in the HTS CC subject to sinusoidal ripples, given that the amplitude of the ac ripples is smaller than approximately 20% of that of the dc current. This is a distinct contrast to the usual observation of two peaks per cycle in a HTS CC subject to ac currents only. The unique mechanism is also revealed, which is directly associated with the finding that, around any local minima of the applied ac ripples, the critical state of -J c is never reached at the edges of the HTS CC, as it should be according to the Bean model. When running further into the longer term, it is discovered that the ac ripple loss of the HTS CC in full-wave rectification decays monotonically, at a speed which is found to be insensitive to the frequency of the applied ripples within our targeted situations, to a relatively low level of approximately 1.38 × 10-4 W m-1 in around 1.7 s. Comparison between this level and other typical loss contributions in a HTS dc cable implies that ac ripple currents in HTS CCs should only be considered as a minor source of dissipation in superconducting dc

  9. Loss and Inductance Investigation in Superconducting Cable Conductors

    Olsen, Søren Krüger; Tønnesen, Ole; Træholt, Chresten;

    1999-01-01

    the layers are therefore studied theoretically. The current distribution between the superconducting layers is monitored as a function of transport current, and the results are compared with the expected current distribution given by our electrical circuit model.The AC-losses are measured as a...... Hz) the AC-loss was measured on cable #2 to 0.6W/mxphase. This is, to our knowledge, the lowest AC-loss (at 2kA and 77K) of a high temperature superconducting cable conductor reported so far....

  10. Superconducting ac cable

    The components of a superconducting 110 kV ac cable for power ratings >= 2000 MVA have been developed. The cable design especially considered was of the semiflexible type, with a rigid cryogenic envelope and flexible hollow coaxial cable cores pulled into the former. The cable core consists of spirally wound Nb-Al composite wires and a HDPE-tape wrapped electrical insulation. A 35 m long single phase test cable with full load terminations for 110 kV and 10 kA was constructed and successfully tested. The results obtained prove the technical feasibility and capability of our cable design. (orig.)

  11. High performance AC drives

    Ahmad, Mukhtar

    2010-01-01

    This book presents a comprehensive view of high performance ac drives. It may be considered as both a text book for graduate students and as an up-to-date monograph. It may also be used by R & D professionals involved in the improvement of performance of drives in the industries. The book will also be beneficial to the researchers pursuing work on multiphase drives as well as sensorless and direct torque control of electric drives since up-to date references in these topics are provided. It will also provide few examples of modeling, analysis and control of electric drives using MATLAB/SIMULIN

  12. Superconductor films with improved flux pinning and reduced AC losses

    Goyal, Amit

    2011-04-05

    The present invention relates to a method for producing a defect-containing superconducting film, the method comprising (a) depositing a phase-separable layer epitaxially onto a biaxially-textured substrate, wherein the phase-separable layer includes at least two phase-separable components; (b) achieving nanoscale phase separation of the phase-separable layer such that a phase-separated layer including at least two phase-separated components is produced; and (c) depositing a superconducting film epitaxially onto said phase-separated components of the phase-separated layer such that nanoscale features of the phase-separated layer are propagated into the superconducting film.

  13. Calculation of AC losses in large HTS stacks and coils

    Zermeno, Victor; Abrahamsen, Asger Bech; Mijatovic, Nenad;

    2012-01-01

    substrate layers are reduced while keeping the overall electromagnetic behavior. Our work extends the anisotropic bulk model originally presented by Clem et al. and later refined by Prigozhin and Sokolovsky. We disregard assumptions upon the shape of the critical region and use a power law E-J relationship...

  14. Hidden loss

    Kieffer-Kristensen, Rikke; Johansen, Karen Lise Gaardsvig

    2013-01-01

    finding indicates that the children experienced numerous losses, many of which were often suppressed or neglected by the children to protect the ill parents. CONCLUSIONS: The findings indicated that the children seemed to make a special effort to hide their feelings of loss and grief in order to protect...

  15. Ac Hybrid Charge Controller

    Shalini S. Durgam

    2015-03-01

    Full Text Available One of the primary needs for socio-economic development in any nation in the world is the provision of reliable electricity supply systems with lower carbon footprint levels. The purpose of this work is the development of a hybrid Power system that harnesses the renewable energy in sun and electricity to generate electricity. The working model can able to run on dual mode- solar and electricity. It can also be driven independently either by solar or electricity. The battery can be charge from solar panel (40W or by power supply. The household single phase A.C. power supply of 230V is converted into 12V D.C. using step down transformer and rectifying circuit. The working model can achieve energy saving, low carbon emission, environmental protection for the upcoming future of human life.

  16. AcEST: BP920072 [AcEST

    Full Text Available YMU001_000132_F11 525 Adiantum capillus-veneris mRNA. clone: YMU001_000132_F11. BP920072 - Show ... YGMYGEGEKALETFADMEKSGIVPDSVVFIAII 617 Query: 139 NACSR SCLFHECHSYFEAMSTHHGIVPCLEHHSCVV 32 ACS S L E + FE M ... KLMTRDVVSWNTLIAGYAQVGQNEGLFCTFSDMLGQRVKPDLITFVIVLNACSR ... 125 VF+ + +D VSWN++I+GY Q G F M+ + D IT++++++ +R S ... YGVHGYGKKAIQIFEEMLANGASP 384 Query: 166 DLITFVIVLNACSR SCLFHECHSYFEAMSTHHGIVPCLEHHSCVV 32 +TFV VL ACS L E ... KLMTRDVVSWNTLIAGYAQVGQNEGLFCTFSDMLGQRVKPDLITFVIVLNACSR S 122 +VFDK R + WN L G E + + M V+ D T+ VL AC S Sbjc ...

  17. Memory loss

    A person with memory loss needs a lot of support. It helps to show the person familiar objects, music, or and photos or play familiar music. Write down when the person should take any medicine or do other ...

  18. Parametric study on coupling loss in subsize ITER Nb3Sn cabled specimen

    Nijhuis, Arend; Kate, ten, F.J.W.; Bruzzone, Pierluigi; Bottura, Luca

    1996-01-01

    The cable in conduit conductors for the various ITER coils are required to function under pulse conditions and fields up to 13 T. A parametric study, restricted to a limited variation of the reference cable lay out, is carried out to clarify the quantitative impact of various cable parameters on the coupling loss and to find realistic values for the coupling loss time constants to be used in ac loss computations. The investigations cover ac coupling loss measurements on jacketed sub- and full...

  19. AcEST: DK950147 [AcEST

    Full Text Available TST38A01NGRL0007_O05 706 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0007_O05. 5' end seq ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... OS=Medicago truncatula GN=MtrDRAFT_AC149576g3v2 PE ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... (Fragment) OS=Medicago truncatula GN=MtrDRAFT_AC14 ...

  20. AcEST: DK959344 [AcEST

    Full Text Available TST39A01NGRL0004_G23 714 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0004_G23. 5' end seq ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... OS=Medicago truncatula GN=MtrDRAFT_AC149576g3v2 PE ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... (Fragment) OS=Medicago truncatula GN=MtrDRAFT_AC14 ...

  1. AcEST: DK949716 [AcEST

    Full Text Available TST38A01NGRL0006_L20 613 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0006_L20. 5' end seq ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... OS=Medicago truncatula GN=MtrDRAFT_AC149576g3v2 PE ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... (Fragment) OS=Medicago truncatula GN=MtrDRAFT_AC14 ...

  2. AcEST: BP920905 [AcEST

    Full Text Available EM + + D ++S L AC Sbjct: 374 NSAYKLFERMPKKNVVAWNAIISGYSQHGHPHEALALFIEMQAQGIKPDSFAIVSVLPAC 433 Query: 71 SHSSTLNDGKLIHFYILMNNFE...EM++ ++ + V + S L +C Sbjct: 255 SSERIFEKIAKKNAVSWTAMISSYNRGEFSEKALRSFSEMIKSGIEPNLVTLYSVLSSCG 314 Query: 68 HSSTLNDGKLIHFYILMNNFE...VVVMSCLKACS 69 ++ +F RRD VTW A+I GYA HG E A+ LF+ M+ EN+ + V +S L+AC+ Sbjct: 656 DSRLMFEKSLRRDFVTWNAMICGYAHHGKGEEAIQLFERMILEN...ELEKMHNKRLQEMCVSWNSIISGYVMKEQSEDAQMLFTRMME 596 Query: 122 ENVDTDGVVVMSCLKACSHSSTLNDGKLIHFYILMNNFE ...FCEADT-NVITWNAMIASYVHCEQSEKAIALFDRMVSENFKPSSITLVTLLMAC 543 Query: 71 SHSSTLNDGKLIHFYILMNNFEL 3 ++ +L G++

  3. Induction Motor Control through AC/DC/AC Converters

    Elfadili, Abderrahim; Giri, Fouad; Ouadi, Hamid; El Magri, Abdelmounime; Dugard, Luc; Abouloifa, Abdelmajid

    2010-01-01

    We consider the problem of controlling inductions motors driven through AC/DC rectifiers and DC/AC inverters. The control objectives are threefold: (i) forcing the motor speed to track a reference signal, (ii) regulating the DC Link voltage, (iii) assuring a satisfactory power factor correction (PFC) with respect to the power supply net. First, a nonlinear model of the whole controlled system is developed in the Park-coordinates. Then, a nonlinear multi-loop controller is synthesized using th...

