WorldWideScience

Sample records for ac losses

  1. Transport AC losses in YBCO coated conductors

    Majoros, M [Ohio State University, Columbus, OH 43210 (United States); Ye, L [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Velichko, A V [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Coombs, T A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Sumption, M D [Ohio State University, Columbus, OH 43210 (United States); Collings, E W [Ohio State University, Columbus, OH 43210 (United States)

    2007-09-15

    Transport AC loss measurements have been made on YBCO-coated conductors prepared on two different substrate templates-RABiTS (rolling-assisted biaxially textured substrate) and IBAD (ion-beam-assisted deposition). RABiTS samples show higher losses compared with the theoretical values obtained from the critical state model, with constant critical current density, at currents lower than the critical current. An origin of this extra AC loss was demonstrated experimentally by comparison of the AC loss of two samples with different I-V curves. Despite a difference in I-V curves and in the critical currents, their measured losses, as well as the normalized losses, were practically the same. However, the functional dependence of the losses was affected by the ferromagnetic substrate. An influence of the presence of a ferromagnetic substrate on transport AC losses in YBCO film was calculated numerically by the finite element method. The presence of a ferromagnetic substrate increases transport AC losses in YBCO films depending on its relative magnetic permeability. The two loss contributions-transport AC loss in YBCO films and ferromagnetic loss in the substrate-cannot be considered as mutually independent.

  2. AC losses in filamentary YBCO/hastelloy

    Full text: The AC hysteresis loss of a long YBCO thin-film superconducting strip in a perpendicular AC magnetic field can be reduced by subdividing the film into narrow parallel strips (filaments). The hysteresis loss depends on the film critical current density Jc, the film thickness d, the filament width 2a and the lateral spacing L between filaments as well as on the AC magnetic field amplitude Hm. In addition, if the film is deposited onto a YSZ/hastelloy substrate to form a flexible tape, eddy current loss occurs in the hastelloy metal. The eddy current loss depends on the resistivity p of the hastelloy, the width 2w and thickness dm of the hastelloy substrate as well as on the frequency f and amplitude Hm. We have calculated the hysteresis and eddy current losses as a function of Jc, d, 2a, L, p, w, dm, f, and Hm to find optimal design parameters for a YBCO/hastelloy tape. As the AC loss is related to the loss component X'' of the AC susceptibility, we have measured X'' at different frequencies f and amplitudes Hm for several filamentary designs of YBCO/hastelloy tapes and compared our experimental results with our model calculations

  3. AC loss in superconducting tapes and cables

    Oomen, Marijn Pieter

    High-temperature superconductors are developed for use in power-transmission cables, transformers and motors. The alternating magnetic field in these devices causes AC loss, which is a critical factor in the design. The study focuses on multi-filament Bi-2223/Ag tapes exposed to a 50-Hz magnetic field at 77 K. The AC loss is measured with magnetic, electric and calorimetric methods. The results are compared to theoretical predictions based mainly on the Critical-State Model. The loss in high- temperature superconductors is affected by their characteristic properties: increased flux creep, high aspect ratio and inhomogeneties. Filament intergrowths and a low matrix resistivity cause a high coupling-current loss especially when the filaments are fully coupled. When the wide side of the tape is parallel to the external magnetic field, the filaments are decoupled by twisting. In a perpendicular field the filaments can be decoupled only by combining a short twist pitch with a transverse resistivity much higher than that of silver. The arrangement of the inner filaments determines the transverse resistivity. Ceramic barriers around the filaments cause partial decoupling in perpendicular magnetic fields at power frequencies. The resultant decrease in AC loss is greater than the accompanying decrease in critical current. With direct transport current in alternating magnetic field, the transport-current loss is well described with a new model for the dynamic resistance. The Critical- State Model describes well the magnetisation and total AC loss in parallel magnetic fields, at transport currents up to 0.7 times the critical current. When tapes are stacked face-to-face in a winding, the AC-loss density in perpendicular fields is greatly decreased due to the mutual shielding of the tapes. Coupling currents between the tapes in a cable cause an extra AC loss, which is reduced by a careful cable design. The total AC loss in complex devices with many tapes is generally well

  4. AC loss performance of CS insert coil

    The ITER Central Solenoid (CS) model coil and the CS insert coil were fabricated, and the test was carried out. The AC loss measurement of the coil is one of the most important tests to determine coil performance. The AC loss of a short sample conductor for the CS insert coil was measured by using the calorimetric method, and the coupling time constants of the conductor were estimated to be 30 ms and 20 ms for pulse and discharge tests, respectively. The AC loss of the CS insert coil was measured by using the calorimetric method for pulse and discharge tests. The coupling time constant estimated from the result of the pulse tests was 34 ms and almost equal to that of the short sample. The coupling time constant for the discharge test was estimated to be 140 ms and about 4 times that of the pulse test. (author)

  5. AC loss in superconducting tapes and cables

    Oomen, Marijn Pieter

    2000-01-01

    The present study discusses the AC loss in high-temperature superconductors. Superconducting materials with a relatively high critical temperature were discovered in 1986. They are presently developed for use in large-scale power-engineering devices such as power-transmission cables, transformers an

  6. The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual

    Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)

  7. Development of YBCO HTS cable with low AC loss

    High temperature superconducting (HTS) cables using YBCO tapes are expected to be more economical because AC losses will be much smaller than conventional cables. To reduce AC loss, 10 mm wide YBCO tapes were divided into five strips using a YAG laser. Using narrower strips and optimizing the space between the strips were effective in reducing AC loss. A 1 m conductor was fabricated, and AC loss was 0.048 W/m at 1 kA and 50 Hz. Based on the successful AC loss reduction in the 1 m conductor, we will fabricate a 10 m HTS cable with a three-layer HTS conductor, electrical insulation, and a one-layer HTS shield and cupper protection layer for overcurrent. In addition, we have developed a prototype of the HTS cable joint that can withstand an overcurrent condition of 31.5 kA for 2 s

  8. Numerical estimation of AC loss in superconductors with ripple current

    Highlights: •The loss energy density with ripple current is numerically calculated. •Irie–Yamafuji model is used for magnetic field dependence of critical current. •Calculated result of cylindrical superconductor agrees with theoretical result. •AC loss of strip superconductor becomes large at small ripple current amplitude. •Strip superconductor should be used as a form of hollow cylinder to reduce AC loss. -- Abstract: The loss energy density (AC loss) with ripple current is numerically calculated by finite element method for cylindrical and strip superconductors based on Irie–Yamafuji model in which the magnetic field dependence of the critical current density is taken into account for design of DC transmission cable system. It is confirmed that calculated result of the AC loss in the cylindrical superconductor with the ripple current agrees well with theoretical estimation which was reported in the previous work. On the contrary, the AC loss in the strip superconductor with the ripple current is obtained only by numerical calculation. It is found that the AC loss in the strip superconductor of the ripple current becomes larger than that without DC current at small ripple current amplitude, since the penetration depth of magnetic field becomes large. Therefore, it is recommended that strip superconductor is better to use as cylindrical hollow superconductor for DC transmission cable system to reduce the AC loss

  9. Analytical description of AC losses for high temperature superconductors

    Full text: AC losses for high temperature superconductors have been calculated by considering the effects of the temperature distribution and the flux flow resistance. Maxwell's equations and thermal diffusion equation are used to calculate the distribution of magnetic field and the temperature inside the superconductors, respectively. The flux flow effect on the AC losses is calculated by using the extended critical state model. An analytical expression of the AC losses is obtained using a superposition approximation in which the cases of complete and incomplete magnetic field penetration have been distinguished. The expression can well explain the experimental observations of the frequency dependence of the AC losses per cycle in high temperature superconductors. It is clearly shown from the analytical expression that the effect of the thermal distribution inside the superconductors is different from the effect caused by flux flow resistance. In the case of incomplete magnetic penetration, the temperature distribution results in the increase of the AC losses per cycle upon frequency whereas the flux flow leads to the decrease of the AC losses per cycle upon frequency. In the case of complete magnetic penetration the results are opposite to those in the previous case. Due to the extremely strong flux flow in high temperature superconducting materials, the effect of the flux flow on the AC losses is dominant, and the overall dependence of AC losses per cycle upon frequency is controlled by the flux flow. On the other hand, because the inhomogeneous distribution of the temperature inside the superconductors which is normal higher in the center than near the edge, there is an upper limit for the frequency beyond which the superconductivity will be totally destroyed by AC losses. Analytical expressions for the critical frequency, distributions of magnetic field and critical current density are also obtained

  10. AC losses in a HTS coil carrying DC current in AC external magnetic field

    We electrically measured AC losses in a Bi2223/Ag-sheathed pancake coil excited by a DC current in AC external magnetic field. Losses in the coil contain two kinds of loss components that are the magnetization losses and dynamic resistance losses. In the measurement, current leads to supply a current to the coil were specially arranged to suppress electromagnetic coupling between the coil current and the AC external magnetic field. A double pick-up coils method was used to suppress a large inductive voltage component contained in voltage signal for measuring the magnetization losses. It was observed that the magnetization losses were dependent on the coil current and that a peak of a curve of the loss factor vs. amplitude of the AC external magnetic field shifted to lower amplitude of the AC magnetic field as the coil current increased. This result suggests the full penetration magnetic field of the coil tape decreases as the coil current increases. The dynamic resistance losses were measured by measuring a DC voltage appearing between the coil terminals. It was observed that the DC voltage appearing in the coil subject to the AC external magnetic field was much larger than that in the coil subject to DC magnetic field

  11. Theoretical analysis of ac losses in high temperature superconducting bulks

    Ac loss behavior in HTS bulk materials is studied by developing an analytic method. The self-heating effect on the distributions of temperature in HTS bulks has been calculated. A critical frequency which sets the upper limit for driving frequency of the external field in sustaining a superconducting state is obtained. Our model provides useful information of understanding the experimental phenomena, including an anomalous ac loss behavior, a retardation of the inner field respect to the external ac field, etc., in HTS bulk materials

  12. Power Loss Modeling of Isolated AC/DC Converter

    Ahmad Khan, Naveed

    2012-01-01

    Several research activities at KTH are carried out related to Isolated AC/DC converters in order to improve the design and efficiency. Concerning the improvement in the mentioned constraints, losses of the elements in the prototype converter are modeled in this thesis work. The obtained loss model is capable of calculating the losses under different circumstances. The individual contribution of losses for each element at different conditions can be obtained, which is further useful in improvi...

  13. A.C. losses in current-carrying superconductors

    The feasibility of superconductors for alternating current use depends on successful reduction of losses. Moreover, the demand for large field amplitudes is a stimulation for investigating the nature of a.c. losses (e.g. in the set of poloidal coils in a TOKAMAK). In this thesis, measurements are performed at a.c. superconductivity. Attention is given to various external field conditions as well as to self-field instability. Measurements are performed on different types of wires. A type of wire is searched for with both low losses and a good stabilization under self-field conditions. (G.J.P.)

  14. AC power losses in Bi-2223/Ag HTS tapes

    Full text: We report measurements at 77 K of the transport ac losses of Bi-2223/Ag composite tapes. The investigated tapes vary from single filament to multifilament construction and include both conventional tapes and other conductor shapes with twisted filaments. The self-field ac losses were determined at 77 K and 60 Hz as a function of ac current amplitude (0 - 100 A). We observe different behaviour among tapes depending on their quality and strain history. For 'good' virgin tapes the experimental data are well described by the Norris equations for the dependence of power loss P on the amplitude Im of the transport current. The data of good monofilament tapes are fitted to the Norris equation P ∼ Imn for an elliptical cross section (ie. n = 3) and the data of good multifilament tapes are fitted to the Norris equation for a rectangular strip (ie. n = 4). Many specimens, however, show a range of behaviour with lower values of n. Based on our work on the effect of strain on the dc transport properties of tapes, we carried out detailed investigations of the effect of controlled applied bend strain on the ac loss. Our results show that irreversible damage to superconducting filaments (ie. cracks) cause the ac loss to rise and n to decrease with increasing strain. In addition, applied strains much greater than the irreversible strain limit cause the ac loss to increase by several orders of magnitude and become ohmic in character with n = 2. Theoretical work is in progress to model the observed behaviour

  15. AC Loss Analysis on the Superconducting Coupling Magnet in MICE

    Wu, Hong; Wang, Li; Green, Michael; Li, LanKai; Xu, FengYu; Liu, XiaoKun; Jia, LinXinag

    2008-07-08

    A pair of coupling solenoids is used in MICE experiment to generate magnetic field which keeps the muons within the iris of thin RF cavity windows. The coupling solenoids have a 1.5-meter inner diameter and will produce 7.4 T peak magnetic field. Three types of AC losses in coupling solenoid are discussed. The affect of AC losses on the temperature distribution within the cold mass during charging and rapid discharging process is analyzed also. The analysis result will be further confirmed by the experiment of the prototype solenoid for coupling solenoid, which will be designed, fabricated and tested at ICST.

  16. Analysis of AC loss in superconducting power devices calculated from short sample data

    Rabbers, J.J.; Haken, ten, Bennie; Kate, ten, F.J.W.

    2003-01-01

    A method to calculate the AC loss of superconducting power devices from the measured AC loss of a short sample is developed. In coils and cables the magnetic field varies spatially. The position dependent field vector is calculated assuming a homogeneous current distribution. From this field profile and the transport current, the local AC loss is calculated. Integration over the conductor length yields the AC loss of the device. The total AC loss of the device is split up in different compone...

  17. AC losses in circular arrangements of parallel superconducting tapes

    Kühle (fratrådt), Anders Van Der Aa; Træholt, Chresten; Däumling, Manfred; Olsen, Søren Krüger; Tønnesen, Ole

    The DC and AC properties of superconducting tapes connected in parellel and arranged in a single closed layer on two tubes (correspondig to power cable models with infinite pitch) with different diameters are compared. We find that the DC properties, i.e. the critical currents of the two arrangem......The DC and AC properties of superconducting tapes connected in parellel and arranged in a single closed layer on two tubes (correspondig to power cable models with infinite pitch) with different diameters are compared. We find that the DC properties, i.e. the critical currents of the two...... arrangements, scale with the number of tapes and hence appear to be independent of the diameter.However, the AC loss per tape (for a given current per tape) appears to decrease with increasing diameter of the circular arrangement. Compared to a model for the AC loss in a continuous superconducting layer...... (Monoblock model) the measured values are about half an order of magnitude higher than expected for the small diameter arrangement. When compared to the AC loss calculated for N individual superconducting tapes using a well known model ( Norris elliptical) the difference is slightly smaller....

  18. AC losses in circular arrangements of parallel superconducting tapes

    Kühle (fratrådt), Anders Van Der Aa; Træholt, Chresten; Däumling, Manfred;

    1998-01-01

    The DC and AC properties of superconducting tapes connected in parellel and arranged in a single closed layer on two tubes (correspondig to power cable models with infinite pitch) with different diameters are compared. We find that the DC properties, i.e. the critical currents of the two arrangem......The DC and AC properties of superconducting tapes connected in parellel and arranged in a single closed layer on two tubes (correspondig to power cable models with infinite pitch) with different diameters are compared. We find that the DC properties, i.e. the critical currents of the two...... arrangements, scale with the number of tapes and hence appear to be independent of the diameter.However, the AC loss per tape (for a given current per tape) appears to decrease with increasing diameter of the circular arrangement. Compared to a model for the AC loss in a continuous superconducting layer...... (Monoblock model) the measured values are about half an order of magnitude higher than expected for the small diameter arrangement. When compared to the AC loss calculated for N individual superconducting tapes using a well known model ( Norris elliptical) the difference is slightly smaller....