  4. AC drives for industrial plants. Plant kudoyo AC drive sochi

    Miyazaki, M.; Shibata, M.; Yamada, S. (Toshiba Corp., Tokyo (Japan))

    1992-08-01

    Features and product series of AC drives for industrial plants were outlined. Configurations and features of various types of AC drives were briefly discussed which are put into market to meet various requirements for industrial plants and wide ranges of output voltage and capacity. The following product series were outlined; the power bipolar transistor inverter for 3.5-600 kVA in output capacity, IGBT inverter for AC 400 V in output voltage and 1,000 kVA or less, GTO inverter for AC 600 V and 700-2,000 kVA, and cycloconverter for AC 1,000-3,000 V and 1,000 kW-20 MW. The following subjects were outlined as current technical trends of AC drives for industrial plants; increasing in capacity of voltage-source PWM inverters, downsizing of converters through highly efficient cooling and highly dense mounting, spreading of sensorless vector controls, and development of high-voltage large-capacity PWM inverters. 6 figs., 2 tabs.

  5. Neural network based PWM AC chopper fed induction motor drive

    Venkatesan Jamuna

    2009-01-01

    Full Text Available In this paper, a new Simulink model for a neural network controlled PWM AC chopper fed single phase induction motor is proposed. Closed loop speed control is achieved using a neural network controller. To maintain a constant fluid flow with a variation in pressure head, drives like fan and pump are operated with closed loop speed control. The need to improve the quality and reliability of the drive circuit has increased because of the growing demand for improving the performance of motor drives. With the increased availability of MOSFET's and IGBT's, PWM converters can be used efficiently in low and medium power applications. From the simulation studies, it is seen that the PWM AC chopper has a better harmonic spectrum and lesser copper loss than the Phase controlled AC chopper. It is observed that the drive system with the proposed model produces better dynamic performance, reduced overshoot and fast transient response. .

  6. Flux-transfer losses in helically wound superconducting power cables

    Clem, John R; Malozemoff, A P

    2013-06-25

    Minimization of ac losses is essential for economic operation of high-temperature superconductor (HTS) ac power cables. A favorable configuration for the phase conductor of such cables has two counter-wound layers of HTS tape-shaped wires lying next to each other and helically wound around a flexible cylindrical former. However, if magnetic materials such as magnetic substrates of the tapes lie between the two layers, or if the winding pitch angles are not opposite and essentially equal in magnitude to each other, current distributes unequally between the two layers. Then, if at some point in the ac cycle the current of either of the two layers exceeds its critical current, a large ac loss arises from the transfer of flux between the two layers. A detailed review of the formalism, and its application to the case of paramagnetic substrates including the calculation of this flux-transfer loss, is presented.

  7. AcEST: BP915640 [AcEST

    Full Text Available YMU001_000074_A01 462 Adiantum capillus-veneris mRNA. clone: YMU001_000074_A01. BP915640 CL3685C ... y: 462 GPLILRACLVYMQGAPVGSLAEDGIVSAATGKDMEQSTVGFRLMLAKI IHRLIAAFKEVG 283 G IL+AC YM+G +GSL +D V ++VGF+LMLAK ... : 1032 GYYILKACDAYMKGYLIGSLTKDASVIDERSS-ANSTSVGFKLMLAKI APKLFSALSEVG 1090 Query: 282 AYCDAYE 262 A C+ ++ Sb ... uery: 453 ILRACLVYMQGAPVGSLAEDGIVSAATGKDMEQSTVGFRLMLAKI IHRLIAAFKEVGAYC 274 +L AC YM+G PVGS A G ST GF++ML+K ... ame = -1 Query: 423 GAPVGSLAEDGIVSAATGKDMEQSTVGFRLMLAKI I----HRLIAAFKEVGAYCD 271 G P+ L D +S GK + S RL + L+ ...

  8. AcEST: DK955197 [AcEST

    Full Text Available TST39A01NGRL0022_H07 532 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0022_H07. 5' end seq ... KDEVTALPLLK 192 Query: 194 RFAFGIACELLMSRYEKEEQEMLEEPF TTMMKGILQLPIKLPGTRFSKAIVAANMLRARF 373 R+ F +AC+L S ... KDEVMALPLLK 192 Query: 194 RFAFGIACELLMSRYEKEEQEMLEEPF TTMMKGILQLPIKLPGTRFSKAIVAANMLRARF 373 R+ F +AC+L S ... KDEVKVLP 189 Query: 185 LMKRFAFGIACELLMSRYEKEEQEMLEEPF TTMMKGILQLPIKLPGTRFSKAIVAANMLR 364 L++ F IA L + +Q+ ... KDEATVLP 177 Query: 185 LMKRFAFGIACELLMSRYEKEEQEMLEEPF TTMMKGILQLPIKLPGTRFSKAIVAANMLR 364 L+K F +A L E+ QE ...

  9. Speed Control of DC Motor using AC/AC/DC Converter Based on Intelligent Techniques

    Rakan Kh Antar

    2013-05-01

    Full Text Available    This paper describes the application of ac/ac/dc and ac/dc converters to control the speed of a separately excited DC motor. Artificial neural network and PI controller are trained to select the desired values of firing angles for triggering thyristors of the ac/ac/dc and ac/dc bridge converters in order to control the speed of the dc motor at a desired value with constant and different load torques in order to obtain the best speed response. Simulation results show that the rising time for ac/dc and ac/ac/dc converters at 250rpm are reduced about 79% and 89% respectively, while delay time it reduced about 69% and 64% respectively. Therefore, speed response of the dc motor is more efficient for closed loop system compared with open loop also the response of ac/ac/dc converter is better than ac/dc converter.

  10. Nuclear structure of $^{231}$Ac

    Boutami, R; Mach, H; Kurcewicz, W; Fraile, L M; Gulda, K; Aas, A J; García-Raffi, L M; Løvhøiden, G; Martínez, T; Rubio, B; Taín, J L; Tengblad, O

    2008-01-01

    The low-energy structure of 231Ac has been investigated by means of gamma ray spectroscopy following the beta-decay of 231Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a mini-orange electron spectrometer. The decay scheme of 231Ra --> 231Ac has been constructed for the first time. The Advanced Time Delayed beta-gamma-gamma(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

  11. Alternating current losses of a 10 metre long low loss superconducting cable conductor determined from phase sensitive measurements

    Olsen, Søren Krüger; Kühle (fratrådt), Anders Van Der Aa; Træholt, Chresten;

    1999-01-01

    The ac loss of a superconducting cable conductor carrying an ac current is small. Therefore the ratio between the inductive (out-of-phase) and the resistive (in-phase) voltages over the conductor is correspondingly high. In vectorial representations this results in phase angles between the current...... and the voltage over the cable close to 90 degrees. This has the effect that the loss cannot be derived directly using most commercial lock-in amplifiers due to their limited absolute accuracy. However, by using two lock-in amplifiers and an appropriate correction scheme the high relative accuracy of...... such lock-in amplifiers can be exploited. In this paper we present the results from ac-loss measurements on a low loss 10 metre long high temperature superconducting cable conductor using such a correction scheme. Measurements were carried out with and without a compensation circuit that could reduce...

  12. AcEST: BP920800 [AcEST

    Full Text Available DLNLALQVHSRMVRFGFNAEVEACGALINMYGKCGKVLYAQRVFDDT 298 Query: 206 RQQDVISWNDIISACAQRGHGTEALENFSQMLHEGIVPNSMTFTSVMQA---CNSIEGG...G L +A S F ++ +D+ISW +I +Q EA+ F Sbjct: 217 SEKNEATSNCLINGYMGLGNLEQAESLFNQMPVKDIISWTTMIKGYSQNKRYREAIAVFY 276 Query: 119 QMLHEG...EKAWRIFDGVSCKNLPSWNAIITGCVQGGLLEEAIDLYRHMK 281 Query: 110 HEGIVPNSMTFTSVMQAC---NSIEGGR 36 + + PN +T +V+ AC +...N IIS AQ G +EA+E ++ M Sbjct: 383 DITIGNAVVVMYAKLGLVDSARAVFNWLPNTDVISWNTIISGYAQNGFASEAIEMYNIME 442 Query: 110 HEG...EIDLGEQIHSLSVKTGFESDMYVSGVLIDMYSKYGWLEKARRVLEML 406 Query: 206 RQQDVISWNDIISACAQRGHGTEALENFSQMLHEGIVPNSMTFTSVMQACNSIEGG

  13. AcEST: DK945549 [AcEST

    Full Text Available AGGCGATTTCATCTTTTCTGAGAACCCTGATTTTGTGATTGTGTAATTACA ACTGTGGAACAGAAGGATGAGAAGTCTACTGACACAACAAGATATCTCTGGAGAGGAGA...A AATTGAGAAGGTTTGAGTTCTCAACAATGGGCTATGAGGCAATAATGGGAAGGCACCGAT TGTGGGCTTGTATAGGTTTTGAC...LCTG 239 L++R+LRR + + ++ G AC+ DP +P PLC+G Sbjct: 108 LQQRELRRKLLADSGALNTNSVNGPRNWKACVQQDPSSRPGTPLCSG 154 >sp|A6UUY8|RNZ_META3...49 Tissue type young leaves Developmental stage sporophyte Contig ID CL454Contig1 Sequence GATGAGCGA...CCACCTGTGCAACCGTCAGCGCCTTTGTGCACTGGTG CAATGTCCTGTGGTTACCTTGTTTGGAATCTTAATTGTTCTCATGTAT

  14. AcEST: BP917632 [AcEST

    Full Text Available YMU001_000103_D10 554 Adiantum capillus-veneris mRNA. clone: YMU001_000103_D10. BP917632 - Show ... YSKCKIHQKALELLVLML 154 Query: 466 KDSLEPDEVTYLNVLKACARE EDLKV 543 +D++ P+ TY +VL++C D+++ Sbjct: 155 RDNVRPN ... 185 Query: 415 GHSDSS--KEALKLLTQMRKDSLEPDEVTYLNVLKACARE EDLK 540 + EA KL +M+ ++ PDE+ N++ AC R +++ Sbjct: 18 ...

  15. AcEST: DK961189 [AcEST

    Full Text Available OS=A... 127 7e-29 sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS... 125 2e-28 sp|P00785|AC...IRNSWGLNWGDSGYVKLQRNIDDPFGKCGIAMMPSYP 347 >sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS=

  16. AcEST: DK946687 [AcEST

    Full Text Available YMU02A01NGRL0013_G11 544 Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0013_G11. 5' end seq ... + G P+ TY+ + AC+ E Sbjct: 97 YSFNYMIRGLTNTWN-------DHEA ---ALSLYRRMKFSGLKPDKFTYNFVFIACAKLE 146 Query: 214 A ... Sbjct: 71 LIPKAVELGDFNYSSFLFSVTEEPNHYSFNYMIRGLTNTWNDHEA ALSLYRRMKFSGLKP 130 Query: 469 DGATFSCVLRACGNVGALDV ...

  17. AcEST: DK949372 [AcEST

    Full Text Available TST38A01NGRL0005_N02 627 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0005_N02. 5' end seq ... 363 DQLREKTC-GVDKFDDIVMACXXXXXXXXXXXXXXXXXXKARVHAYGVCD DPEYFYDYVQ 539 Q++EK G+ FDDIV+AC KA+VHA+ VCD DP+YFYD ... 264 QQVQEKKVPGITFFDDIVVACGSGGSIAGLSLGSYLSNLKAKVHAFAVCD DPDYFYDYTQ 323 Query: 540 GLLDGMNANIASRDIVNVIDAKGLG ...

  18. Apuntes de Acústica

    Martín Domingo, Agustín

    2014-01-01

    Esta publicacion contiene unos apuntes para la parte de Acústica de las asignaturas de la ETSAM, junto con cierta cantidad de material adicional que excede el ámbito del curso. Aunque está lejos de ser completa y de estar libre de errores, el autor espera sea útil.

  19. SSTI Clark ACS Technology Demonstrations

    Freesland, Douglas

    1997-01-01

    SSTI Clark, one of two spacecraft built under NASA's Small Satellite Technology Initiative, includes seven ACS technology demonstrations. The technologies redefine the performance cost envelope, providing improved sensor and actuator performance at reduced costs. Six sensing technologies are being flown consisting of both hardware and algorithmic demonstrations: autonomous star tracker, hemispherical resonating gyro, GPS attitude determination, miniature horizon sensors, low cost course sun s...

  20. Evaluating conversion of AC power transmission lines to DC

    Edris, A. [EPRI, Palo Alto, CA (United States); Barthold, L. [IMod Inc., Lafayette, LA (United States); Douglass, D. [Power Delivery Consultants, Ballston Lake, NY (United States); Litzenberger, W. [Litzenberger Consultant (United States); Woodford, D. [Electranix, Winnipeg, MB (Canada)

    2008-07-01

    Conversion of alternating current (AC) transmission lines has been of significant interest for several years but has never been implemented to expand transmission line capacity or improve system security. This paper outlined the procedures necessary to identify and assess feasibility of specific AC to direct current (DC) conversion opportunities, with special focus on emerging DC transmission technologies. The paper outlined the process for investigating the conversion of an AC transmission line to DC. The investigation examined both bipole and tripole applications. A summary of the characteristics for alternative DC conversion configuration was presented. These characteristics included maximum transfer capability; redundancy; losses; overhead ratio; switching requirements; reactive power requirement; and accommodation of taps. The challenges and objectives of the project were also described. The paper provided a summary of the cost and benefit analysis for the various AC to DC conversion technologies for the Grand Coulee to Olympia transmission line. It was concluded that the project was particularly timely in that current work on the prospect of major North American system segmentation could benefit substantially, both technically and economically by having inter-system links take fuller advantage of the inherent DC capability of the circuits involved, thereby encouraging greater inter-regional energy exchange and providing the basis for lower energy supply costs. 12 refs., 2 tabs., 3 figs., 1 appendix.

  1. ac MH loop measurements on Mn doped YBa2Cu3O7– superconductors

    E Isaac Samuel; V Seshu Bai

    2006-06-01

    Isothermal ac MH (magnetization-field) loops for varying field amplitudes were recorded at 77 K on YBa2(Cu1–Mn)3O7– with = 0, 0.010, 0.015, 0.020, 0.025, 0.035 and 0.050, YBa2(Cu0.075Fe0.025)3O7–, YBa2(Cu0.075Ni0.025)3O7– and YBa2(Cu0.075Zn0.025)3O7– samples up to a maximum field amplitude of 80 Oe. Flat band susceptibility, ac losses and flux profiles were deduced from the ac MH loops. The undoped sample exhibited a minimum weak link ac loss and the 5.0% doped sample showed maximum weak link ac loss. Ni and Fe doped samples showed higher granular losses. cg estimated from the flux profiles decreases monotonically with increasing concentrations of Mn up to 2.5%.