  19. AC loss calculation of central solenoid model coil

    The AC loss of Central Solenoid Model Coil of ITER is calculated in order to be able to determine the allowable excitation current shape in time with respect to the available cooling capacity at liquid helium temperature. In Part A the theory is summarized essential to present calculation. This covers a semianalytical integral formulation to calculate the magnetic field distribution in the cross-section of a coil and also 2D and 3D differential formulations for eddy current calculation of jackets and structural steel components, respectively. In Part B the conditions and results of calculation are described in detail. Losses are calculated separately in different components. Also the different types of losses are separated, and only one of the followings is considered in the same time; eddy current loss, ferromagnetic hysteresis loss, superconducting hysteresis loss, coupling loss. The followings are concluded. The coupling loss was found to be the largest 83% of the total AC loss supposing 50 msec characteristic time constant. Also significant amount of heat is generated in structural steels, cooling is required for stainless steel structural components. The loss of joints is not large, however concentrated, therefore joints should receive attention. Specially Lap-type joints are critical components. The eddy current and coupling power losses can be significantly decreased by increasing the ramp-up time since they are proportional to the square of flux change rate, while superconducting and ferromagnetic hysteresis power losses decrease linearly with decreasing flux change rate. Joule losses are produced in joints even after the energizing process of the magnet, when it is driven by a constant excitation current. This propose us to keep the time of full power operation short. (J.P.N.)

  20. Total loss of AC power analysis for EPR reactor

    Darnowski, Piotr, E-mail: piotr.darnowski@itc.pw.edu.pl [Warsaw University of Technology, Institute of Heat Engineering, Nowowiejska 21/25, 00-665 Warsaw (Poland); Skrzypek, Eleonora, E-mail: eleonora.skrzypek@ncbj.gov.pl [Warsaw University of Technology, Institute of Heat Engineering, Nowowiejska 21/25, 00-665 Warsaw (Poland); National Centre for Nuclear Research (NCBJ), A. Sołtana 7, 05-400 Otwock-Świerk (Poland); Mazgaj, Piotr, E-mail: piotr.mazgaj@itc.pw.edu.pl [Warsaw University of Technology, Institute of Heat Engineering, Nowowiejska 21/25, 00-665 Warsaw (Poland); Świrski, Konrad [Warsaw University of Technology, Institute of Heat Engineering, Nowowiejska 21/25, 00-665 Warsaw (Poland); Gandrille, Pascal [AREVA NP SAS, Tour AREVA, 1 place Jean Millier, 92084 Paris La Défense (France)

    2015-08-15

    Highlights: • Total loss of AC power (Station Blackout) was simulated for the EPR reactor model. • In-vessel phase of the accident is under consideration. • Comparison of MELCOR and MAAP results is presented. • MELCOR and MAAP results are comparable. - Abstract: In this paper the results of severe accident simulations for the EPR reactor in the case of loss of offsite power combined with total failure of all diesel generators (total loss of AC power) are presented. Calculations were performed with MELCOR 2.1 computer code for in-vessel phase of the accident. In this scenario, the unavailability of all offsite and onsite power sources and the lack of cooling leads directly to core degradation, material relocation to the lower plenum and rupture of the reactor pressure vessel. MELCOR results were compared qualitatively and quantitatively with MAAP4 code results and show a good agreement.

  1. Measurement of AC losses in different former materials

    Olsen, Søren Krüger; Træholt, Chresten; Kühle, Anders Van Der Aa;

    1998-01-01

    A high temperature superconducting cable may be based on a centrally located cylindrical support, a so-called former. If electrically conductive, the former can contribute to the AC losses through eddy current losses caused by unbalanced axial and tangential magnetic fields. With these measurements...... we aim at investigating the eddy current losses of commonly used former materials. A one layer cable conductor was wound on a glass fibre reinforced polymer (GRFP) former. By inserting a variety of materials into this, it was possible to measure the eddy current losses of each of the former...... candidates separately; for example copper tubes, stainless steel braid, copper braid, corrugated stainless steel tubes, etc. The measured data are compared with the predictions of a theoretical model. Our results show that in most cases, the losses induced by eddy currents in the former are negligible...

  2. Measurement of AC losses in different former materials

    Olsen, Søren Krüger; Træholt, Chresten; Kühle, Anders Van Der Aa;

    1998-01-01

    candidates separately; for example copper tubes, stainless steel braid, copper braid, corrugated stainless steel tubes, etc. The measured data are compared with the predictions of a theoretical model. Our results show that in most cases, the losses induced by eddy currents in the former are negligible......A high temperature superconducting cable may be based on a centrally located cylindrical support, a so-called former. If electrically conductive, the former can contribute to the AC losses through eddy current losses caused by unbalanced axial and tangential magnetic fields. With these measurements...... we aim at investigating the eddy current losses of commonly used former materials. A one layer cable conductor was wound on a glass fibre reinforced polymer (GRFP) former. By inserting a variety of materials into this, it was possible to measure the eddy current losses of each of the former...

  3. Design and AC loss analysis of a superconducting synchronous motor

    This paper gives a conceptual design of a superconducting synchronous motor consisting of both high-temperature superconducting rotating field winding and armature winding. The AC losses of the armature winding of the motor have been investigated experimentally and numerically, by considering the self-field of the superconducting coils and the rotating magnetic field exposed on the armature winding. The recent developments of YBCO-coated conductors present the possibility of achieving a wholly superconducting machine of significantly smaller size and weight than a conventional machine. Both the rotating field winding and the armature winding are composed of YBCO high-temperature superconducting (HTS) coils. A low AC loss armature winding design has been developed for this superconducting synchronous motor. The performance of the machine was investigated by modelling with the finite-element method. The machine's torque is calculated from first principles by considering the angle between the field and the armature main flux lines

  4. Narrow strand YBCO Roebel cable for lowered AC loss

    We have constructed test lengths of Roebel cable from wide strips of second generation YBCO wire. The strand width is 2mm to allow for lowered AC losses in comparison with standard HTS wires. Up to 10 strands can be cut from the 40mm wide strip and assembled into a 10 strand cable with a transposition length of 90mm. Electrical measurements show good retention of critical current through the cutting and cabling processes. Initial AC loss measurements confirm the reduction expected from full width wire. Results from mechanical modeling are presented which have been used to optimise strand geometry to reduce stress concentrations. Manufacturing capability to produce up to 100m lengths has been demonstrated

  5. Design and AC loss analysis of a superconducting synchronous motor

    Jiang, Q [Cambridge University Engineering Department, Trumpington Street, Cambridge CB2 1PZ (United Kingdom); Majoros, M [Department of Materials Science and Engineering, Ohio State University (United States); Hong, Z [Cambridge University Engineering Department, Trumpington Street, Cambridge CB2 1PZ (United Kingdom); Campbell, A M [Cambridge University Engineering Department, Trumpington Street, Cambridge CB2 1PZ (United Kingdom); Coombs, T A [Cambridge University Engineering Department, Trumpington Street, Cambridge CB2 1PZ (United Kingdom)

    2006-11-15

    This paper gives a conceptual design of a superconducting synchronous motor consisting of both high-temperature superconducting rotating field winding and armature winding. The AC losses of the armature winding of the motor have been investigated experimentally and numerically, by considering the self-field of the superconducting coils and the rotating magnetic field exposed on the armature winding. The recent developments of YBCO-coated conductors present the possibility of achieving a wholly superconducting machine of significantly smaller size and weight than a conventional machine. Both the rotating field winding and the armature winding are composed of YBCO high-temperature superconducting (HTS) coils. A low AC loss armature winding design has been developed for this superconducting synchronous motor. The performance of the machine was investigated by modelling with the finite-element method. The machine's torque is calculated from first principles by considering the angle between the field and the armature main flux lines.

  6. Experimental investigation of a.c. losses in cabled superconductors

    A.c. losses in multifilamentary composite superconducting strands and cables have been measured in adiabatic conditions for transverse field sweep rates up to 50 T s-1. Measurements were performed on NbTi and Nb3Sn conductors of several configurations and surface preparations: single strands, soldered strands and cables of varying degrees of compaction composed of bare strands, with CuNi barriers and strands with chrome plating. The experimental data agree well with existing loss models. The data suggests that the total cable loss grows as approx.= 1/(void)3 below void fractions of 40%. This observed cable loss dependence on void fraction does not agree well with a previously proposed model. (author)

  7. AC losses and transient field stability of PF-FSJS sample

    This series of 17 slides deals with AC losses and transient field stability of poloidal field full-size-joint sample) which is relevant to the poloidal field coils of ITER. The topic is divided into 6 parts: 1) general - AC losses, 2) conductor magnetization, 3) conductor calorimetry, 4) conclusion on AC losses, 5) stability, and 6) conclusion on stability

  8. AC losses and transient field stability of PF-FSJS sample

    Zani, L

    2003-07-01

    This series of 17 slides deals with AC losses and transient field stability of poloidal field full-size-joint sample) which is relevant to the poloidal field coils of ITER. The topic is divided into 6 parts: 1) general - AC losses, 2) conductor magnetization, 3) conductor calorimetry, 4) conclusion on AC losses, 5) stability, and 6) conclusion on stability.

  9. AC magnetization losses in striated YBCO-123/Hastelloy coated conductors

    In this work we present experimental results of reductions in AC magnetization losses due to a striation process in YBCO-123/Hastelloy coated conductors. The measurements were carried out in a sinusoidally varying external magnetic field, with amplitudes up to 100 mT, in a frequency range of 8.5-85.4 Hz, and at a temperature of 77 K. The field was oriented perpendicularly to the face of the tapes. Sample tapes were successively patterned into the form of narrow parallel strips, by means of a photoresist lithography and chemical wet etching technique. Experimental results are discussed in the framework of existing theoretical models for energy dissipation in thin films in perpendicular AC magnetic fields

  10. AC Losses in the MICE Channel Magnets -- Is This a Curse or aBlessing?

    Green, M.A.; Wu, H.; Wang, L.; Kai, L.L.; Jia, L.X.; Yang, S.Q.

    2008-01-31

    This report discusses the AC losses in the MICE channelmagnets during magnet charging and discharging. This report talks aboutthe three types of AC losses in the MICE magnets; the hysteretic AC lossin the superconductor, the coupling AC loss in the superconductor and theeddy current AC loss in the magnet mandrel and support structure. AClosses increase the heat load at 4 K. The added heat load increases thetemperature of the second stage of the cooler. In addition, AC losscontributes to the temperature rise between the second stage cold headand the high field point of the magnet, which is usually close to themagnet hot spot. These are the curses of AC loss in the MICE magnet thatcan limit the rate at which the magnet can be charge or discharged. Ifone is willing to allow some of the helium that is around the magnet toboil away during a magnet charge or discharge, AC losses can become ablessing. The boil off helium from the AC losses can be used to cool theupper end of the HTS leads and the surrounding shield. The AC losses arepresented for all three types of MICE magnets. The AC loss temperaturedrops within the coupling magnet are presented as an example of how boththe curse and blessing of the AC losses can be combined.

  11. Development of Low AC Loss TFA-MOD Coated Conductors

    Katayama, K.; Machi, T.; Nakamura, T.; Takagi, Y.; Nakaoka, K.; Yoshizumi, M.; Izumi, T.; Shiohara, Y.

    TFA-MOD process is expected to be promising for future applications since it can produce high performance YBCO coated conductors (CCs) with low cost. Applying YBCO CCs to the power electric devices such as transformers and power cables, the reduction of alternating current (AC) loss for long wire is necessary. Multi-filamentation process, which is one of the most effective approaches for AC loss reduction, has been developed by the scribing process. We have developed the filamentation process using chemical etching. MOD derived CCs are, however, easily damaged in the chemical etching process due to existence of pores in a YBCO layer, resulting in critical current (Ic)-degradation and weak delamination strength. Consequently, it is difficult to scribe MOD derived CCs into 1mm-wide filaments for long length using the chemical etching process. Accordingly, we have studied a scribing process using an excimer laser without chemical etching. We defined P' value in this study as a function of irradiated laser power [J] divided by processing speed[m/s]. We studied relationship between the P' value and the results of scribing. It was found that we could scribe the C.C. with a sufficient depth in the condition of large P' value. Furthermore, we found that the Ic was degraded with further increase of the P' value. A 5 mm wide short sample was divided into 10 filaments by the excimer laser scribing process at the P' of 9[J/(m/s)]. The sample revealed reduction of the hysteresis loss down to 1/10 which could be expected from a theoretical prediction using the numbers of the filaments. Ic-degradation was suppressed as 28%, which was smaller than that of the scribed sample using chemical etching (Ic degradation was 38%). Subsequently, we applied the technique to a 100m long YBCO CC. The hysteresis loss of the 100m long MOD derived CC was reduced down to 1/10 (1/the number of filaments) after the multi-filamentation.

  12. Evaluation of AC losses for HT-7U CICC on plasma disruption

    AC loss is one of the main issues in the design of the CICC used for PF and TF coils of superconducting tokamak. A preliminary calculation of AC loss for the designed HT-7U CICCs used for TF magnets is given. The authors only consider the hysteresis and coupling losses related to transversal and longitudinal kinds. In addition to the strand resistive barriers (Pb-30Sn-2Sb coating for NbTi strands), a stainless steel strip has been used inside these cables to reduce the AC loss in this kind of conductor. The available theory has enabled to emphasize the role played by the stainless steel strip in the reduction of total AC losses in this kind of conductor. It was shown that AC losses of cable were affected by the structure and change rate of magnetic field

  13. Modelling of AC loss in coils made of thin tapes under DC bias current

    Pardo, Enric

    2013-01-01

    Many applications, such as magnets and SMES, are usually charged and discharged under a bias DC current, which may increase the AC loss. For their design, it is necessary to understand and predict the AC loss. This article analises the AC loss in magnet-like coils under DC bias contribution super-imposed to the AC current. The analysis is based on a numerical model that takes the interaction between magnetization currents in all turns into account. The studied example is a stack of 32 pancake...

  14. AC Losses and Their Thermal Effect in High-Temperature Superconducting Machines

    Song, Xiaowei (Andy); Mijatovic, Nenad; Zou, Shengnan;

    2016-01-01

    approximation and solves the H formulation. Afterward, the computed ac losses are considered as the heat source in a thermal model to study the temperature profile in HTS windings. The method proposed is able to evaluate ac losses and their thermal effect, thus providing a reference to design an HTS machine and...

  15. AC Losses and Their Thermal Effect in High Temperature Superconducting Machines

    Song, Xiaowei (Andy); Mijatovic, Nenad; Zou, Shengnan;

    2015-01-01

    homogeneous approximation and solves the H formulation. Afterwards, the computed AC losses are considered as the heat source in a thermal model to study the temperature profile in HTS windings. The method proposed is able to evaluate AC losses and their thermal effect, thus providing a reference to design an...