  2. Development of an AC Module System: Final Technical Report

    Suparna Kadam; Miles Russell

    2012-06-15

    The GreenRay Inc. program focused on simplifying solar electricity and making it affordable and accessible to the mainstream population. This was accomplished by integrating a solar module, micro-inverter, mounting and monitoring into a reliable, 'plug and play' AC system for residential rooftops, offering the following advantages: (1) Reduced Cost: Reduction in installation labor with fewer components, faster mounting, faster wiring. (2) Maximized Energy Production: Each AC Module operates at its maximum, reducing overall losses from shading, mismatch, or module downtime. (3) Increased Safety. Electrical and fire safety experts agree that AC Modules have significant benefits, with no energized wiring or live connections during installation, maintenance or emergency conditions. (4) Simplified PV for a Broader Group of Installers. Dramatic simplification of design and installation of a solar power system, enabling faster and more efficient delivery of the product into the market through well-established, mainstream channels. This makes solar more accessible to the public. (5) Broadened the Rooftop Market: AC Modules enable solar for many homes that have shading, split roofs, or obstructions. In addition, due to the smaller building block size of 200W vs. 1000W, homeowners with budget limitations can start small and add to their systems over time. Through this DOE program GreenRay developed the all-in-one AC Module system with an integrated PV Module and microinverter, custom residential mounting and performance monitoring. Development efforts took the product from its initial concept, through prototypes, to a commercial product sold and deployed in the residential market. This pilot deployment has demonstrated the technical effectiveness of the AC Module system in meeting the needs and solving the problems of the residential market. While more expensive than the traditional central inverter systems at the pilot scale, the economics of AC Modules become

  3. AcEST: DK950895 [AcEST

    Full Text Available |A7SFA3|A7SFA3_NEMVE Predicted protein OS=Nematostella vectens... 210 5e-53 tr|Q0CVA9|Q0CVA9_ASPTN ATP-citrate synthase subunit...stX Result : Swiss-Prot sp_hit_id Q54YA0 Definition sp|Q54YA0|ACLY_DICDI Probable ATP-citrate synthase OS=Dictyos...PIDYSWAQELGLIRKPAAFISTI 404 >sp|Q8X097|ACL1_NEUCR Probable ATP-citrate synthase subunit 1 OS=Neurospora cras...IRKPASFMTSI 844 >sp|Q9P7W3|ACL1_SCHPO Probable ATP-citrate synthase subunit 1 OS=Schizosaccharomyces pombe G....done Score E Sequences producing significant alignments: (bits) Value sp|Q54YA0|ACLY_DICDI Probable ATP-citrate synthase OS=Dictyos

  4. AcEST: BP914304 [AcEST

    Full Text Available IDEHTFVFTLRAC 4 V+ NA++ Y G+ E A++ + +M+ E++ + TF+ LRAC Sbjct: 670 VTWNAMICGYAHHGKGEEAIQLFERMILENIKPNHVTFISI...KSLRRDFVTWNAMICGYAHHGKGEEAIQLFERMILENIKPN 703 Query: 339 NLTYVSLFKACGNVLDFGQG-RTIHGEARANGFSSDRFICTTLI...TFVFTLRAC 4 +F + + V+ N ++ +YV A +++M + D TL+AC Sbjct: 484 QIFERMCDRDNVTWNTIIGSYVQDENESEAFDLFKRMNLCGIVSDGACL...K + A+Q+ + R + +W++MI++ +A + ++ M Sbjct: 93 LGNSLINFYSKFEDVASAEQVFRRMTLRDVVTWSSMIAAYAGNNHPAKAFDTFERMTDAN 152... + R + +W++MI++ +A + ++ M Sbjct: 93 LGNSLINFYSKFEDVASAEQVFRRMTLRDVVTWSSMIAAYAGNNHPAKAFDTFERM

  5. AcEST: BP911793 [AcEST

    Full Text Available + +VSWN +++ Y QHG + ++L+ M+AE T N + + A Sbjct: 58 EAKFVFERIQNKDVVSWNCIINGYSQHGPSGSSHVMELFQRMRAENTAPNAHTFAGVF... N + + A Sbjct: 58 EAKFVFERIQNKDVVSWNCIINGYSQHGPSGSSHVMELFQRMRAENTAPNAHTFAGVFTA 117 Query: 359 CIQTGNLELCKQM...D VT S+LSACSH G + +G YF Sbjct: 602 IIGGSAQHGRGQDALQLFERMKMEGVKPDIVTFVSLLSACSHAGLLEEGRRYF 654 Score = 115 bit...53 QTGNLELCKQMHFNIVSAGNELNPSLASSLIRTYGNCGSMLDAHAVFDSLPLPDIVSWNV 174 Q +E+ K++ F+++ N S +++I Y CG + +A +FD +P D VSW Sbjct: 324 QGERME... L+ M +E + I+LV +L AC+ TG+LE + +H Sbjct: 498 VITWNAMIASYVHCEQSEKAIALFDRMVSENFKPSSITLVTLLMACVNTGSLER

  6. AcEST: BP921649 [AcEST

    Full Text Available 40 + ++LV YAK L + ++ +P R W+ +I+ + + ++E AL+ + M+ G Sbjct: 144 VASSLVGMYAKFNLFENSLQVFDEMPERDVASWNTVISCFYQSGEAEKALELFGRME...LDCYKEM 52 ++L +GNALVD YAKCG L A ++ +R+ R V W+ +I Y + E A D +K M Sbjct: 461 KNLFVGNALVDMYAKCGALEDARQIFERMCDRDNVTWNTIIGSYVQDEN...RD+ WNA+I Sbjct: 237 LEQGKQIHCYAIRSG-IESDVLVVNGLVNMYAKCGNVNTAHKLFERMPIRDVASWNAIIG 295 Query: 411 GYVNHGRAEVALDCFGKME...SNDVV-GNALVNMYAKCGNVNSAYKLFERMPKKNVVAWNAIIS 396 Query: 411 GYVNHGRAEVALDCFGKME... HGR + AL F +M+ EG PD +TF +L AC G + + + + Sbjct: 603 IGGSAQHGRGQDALQLFERMKMEGVKPDIVTFVSLLSACSHAGLLEEGRRYFCSM

  7. AcEST: BP919669 [AcEST

    Full Text Available D + RDV SW ++S + + G+ ++F M G +P+ Sbjct: 148 LVGMYAKFNLFENSLQVFDEMPERDVASWNTVISCFYQSGEAEKALELFGRMESSGFEPN 20...+ +++AC L + +G+E+H + K+G EL V Sbjct: 190 EKALELFGRMESSGFEPNSVSLTVAISACSRLLWLERGKE...F Sbjct: 468 IY---VVNSLIDSYGKCSHVEDAERIFEECTIGDLVSFTSMITAYAQYGQGEEALKLFLE 524 Query: 226 MVGEGTKPDSISLLVVLRA-YNF...+ IR DV W +LMSGY+K D ++F ++ Sbjct: 44 SLINVYFTCKDHCSARHVFENFDIRSDVYIWNSLMSGYSKNSMFHDTLEVFKRLLNCSIC 103 Query: 208 KPDSISLLVVLRAYNF...KPD Sbjct: 261 VDMYAKCGCIETAVEVFEKLTRRNVFSWAALIGGYAAYGYAKKATTCLDRIEREDGIKPD 320 Query: 199 SISLLVVLRAYNFLGFP

  8. AcEST: DK957916 [AcEST

    Full Text Available PQKQPVPAVSHSPQKSSTPPTPAATKPKEEPSVPKEVPKLQQGKLEKT 967 Query: 577 --TTEASQGIPVEEG...G E+ P+ P Sbjct: 1974 QEQGRAPSQDQEAPSPEALPSPGQEPAAGASPRRGELRRGSSAESALPRAGP 2025 >sp|Q05175|BASP_RAT Brain ac... +P AP P Sbjct: 388 ERETAASAGPQG----AFPEPRPAQPSAGPEPRPAQPSAGPEPRPAQPSAAPEPRP---- 439 Query: 571 GQTTE... L ++ +A+ +E AP Sbjct: 406 IVTTPEPEGSGEEDVPKPDEIPEKEVTEEELIKVSTAAPAKASPEEEVVKATTLAPSEED 465 Query: 550 VSPYIASGQTTE... Query: 424 KGQAYEAIPDPHVDPAAGVHERLAQLQLGDEPEATKPKEAPG-VSPYI--ASGQTTEASQ 594 K A E P + + G E + E EA P A G +P

  9. AcEST: DK956923 [AcEST

    Full Text Available CCATAGTCTCAA CAGCGATAAGCAGGAAATGCATGCAGTGACCATGGGTAAGAAAAGGGTCATGGTGGGCGC CATTAACACGATACTTATCCTA...CTCCTCTTGCAGTTTATGAAGCAATGTTCTTCCTCTTC TAGTCATGATGATGATGGCGATGCCTTTGCGGATGACACTCTAAGCAGACGCAACGAT...AC GGTCGAGTCTGCTCCTCGACATTGGCCAAGGCGAATGCTGGGCAGCCAAGAACCTGCCTC CAACAAGACTTCATATGGTATTCCTGAT...H At1g73965 (CLE13 / CLAVATA3/ESR-Related 13) (CLE13) OS=Arabidopsis thaliana Align length 25 Sco...icant alignments: (bits) Value tr|Q6NMF0|Q6NMF0_ARATH At1g73965 (CLE13 / CLAVATA3/ESR-Related 1... 49 3e-04

  10. AcEST: BP921492 [AcEST

    Full Text Available + AL +G+ +H Sbjct: 286 DVASWNAIIGGYSLNSQHHEALAFFNRMQVRGIKPNSITMVSVLPACAHLFAL... ++ L +GK +H Sbjct: 178 NLVSWTAMVSGYAQGGFADEALRMFYEMQGEDVKANYVTVASVLPACAQLSDLQQGKEIH 237 Query: 153 AC...FDRMPEK 171 Query: 333 DVVSWSAMIAMYGQQGCGKEAFQLFQEMACEGGMPNRVTYVSILDACASVAALPEGKLVH 154 +V+W+++++ + Q G EA Q+F +M G P+ T+VS+L ACA...333 DVVSWSAMIAMYGQQGCGKEAFQLFQEMACE-GGMPNRVTYVSILDACASVAALPEGKLV 157 +V +W+AMI+ YG G G++A +LF +M + G +PN VT+V++L ACA...SKL 85 Query: 288 GCGKEAFQLFQEMACEGGMPNRVTYVSILDACASVAALPEGKLVHACFMESELELDVVVG 109 ++ M P+ T+ S++ +CA ++AL G

  11. [Intestinal occlusion and abdominal compartment syndrome (ACS)].

    Stagnitti, Franco

    2009-01-01

    Intestinal occlusion is defined as an independent predictive factor of intra-abdominal hypertension (IAH) which represents an independent predictor of mortality. Baggot in 1951 classified patients operated with intestinal occlusion as being at risk for IAH ("abdominal blow-out"), recommending them for open abdomen surgery proposed by Ogilvie. Abdominal surgery provokes IAH in 44.7% of cases with mortality which, in emergency, triples with respect to elective surgery (21.9% vs 6.8%). In particular, IAH is present in 61.2% of ileus and bowel distension and is responsible for 52% of mortality (54.8% in cases with intra-abdominal infection). These patients present with an increasing intra-abdominal pressure (IAP) which, over 20-25 mmHg, triggers an Abdominal Compartment Syndrome (ACS) with altered functions in some organs arriving at Multiple Organ Dysfunction Syndrome (MODS). The intestine normally covers 58% of abdominal volume but when there is ileus distension, intestinal pneumatosis develops (third space) which can occupy up to 90% of the entire cavity. At this moment, Gastro Intestinal Failure (GIF) can appear, which is a specific independent risk factor of mortality, motor of "Organ Failure". The pathophysiological evolution has many factors in 45% of cases: intestinal pneumatosis is associated with mucosal and serous edema, capillary leakage with an increase in extra-cellular volume and peritoneal fluid collections (fourth space). The successive loss of the mucous barrier permits a bacterial translocation which includes bacteria, toxins, pro-inflammatory factors and oxygen free radicals facilitating the passage from an intra-abdominal to inter-systemic vicious cyrcle. IAH provokes the raising of the diaphragm, and vascular and visceral compressions which induce hypertension in the various spaces with compartmental characteristics. These trigger hypertension in the renal, hepatic, pelvic, thoracic, cardiac, intracranial, orbital and lower extremity areas, giving

  12. Performance of AC/graphite capacitors at high weight ratios of AC/graphite

    Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)

    2008-03-01

    The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)

  13. Simultaneous distribution of AC and DC power

    Polese, Luigi Gentile

    2015-09-15

    A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.

  14. AcEST: DK952954 [AcEST

    Full Text Available TST38A01NGRL0015_H21 616 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0015_H21. 5' end seq ... LIHAHIVCSCNDVDNFVRSTLVNLYSKCGSIEDAHNVFAKLATRRSVDWSMMIS ... 541 ++ Q K +HA I + D + V + L+++Y+KCGSI DA F +++T+ ... LIHAHIVCSCNDVDNFVRSTLVNLYSKCGSIEDAHNVFAKLATRRSVDWSMMIS GS 547 + + IHA S D ++ LV LYS+CG IE+++ F + ++ W+ ++S ... LIHAHIVCSCNDVDNFVRSTLVNLYSKCGSIEDAHNVFAKLATRRSVDWSMMIS ... 541 DL + IH+ I+ + ++ +V S L+++Y+K G ++ A ++ + A + ... EA+ LF +M G+ P + + L AC Sbjct: 243 RVFDGLRLKDHSSWVAMIS GLSKNECEAEAIRLFCDMYVLGIMPTPYAFSSVLSACKKIE 302 Query ...

  15. AcEST: BP912540 [AcEST

    Full Text Available YMU001_000020_B03 501 Adiantum capillus-veneris mRNA. clone: YMU001_000020_B03. BP912540 - Show ... 2 EELTVHHTASVGDVEALKALLAEGADKDEKDSEGRTALHFACGYGEVMCAE VLLEAGVAV 181 EE VH TAS+GDVE LKA LA G +KDE+DSEGRTAL ... ry: 14 VHHTASVGDVEALKALLAEGADKDEKDSEGRTALHFACGYGEVMCAE VLLEAGVAVDAVD 193 +H A V ++ LL GAD KD G LH AC YG AE ... uery: 26 ASVGDVEALKALLAEGADKDEKDSEGR--TALHFACGYGEVMCAE VLLEAGVAVDAVDKN 199 + GD+E +K L + + + +D EGR T LHFA ... ry: 14 VHHTASVGDVEALKALLAEGADKDEKDSEGRTALHFACGYGEVMCAE VLLEAGVAVDAVD 193 +H A ++E + LL GAD + +D G LH A YG ...

  16. AcEST: DK948526 [AcEST

    Full Text Available TST38A01NGRL0003_I19 675 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0003_I19. 5' end seq ... IAMVRTTTPVYV 214 Query: 542 ALALFNQARVSSLPIIDDNGSLIDIY ARSDITALARDDTY 661 AL +F Q RVS+LP++D+ G ++DIY ++ D+ ... LA + TY Sbjct: 215 ALGIFVQHRVSALPVVDEKGRVVDIY SKFDVINLAAEKTY 254 >sp|Q09138|AAKG1_PIG 5'-AMP-acti ... IAMVRTTTPVYV 215 Query: 542 ALALFNQARVSSLPIIDDNGSLIDIY ARSDITALARDDTY 661 AL +F Q RVS+LP++D+ G ++DIY ++ D+ ... LA + TY Sbjct: 216 ALGIFVQHRVSALPVVDEKGRVVDIY SKFDVINLAAEKTY 255 >sp|O54950|AAKG1_MOUSE 5'-AMP-ac ...

  17. AcEST: DK962916 [AcEST

    Full Text Available TST39A01NGRL0015_C06 596 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0015_C06. 5' end seq ... NA. clone: TST39A01NGRL0015_C06. 5' end sequence. Acce ssion DK962916 Tissue type prothallia with plantlet ... 2 Query: 317 MPKSKEPCSQEACDIQTCLVKNNFITERCFPVIEALQACCE K 442 MP+ K+PC ++AC+IQ CL NN++ +C VI+ L+ CC + Sbjct ... me = +2 Query: 335 PCSQEACDIQTCLVKNNFITERCFPVIEALQACCE K 442 PC +EAC IQ CL+ + + +C VI+ L CC K Sbjct: 4 PCQ ... = +2 Query: 326 SKEPCSQEACDIQTCLVKNNFITERCFPVIEALQACCE KCNSK 454 + E C+ CD +TC +K F +C AL CCE KC K Sbjct: 4 ...

  18. AcEST: DK955705 [AcEST

    Full Text Available TST39A01NGRL0023_N02 635 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0023_N02. 5' end seq ... NA. clone: TST39A01NGRL0023_N02. 5' end sequence. Acce ssion DK955705 Tissue type prothallia with plantlet ... 2 Query: 296 MPKSKEPCSQEACDIQTCLVKNNFITERCFPVIEALQACCE K 421 MP+ K+PC ++AC+IQ CL NN++ +C VI+ L+ CC + Sbjct ... me = +2 Query: 314 PCSQEACDIQTCLVKNNFITERCFPVIEALQACCE K 421 PC +EAC IQ CL+ + + +C VI+ L CC K Sbjct: 4 PCQ ... = +2 Query: 305 SKEPCSQEACDIQTCLVKNNFITERCFPVIEALQACCE KCNSK 433 + E C+ CD +TC +K F +C AL CCE KC K Sbjct: 4 ...