  16. Complex study of transport AC loss in various 2G HTS racetrack coils

    Chen, Yiran, E-mail: yc315@cam.ac.uk [University of Cambridge, 9 JJ Thomson Avenue, Cambridge CB3 0FA (United Kingdom); Zhang, Min; Chudy, Michal; Matsuda, Koichi; Coombs, Tim [University of Cambridge, 9 JJ Thomson Avenue, Cambridge CB3 0FA (United Kingdom)

    2013-04-15

    Highlights: ► Comparing transport AC losses of two types of 2G HTS racetrack coils. ► The magnetic substrate in the MAG RABITS coil is the main difference. ► Experimental data agree well with simulation results. ► The transport AC loss in the MAG RABITS coil is 36% higher than that in the IBAD coil. ► It is better to keep all the substrate non-magnetic. -- Abstract: HTS racetrack coils are becoming important elements of an emerging number of superconducting devices such as generators or motors. In these devices the issue of AC loss is crucial, as performance and cooling power are derived from this quantity. This paper presents a comparative study of transport AC loss in two different types of 2G HTS racetrack coils. In this study, both experimental measurements and computer simulation approaches were employed. All the experiments were performed using classical AC electrical method. The finite-element computer model was used to estimate electromagnetic properties and calculate transport AC loss. The main difference between the characterized coils is covered inside tape architectures. While one coil uses tape based on RABITS magnetic substrate, the second coil uses a non-magnetic tape. Ferromagnetic loss caused by a magnetic substrate is an important issue involved in the total AC loss. As a result, the coil with the magnetic substrate surprised with high AC loss and rather low performance.

  17. Analysis of AC loss in superconducting power devices calculated from short sample data

    Rabbers, J.J.; Haken, ten B.; Kate, ten H.H.J.

    2003-01-01

    A method to calculate the AC loss of superconducting power devices from the measured AC loss of a short sample is developed. In coils and cables the magnetic field varies spatially. The position dependent field vector is calculated assuming a homogeneous current distribution. From this field profile

  18. AC loss measurements in HTS coil assemblies with hybrid coil structures

    Jiang, Zhenan; Long, Nicholas J.; Staines, Mike; Badcock, Rodney A.; Bumby, Chris W.; Buckley, Robert G.; Amemiya, Naoyuki

    2016-09-01

    Both AC loss and wire cost in coil windings are critical factors for high temperature superconductor (HTS) AC machinery applications. We present AC loss measurement results in three HTS coil assemblies at 77 K and 65 K which have a hybrid coil structure comprising one central winding (CW) and two end windings (EWs) wound with ReBCO and BSCCO wires with different self-field I c values at 77 K. All AC loss results in the coil assemblies are hysteretic and the normalized AC losses in the coil assemblies at different temperatures can be scaled with the I c value of the coil assemblies. The normalised results show that AC loss in a coil assembly with BSCCO CW can be reduced by using EWs wound with high I c ReBCO wires, whilst further AC loss reduction can be achieved by replacing the BSCCO CW with ReBCO CW. The results imply that a flexible hybrid coil structure is possible which considers both AC loss and wire cost in coil assemblies.

  19. Reducing AC-Winding Losses in High-Current High-Power Inductors

    Nymand, Morten; Madawala, Udaya K.; Andersen, Michael Andreas E.;

    2009-01-01

    Foil windings are preferable in high-current high-power inductors to realize compact designs and to reduce dc-current losses. At high frequency, however, proximity effect will cause very significant increase in ac resistance in multi-layer windings, and lead to high ac winding losses. This paper...... presents design, analysis and experimental verification of a two winding technique, which significantly reduces ac winding losses without compromising dc losses. The technique uses an inner auxiliary winding, which is connected in parallel with an outer main winding. The auxiliary winding is optimally...

  20. The scaling of transport AC losses in Roebel cables with varying strand parameters

    A Roebel cable is a good candidate for low-voltage windings in a high-temperature superconductor (HTS) transformer because of its high current-carrying capability and low AC loss. Transport AC loss measurements were carried out in 1.8 m long 15/5 (fifteen 5 mm wide strands) and 15/4 Roebel cables. The results were compared with those in many Roebel cables composed of 2 mm wide Roebel strands. Comparison of the AC losses hinted that the intrinsic difference in normalized transport AC losses is due to differences in the g/w (ratio of the horizontal gap between the Roebel strands over the Roebel strand width) values. The intrinsic difference was confirmed by measuring transport AC loss in a series of horizontally arranged parallel conductor pairs with various g values. A method to scale transport AC losses in Roebel cables with varying strand parameters was developed. The scaling method will be useful for a rough assessment of AC loss in one-layer solenoid winding coils, such as in a HTS transformer. (papers)

  1. Calorimetric method of ac loss measurement in a rotating magnetic field

    A method is described for calorimetric ac-loss measurements of high-Tc superconductors (HTS) at 80 K. It is based on a technique used at 4.2 K for conventional superconducting wires that allows an easy loss measurement in parallel or perpendicular external field orientation. This paper focuses on ac loss measurement setup and calibration in a rotating magnetic field. This experimental setup is to demonstrate measuring loss using a temperature rise method under the influence of a rotating magnetic field. The slight temperature increase of the sample in an ac-field is used as a measure of losses. The aim is to simulate the loss in rotating machines using HTS. This is a unique technique to measure total ac loss in HTS at power frequencies. The sample is mounted on to a cold finger extended from a liquid nitrogen heat exchanger (HEX). The thermal insulation between the HEX and sample is provided by a material of low thermal conductivity, and low eddy current heating sample holder in vacuum vessel. A temperature sensor and noninductive heater have been incorporated in the sample holder allowing a rapid sample change. The main part of the data is obtained in the calorimetric measurement is used for calibration. The focus is on the accuracy and calibrations required to predict the actual ac losses in HTS. This setup has the advantage of being able to measure the total ac loss under the influence of a continuous moving field as experienced by any rotating machines.

  2. Calorimetric method of ac loss measurement in a rotating magnetic field

    Ghoshal, P. K. [Oxford Instruments NanoScience, Abingdon, Oxfordshire OX13 5QX (United Kingdom); Coombs, T. A.; Campbell, A. M. [Department of Engineering, Electrical Engineering, University of Cambridge, Cambridge CB3 0FA (United Kingdom)

    2010-07-15

    A method is described for calorimetric ac-loss measurements of high-T{sub c} superconductors (HTS) at 80 K. It is based on a technique used at 4.2 K for conventional superconducting wires that allows an easy loss measurement in parallel or perpendicular external field orientation. This paper focuses on ac loss measurement setup and calibration in a rotating magnetic field. This experimental setup is to demonstrate measuring loss using a temperature rise method under the influence of a rotating magnetic field. The slight temperature increase of the sample in an ac-field is used as a measure of losses. The aim is to simulate the loss in rotating machines using HTS. This is a unique technique to measure total ac loss in HTS at power frequencies. The sample is mounted on to a cold finger extended from a liquid nitrogen heat exchanger (HEX). The thermal insulation between the HEX and sample is provided by a material of low thermal conductivity, and low eddy current heating sample holder in vacuum vessel. A temperature sensor and noninductive heater have been incorporated in the sample holder allowing a rapid sample change. The main part of the data is obtained in the calorimetric measurement is used for calibration. The focus is on the accuracy and calibrations required to predict the actual ac losses in HTS. This setup has the advantage of being able to measure the total ac loss under the influence of a continuous moving field as experienced by any rotating machines.

  3. Calorimetric method of ac loss measurement in a rotating magnetic field

    Ghoshal, P. K.; Coombs, T. A.; Campbell, A. M.

    2010-07-01

    A method is described for calorimetric ac-loss measurements of high-Tc superconductors (HTS) at 80 K. It is based on a technique used at 4.2 K for conventional superconducting wires that allows an easy loss measurement in parallel or perpendicular external field orientation. This paper focuses on ac loss measurement setup and calibration in a rotating magnetic field. This experimental setup is to demonstrate measuring loss using a temperature rise method under the influence of a rotating magnetic field. The slight temperature increase of the sample in an ac-field is used as a measure of losses. The aim is to simulate the loss in rotating machines using HTS. This is a unique technique to measure total ac loss in HTS at power frequencies. The sample is mounted on to a cold finger extended from a liquid nitrogen heat exchanger (HEX). The thermal insulation between the HEX and sample is provided by a material of low thermal conductivity, and low eddy current heating sample holder in vacuum vessel. A temperature sensor and noninductive heater have been incorporated in the sample holder allowing a rapid sample change. The main part of the data is obtained in the calorimetric measurement is used for calibration. The focus is on the accuracy and calibrations required to predict the actual ac losses in HTS. This setup has the advantage of being able to measure the total ac loss under the influence of a continuous moving field as experienced by any rotating machines.

  4. Segmented superconducting tape having reduced AC losses and method of making

    Foltyn, Stephen R. (Los Alamos, NM); Jia, Quanxi (Los Alamos, NM); Arendt, Paul N. (Los Alamos, NM); Holesinger, Terry G. (Los Alamos, NM); Wang, Haiyan (Los Alamos, NM)

    2009-09-22

    A superconducting tape having reduced AC losses. The tape has a high temperature superconductor layer that is segmented. Disruptive strips, formed in one of the tape substrate, a buffer layer, and the superconducting layer create parallel discontinuities in the superconducting layer that separate the current-carrying elements of the superconducting layer into strips or filament-like structures. Segmentation of the current-carrying elements has the effect of reducing AC current losses. Methods of making such a superconducting tape and reducing AC losses in such tapes are also disclosed.

  5. Effect of combining a DC bias current with an AC transport current on AC losses in a High Temperature Superconductor

    Dolez, Patricia; Ligneris, Benoit des; Aubin, Marcel; Zhu, When; Cave, Julian

    1998-01-01

    Creating complex flux configurations by superposing a dc current or magnetic field onto the ac current in a type II superconducting tape should lead to a variety of peculiar behaviors. An example is the appearance of the Clem valley, a minimum in the ac losses as a function of the dc bias amplitude, which has been theoretically studied by LeBlanc et al., in the continuation of Clem's calculations. These situations have been investigated by applying a dc current to a silver-gold sheathed Bi-22...

  6. Dissipation and AC loss in high Tc superconductors destined for power applications

    Full text: Superconductivity, which was discovered at the beginning of this century, has long been promoted as a solution to many power engineering problems. This was because a superconductor exhibits zero resistance to DC currents and a very low resistance to AC currents. Historically however, power utility applications, whilst technically feasible, were not economically viable. With the discovery of high temperature superconductors in the late 80's there has been a resurgence of interest in the use of superconductivity for power applications: cables, motors, generators, transformers, fault current limiters. In order for power applications of superconductors to be realized, in addition to a high current density, low AC losses and transient stability are also necessary. Whilst much work worldwide has been devoted to increasing critical current densities of high Tc materials, reliable AC loss characterisation of power applications and low loss conductor designs optimized for each application still remain to be developed. Here, calorimetric methods for the measurement of AC losses for high Tc wires will be compared to electric and magnetization methods. The relative merits of each method will be discussed. One of the key differences between high and low Tc superconductors is in the nature of E-J curves. In high Tc materials these curves are extended, i.e. E increases gradually with J. This has consequences for both AC losses and stability. In this article the nature of AC losses and stability in high temperature superconducting wires will be discussed: hysteretic losses, eddy current losses, role of flux creep, anisotropy, dimensional effects ..., and compared to those for low temperature wires such as multifilamentary NbTi and NbSn. In conclusion, the key requirements will be discussed that must be achieved in order that superconducting technologies gain acceptance in power engineering applications: current density, AC losses, transient response, mechanical

  7. Ac loss characteristics of YBCO superconducting tapes fabricated by TFA-MOD technique

    We investigated the ac loss properties of a YBCO superconducting tape fabricated by TFA-MOD technique. The thickness of the YBCO layer is 1.2 μm. A 6-tape stack of 50 mm in length and 10 mm in width was inserted into a saddle-shaped pickup coil. The ac loss was measured at 35-77 K by applying an external ac magnetic field. The magnetic field angle was changed by rotating the sample stack around its longitudinal axis. The effective penetration field, which corresponds to the breaking point of an ac loss curve, decreased with increasing field angle though it was much smaller than that which was estimated for a superconducting slab with the same thickness as the width of a tape. As a result, the ac loss increased monotonically with an increasing field angle against the wide surface for any amplitude. The observed field angular dependence of the ac loss agreed with the theoretically predicted one by using the observed ac losses in perpendicular magnetic field. Anyway the ac loss for a larger amplitude than the effective penetration field was proportional to the critical current density and the projective width of a tape in the direction of the applied magnetic field for any field angle and any temperature as well known. In addition we estimated the magnetic field, B, dependence of the critical current, I c, from the observed magnetization curves. It was shown that zero-field I c appeared to be a linear function of temperature and I c-B characteristics was scaled with zero-field I c. We also discussed a difference in I c-B characteristics and its temperature dependence between TFA-MOD tapes and IBAD-PLD ones

  8. Ac loss characteristics of YBCO superconducting tapes fabricated by TFA-MOD technique

    Iwakuma, Masataka; Nigo, Masahiro; Inoue, Daisuke; Miyamoto, Naoya; Kiss, Takanobu; Funaki, Kazuo; Iijima, Yasuhiro; Saitoh, Takashi; Izumi, Teruo; Yamada, Yutaka; Shiohara, Yuu

    2005-10-01

    We investigated the ac loss properties of a YBCO superconducting tape fabricated by TFA-MOD technique. The thickness of the YBCO layer is 1.2 μm. A 6-tape stack of 50 mm in length and 10 mm in width was inserted into a saddle-shaped pickup coil. The ac loss was measured at 35-77 K by applying an external ac magnetic field. The magnetic field angle was changed by rotating the sample stack around its longitudinal axis. The effective penetration field, which corresponds to the breaking point of an ac loss curve, decreased with increasing field angle though it was much smaller than that which was estimated for a superconducting slab with the same thickness as the width of a tape. As a result, the ac loss increased monotonically with an increasing field angle against the wide surface for any amplitude. The observed field angular dependence of the ac loss agreed with the theoretically predicted one by using the observed ac losses in perpendicular magnetic field. Anyway the ac loss for a larger amplitude than the effective penetration field was proportional to the critical current density and the projective width of a tape in the direction of the applied magnetic field for any field angle and any temperature as well known. In addition we estimated the magnetic field, B, dependence of the critical current, Ic, from the observed magnetization curves. It was shown that zero-field Ic appeared to be a linear function of temperature and Ic-B characteristics was scaled with zero-field Ic. We also discussed a difference in Ic-B characteristics and its temperature dependence between TFA-MOD tapes and IBAD-PLD ones.

  9. Structural and AC loss study for pure and doped MgB{sub 2} superconductor

    Hansdah, J. S.; Sarun, P. M., E-mail: sarun.res@gmail.com [Functional Ceramics Lab, Department of Applied Physics, Indian School of Mines (ISM), Dhanbad – 826004 (India)

    2015-06-24

    Superconducting polycrystalline bulk MgB{sub 2} samples doped with n-C, n-Y{sub 2}O{sub 3} and n-Ho{sub 2}O{sub 3} were prepared by powder-in-sealed (PIST) method. XRD measurement shows the influence of dopants on phase and lattice parameters of samples. The ac susceptibility measurement reveals ac loss and activation energy of the samples. Nano-C doped sample shows less ac loss in all frequency (208 Hz – 999 Hz) among the doped samples; whereas n-Ho{sub 2}O{sub 3} doped sample shows highest ac loss. The activation energy is high for rare earth (n-Y{sub 2}O{sub 3} and n-Ho{sub 2}O{sub 3}) doped samples as compare to n-C doped samples which reveals the enhancement in flux-pinning properties of these materials.