  19. AcEST: DK961330 [AcEST

    Full Text Available FWVPCMHTPIKQEKHTHA 405 +AR P W +++PI+ ++C++ P + AK+ PL DVTH+F+V + +QE Sbjct: 61 VARRTRP-SWHEDNPINYVQCDISDPDD...+IL +D PGGPWKVYG Sbjct: 4 WWAGAIGAAKKKLEEDDAPPKHS---SVALIVGVTGIIGNSLAEILPLADTPGGP...AWHEDNPINYIQCDISDPDDSLAKLSPLTDVTHVFYVTCANR--STEPENCE 117 Query: 406 MATHMFENIIGVLLTHAPNLQHVCMQTSDKHY-... : Swiss-Prot sp_hit_id Q7MXT7 Definition sp|Q7MXT7|LPXD_PORGI UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac...lue sp|Q7MXT7|LPXD_PORGI UDP-3-O-[3-hydroxymyristoyl] glucosamine N-... 34 0.62 sp|P60369|KR103_HUMAN Kerati

  20. AcEST: BP913772 [AcEST

    Full Text Available N VT V L C+ G G+ H Sbjct: 350 NVVTWSAVIAGYAQRGLGFEALDVFRQMRLCGSEPNVVTLVSLLSGCALAGTLLHGKETH 409 Query: 376 IEIER--RGLLEVDP-...VFNKLSVQDIVSW 236 + + A ++G+++H I RRGL + PV+ + LV MY R G L Q VF+++ +D+VSW Sbjct: 296 ASLAALEQGKLIHGYILRRGLDSILPVI-S... TF M+ +PN+VT V VL+AC+ + Q + Sbjct: 250 SWSAMIACYAKNGKAFEALRTFREMMRETKDSSPNSVTMVSVLQACASLA...MIEGGVAPNAVTFVVVLRACSQTGSYSQSQTFFEAMSKNF 50 + G A G + F+ M + GV PNAVTFV VLR CS G + Q F++M F Sbjct: 312 ALNGLAMNGFGEKCLELFSL...L YA G + + +F++ D+ +TA + + Sbjct: 48 IHAAILRHNLLLHPRYPVLNLKLHRAYASHGKIRHSLALFHQTIDP

  1. A decomposition method for network-constrained unit commitment with AC power flow constraints

    To meet the increasingly high requirement of smart grid operations, considering AC power flow constraints in the NCUC (network-constrained unit commitment) is of great significance in terms of both security and economy. This paper proposes a decomposition method to solve NCUC with AC power flow constraints. With conic approximations of the AC power flow equations, the master problem is formulated as a MISOCP (mixed integer second-order cone programming) model. The key advantage of this model is that the active power and reactive power are co-optimised, and the transmission losses are considered. With the AC optimal power flow model, the AC feasibility of the UC result of the master problem is checked in subproblems. If infeasibility is detected, feedback constraints are generated based on the sensitivity of bus voltages to a change in the unit reactive power generation. They are then introduced into the master problem in the next iteration until all AC violations are eliminated. A 6-bus system, a modified IEEE 30-bus system and the IEEE 118-bus system are used to validate the performance of the proposed method, which provides a satisfactory solution with approximately 44-fold greater computational efficiency. - Highlights: • A decomposition method is proposed to solve the NCUC with AC power flow constraints • The master problem considers active power, reactive power and transmission losses. • OPF-based subproblems check the AC feasibility using parallel computing techniques. • An effective feedback constraint interacts between the master problem and subproblem. • Computational efficiency is significantly improved with satisfactory accuracy

  2. Speed Control of DC Motor using AC/AC/DC Converter Based on Intelligent Techniques

    Rakan Kh Antar

    2013-01-01

       This paper describes the application of ac/ac/dc and ac/dc converters to control the speed of a separately excited DC motor. Artificial neural network and PI controller are trained to select the desired values of firing angles for triggering thyristors of the ac/ac/dc and ac/dc bridge converters in order to control the speed of the dc motor at a desired value with constant and different load torques in order to obtain the best speed response. Simulation results show that the rising time fo...

  3. Vision Loss, Sudden

    ... of age-related macular degeneration. Spotlight on Aging: Vision Loss in Older People Most commonly, vision loss ... Some Causes and Features of Sudden Loss of Vision Cause Common Features* Tests Sudden loss of vision ...

  4. Water-induced dc and ac degradations in TiO2-based ceramic capacitors

    Water-induced degradations of TiO2-based ceramic capacitors in the presence of dc and ac voltages are reported in this paper. Atomic hydrogen generated by electrolysis of water using dc voltages reduced TiO2-based ceramics at ambient temperature. The resulting degradation was characterized by an increase in capacitance, a large dielectric loss and a dramatic decrease in insulation resistance. Hydrogen and oxygen generated by the electrolysis of water using ac voltages reacted with TiO2-based ceramics. The resulting degradation was characterized by a decrease in capacitance, a large dielectric loss, but no noticeable changes in insulation resistance. Water played a vital role in both dc and ac degradations of TiO2-based capacitors and an effort should be made to prevent water-induced degradations

  5. Electromechanical systems with transient high power response operating from a resonant ac link

    Burrows, Linda M.; Hansen, Irving G.

    1992-01-01

    The combination of an inherently robust asynchronous (induction) electrical machine with the rapid control of energy provided by a high frequency resonant ac link enables the efficient management of higher power levels with greater versatility. This could have a variety of applications from launch vehicles to all-electric automobiles. These types of systems utilize a machine which is operated by independent control of both the voltage and frequency. This is made possible by using an indirect field-oriented control method which allows instantaneous torque control all four operating quadrants. Incorporating the ac link allows the converter in these systems to switch at the zero crossing of every half cycle of the ac waveform. This zero loss switching of the link allows rapid energy variations to be achieved without the usual frequency proportional switching loss. Several field-oriented control systems were developed under contract to NASA.

  6. Universality of ac conduction in disordered solids

    Dyre, Jeppe; Schrøder, Thomas

    2000-01-01

    non-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally......The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual...

  7. AC-DC integrated load flow calculation for variable speed offshore wind farms

    Zhao, Menghua; Chen, Zhe; Blaabjerg, Frede

    2005-01-01

    This paper proposes a sequential AC-DC integrated load flow algorithm for variable speed offshore wind farms. In this algorithm, the variable frequency and the control strategy of variable speed wind turbine systems are considered. In addition, the losses of wind turbine systems and the losses of...... converters are also integrated into the load flow algorithm. As a general algorithm, it can be applied to different types of wind farm configurations, and the load flow is related to the wind speed....

  8. Short term dynamic aperture with AC dipoles

    Mönig, Saskia; Persson, Tobias Hakan Bjorn; Coello De Portugal, Jaime; Langner, Andy; Tomas, Rogelio; CERN. Geneva. ATS Department

    2015-01-01

    The dynamic aperture of an accelerator is determined by its non-linear components and errors. Control of the dynamic aperture is important for a good understanding and operation of the accelerator. The AC dipole, installed in the LHC for the diagnostic of linear and non-linear optics, could serve as a tool for the determination of the dynamic aperture. However, since the AC dipole itself modifies the non-linear dynamics, the dynamic aperture with and without AC dipole are expected to differ. The effect of the AC dipole on the dynamic aperture is studied within this note.

  9. DESARROLLO RURAL A.C.

    Alfredo Aguilar Valdés

    2015-01-01

    Full Text Available El objetivo de este trabajo fue analizar el diagnostico situacional de una Empresa de Servicios Profesionales en el caso de: Instituto de Promoción Para el Desarrollo Rural A.C., a través de la Metodología “UALAE” así como la oportunidad que como empresa presenta. Este estudio se realizó en el municipio de Saltillo, Coahuila, México. Adoptó esta Metodología UALAE y se difundió su opinión. El Instituto de Promoción Para el Desarrollo Rural A.C., está formado por profesionistas y productores cuya finalidad es la de contribuir al desarrollo del medio rural con proyectos de viabilidad técnica, económica y social, sobre la base de necesidades reales y al aprovechamiento sustentable del potencial de los recursos naturales. Su buen funcionamiento es indispensable e importante para el desarrollo de los productores agropecuarios principalmente, debido a que se ven muy beneficiados con todos los servicios que se les brinda, se han logrado buenos proyectos, buenas capacitaciones y un gran crecimiento de sus productos. Mediante el proceso de asistencia técnica a organizaciones de productores, se induce la formulación adecuada de proyectos viables desde el punto visto del mercado, la rentabilidad económica, las tecnologías disponibles y de la organización social.

  10. ac electroosmosis in rectangular microchannels.

    Campisi, Michele; Accoto, Dino; Dario, Paolo

    2005-11-22

    Motivated by the growing interest in ac electroosmosis as a reliable no moving parts strategy to control fluid motion in microfluidic devices for biomedical applications, such as lab-on-a-chip, we study transient and steady-state electrokinetic phenomena (electroosmosis and streaming currents) in infinitely extended rectangular charged microchannels. With the aid of Fourier series and Laplace transforms we provide a general formal solution of the problem, which is used to study the time-dependent response to sudden ac applied voltage differences in case of finite electric double layer. The Debye-Huckel approximation has been adopted to allow for an algebraic solution of the Poisson-Boltzmann problem in Fourier space. We obtain the expressions of flow velocity profiles, flow rates, streaming currents, as well as expressions of the complex hydraulic and electrokinetic conductances. We analyze in detail the dependence of the electrokinetic conductance on the extension of linear dimensions relative to the Debye length, with an eye on finite electric double layer effects. PMID:16351310

  11. AcEST: DK960083 [AcEST

    Full Text Available ome P450 71D7 OS=Solanum chacoense ... 96 1e-19 sp|Q9SAB6|C71AI_ARATH Cytochrome ...... 96 2e-19 sp|P93530|C71D6_SOLCH Cytochrome P450 71D6 OS=Solanum chacoense ... 94 5e-19 sp|Q9T0K2|C71AK_AR... paten... 176 1e-42 tr|Q9AXP9|Q9AXP9_POPJC Cinnamate 4-hydroxylase OS=Populus jackii... 176 2e-42 tr|Q40907|Q40907_POPKI Cinnamic ac...8 KVVQQSRGAWEDEALRVIQDLKA 160 >tr|Q9AXP9|Q9AXP9_POPJC Cinnamate 4-hydroxylase OS=Populus jackii GN=C4H PE=2 ...e-42 tr|A9PBZ7|A9PBZ7_POPTR Putative uncharacterized protein OS=Popul... 176 2e-4

  12. AcEST: DK955376 [AcEST

    Full Text Available TST39A01NGRL0022_O23 611 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0022_O23. 5' end seq ... LMDETRAAGIKL 210 Query: 602 AIC 610 A+C Sbjct: 211 AVC ... 213 >tr|A9SM81|A9SM81_PHYPA Predicted protein OS=P ... C 610 VLELMD A+ KGLKVA+C Sbjct: 196 VLELMDAAREKGLKVAVC ... 213 >tr|Q8L7U1|Q8L7U1_ARATH AT4g39970/T5J17_140 OS ... LKVAIC 610 LMDEA+A G K+A+C Sbjct: 182 RLMDEAKAAGKKLAVC ... 197 >tr|Q680K2|Q680K2_ARATH MRNA, complete cds, cl ... LKVAIC 610 LMDEA+A G K+A+C Sbjct: 182 RLMDEAKAAGKKLAVC ... 197 >tr|Q8LAS1|Q8LAS1_ARATH Putative uncharacteriz ...

  13. AcEST: BP913416 [AcEST

    Full Text Available GCATGTAGTTTGGA CAGAGATG ■■Homology search results ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swi...AC_BACFN Uronate isomerase OS=Bacteroides fragilis (... 30 4.5 sp|Q3ITT7|SYA_NATPD Alanyl-tRNA synthetase OS=Natronomonas phar...C++ N IP+ M C Sbjct: 417 LSYPRHEYFRRTLCNLLGCDVENGEIPLSEMERVC 451 >sp|Q3ITT7|SYA_NATPD Alanyl-tRNA synthetase OS=Natronomonas phar...ng, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database searc...148,809,765 total letters Searching..................................................done Score E Sequences

  14. AcEST: BP920845 [AcEST

    Full Text Available 45|Adiantum capillus-veneris mRNA, clone: YMU001_000142_D08. (514 letters) Database: uniprot_sprot.fasta 412,525 seq...P7 OS=Magnapor... 33 1.0 sp|Q7VF68|SYH_HELHP Histidyl-tRNA synthetase OS=Helicobacter hep... 31 3.8 sp|P1305...90 FTGFLVLHSEPRQQPQVDL 1608 >sp|A4QX49|DBP7_MAGGR ATP-dependent RNA helicase DBP7 OS=Magnaporthe grise...T PT VT+H + T+ AC+ A+TT+ H H Sbjct: 481 PPKETKPTK------PVTNHTESTVGKACYITSAANTTITLHKLH 519 >sp|Q7VF68|SYH_HELHP His...rot_trembl.fasta 7,341,751 sequences; 2,391,615,440 total letters Searching.................................

  15. AcEST: DK953324 [AcEST

    Full Text Available |LSRR_PHOLL Transcriptional regulator lsrR OS=Photorhab... 30 6.1 sp|A0JY64|ATPB_ARTS2 ATP synthase subunit beta OS=Arthroba...cter s... 30 6.1 sp|A1R7V3|ATPB_ARTAT ATP synthase subunit beta OS=Arthroba...ATP synthase subunit beta OS=Arthrobacter sp. (strain FB24) GN=atpD PE=3 SV=1 Len...KD 372 Query: 311 HLHFTHRGKQRL 346 H + R KQ L Sbjct: 373 HYNTAVRVKQIL 384 >sp|A1R7V3|ATPB_ARTAT ATP synthase subunit beta OS=Arthroba...T and PSI-BLAST: a new generation of protein database search programs, Nucleic Ac

  16. AcEST: DK945049 [AcEST

    Full Text Available R 148 >sp|Q9X5X3|ATCU_SINMW Copper-transporting P-type ATPase OS=Sinorhizobium medicae (strain WSM419) GN=ac...|Q4EPP8|Q4EPP8_LISMO Heavy metal-binding protein OS=Listeria m... 34 3.2 tr|A6AST1|A6AST1_VIBHA Copper-trans..... 31 2.7 sp|Q4X0S7|DPH1_ASPFU Diphthamide biosynthesis protein 1 OS=Asper... 30 4.5 sp|A2VDJ0|T131L_HUMAN Transmembran...P58342|ATCU2_RHIME Copper-transporting ATPase 2 OS=Rhizobium meliloti Align length 75 Score (bit) 34.7 E-val...sophila ... 30 7.8 >sp|P58342|ATCU2_RHIME Copper-transporting ATPase 2 OS=Rhizobium me

  17. AcEST: BP916217 [AcEST

    Full Text Available inase kinase 7-interacting protein 3 OS=Mus musculus Align length 119 Score (bit) 35.0 E-value 0.16 Report B...visiae GN... 30 6.8 >sp|Q571K4|TAB3_MOUSE Mitogen-activated protein kinase kinase kinase 7-interacting protein 3 OS=Mus musculus...protein kinase kinase kinase 7 interacting protein 3 OS=Mus musculus GN=Map3k7ip3 PE=2 SV=1 Length = 716 Sco...(3)malignant brain tumor-like 2 prot... 31 2.3 sp|P33234|ADIY_ECOLI HTH-type transcriptional regulator adiY ...ZZC3_PSEU2 Membrane protein, putative OS=Pseudomonas... 35 2.5 tr|Q5U7D5|Q5U7D5_9BACI OpuAC OS=Halobacillus trueperi GN=opu

  18. AcEST: DK947388 [AcEST

    Full Text Available Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Ac...ids Res. 25:3389-3402. Query= DK947388|Adiantum capillus-veneris mRNA, clone: YMU02A01NGRL0015_L18, 5' (587 letters) Databa... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK947388|Adiantum c...apillus-veneris mRNA, clone: YMU02A01NGRL0015_L18, 5' (587 letters) Database: uniprot_trembl.fasta...-ribosylation factor 1 OS=Salix bakko GN... 268 1e-71 sp|P49076|ARF_MAIZE ADP-ribosylation factor OS=Zea may

  19. High benefits approach for electrical energy conversion in electric vehicles from DC to PWM-AC without any generated harmonic

    Highlights: • Novel hybrid power source including AC feature for using in electric/hybrid vehicles. • Minimizing the energy loss in electric/hybrid vehicles by using the proposed system. • Suitable AC wave form for braking/accelerating purposes in electric/hybrid vehicles. • A novelty is that the harmonic generated by the added AC feature is really zero. • Another novelty is the capability of choosing arbitrary frequency for AC feature. - Abstract: This paper presents a novel hybrid power source, including a Li-ion battery together with an interface, which generates simultaneously electrical energy with the forms of both DC and AC for electric vehicles. A novel and high benefits approach is applied to convert the electrical energy of the Li-ion battery from DC form to single-phase symmetric pulse-width modulation (PWM)-AC form. Harmonic generation is one of the important problems when electrical energy is converted from DC to AC but there are not any generated harmonic during the DC/AC conversion using the proposed technique. The proposed system will be widely used in electric/hybrid vehicles because it has many benefits. Minimizing the energy loss (saving energy), no generated harmonic (it is really zero), the capability of arbitrary/necessary frequency selection for output AC voltage and the ability of long distance energy transmission are some novelties and advantages of the proposed system. The proposed hybrid power source including DC/AC PWM inverter is simulated in Proteus 6 software environment and a laboratory-based prototype of the hybrid power source is constructed to validate the theoretical and simulation results. Simulation and experimental results are presented to prove the superiority of the proposed hybrid power supply