  10. Transport ac losses in Bi-2223 multifilamentary tapes - conductor materials aspect

    Transport ac losses in technical superconductors based on Bi-2223 tape material are influenced by many parameters. The major factors that define the ac performance of such conductors are the following: the size and number of filaments, their geometrical arrangement in the cross-section of the conductor, the twist pitch length, the resistivity of the matrix, the presence of oxide barriers around the filaments and deformation procedures such as sequential pressing or rolling followed by appropriate thermal treatment. In the present paper the above aspects are addressed from the viewpoint of the materials science of technical conductor design. Transport ac losses at power frequencies in different types of Bi-2223 conductor are presented and analysed. The results of conductor design analysis with respect to the coexistence of the superconductor with other materials in the conductor structure are presented. New concepts for minimization of the transport ac losses are discussed in detail. (author)

  11. AC loss in high-temperature superconducting conductors, cables and windings for power devices

    High-temperature superconducting (HTS) transformers and reactor coils promise decreased weight and volume and higher efficiency. A critical design parameter for such devices is the AC loss in the conductor. The state of the art for AC-loss reduction in HTS power devices is described, starting from the loss in the single HTS tape. Improved tape manufacturing techniques have led to a significant decrease in the magnetization loss. Transport-current loss is decreased by choosing the right operating current and temperature. The role of tape dimensions, filament twist and resistive matrix is discussed and a comparison is made between state-of-the-art BSCCO and YBCO tapes. In transformer and reactor coils the AC loss in the tape is influenced by adjacent tapes in the coil, fields from other coils, overcurrents and higher harmonics. These factors are accounted for by a new AC-loss prediction model. Field components perpendicular to the tape are minimized by optimizing the coil design and by flux guidance pieces. High-current windings are made of Roebel conductors with transposed tapes. The model iteratively finds the temperature distribution in the winding and predicts the onset of thermal instability. We have fabricated and tested several AC windings and used them to validate the model. Now we can confidently use the model as an engineering tool for designing HTS windings and for determining the necessary tape properties

  12. Distribution of AC loss in a HTS magnet for SMES with different operating conditions

    Xu, Y., E-mail: xuyinghust@163.com [State Key Laboratory of Advanced Electromagnetic Engineering and Technology, R and D Center of Applied Superconductivity, Huazhong University of Science and Technology, Wuhan 430074 (China); Tang, Y.; Ren, L.; Jiao, F. [State Key Laboratory of Advanced Electromagnetic Engineering and Technology, R and D Center of Applied Superconductivity, Huazhong University of Science and Technology, Wuhan 430074 (China); Song, M.; Cao, K.; Wang, D. [Yunnan Electric Power Research Institute, Kunming City 650217 (China); Wang, L.; Dong, H. [State Key Laboratory of Advanced Electromagnetic Engineering and Technology, R and D Center of Applied Superconductivity, Huazhong University of Science and Technology, Wuhan 430074 (China)

    2013-11-15

    Highlights: •We present a model to calculate the distribution of AC loss for a storage magnet. •Comparative analysis of AC loss with different operating conditions has done. •The nonuniform distribution factor “d” is proposed to estimate the inhomogeneity of a storage magnet. •The model predicts the loss distribution and crucial areas which are suffering from the high AC loss. This is significant for the conduction-cooled structure design. -- Abstract: The AC loss induced in superconducting tape may affect the performance of a superconducting device applied to power system, such as transformer, cable, motor and even Superconducting Magnetic Energy Storage (SMES). The operating condition of SMES is changeable due to the need of compensation to the active or reactive power according to the demand of a power grid. In this paper, it is investigated that the distribution of AC loss for a storage magnet on different operating conditions, which is based on finite element method (FEM) and measured properties of BSCCO/Ag tapes. This analytical method can be used to optimize the SMES magnet.

  13. Test results of the 100 kWh SMES model coil. AC loss performance

    In order to establish a technology needed for a small-scale 100 kWh SMES device, a SMES model coil was fabricated. Performance tests were carried out at the Japan Atomic Energy Research Institute (JAERI) in 1996. After that, the coil was installed in facilities of the Lawrence Livermore National Laboratory (LLNL) and tested in 1998, in collaboration between Japan and the United States. The AC loss results at LLNL were in good agreement with those at JAERI. It was reconfirmed from the results that the coupling loss of the coil consists of two components with short and long time constants. We found out from the signals of Hall probes that the current loops with long decay time constants were induced in the CIC conductor. These loops could enhance additional AC loss in the coil. To reduce the AC loss, we made small-sized CIC conductor of strands having a CuNi surface, a fabricated the small coil. The measured AC loss of the small coil was reduced to about 1/6. The CuNi surface on the strands was demonstrated to be effective to reduce AC loss in the coil. (author)

  14. Theory of AC Loss in Cables with 2G HTS Wire

    Clem, J.R.; Malozemoff, A.P.

    2009-09-13

    While considerable work has been done to understand AC losses in power cables made of first generation (1G) high temperature superconductor (HTS) wires, use of second generation (2G) HTS wires brings in some new considerations. The high critical current density of the HTS layer 2G wire reduces the surface superconductor hysteretic losses. Instead, gap and polygonal losses, flux transfer losses in imbalanced two layer cables and ferromagnetic losses for wires with NiW substrates constitute the principal contributions. Current imbalance and losses associated with the magnetic substrate can be minimized by orienting the substrates of the inner winding inward and the outer winding outward.

  15. Modelling and measurement of ac loss in BSCCO/Ag-tape windings

    High-temperature superconducting (HTS) transformers promise decreased weight and volume and higher efficiency. A 1 MVA HTS railway transformer was built and tested at Siemens AG. This paper deals with the prediction of ac loss in the BSCCO/Ag-tape windings. In a railway transformer the tape carries ac current in alternating field, the temperature differs from 77 K, tapes are stacked or cabled and overcurrents and higher harmonics occur. In ac-loss literature these issues are treated separately, if at all. We have developed a model that predicts the ac loss in sets of BSCCO/Ag-tape coils, and deals with the above-mentioned issues. The effect of higher harmonics on the loss in HTS tapes is considered for the first time. The paper gives a complete overview of the model equations and required input parameters. The model is validated over a wide range of the input parameters, using the measured critical current and ac loss of single tapes, single coils and sets of coils in the 1 MVA transformer. An accuracy of around 25% is achieved in all relevant cases. Presently the model is developed further, in order to describe other HTS materials and other types of applications

  16. Modelling and measurement of ac loss in BSCCO/Ag-tape windings

    Oomen, M. P.; Nanke, R.; Leghissa, M.

    2003-03-01

    High-temperature superconducting (HTS) transformers promise decreased weight and volume and higher efficiency. A 1 MVA HTS railway transformer was built and tested at Siemens AG. This paper deals with the prediction of ac loss in the BSCCO/Ag-tape windings. In a railway transformer the tape carries ac current in alternating field, the temperature differs from 77 K, tapes are stacked or cabled and overcurrents and higher harmonics occur. In ac-loss literature these issues are treated separately, if at all. We have developed a model that predicts the ac loss in sets of BSCCO/Ag-tape coils, and deals with the above-mentioned issues. The effect of higher harmonics on the loss in HTS tapes is considered for the first time. The paper gives a complete overview of the model equations and required input parameters. The model is validated over a wide range of the input parameters, using the measured critical current and ac loss of single tapes, single coils and sets of coils in the 1 MVA transformer. An accuracy of around 25% is achieved in all relevant cases. Presently the model is developed further, in order to describe other HTS materials and other types of applications.

  17. Measurement of AC losses in a racetrack superconducting coil made from YBCO coated conductor

    Seiler, Eugen; Abrahamsen, Asger Bech; Kovac, Jan;

    2012-01-01

    We present the results of transport measurements of AC losses in a racetrack shaped superconducting coil made from coated conductor tape. The outer dimensions of the coil are approximately 24 cm × 12 cm and it has 57 turns. The coil is impregnated with epoxy resin and fiberglass tape is used to...... insulate the individual turns and to improve the mechanical properties of the epoxy when exposed to thermal cycling. The coil is manufactured as a part of the field winding of a small synchronous generator; therefore stainless steel frames are installed on the inner and outer side of the winding to...... reinforce it. The AC loss is measured versus the transport current Ia with the coil immersed in liquid nitrogen. Measurements at frequencies 21 Hz, 36 Hz and 72 Hz are compared. The AC losses follow I2 a dependence at low current amplitudes and I3 a at high amplitudes. After cutting the inner steel frame...

  18. Low AC Loss YBCO Coated Conductor Geometry by Direct Inkjet Printing

    Rupich, Martin, Dr. [American Superconductor Corporation; Duckworth, Robert, Dr. [Oak Ridge National Laboratory

    2009-10-01

    The second generation (2G) high temperature superconductors (HTS) wire offers potential benefits for many electric power applications, including ones requiring filamentized conductors with low ac loss, such as transformers and fault current limiters. However, the use of 2G wire in these applications requires the development of both novel multi-filamentary conductor designs with lower ac losses and the development of advanced manufacturing technologies that enable the low-cost manufacturing of these filamentized architectures. This Phase I SBIR project focused on testing inkjet printing as a potential low-cost, roll-to-roll manufacturing technique to fabricate potential low ac loss filamentized architectures directly on the 2G template strips.

  19. A numerical method to estimate AC loss in superconducting coated conductors by finite element modelling

    Hong, Z; Jiang, Q; Pei, R; Campbell, A M; Coombs, T A [Engineering Department, University of Cambridge, Trumpington Street, Cambridge CB2 1PZ (United Kingdom)

    2007-04-15

    A finite element method code based on the critical state model is proposed to solve the AC loss problem in YBCO coated conductors. This numerical method is based on a set of partial differential equations (PDEs) in which the magnetic field is used as the state variable. The AC loss problems have been investigated both in self-field condition and external field condition. Two numerical approaches have been introduced: the first model is configured on the cross-section plane of the YBCO tape to simulate an infinitely long superconducting tape. The second model represents the plane of the critical current flowing and is able to simulate the YBCO tape with finite length where the end effect is accounted. An AC loss measurement has been done to verify the numerical results and shows a good agreement with the numerical solution.

  20. AC losses in superconductors with a power-law constitutive relation

    Highlights: • Derivation of power-law constitutive-relation from distributed Anderson–Kim theory. • The electric-field for HTS constitutive-relation satisfies nonlinear heat-equation. • For slab, AC losses scale as B0m, m = 3–4 and I3 with field-amplitude and current, respectively. • Calculated pinning potential, AC-losses scaling is consistent with BSCCO data. - Abstract: The observed constitutive relation between the electrical field and current density in cuprates high temperature superconductors is a power-law of the current. This functional dependence is presumably related to the giant flux-creep domain. It is shown that this constitutive relation reflects the statistical spread of the pinning potential associated with creep motion of vortex bundles. The AC losses emanating from a power-law constitutive relation are calculated in an approach focused on the superconductor’s electric field. For a slab geometry in the presence of a parallel AC magnetic field or transport current, the calculated AC-loss scaling laws are consistent with BSCCO data and the critical state model. Extensions of the approach are briefly discussed

  1. AC losses in superconductors with a power-law constitutive relation

    Agassi, Y.D., E-mail: yehoshua.agassi@navy.mil

    2015-10-15

    Highlights: • Derivation of power-law constitutive-relation from distributed Anderson–Kim theory. • The electric-field for HTS constitutive-relation satisfies nonlinear heat-equation. • For slab, AC losses scale as B{sub 0}{sup m}, m = 3–4 and I{sup 3} with field-amplitude and current, respectively. • Calculated pinning potential, AC-losses scaling is consistent with BSCCO data. - Abstract: The observed constitutive relation between the electrical field and current density in cuprates high temperature superconductors is a power-law of the current. This functional dependence is presumably related to the giant flux-creep domain. It is shown that this constitutive relation reflects the statistical spread of the pinning potential associated with creep motion of vortex bundles. The AC losses emanating from a power-law constitutive relation are calculated in an approach focused on the superconductor’s electric field. For a slab geometry in the presence of a parallel AC magnetic field or transport current, the calculated AC-loss scaling laws are consistent with BSCCO data and the critical state model. Extensions of the approach are briefly discussed.

  2. A Simplified Model to Calculate AC Losses in Large 2G HTS Coils

    Song, Xiaowei (Andy); Mijatovic, Nenad; Jensen, Bogi Bech;

    2015-01-01

    AC losses are of great significance to quantify the performance of high temperature superconducting (HTS) devices. This paper presents a simplified model to calculate AC losses in large 2G HTS coils, which serves as a baseline to study HTS large scale applications such as electric machines. The....... The model presented uses H formulation which directly solves magnetic fields, and the general partial differential equations (PDEs) module in Comsol Multiphysics is used to implement the model. Afterwards, the model is used to simulate the excitation stage of a racetrack HTS coil with 350 tapes. The...

  3. Distribution of AC loss in a HTS magnet for SMES with different operating conditions

    Xu, Y.; Tang, Y.; Ren, L.; Jiao, F.; Song, M.; Cao, K.; Wang, D.; Wang, L.; Dong, H.

    2013-11-01

    The AC loss induced in superconducting tape may affect the performance of a superconducting device applied to power system, such as transformer, cable, motor and even Superconducting Magnetic Energy Storage (SMES). The operating condition of SMES is changeable due to the need of compensation to the active or reactive power according to the demand of a power grid. In this paper, it is investigated that the distribution of AC loss for a storage magnet on different operating conditions, which is based on finite element method (FEM) and measured properties of BSCCO/Ag tapes. This analytical method can be used to optimize the SMES magnet.

  4. AC loss in superconducting wires operating in a wind turbine like generator

    Seiler, Eugen; Zirngibl, Thomas; Mijatovic, Nenad;

    2010-01-01

    We have manufactured a small circular superconducting coil impregnated with epoxy fibreglass. The coil was wound from a Bi-2223/Ag superconducting wire and it was tested in liquid nitrogen at 77 K. Current-voltage characteristic and the AC losses of the coil were measured and compared with the...

  5. AC losses in arrays of superconducting strips on buffered metallic substrates

    Full text: The effect of subdividing superconducting YBCO films on YSZ-buffered hastelloy substrates into arrays of parallel strips on the AC loss was investigated theoretically and experimentally. The hysteretic and eddy current contributions to the AC loss of such arrays were calculated as a function of temperature and applied AC magnetic field amplitude and frequency for different width and lateral separation of the strips as well as substrate and film thickness. It is shown that subdivision of a strip into sub-strips reduces the hysteretic loss proportional to the number of sub-strips. Measurements of the loss component of the AC susceptibility, X'', confirm the theoretical predictions. When the film is subdivided into N parallel strips, the frequency-independent hysteretic contribution to X'', which is dominant at lower frequencies (f ∼ 100 Hz), decreases to 1/N of its original value. As the strips become wider or their separation becomes smaller, the hysteretic X'' increases. The eddy current contribution to X'', which originates from the metallic substrate, becomes prominent as the frequency increases, approaching a linear frequency dependence at high frequencies. Its weak temperature dependence reflects that of the hastelloy resistivity

  6. AC-loss considerations of a pulse SMES for an accelerator

    Lyly, M.; Hiltunen, I.; Järvelä, J.; Korpela, A.; Lehti, L.; Stenvall, A.; Mikkonen, R.

    2010-06-01

    In particle accelerators quasi-DC superconducting magnets are used to keep particles in desired tracks. The needed rapid field variations of these high energy magnets require large energy bursts. If these bursts are taken from and fed back to the utility grid, its voltage is distorted and the quality of the electricity degrades. In addition, these bursts may decrease operation life time of generators and extra arrangements may be required by the electricity producers. Thus, an energy storage is an essential component for a cost-effective particle accelerator. Flywheels, capacitors and superconducting magnetic energy storage (SMES) are possible options for these relatively large and high power energy storages. Here we concentrate on AC-loss of a pulse SMES aiming to demonstrate the feasibility of NbTi SMES in a particle accelerator. The designing of a SMES requires highly reliable AC-loss simulations. In this paper, calorimetric AC-loss measurements of a NbTi magnet have been carried out to consider conductor's suitability in a pulse SMES. In addition, the measured results are compared with AC-loss simulations.

  7. AC-loss considerations of a pulse SMES for an accelerator

    Lyly, M; Hiltunen, I; Jaervelae, J; Korpela, A; Lehti, L; Stenvall, A; Mikkonen, R, E-mail: mika.lyly@tut.f [Tampere University of Technology, Electromagnetics, PO Box 692, FI-33101 (Finland)

    2010-06-01

    In particle accelerators quasi-DC superconducting magnets are used to keep particles in desired tracks. The needed rapid field variations of these high energy magnets require large energy bursts. If these bursts are taken from and fed back to the utility grid, its voltage is distorted and the quality of the electricity degrades. In addition, these bursts may decrease operation life time of generators and extra arrangements may be required by the electricity producers. Thus, an energy storage is an essential component for a cost-effective particle accelerator. Flywheels, capacitors and superconducting magnetic energy storage (SMES) are possible options for these relatively large and high power energy storages. Here we concentrate on AC-loss of a pulse SMES aiming to demonstrate the feasibility of NbTi SMES in a particle accelerator. The designing of a SMES requires highly reliable AC-loss simulations. In this paper, calorimetric AC-loss measurements of a NbTi magnet have been carried out to consider conductor's suitability in a pulse SMES. In addition, the measured results are compared with AC-loss simulations.

  8. AC loss performance of cable-in-conduit conductor. Influence of cable mechanical property on coupling loss reduction

    The ITER Central Solenoid (CS) model coil, CS Insert and Nb3Al Insert were developed and tested from 2000 to 2002. The AC loss performances of these coils were investigated in various experiments. In addition, the AC losses of the CS and Nb3Al Insert conductors were measured using short CS and Nb3Al Insert conductors before the coil tests. The coupling time constants of these conductors were estimated to be 30 and 120 ms, respectively. On the other hand, the test results of the CS and Nb3Al Inserts show that the coupling currents induced in these conductors had multiple decay time constants. In fact, the existence of the coupling currents with long decay time constants, the order of which was in the thousands of seconds, was directly observed with hall sensors and voltage taps. Moreover, the AC loss test results show that electromagnetic force decreases coupling losses with exponential decay constants. This is because the weak sinter among the strands, which originated during heat treatment, was broken due to the electromagnetic force, and then the contact resistance among strands increased. It was found that this exponential decay constant was the function of a gap (i.e., a mechanical property of the cable) created between the cable and conduit due to electromagnetic force. The gap can be estimated by pressure drop, measured under the electromagnetic force. The pressure drop can easily be measured at an initial trial charge, and then it is possible to estimate the exponential decay constant before normal coil operation. Accordingly, it is possible to predict promptly how many times the trial operations are necessary to decrease the coupling losses to the designed value by measuring the coupling losses and the pressure drop during the initial coil operation trial. (author)

  9. Theory of ac loss in power transmission cables with second generation high temperature superconductor wires

    While a considerable amount of work has been done in an effort to understand ac losses in power transmission cables made of first generation high temperature superconductor (HTS) wires, use of second generation (2G) HTS wires brings in some new considerations. The high critical current density of the HTS layer in 2G wires reduces the surface superconductor hysteretic losses, for which a new formula is derived. Instead, gap and polygonal losses, flux transfer losses in imbalanced two-layer cables and ferromagnetic losses for wires with NiW substrates constitute the principal contributions. A formula for the flux transfer losses is also derived with a paramagnetic approximation for the substrate. Current imbalance and losses associated with the magnetic substrate can be minimized by orienting the substrates of the inner winding inward and the outer winding outward.

  10. Numerical and theoretical evaluations of AC losses for single and infinite numbers of superconductor strips with direct and alternating transport currents in external AC magnetic field

    Kajikawa, K., E-mail: kajikawa@sc.kyushu-u.ac.j [Research Institute of Superconductor Science and Systems, Kyushu University, 744 Motooka, Nishi-ku, Fukuoka 819-0395 (Japan); Funaki, K. [Research Institute of Superconductor Science and Systems, Kyushu University, 744 Motooka, Nishi-ku, Fukuoka 819-0395 (Japan); Shikimachi, K.; Hirano, N.; Nagaya, S. [Chubu Electric Power Co., Inc., 20-1 Kitasekiyama, Ohdaka-cho, Midori-ku, Nagoya 459-8522 (Japan)

    2010-11-01

    AC losses in a superconductor strip are numerically evaluated by means of a finite element method formulated with a current vector potential. The expressions of AC losses in an infinite slab that corresponds to a simple model of infinitely stacked strips are also derived theoretically. It is assumed that the voltage-current characteristics of the superconductors are represented by Bean's critical state model. The typical operation pattern of a Superconducting Magnetic Energy Storage (SMES) coil with direct and alternating transport currents in an external AC magnetic field is taken into account as the electromagnetic environment for both the single strip and the infinite slab. By using the obtained results of AC losses, the influences of the transport currents on the total losses are discussed quantitatively.

  11. Numerical and theoretical evaluations of AC losses for single and infinite numbers of superconductor strips with direct and alternating transport currents in external AC magnetic field

    Kajikawa, K.; Funaki, K.; Shikimachi, K.; Hirano, N.; Nagaya, S.

    2010-11-01

    AC losses in a superconductor strip are numerically evaluated by means of a finite element method formulated with a current vector potential. The expressions of AC losses in an infinite slab that corresponds to a simple model of infinitely stacked strips are also derived theoretically. It is assumed that the voltage-current characteristics of the superconductors are represented by Bean’s critical state model. The typical operation pattern of a Superconducting Magnetic Energy Storage (SMES) coil with direct and alternating transport currents in an external AC magnetic field is taken into account as the electromagnetic environment for both the single strip and the infinite slab. By using the obtained results of AC losses, the influences of the transport currents on the total losses are discussed quantitatively.

  12. Theoretical and experimental study of AC loss in high temperature superconductor single pancake coils

    The electromagnetic properties of a pancake coil in an AC regime as a function of the number of turns is studied theoretically and experimentally. Specifically, the AC loss, the coil critical current and the voltage signal are discussed. The coils are made of Bi2Sr2Ca2Cu3O10/Ag (BiSCCO) tape, although the main qualitative results are also applicable to other kinds of superconducting tape, such as coated conductors. The AC loss and the voltage signal are electrically measured using different pick-up coils with the help of a transformer. One of them avoids dealing with the huge coil inductance. In addition, the critical current of the coils is experimentally determined by conventional DC measurements. Furthermore, the critical current, the AC loss and the voltage signal are simulated, showing a good agreement with the experiments. For all simulations, the field dependent critical current density inferred from DC measurements on a short tape sample is taken into account.

  13. Artificial neural networks for AC losses prediction in superconducting round filaments

    Leclerc, J.; Makong Hell, L.; Lorin, C.; Masson, P. J.

    2016-06-01

    An extensive and fast method to estimate superconducting AC losses within a superconducting round filament carrying an AC current and subjected to an elliptical magnetic field (both rotating and oscillating) is presented. Elliptical fields are present in rotating machine stators and being able to accurately predict AC losses in fully superconducting machines is paramount to generating realistic machine designs. The proposed method relies on an analytical scaling law (ASL) combined with two artificial neural network (ANN) estimators taking 9 input parameters representing the superconductor, external field and transport current characteristics. The ANNs are trained with data generated by finite element (FE) computations with a commercial software (FlexPDE) based on the widely accepted H-formulation. After completion, the model is validated through comparison with additional randomly chosen data points and compared for simple field configurations to other predictive models. The loss estimation discrepancy is about 3% on average compared to the FEA analysis. The main advantages of the model compared to FE simulations is the fast computation time (few milliseconds) which allows it to be used in iterated design processes of fully superconducting machines. In addition, the proposed model provides a higher level of fidelity than the scaling laws existing in literature usually only considering pure AC field.

  14. AC transport current loss analysis for a face-to-face stack of superconducting tapes

    Yoo, Jaeun [Dept. of Physics, Chonbuk National University, Jeonju (Korea, Republic of); Youm, Dojun [Dept. of Physics, Korea Advanced Institute of Science and Technology, Daejeon (Korea, Republic of); Oh, Sang Soo [Superconducting Materials Research Group, KERI, Changwon (Korea, Republic of)

    2013-06-15

    AC Losses for face to face stacks of four identical coated conductors (CCs) were numerically calculated using the H-formulation combined with the E-J power law and the Kim model. The motive sample was the face to face stack of four 2 mm-wide CC tapes with 2 μm thick superconducting layer of which the critical current density, J{sub c}, was 2.16 x 10{sup 6} A/cm{sup 2} on IBAD-MgO template, which was suggested for the mitigation of ac loss as a round shaped wire by Korea Electrotechnology Research Institute. For the calculation the cross section of the stack was simply modeled as vertically aligned 4 rectangles of superconducting (SC) layers withE=E{sub o}(J(x,y,t)/J{sub c}(B)){sup n} in x-y plane where E{sub o} was 10{sup -6} V/cm, J{sub c} (B) was the field dependence of current density and n was 21. The field dependence of the critical current of the sample measured in four-probe method was employed for J{sub c} (B) in the equation. The model was implemented in the finite element method program by commercial software. The ac loss properties for the stacks were compared with those of single 4 cm-wide SC layers with the same critical current density or the same critical current. The constraint for the simulation was imposed in two different ways that the total current of the stack obtained by integrating J(x,y,t) over the cross sections was the same as that of the applied transport current: one is that one fourth of the external current was enforced to flow through each SC. In this case, the ac loss values for the stacks were lower than those of single wide SC layer. This mitigation of the loss is attributed to the reduction of the normal component of the magnetic field near the SC layers due to the strong expulsion of the magnetic field by the enforced transport current. On the contrary, for the other case of no such enforcement, the ac loss values were greater than those of single 4cm-wide SC layer and. In this case, the phase difference of the current flowing

  15. Self-field ac losses in biaxially aligned Y endash Ba endash Cu endash O tape conductors

    Self-field ac losses were measured by the conventional ac four-probe method in biaxially aligned Y endash Ba endash Cu endash O tapes using polycrystalline Hastelloy tapes with textured yttria-stabilized-zirconia buffer layers. The ac losses increased in proportion to the fourth power of transport current in the high Jc sample, and agreed well with Norris close-quote equation for thin strip conductors. However, the low Jc sample had rather higher losses than Norris close-quote prediction, suggesting excessive magnetic flux penetration caused by percolated current paths. The results confirmed Norris close-quote prediction of the low ac losses for thin strip conductors, and indicated the importance of removing percolated structures of current paths to avoid higher ac losses than the theoretical predictions based on uniform conductors. copyright 1997 American Institute of Physics

  16. Transport and AC loss properties of the repaired multifilamentary REBCO superconducting tapes

    Yamasaki, S.; Iwakuma, M.; Funaki, K.; Kato, J.; Chikumoto, T.; Tanabe, K.; Nakao, K.; Izumi, T.; Yamada, Y.; Shiohara, Y.; Saito, T.

    2010-11-01

    For near-future applications of REBa 2Cu 3O 7 (REBCO) coated conductors to electric power cables, transformers and Superconducting Magnetic Energy Storage (SMES), the long taped wires with high performance in the transport properties have been designed and fabricated. Moreover, in order to drastically reduce AC losses in perpendicular field configuration, advanced multifilament YBCO coated conductors (MFYCCs) fabricated with technique of a laser scribing process have been also developed. In the present study, from engineering viewpoints to utilize such advanced conductors, we evaluated the transport and AC loss properties of short MFYCCs with a repaired part or a joint by a diffusion joint technique with the saddle-shaped pickup coil method.

  17. Transport and AC loss properties of the repaired multifilamentary REBCO superconducting tapes

    Yamasaki, S. [Research Institute of Superconductor Science and Systems, Kyushu University, 744 Motooka, Nishi-ku, Fukuoka 819-0395 (Japan); Iwakuma, M., E-mail: iwakuma@sc.kyushu-u.ac.j [Research Institute of Superconductor Science and Systems, Kyushu University, 744 Motooka, Nishi-ku, Fukuoka 819-0395 (Japan); Funaki, K. [Research Institute of Superconductor Science and Systems, Kyushu University, 744 Motooka, Nishi-ku, Fukuoka 819-0395 (Japan); Kato, J.; Chikumoto, T.; Tanabe, K.; Nakao, K.; Izumi, T.; Yamada, Y.; Shiohara, Y. [International Superconductivity Technology Center, ISTEC, 1-10-13 Shinonome, Koto-ku, Tokyo 135-0062 (Japan); Saito, T. [Fujikura Ltd., 1-5-1 Kiba, Koto-ku, Tokyo 135-8512 (Japan)

    2010-11-01

    For near-future applications of REBa{sub 2}Cu{sub 3}O{sub 7} (REBCO) coated conductors to electric power cables, transformers and Superconducting Magnetic Energy Storage (SMES), the long taped wires with high performance in the transport properties have been designed and fabricated. Moreover, in order to drastically reduce AC losses in perpendicular field configuration, advanced multifilament YBCO coated conductors (MFYCCs) fabricated with technique of a laser scribing process have been also developed. In the present study, from engineering viewpoints to utilize such advanced conductors, we evaluated the transport and AC loss properties of short MFYCCs with a repaired part or a joint by a diffusion joint technique with the saddle-shaped pickup coil method.

  18. Loss optimizing low power 50 Hz transformers intended for AC/DC standby power supplies

    Nielsen, Nils

    2004-01-01

    This paper presents the measured efficiency on selected low power conventional 50 Hz/230 V-AC transformers. The small transformers are intended for use in 1 W@5 V-DC series- or buck-regulated power supplies for standby purposes. The measured efficiency is compared for cheap off-the-self transformer...... and for some which are optimized for a lower no-load loss. The optimization is done by simple and low cost means....

  19. Loss optimizing low power 50 Hz transformers intended for AC/DC standby power supplies

    Nielsen, Nils

    2004-01-01

    This paper presents the measured efficiency on selected low power conventional 50 Hz/230 V-AC transformers. The small transformers are intended for use in 1 W@5 V-DC series- or buck-regulated power supplies for standby purposes. The measured efficiency is compared for cheap off-the-self transformer and for some which are optimized for a lower no-load loss. The optimization is done by simple and low cost means.

  20. Evaluation of Core Loss in Magnetic Materials Employed in Utility Grid AC Filters

    Beres, Remus Narcis; Wang, Xiongfei; Blaabjerg, Frede;

    2016-01-01

    the core, depending on the magnetic material of choice and current ripple specifications. Additionally, shunt or series reactors that exists in LCL or trap filters and which are subjected to sinusoidal excitations have different specifications and requirements. Therefore, the core losses of different...... magnetic materials adopted in utility grid ac filters have been investigated and measured for both sinusoidal and rectangular excitation, with and without dc bias condition. The core loss information can ensure cost effective passive filter designs and may avoid trial-error design procedures of the passive...