  20. Study of Power Flow Algorithm of AC/DC Distribution System including VSC-MTDC

    Haifeng Liang

    2015-08-01

    Full Text Available In recent years, distributed generation and a large number of sensitive AC and DC loads have been connected to distribution networks, which introduce a series of challenges to distribution network operators (DNOs. In addition, the advantages of DC distribution networks, such as the energy conservation and emission reduction, mean that the voltage source converter based multi-terminal direct current (VSC-MTDC for AC/DC distribution systems demonstrates a great potential, hence drawing growing research interest. In this paper, considering losses of the reactor, the filter and the converter, a mathematical model of VSC-HVDC for the load flow analysis is derived. An AC/DC distribution network architecture has been built, based on which the differences in modified equations of the VSC-MTDC-based network under different control modes are analyzed. In addition, corresponding interface functions under five control modes are provided, and a back/forward iterative algorithm which is applied to power flow calculation of the AC/DC distribution system including VSC-MTDC is proposed. Finally, by calculating the power flow of the modified IEEE14 AC/DC distribution network, the efficiency and validity of the model and algorithm are evaluated. With various distributed generations connected to the network at appropriate locations, power flow results show that network losses and utilization of transmission networks are effectively reduced.

  1. Magnetization losses in superconducting YBCO conductor-on-round-core (CORC) cables

    Majoros, M.; Sumption, M. D.; Collings, E. W.; van der Laan, D. C.

    2014-12-01

    Described are the results of magnetization loss measurements made at 77 K on several YBCO conductor-on-round-core (CORC) cables in ac magnetic fields of up to 80 mT in amplitude and frequencies of 50 to 200 Hz, applied perpendicular to the cable axis. The cables contained up to 40 tapes that were wound in as many as 13 layers. Measurements on the cables with different configurations were made as functions of applied ac field amplitude and frequency to determine the effects of their layout on ac loss. In large scale devices such as e.g. Superconducting Magnetic Energy Storage (SMES) magnets, the observed ac losses represent less than 0.1% of their stored energy.

  2. Living with vision loss

    Diabetes - vision loss; Retinopathy - vision loss; Low vision; Blindness - vision loss ... Low vision is a visual disability. Wearing regular glasses or contacts does not help. People with low vision have ...

  3. Economic Loan Loss Provision and Expected Loss

    Stefan Hlawatsch

    2010-10-01

    Full Text Available The intention of a loan loss provision is the anticipation of the loan's expected losses by adjusting the book value of the loan. Furthermore, this loan loss provision has to be compared to the expected loss according to Basel II and, in the case of a difference, liable equity has to be adjusted. This however assumes that the loan loss provision and the expected loss are based on a similar economic rationale, which is only valid conditionally in current loan loss provisioning methods according to IFRS. Therefore, differences between loan loss provisions and expected losses should only result from different approaches regarding the parameter estimation within each model and not due to different assumptions regarding the outcome of the model. The provisioning and accounting model developed in this paper overcomes the before-mentioned shortcomings and is consistent with an economic rationale of expected losses. Additionally, this model is based on a close-to-market valuation of the loan that is in favor of the basic idea of IFRS. Suggestions for changes in current accounting and capital requirement rules are provided.

  4. Generator method of 225Ac production without a carrier for nuclear medicine

    The two-steps isotope generator scheme of 225Ac production from 229Th has been developed. The first step is used for separation of thorium, actinium, radium and daughter decay products (DDP), and removals of parent radionuclide. The second step provides additional separation of actinium from traces of radium and DDP, and conversion of actinium in the nitrate form. The chosen solutions provide optimal conditions for carry out of process. The yield of the 225Ac was 99.9% at minimal losses of parent 229Th (less than 0.1%)

  5. Autonomous operation of hybrid AC-DC microgrids with progressive energy flow tuning

    Loh, Poh Chiang; Li, Ding; Chai, Yi Kang;

    2012-01-01

    accompanied losses. Hybrid microgrids are therefore more efficient with a control scheme now proposed for controlling them. The scheme allows the hybrid microgrids to operate autonomously without fast communication links, while yet maintaining high efficiency through progressive energy flow tuning....... Experimental testing has already been performed with results presented in a later section for verifying the control concepts discussed.......Modern distributed sources can either be ac or dc. It is thus possible to form hybrid microgrids with ac and dc sub-grids inter-tied by power converters. The resulting hybrid architecture allows loads to be flexibly placed so as to minimize the amount of energy conversion needed and hence its...

  6. SINGLE PHASE HIGH FREQUENCY AC CONVERTER FOR INDUCTION HEATING APPLICATION

    M.A INAYATHULLAAH,; Dr. R. Anita

    2010-01-01

    The proposed topology reduces the total harmonic distortion (THD) of a high frequency AC/AC Converter well below the acceptable limit. This paper deals with a novel single phase AC/DC/AC soft switching utility frequency AC to high frequency AC converter. In this paper a single phase full bridge inverter with Vienna rectifier as front end is used instead of conventional diode bridge rectifier to provide continuous sinusoidal input current with nearly unity power factor at the source side with ...

  7. Characterization of AcMNPV with a deletion of ac69 gene

    Jianhao Ke

    2011-07-01

    Full Text Available ORF69 (Ac69 of Autographa californica multiple nucleopolyhedrovirus (AcMNPV is conserved in some baculovirus genomes. Although it has been shown that Ac69 has cap 0-dependent methyltransferase activity and is not required for budded virus production in Spodoptera frugiperda Sf-9 cells, its role in occlusion-derived virus synthesis and virus oral infectivity is not known. This paper describes generation of an ac69 knockout AcMNPV bacmid mutant and analyses of the influence of ac69 deletion on the viral infectivity in Sf-9 cells and Trichoplusia ni larvae so as to investigate the role of ac69 in the viral life cycle. Results indicated that ac69 deletion has little effect on the production rates and morphogenesis of budded virus and occlusion-derived virus in Sf-9 cells. In addition, animal experiment revealed that the deletion mutant did not affect AcMNPV infectivity for Trichoplusia ni larvae in LD50 and LT50 bioassay when administered orally. These results suggest that ac69 may be dispensable for viral infectivity both in vitro and in vivo.

  8. Alternating magnetic field losses in ATLAS type aluminium stabilized NbTi superconductors

    Boxman, E W; ten Kate, H H J

    2002-01-01

    During ramping up- and down of the current in large-scale magnets the ramp losses are an important factor affecting the thermal and electro-magnetic stability of the system. The calculation of the losses is not straightforward due to the large dimensions of the conductor (~600 mm/sup 2/) implying that diffusion effects have to be taken into account. The AC-losses of the Al stabilized NbTi cable conductors used in the ATLAS magnet system were measured in 0.5 m long samples, using an inductive method with pick-up coils as well as the calorimetric method. External varying magnetic fields up to 2 tesla amplitude were applied parallel and perpendicular to the conductor wide surface. The results are compared to theory. It is found that hysteresis loss, eddy current loss in the Aluminum cladding and cable-to-cladding coupling loss contribute most to the AC loss. (5 refs).

  9. Noise reduction in AC-coupled amplifiers

    Serrano Finetti, Roberto Ernesto; Pallàs Areny, Ramon

    2014-01-01

    AC-coupled amplifiers are noisier than dc-coupled amplifiers because of the thermal noise of the resistor(s) in the ac-coupling network and the increased contribution of the amplifier input noise current i(n). Both contributions, however, diminish if the corner frequency f(c) of the high-pass filter observed by the signal is lowered, the cost being a longer transient response. At the same time, the presence of large resistors in the ac-coupling network suggests that the use of FET-input ampli...

  10. Menopause and Bone Loss

    Fact Sheet & Menopause Bone Loss How are bone loss and menopause related? Throughout life your body keeps a balance between the loss ... The sooner you take steps to prevent bone loss, the lower your risk of osteoporosis later in life. If you are skipping menstrual periods, have had ...