  1. Fabrication and AC transport losses for Ag-sheathed Bi-2223 tapes using rectangular deformation process

    The AC transport losses in self-field at 77 K have been investigated for the Ag-sheathed Bi-2223 multifilamentary tapes prepared by rectangular deformation process. The rectangular wires with 20 (5 x 4 arrangement) filaments and different aspect ratio of their cross-section were fabricated by two-axial rolling machine, and subsequently they were converted to the tape-form conductors by the one-axial flat rolling and heat treatments. The initial configurations of rectangular wires before applying the flat rolling affect the filament shape near the tape edge in the final tapes. Furthermore, transport loss behaviors for investigated tapes also depend on the initial configurations of rectangular wires, although the main contribution to the losses comes from the hysteresis loss of the superconductor. This may be caused by the difference in filament shape and lateral Jc distributions in the cross-section of each tape samples

  2. AC loss reduction of TFA-MOD coated conductors in long length by laser scribing technique

    Katayama, K.; Hirano, H.; Machi, T.; Takagi, Y.; Takahashi, Y.; Izumi, T.

    TFA-MOD process is expected to be promising for future applications since it can produce high performance YBCO coated conductors with low cost. Applying YBCO coated conductors to the power electric devices such as transformer, cable, motors, reduction of AC loss for long wire is necessary. Multifilamentation, which is one of the effective approaches for AC loss reduction, has been developed by the scribing process. YBCO coated conductors produced by our standard TFA-MOD process delaminated into two parts by the laser scribing. The delamination was clarified to occur within the superconducting layer caused by the defects such as pores in the superconducting layer. In order to reduce the defects in the superconducting layer, we modify the heat treatment profile performed on the decomposed precursor films by applying the interim annealing(550-600°C) before crystallization heat treatment(740-770°C). The interim annealed samples had much less and smaller pores than the standard processed ones. The peel strength measured by transverse tensile test was as high as the PLD derived coated conductors which was successfully scribed into five filaments resulting in 1/5 AC loss. A 50m long YBCO coated conductor with the characteristics of 398A/cmwidth was obtained and cut into 5 mm width, followed by the laser scribing process into five filaments. The multifilamentation process was successfully performed without delamination throughout the wire. The hysteresis loss was down to 1/N (N: number of filaments), as we aimed. The IC properties of the filaments were 29±4A, indicating the wire was uniformly fabricated.

  3. Modelling and computation of AC fields and losses in high temperature superconductors

    This thesis is concerned with the modelling and the computation of the AC losses and electromagnetic fields in high temperature superconducting tapes using an E - J characteristic diffusion model. The AC losses in high temperature superconductors are modelled as a highly non-linear diffusion process. An empirical expression for modelling effective resistivity of the tape is extracted from the Rhyner's model and then used in the build up of the diffusion model. Formulation in terms of electric field E is used extensively and comprehensive explanations of why this model is used are given. Using the E formulation three different models that describe three different cases of the problem are developed. To understand the physical and the numerical phenomena that occur when a superconducting tape carries an alternating current or is exposed to an external variable magnetic field a one-dimensional model has been developed first. Comprehensive details and results of the principle and formulation of the primary model are given. The solid basis created by the one-dimensional model and the necessity of the model to be closer to the real tape drive us to two more realistic models, one where a silver layer is added on the top of the superconducting core, and the second one is the two-dimensional model where the edge effects and importance of non-linearity is emphasised. For both of these models comprehensive formulations and results are given. A collection of programs that solves the models has been created and tested, and the results obtained where successfully compared with results obtained by other authors through numerical and experimental means. The research demonstrates that the models developed are useful in exploring the mechanism of AC losses in superconducting tapes, the numerical programs allow prediction of losses under particular conditions and the applicability of different models (one and two-dimensional, the ''sandwich model'' and the critical state model

  4. Comparison between measured and numerically calculated AC losses in second-generation high temperature superconductor pancake coils

    The critical current and alternating current loss of HTS coil are not equal in different parts of HTS coil. AC loss inside the magnet forms a certain distribution which makes the winding loss calculation very complex. The analytical expressions are established based on Kim's model and the Clem model. The AC loss of HTS coil is measured by electrical method at 77 K and numerical calculation model is resolved by Matlab. The theoretical results and measurement data were compared and analyzed. As a high temperature superconductor (HTS) coil is a complex electromagnetic system, the critical current and alternating current loss are not equal in different parts of HTS coil. AC loss inside the magnet forms a certain distribution which makes the winding loss calculation very complex. The analytical expressions are established based on Kim's model and the Clem model. The AC loss of high-temperature superconductor pancake coil is generally obtained from experimental measurements and numerical calculations. The AC loss of high-temperature superconductor pancake coil is measured by electrical method at the temperature of liquid nitrogen. Numerical calculation model, which is set up and resolved by Matlab, was given as the theory equation in this study, where the theoretical results and measurement data were compared and analyzed.

  5. AC loss in stacks of Bi-2223/Ag tapes modified with ferromagnetic covers at the edges

    Safran, S; Goemoery, F [Institute of Electrical Engineering, Slovak Academy of Sciences, Dubravska cesta 9, 842 39 Bratislava (Slovakia); Gencer, Ali [Physics Department, Faculty of Sciences, Ankara University, Tandogan, 06100 Ankara (Turkey)

    2010-10-15

    We investigated the magnetization loss of stacked Bi-2223/Ag tapes with a ferromagnetic cover on the edges. Such modification has been found recently to reduce the AC loss of a single tape; however, the behavior in a coil winding could be different. With experiments and numerical calculations we show that a ferromagnetic cover on the edges of a superconducting tape could reduce its magnetization loss also when the tapes are arranged in a stack. The effect is weaker for larger numbers of tapes but nevertheless remained significant in a stack of four tapes, which was the maximum number studied here. The effects observed experimentally are nicely explained by the results of numerical calculations.

  6. Measuring ac losses in superconducting cables using a resonant circuit:Resonant current experiment (RESCUE)

    Däumling, Manfred; Olsen, Søren Krüger; Rasmussen, Carsten;

    1998-01-01

    A simple way to obtain true ac losses with a resonant circuit containing a superconductor, using the decay of the circuit current, is described. For the measurement a capacitor is short circuited with a superconducting cable. Energy in the circuit is provided by either charging up the capacitors...... with a certain voltage, or letting a de flow in the superconductor. When the oscillations are started-either by opening a switch in case a de is flowing or by closing a switch to connect the charged capacitors with the superconductor-the current (via a Rogowski coil) or the voltage on the capacitor can...

  7. ESBWR response to an extended station blackout/loss of all AC power

    U.S. federal regulations require light water cooled nuclear power plants to cope with Station Blackouts for a predetermined amount of time based on design factors for the plant. U.S. regulations define Station Blackout (SBO) as a loss of the offsite electric power system concurrent with turbine trip and unavailability of the onsite emergency AC power system. According to U.S. regulations, typically the coping period for an SBO is 4 hours and can be as long as 16 hours for currently operating BWR plants. Being able to cope with an SBO and loss of all AC power is required by international regulators as well. The U.S. licensing basis for the ESBWR is a coping period of 72 hours for an SBO based on U.S. NRC requirements for passive safety plants. In the event of an extended SBO (viz., greater than 72 hours), the ESBWR response shows that the design is able to cope with the event for at least 7 days without AC electrical power or operator action. ESBWR is a Generation III+ reactor design with an array of passive safety systems. The ESBWR primary success path for mitigation of an SBO event is the Isolation Condenser System (ICS). The ICS is a passive, closed loop, safety system that initiates automatically on a loss of power. Upon Station Blackout or loss of all AC power, the ICS begins removing decay heat from the Reactor Pressure Vessel (RPV) by (i) condensing the steam into water in heat exchangers located in pools of water above the containment, and (ii) transferring the decay heat to the atmosphere. The condensed water is then returned by gravity to cool the reactor again. The ICS alone is capable of maintaining the ESBWR in a safe shutdown condition after an SBO for an extended period. The fuel remains covered throughout the SBO event. The ICS is able to remove decay heat from the RPV for at least 7 days and maintains the reactor in a safe shutdown condition. The water level in the RPV remains well above the top of active fuel for the duration of the SBO event

  8. Transport ac loss in a rectangular thin strip with power-law E(J) relation

    Li, Shuo [School of Electrical Engineering, Beijing Jiaotong University, Beijing 100044 (China); Chen, Du-Xing, E-mail: chendx3008@hotmail.com [Departament de Física, Universitat Autònoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Fan, Yu; Fang, Jin [School of Electrical Engineering, Beijing Jiaotong University, Beijing 100044 (China)

    2015-01-15

    Highlights: • Transport ac loss in a thin strip with power-law E(J) is systematically computed. • The scaled results can be accurately used for strips with any critical current and frequency. • Experiments may be unambiguously compared with modeling results at a critical frequency. - Abstract: Transport ac losses of a rectangular thin strip obeying relation E/E{sub c}=(J/J{sub c}){sup n} with a fixed critical current I{sub c} and n=5,10,20,30, and 40 are accurately computed at a fixed frequency f as functions of the current amplitude I{sub m}. The results may be interpolated and scaled to those at any values of I{sub c},f, and 5⩽n⩽40. Normalized in the same way as that in Norris’ analytical formula derived from the critical-state model and converting f to a critical frequency f{sub c}, the modeling results may be better compared with the Norris formula and experimental data. A complete set of calculated modeling data are given with necessary formulas to be easily used by experimentalists in any particular case.

  9. Transport ac loss in a rectangular thin strip with power-law E(J) relation

    Highlights: • Transport ac loss in a thin strip with power-law E(J) is systematically computed. • The scaled results can be accurately used for strips with any critical current and frequency. • Experiments may be unambiguously compared with modeling results at a critical frequency. - Abstract: Transport ac losses of a rectangular thin strip obeying relation E/Ec=(J/Jc)n with a fixed critical current Ic and n=5,10,20,30, and 40 are accurately computed at a fixed frequency f as functions of the current amplitude Im. The results may be interpolated and scaled to those at any values of Ic,f, and 5⩽n⩽40. Normalized in the same way as that in Norris’ analytical formula derived from the critical-state model and converting f to a critical frequency fc, the modeling results may be better compared with the Norris formula and experimental data. A complete set of calculated modeling data are given with necessary formulas to be easily used by experimentalists in any particular case

  10. A two-dimensional finite element method to calculate the AC loss in superconducting cables, wires and coated conductors

    In order to utilize HTS conductors in AC electrical devices, it is very important to be able to understand the characteristics of HTS materials in the AC electromagnetic conditions and give an accurate estimate of the AC loss. A numerical method is proposed in this paper to estimate the AC loss in superconducting conductors including MgB2 wires and YBCO coated conductors. This method is based on solving a set of partial differential equations in which the magnetic field is used as the state variable to get the current and electric field distributions in the cross sections of the conductors and hence the AC loss can be calculated. This method is used to model a single-element and a multi-element MgB2 wires. The results demonstrate that the multi-element MgB2 wire has a lower AC loss than a single-element one when carrying the same current. The model is also used to simulate YBCO coated conductors by simplifying the superconducting thin tape into a one-dimensional region where the thickness of the coated conductor can be ignored. The results show a good agreement with the measurement

  11. A two-dimensional finite element method to calculate the AC loss in superconducting cables, wires and coated conductors

    Hong, Z; Jiang, Y; Pei, R; Coombs, T A [Electronic, Power and Energy Conversion Group, Engineering Department, University of Cambridge, CB2 1PZ (United Kingdom); Ye, L [Department of Electrical Power Engineering, CAU, P. O. Box 210, Beijing 100083 (China); Campbell, A M [Interdisciplinary Research Centre in Superconductivity, University of Cambridge, CB3 0HE (United Kingdom)], E-mail: Zh223@cam.ac.uk

    2008-02-15

    In order to utilize HTS conductors in AC electrical devices, it is very important to be able to understand the characteristics of HTS materials in the AC electromagnetic conditions and give an accurate estimate of the AC loss. A numerical method is proposed in this paper to estimate the AC loss in superconducting conductors including MgB{sub 2} wires and YBCO coated conductors. This method is based on solving a set of partial differential equations in which the magnetic field is used as the state variable to get the current and electric field distributions in the cross sections of the conductors and hence the AC loss can be calculated. This method is used to model a single-element and a multi-element MgB{sub 2} wires. The results demonstrate that the multi-element MgB{sub 2} wire has a lower AC loss than a single-element one when carrying the same current. The model is also used to simulate YBCO coated conductors by simplifying the superconducting thin tape into a one-dimensional region where the thickness of the coated conductor can be ignored. The results show a good agreement with the measurement.

  12. Hysteretic ac loss in a coated superconductor subjected to oscillating magnetic fields: ferromagnetic effect and frequency dependence

    Numerical simulations of the hysteretic ac loss in a coated superconductor with a more realistic version of the architecture were performed via the finite-element technique in the presence of an oscillating magnetic field. The coated superconductor was electromagnetically modeled by resorting to the quasistatic approximation of a vector potential approach in conjunction with nonlinear descriptions of the superconducting layer and the ferromagnetic substrate therein by a power-law model and the Langevin equation, respectively. A diverse effect of the ferromagnetic substrate on the hysteretic ac loss, depending on the strength of the applied magnetic field, was displayed, and its underlying cause was identified. The dependence of the hysteretic ac loss on the applied frequency is found to be related to a critical amplitude of the applied magnetic field, and the eddy-current loss dissipated in the metal coatings becomes prominent as the frequency increases only at high applied magnetic fields. (paper)

  13. The effect of surface grain reversal on the AC losses of sintered Nd–Fe–B permanent magnets

    Moore, Martina, E-mail: m.moore@ifw-dresden.de [Leibniz Institute for Solid State and Materials Research (IFW) Dresden, 01171 Dresden (Germany); Roth, Stefan; Gebert, Annett [Leibniz Institute for Solid State and Materials Research (IFW) Dresden, 01171 Dresden (Germany); Schultz, Ludwig [Leibniz Institute for Solid State and Materials Research (IFW) Dresden, 01171 Dresden (Germany); TU Dresden, Institute for Materials Science, 01062 Dresden (Germany); Gutfleisch, Oliver [TU Darmstadt, Department of Materials Science, Alarich-Weiß-Str. 16, 64287 Darmstadt (Germany); Fraunhofer Project Group for Materials Recycling and Resource Strategies IWKS, 63457 Hanau (Germany)

    2015-02-01

    Sintered Nd–Fe–B magnets are exposed to AC magnetic fields in many applications, e.g. in permanent magnet electric motors. We have measured the AC losses of sintered Nd–Fe–B magnets in a closed circuit arrangement using AC fields with root mean square-values up to 80 mT (peak amplitude 113 mT) over the frequency range 50 to 1000 Hz. Two magnet grades with different dysprosium content were investigated. Around the remanence point the low grade material (1.7 wt% Dy) showed significant hysteresis losses; whereas the losses in the high grade material (8.9 wt% Dy) were dominated by classical eddy currents. Kerr microscopy images revealed that the hysteresis losses measured for the low grade magnet can be mainly ascribed to grains at the sample surface with multiple domains. This was further confirmed when the high grade material was subsequently exposed to DC and AC magnetic fields. Here a larger number of surface grains with multiple domains are also present once the step in the demagnetization curve attributed to the surface grain reversal is reached and a rise in the measured hysteresis losses is evident. If in the low grade material the operating point is slightly offset from the remanence point, such that zero field is not bypassed, its AC losses can also be fairly well described with classical eddy current theory. - Highlights: • The eddy current losses of sintered Nd–Fe–B magnets were measured. • Field amplitudes up to 113 mT over the frequency range 50 to 1000 Hz were applied. • The Nd–Fe–B magnets showed significant hysteresis losses at low amplitudes (∼100 mT). • The source of such hysteresis losses in sintered Nd–Fe–B magnets was identified. • Two magnet grades with different dysprosium content were investigated.

  14. A model for calculating the AC losses of second-generation high temperature superconductor pancake coils

    A model is presented for calculating the AC losses of a stack of second-generation high temperature superconductor tapes. This model takes as a starting point the model of Clem and co-workers for a stack in which each tape carries the same current. It is based on the assumption that the magnetic flux lines lie parallel to the tapes within the part of the stack where the flux has not penetrated. In this paper we allow for the depth of penetration of field to vary across the stack, and use the Kim model to allow for the variation of Jc with B. The model is applied to the cases of a transport current and an applied field. For a transport current the calculated result differs from the Norris expression for a single tape carrying a uniform current and it does not seem possible to define a suitable average Jc which could be used. Our method also gives a more accurate value for the critical current of the stack than other methods. For an applied field the stack behaves as a solid superconductor with the Jc averaged locally over several tapes, but still allowed to vary throughout the stack on a larger scale. For up to about ten tapes the losses rise rapidly with the number of tapes, but in thicker stacks the tapes shield each other and the losses become that of a slab with a field parallel to the faces.

  15. A model for calculating the AC losses of second-generation high temperature superconductor pancake coils

    Yuan Weijia; Campbell, A M; Coombs, T A [Electronic, Power and Energy Conversion Group, Engineering Department, University of Cambridge, Cambridge CB2 1PZ (United Kingdom)], E-mail: wy215@cam.ac.uk

    2009-07-15

    A model is presented for calculating the AC losses of a stack of second-generation high temperature superconductor tapes. This model takes as a starting point the model of Clem and co-workers for a stack in which each tape carries the same current. It is based on the assumption that the magnetic flux lines lie parallel to the tapes within the part of the stack where the flux has not penetrated. In this paper we allow for the depth of penetration of field to vary across the stack, and use the Kim model to allow for the variation of J{sub c} with B. The model is applied to the cases of a transport current and an applied field. For a transport current the calculated result differs from the Norris expression for a single tape carrying a uniform current and it does not seem possible to define a suitable average J{sub c} which could be used. Our method also gives a more accurate value for the critical current of the stack than other methods. For an applied field the stack behaves as a solid superconductor with the J{sub c} averaged locally over several tapes, but still allowed to vary throughout the stack on a larger scale. For up to about ten tapes the losses rise rapidly with the number of tapes, but in thicker stacks the tapes shield each other and the losses become that of a slab with a field parallel to the faces.

  16. Transport ac loss of elliptical thin strips with a power-law E(J) relation

    Jia, Chen-Xi; Chen, Du-Xing; Li, Shuo; Fang, Jin

    2015-10-01

    The transport ac loss Q of an elliptical thin strip of critical current I c with a power-law relation E\\propto {J}n is accurately computed as a function of current amplitude I m and frequency f. The resulting Q({I}m) is normalized to q({i}m) following the Norris critical-state formula, and converted to {q}*({i}m*) at a critical frequency f c based on a transport scaling law. Having a set of {q}*({i}m*) at several values of n as a base, a general expression of {q}*({i}m*,n) is obtained, which can be used to easily calculate q({i}m) for any practical purposes.

  17. ac losses and field and current density distribution during a full cycle of a stack of superconducting tapes

    Yuan, Weijia; Campbell, A. M.; Coombs, T. A.

    2010-05-01

    Starting from an existing model by Clem et al., this paper has analyzed how the current density and magnetic field distribution of a stack of superconducting tapes with ac transport currents or applied fields will change in a full cycle. This paper assumes when the ac current or field starts to change in the other direction, a new penetrated region will begin to penetrate from the superconductor surface. If we assume Jc is constant in the critical region, this paper demonstrates that the Claassen formula (7) can be used to calculate the exact ac losses. If Jc depends on local Bz, we can use Eq. (9) to quickly predict the ac losses. This approach does not need to calculate a complete ac cycle. This saves considerably computation time while gives a result which is in close agreement with that calculated from a complete ac cycle. The calculation method can be applied for calculating a superconducting pancake coil if the coil radius is much larger than the tape width.

  18. AC loss of HTS magnet for AMR refrigerator using magnetic field formulation and edge element in cylindrical coordinates

    Kim, Seo Ho; Park, Minwon [Changwon National University, Changwon (Korea, Republic of); Jeong, Sang Kwon [KAIST, Daejeon (Korea, Republic of)

    2013-05-15

    AMR (Active Magnetic Regenerative) refrigerators require the large variation of the magnetic field and a HTS magnet can be used. The amount of AC loss is very important considering the overall efficiency of the AMR refrigerator. However, it is very hard to estimate the precise loss of the HTS magnet because the magnetic field distribution around the conductor itself depends on the coil configuration and the neighboring HTS wires interact each other through the distorted magnetic field by the screening current Therefore, the AC loss of HTS magnet should be calculated using the whole configuration of the HTS magnet with superconducting characteristic. This paper describes the AC loss of the HTS magnet by an appropriate FEM approach, which uses the non-linear characteristic of HTS conductor. The analysis model is based on the 2-D FEM model, called as 'magnetic field formulation and edge-element model', for whole coil configuration in cylindrical coordinates. The effects of transport current and stacked conductors on the AC loss are investigated considering the field-dependent critical current. The PDE model of 'Comsol multiphysics' is used for the FEM analysis with properly implemented equations for axisymmetric model.

  19. Ac loss modelling and measurement of superconducting transformers with coated-conductor Roebel-cable in low-voltage winding

    Pardo, Enric; Staines, Mike; Jiang, Zhenan; Glasson, Neil

    2015-11-01

    Power transformers using a high temperature superconductor (HTS) ReBCO coated conductor and liquid nitrogen dielectric have many potential advantages over conventional transformers. The ac loss in the windings complicates the cryogenics and reduces the efficiency, and hence it needs to be predicted in its design, usually by numerical calculations. This article presents detailed modelling of superconducting transformers with Roebel cable in the low-voltage (LV) winding and a high-voltage (HV) winding with more than 1000 turns. First, we model a 1 MVA 11 kV/415 V 3-phase transformer. The Roebel cable solenoid forming the LV winding is also analyzed as a stand-alone coil. Agreement between calculations and experiments of the 1 MVA transformer supports the model validity for a larger tentative 40 MVA 110 kV/11 kV 3-phase transformer design. We found that the ac loss in each winding is much lower when it is inserted in the transformer than as a stand-alone coil. The ac loss in the 1 and 40 MVA transformers is dominated by the LV and HV windings, respectively. Finally, the ratio of total loss over rated power of the 40 MVA transformer is reduced below 40% of that of the 1 MVA transformer. In conclusion, the modelling tool in this work can reliably predict the ac loss in real power applications.

  20. How filaments can reduce AC losses in HTS coated conductors: a review

    Grilli, Francesco; Kario, Anna

    2016-08-01

    Second-generation high-temperature superconductor (HTS) tapes, known also as coated conductors, are very promising tapes for HTS applications, in virtue of their extremely high critical current density, in-field behavior, and mechanical strength. Yet, the extremely large (typically in the range 1000–10 000) width-to-thickness ratio of the superconducting material makes them prone to high power dissipation in the presence of time-varying magnetic fields perpendicular to their flat face—a condition frequently met in several applications. Since the dissipation is directly proportional to the square of the superconductor's width, an obvious way of reducing it is by striating the superconductor into narrow filaments (stripes): in that case, provided that the filaments are electromagnetically uncoupled, the losses are reduced by a factor equal to the number of filaments. In the past two decades, many researchers from groups around the world have tried to apply this idea to practical conductors using different techniques. The aim of this paper is to provide a review of such efforts, focusing on the different approaches to make filamentized conductors, on the effectiveness of the AC loss reduction, and on the applicability of those techniques to long lengths.

  1. Detailed modelling of screening currents, their magnetic field and AC loss in coated conductor magnets containing up to 40000 turns

    Pardo, Enric

    2016-01-01

    Screening currents caused by varying magnetic fields degrade the homogeneity and stability of the magnetic fields created by $RE$BCO coated conductor coils. They are responsible for the AC loss, which is also important for other power applications containing windings. Since real magnets contain coils exceeding 10000 turns, accurate modeling tools for this number of turns are necessary for magnet design. This article presents a fast numerical method to model coils with no loss of accuracy. We ...

  2. Interstrand and AC-loss measurements on Rutherford-type cables for accelerator magnet applications

    Otmani, R; Tixador, P

    2001-01-01

    One of the main issues for particle accelerator magnets is the control of interstrand resistances. Too low resistances result in large coupling currents during ramping, which distort field quality, while too large resistances may prevent current redistribution among cable strands, resulting in degraded quench performance. In this paper, we review a series of interstrand resistance and AC-loss measurements performed on four Rutherford-type cables. The four cables have the same number of strands and similar outer dimensions, corresponding to LHC quadrupole cable specifications. The first cable is made from NbTi strands, coated with silver-tin alloy, the second one is made from bare Nb/sub 3/Sn strands, the third one is made also from bare Nb/sub 3/Sn strands but includes a 25- mu m-thick stainless steel core between the strand layers, and the last one is made from Nb/sub 3/Sn strands plated with chromium. To cross-check the two measurement types and assess their consistency, we compare the coupling-current time...

  3. Effect of wire arrangements on AC transport losses in cylindrical conductors composed of Ag-sheathed Bi2223 tapes

    The AC transport self-field losses at 77 K were investigated on the double-layer cylindrical conductors composed of Ag-sheathed Bi2223 tapes. The multifilamentary tapes as the strands are arranged in a parallel way on the cylindrical former with a diameter of 10.5 mm. The loss values are strongly influenced by the arrangements of tape strands in the conductors. The loss generation in conductors enhances with increasing of the separation between the layers and gap length between the adjacent tapes in the outer-layer. From the numerical calculations of the loss density distributions per-cycle in the conductors, it is suggested that the difference in loss values for each conductor is attributed to the magnetic flux distributions due to self-field and loss generations in tape strands, varying with the arrangement of tape strands in the conductors

  4. AC Transport Losses Calculation in a Bi-2223 Current Lead Using Thermal Coupling With an Analytical Formula

    Berger, Kévin; Lévêque, Jean; Netter, Denis; Douine, Bruno; Rezzoug, Abderrezak

    2005-01-01

    When a superconductor is fed with an alternating current, the temperature rise created by the losses tends to reduce the current carrying capacity. If the amplitude of the current exceeds the value of the critical current, then the losses become particularly high and the thermal heating considerable. In this paper, a numerical and an analytical model which allow to estimate AC transport losses are presented. These models, which use the expression of Ic(T) and n(T), are available for any appli...

  5. Numerical models for ac loss calculation in large-scale applications of HTS coated conductors

    Quéval, Loïc; Zermeño, Víctor M. R.; Grilli, Francesco

    2016-02-01

    Numerical models are powerful tools to predict the electromagnetic behavior of superconductors. In recent years, a variety of models have been successfully developed to simulate high-temperature-superconducting (HTS) coated conductor tapes. While the models work well for the simulation of individual tapes or relatively small assemblies, their direct applicability to devices involving hundreds or thousands of tapes, e.g., coils used in electrical machines, is questionable. Indeed, the simulation time and memory requirement can quickly become prohibitive. In this paper, we develop and compare two different models for simulating realistic HTS devices composed of a large number of tapes: (1) the homogenized model simulates the coil using an equivalent anisotropic homogeneous bulk with specifically developed current constraints to account for the fact that each turn carries the same current; (2) the multi-scale model parallelizes and reduces the computational problem by simulating only several individual tapes at significant positions of the coil’s cross-section using appropriate boundary conditions to account for the field generated by the neighboring turns. Both methods are used to simulate a coil made of 2000 tapes, and compared against the widely used H-formulation finite-element model that includes all the tapes. Both approaches allow faster simulations of large number of HTS tapes by 1-3 orders of magnitudes, while maintaining good accuracy of the results. Both models can therefore be used to design and optimize large-scale HTS devices. This study provides key advancement with respect to previous versions of both models. The homogenized model is extended from simple stacks to large arrays of tapes. For the multi-scale model, the importance of the choice of the current distribution used to generate the background field is underlined; the error in ac loss estimation resulting from the most obvious choice of starting from a uniform current distribution is revealed.

  6. The magnetisation profiles and ac magnetisation losses in a single layer YBCO thin film caused by travelling magnetic field waves

    Wang, Wei; Coombs, Timothy

    2015-05-01

    This paper studies the magnetisation and ac magnetisation losses caused by a travelling magnetic wave on a single-layer YBCO thin film. This work provides thorough investigations on how the critical magnetic field gradient has been changed by the application of a travelling wave. Several conditions were studied such as zero-field cooling (ZFC), field cooling (FC) and a delta-shaped trapped field. It was found that the travelling wave tends to attenuate the existing critical magnetic field gradients in all these conditions. This interesting magnetic behaviour can be well predicted by the finite element (FEM) software with the E-J power law and Maxwell’s equations. The numerical simulations show that the existing critical current density has been compromised after applying the travelling wave. The magnetisation profile caused by the travelling wave is very different from the standing wave, while the magnetisation based on the standing wave can be interpreted by the Bean model and constant current density assumption. Based on the numerical method, which has reliability that has been solidly proven in the study, we have extended the study to the ac magnetisation losses. Comparisons were made between the travelling wave and the standing wave for this specific YBCO sample. It was found that by applying the magnetic wave of the same amplitude, the ac magnetisation loss caused by the travelling wave is about 1/3 of that caused by the standing wave. These results are helpful in understanding the general magnetism problems and ac magnetisation loss in the travelling magnetic wave conditions such as inside a high temperature superconducting (HTS) rotating machine, etc.

  7. AC loss in striped (filamentary) YBCO coated conductors leading to designs for high frequencies and field-sweep amplitudes

    AC losses of YBCO coated conductors are investigated by calculation and experiment for the higher frequency regime. Previous research using YBCO film deposited onto single-crystal substrates demonstrated the effectiveness of 'striping' or filamentary subdivision as a technique for AC loss reduction. As a result of these studies the idea of subdividing YBCO 'coated conductors' (YBCO, overlayer, and even underlayer) into such stripes suggested itself. The suggestion was implemented by burning grooves into samples of coated conductor using laser micromachining. Various machining parameters were investigated, and the striping and slicing characteristics are presented. Loss measurements were performed on unstriped as well as striped samples by the pick-up coil technique at frequencies from 50 to 200 Hz at field sweep amplitudes of up to 150 mT. The effect of soft ferromagnetic Fe shielding was also investigated. The results of the experiments form a starting point for a more general study of reduced-loss coated conductor design (including hysteretic, coupling, normal eddy current, and transport losses) projected into higher ranges of frequency and field-sweep amplitude with transformer and all-cryogenic-motor/generator applications in mind

  8. Magnetic Properties and AC Losses in AFe2O4 (A = Mn, Co, Ni, Zn Nanoparticles Synthesized from Nonaqueous Solution

    Oleksandr Yelenich

    2015-01-01

    Full Text Available Nanosized particles of AFe2O4 (A = Mn, Co, Ni, or Zn spinel ferrites were synthesized by coprecipitation from nonaqueous solutions using nitrate salts as starting reagents. The particles were characterized by X-ray diffraction, transmission electron microscopy, and magnetic measurements. Quasistatic magnetic measurements show superparamagnetic behavior with blocking temperature below room temperature for cobalt, nickel, and zinc spinel ferrite nanoparticles. Characteristic magnetic parameters of the particles including average magnetic moment of an individual nanoparticle and blocking temperature have been determined. The specific loss power which is released on the exposure of an ensemble of synthesized particles to a magnetic field is calculated and measured experimentally. It is shown that among all nanoferrites under study, the ZnFe2O4 nanoparticles demonstrate the highest heating efficiency in AC magnetic fields. The key parameters responsible for the heating efficiency in AC magnetic field have been determined. The directions to enhance the SLP value have been outlined.

  9. Low AC Loss in a 3 kA HTS Cable of the Dutch Project

    Chevtchenko, Oleg; Zuijderduin, Roy; Smit, Johan; Willén, Dag; Lentge, Heidi; Thidemann, Carsten; Traeholt, Chresten; Melnik, Irina; Geschiere, Alex

    2012-01-01

    Requirements for a 6km long high temperature superconducting (HTS) AC power cable of the Amsterdam project are: a cable has to fit in an annulus of 160mm, with two cooling stations at the cable ends only. Existing solutions for HTS cables would lead to excessively high coolant pressure drop in th...

  10. Effects of Formvar coating and copper-nickel outer sheath on the ac losses of multi-strand subsize cables

    Ac losses of two subcables, one with Formvar coating on the strands of the BNL 12-ml NbTi/Cu/CuNi conductor and another without the coating, were measured using the ANL Subcable Test Facility. The results indicate that couplings among the strands with and without the Formvar coating were quite weak. Weak coupling of the bare strands is due to the high resistance of the copper-nickel outer sheath. In the regime of B(dot) = 0 approx. 1.2 T/s and B = 0 approx. 4 T, the magnetic diffusion time constant was (3.8 - 5.7) x 10-3 s

  11. Iron loss in permanent-magnet brushless AC machines under maximum torque per ampere and flux weakening control

    Zhu, Z.Q.; Chen, Y. S.; Howe, D.

    2002-01-01

    The airgap flux density distribution, flux density loci in the stator core, and the associated iron loss in two topologies of brushless AC motor, having a surface-mounted magnet rotor and an interior-mounted magnet rotor, respectively, are investigated when operated under maximum torque per ampere control in the constant torque mode and maximum power control in the flux-weakening mode. It is shown that whilst the interior magnet topology is known to be eminently suitable for flux-weakening op...

  12. Economic simplified boiling water reactor (ESBWR) response to an extended station blackout/ loss of all AC power

    U.S. federal regulations require light water cooled nuclear power plants to cope with Station Blackout for a predetermined amount of time based on design factors for the plant. U.S. regulations define Station Blackout (SBO) as a loss of the offsite electric power system concurrent with turbine trip and unavailability of the onsite emergency AC power system. According to U.S. regulations, typically the coping period for an SBO is 4 hours and can be as long as 16 hours for currently operating BWR plants. Being able to cope with an SBO and loss of all AC power is required by international regulators as well. The U.S. licensing basis for the ESBWR is a coping period of 72 hours for an SBO based on U.S. NRC requirements for passive safety plants. In the event of an extended SBO (viz., greater than 72 hours), the ESBWR response shows that the design is able to cope with the event for at least 7 days without AC electrical power or operator action. ESBWR is a Generation III+ reactor design with an array of passive safety systems. The ESBWR primary success path for mitigation of an SBO event is the Isolation Condenser System (ICS). The ICS is a passive, closed loop, safety system that initiates automatically on a loss of power. Upon Station Blackout or loss of all AC power, the ICS begins removing decay heat from the Reactor Pressure Vessel (RPV) by (i) condensing the steam into water in heat exchangers located in pools of water above the containment, and (ii) transferring the decay heat to the atmosphere. The condensed water is then returned by gravity to cool the reactor again. The ICS alone is capable of maintaining the ESBWR in a safe shutdown condition after an SBO for an extended period. The fuel remains covered throughout the SBO event. The ICS is able to remove decay heat from the RPV for at least 7 days and maintains the reactor in a safe shutdown condition. The water level in the RPV remains well above the top of active fuel for the duration of the SBO event

  13. Technique for reduction of mechanical losses in AC superconducting coils due to thermal expansion properties of various FRP bobbins

    Sekine, N.; Tada, S.; Higuchi, T.; Furumura, Y.; Takao, T.; Yamanaka, A.

    2005-10-01

    We reported about reduction of mechanical losses in AC superconducting coils. The method is the use of FRP bobbins fabricated with special fibers. Since their FRPs have negative thermal expansion coefficient to the fiber direction, the FRP bobbins expand to the circumferential direction during cooling down. In case of the superconducting coils with such FRP bobbins, the winding tensions do not decrease during cooling down. Therefore, the mechanical losses are reduced by the suppression of wire's vibration. Their special FRPs are a Dyneema® fiber reinforced plastic (DFRP), a Dyneema and glass fiber reinforced plastic (DGFRP), and a Zylon® fiber reinforced plastic (ZFRP). These materials have negative thermal expansion coefficient to the fiber direction, however, the amplitudes of thermal expansion are various by the quantity or quality of the fiber. In this paper, the values of thermal expansion were actually measured, and it was discussed about the influence on the mechanical losses. At the experimental results, the mechanical loss was small, so that the thermal strain to the circumferential direction on the coil was large. Moreover, in case of the coils with sufficiently strong winding tensions at coil-operating temperature, the mechanical losses vanished.

  14. Technique for reduction of mechanical losses in AC superconducting coils due to thermal expansion properties of various FRP bobbins

    Sekine, N. [Tsukamoto Laboratory, Faculty of Engineering, Yokohama National University, 79-5, Tokiwadai, Hodogaya-ku, Yokohama 240-8501 (Japan)]. E-mail: n-sekine@tsukalab.dnj.ynu.ac.jp; Tada, S. [Sophia University, 7-1, Kioicho, Chiyoda-ku, Tokyo 102-8554 (Japan); Higuchi, T. [Sophia University, 7-1, Kioicho, Chiyoda-ku, Tokyo 102-8554 (Japan); Furumura, Y. [Sophia University, 7-1, Kioicho, Chiyoda-ku, Tokyo 102-8554 (Japan); Takao, T. [Sophia University, 7-1, Kioicho, Chiyoda-ku, Tokyo 102-8554 (Japan); Yamanaka, A. [Research Center, Toyobo, Co., Ltd, 2-1-1, Katata, Otsu, Shiga 520-0292 (Japan)

    2005-10-01

    We reported about reduction of mechanical losses in AC superconducting coils. The method is the use of FRP bobbins fabricated with special fibers. Since their FRPs have negative thermal expansion coefficient to the fiber direction, the FRP bobbins expand to the circumferential direction during cooling down. In case of the superconducting coils with such FRP bobbins, the winding tensions do not decrease during cooling down. Therefore, the mechanical losses are reduced by the suppression of wire's vibration. Their special FRPs are a Dyneema[reg] fiber reinforced plastic (DFRP), a Dyneema and glass fiber reinforced plastic (DGFRP), and a Zylon[reg] fiber reinforced plastic (ZFRP). These materials have negative thermal expansion coefficient to the fiber direction, however, the amplitudes of thermal expansion are various by the quantity or quality of the fiber. In this paper, the values of thermal expansion were actually measured, and it was discussed about the influence on the mechanical losses. At the experimental results, the mechanical loss was small, so that the thermal strain to the circumferential direction on the coil was large. Moreover, in case of the coils with sufficiently strong winding tensions at coil-operating temperature, the mechanical losses vanished.

  15. Technique for reduction of mechanical losses in AC superconducting coils due to thermal expansion properties of various FRP bobbins

    We reported about reduction of mechanical losses in AC superconducting coils. The method is the use of FRP bobbins fabricated with special fibers. Since their FRPs have negative thermal expansion coefficient to the fiber direction, the FRP bobbins expand to the circumferential direction during cooling down. In case of the superconducting coils with such FRP bobbins, the winding tensions do not decrease during cooling down. Therefore, the mechanical losses are reduced by the suppression of wire's vibration. Their special FRPs are a Dyneema[reg] fiber reinforced plastic (DFRP), a Dyneema and glass fiber reinforced plastic (DGFRP), and a Zylon[reg] fiber reinforced plastic (ZFRP). These materials have negative thermal expansion coefficient to the fiber direction, however, the amplitudes of thermal expansion are various by the quantity or quality of the fiber. In this paper, the values of thermal expansion were actually measured, and it was discussed about the influence on the mechanical losses. At the experimental results, the mechanical loss was small, so that the thermal strain to the circumferential direction on the coil was large. Moreover, in case of the coils with sufficiently strong winding tensions at coil-operating temperature, the mechanical losses vanished

  16. Fast-ion losses induced by ACs and TAEs in the ASDEX Upgrade tokamak

    Garcia-Munoz, M.; Hicks, N.; van Voornveld, R.; Classen, I.G.J.; Bilato, R.; Bobkov, V.; Brambilla, M.; Bruedgam, M.; Fahrbach, H. U.; Igochine, V.; Jaemsae, S.; Maraschek, M.; Sassenberg, K.

    2010-01-01

    The phase-space of convective and diffusive fast-ion losses induced by shear Alfven eigenmodes has been characterized in the ASDEX Upgrade tokamak. Time-resolved energy and pitch-angle measurements of fast-ion losses correlated in frequency and phase with toroidal Alfven eigenmodes (TAEs) and Alfven

  17. A new approach for AC loss reduction in HTS transformer using auxiliary windings, case study: 25 kA HTS current injection transformer

    AC loss is one of the important parameters in HTS (high temperature superconducting) AC devices. Among the HTS AC power devices, the transformer is an essential part in the electrical power system. The AC losses in an HTS tape depend on the magnetic field. One of the techniques usually adopted to mitigate the unwanted magnetic field is using a system of coils that produce a magnetic field opposite to the incident one, reducing the total magnetic field. In this paper adding two auxiliary windings to the HTS transformer to produce this opposite magnetic field is proposed. The proper use of these auxiliary windings could reduce the leakage flux and, therefore, the AC loss. A mathematical model is used to describe the behaviour of a transformer operating with auxiliary windings, based on the theory of electromagnetic coupled circuits. The influence of the auxiliary windings on the leakage field is studied by the finite element method (FEM) and the AC loss of an HTS transformer was calculated. Also, the simulation results show that employing auxiliary windings will improve the HTS transformer efficiency

  18. AC loss characteristics of simulated CIC-type conductors having plastic conduit

    When alternating current superconducting coils having cable-in-conduit conductors are fabricated, non-metallic conduit materials are necessary to avoid eddy current losses in the conduits. Using two kinds of non-metallic tapes made of glass fiber reinforced plastics (GFRPs) and Dyneema fiber reinforced plastics (DFRPs), we made the conductors with the GFRP conduits and DFRP conduits, and experimentally studied the total losses of the conductors. The measured results showed that the total loss of the conductor with the GFRP conduit was smaller than that with the DFRP conduit at the same value of the void ratio, the transport current, the external magnetic field, and so on. When the void ratios become high, the superconducting bundle cable can easily move in the conduit. Hence the measured total losses increased with the void ratios of the conductors

  19. Loss Prediction and Thermal Analysis of Surface-Mounted Brushless AC PM Machines for Electric Vehicle Application Considering Driving Duty Cycle

    Tianxun Chen; Xiaopeng Wu; Yugang Dong; Chengning Zhang; Haipeng Liu

    2016-01-01

    This paper presents a computationally efficient loss prediction procedure and thermal analysis of surface-mounted brushless AC permanent magnet (PM) machine considering the UDDS driving duty cycle by using a lumped parameters’ thermal model. The accurate prediction of loss and its variation with load are essential for thermal analysis. Employing finite element analysis (FEA) to determine loss at every load point would be computationally intensive. Here, the finite element analysis and/or expe...

  20. AC transport current loss analysis for anti-parallel current flow in face to face stacks of superconducting tapes

    In this study we investigated ac transport current losses in the face to face stack for the anti-parallel current flow, and compared the electromagnetic properties with those of the single SC tape as well as those of the same stack for the parallel current path. The gap between the SC tapes in the stack varied in order to verify the electromagnetic influence of the neighbors when current flows in opposite direction, and the model was implemented in the finite element method program by the commercial software, COMSOL Multiphysics 4.2a. Conclusively speaking, the loss was remarkably decreased for the anti-parallel current case, which is attributed the magnetic flux compensation between the SC layers due to the opposite direction of the current flows. As the gap between SC tapes was increased, the loss mitigation became less effective. Besides, the current density distribution is very flat cross the sample width for the narrower gap case, which is believed to be benefit for the power electric system. These results are all in good agreement with those predicted theoretically for an infinite bifilar stack.

  1. AC transport current loss analysis for anti-parallel current flow in face to face stacks of superconducting tapes

    Yoo, Ja Eun; Han, Young Hee; Kim, Hey Rim; Park, Byung Jun; Yang, Seong Eun; Kim, Hee Sun; Yu, Seung Duck; Park, Ki Jun [Future Technology Laboratory, KEPCO Research Institute, Daejeon (Korea, Republic of)

    2014-06-15

    In this study we investigated ac transport current losses in the face to face stack for the anti-parallel current flow, and compared the electromagnetic properties with those of the single SC tape as well as those of the same stack for the parallel current path. The gap between the SC tapes in the stack varied in order to verify the electromagnetic influence of the neighbors when current flows in opposite direction, and the model was implemented in the finite element method program by the commercial software, COMSOL Multiphysics 4.2a. Conclusively speaking, the loss was remarkably decreased for the anti-parallel current case, which is attributed the magnetic flux compensation between the SC layers due to the opposite direction of the current flows. As the gap between SC tapes was increased, the loss mitigation became less effective. Besides, the current density distribution is very flat cross the sample width for the narrower gap case, which is believed to be benefit for the power electric system. These results are all in good agreement with those predicted theoretically for an infinite bifilar stack.

  2. Prediction of temperature and water level in a spent fuel pit during loss of all AC power supplies

    A prediction method for water temperature in a spent fuel pit of a pressurized water reactor (PWR) has been developed to calculate the increase in water temperature during the shutdown of cooling systems. In this study, the prediction method was extended to calculate the water level in a spent fuel pit during loss of all AC power supplies, and predicted results were compared with measured values of spent fuel pools in the Fukushima Daiichi Nuclear Power Station. The calculations gave reasonable results, but overestimated the decreasing rate of the water level and the water temperature. This indicated that decay heat was overestimated and evaporation heat transfer from the water surface was underestimated. Results of calculations with 80% decay heat and 155% (Unit 4 pool) or 230% (Unit 2 pool) evaporation heat flux were in good agreement with measured values. The data-fitted evaporation heat fluxes agreed rather well with the evaporation heat transfer correlation proposed by Fujii et al. (author)

  3. Prediction of temperature and water level in a spent fuel pit during loss of all AC powers

    A prediction method for water temperature in a spent fuel pit of a PWR has been developed to calculate the increase in water temperature during the shutdown of cooling systems. In this study, the prediction method was extended to calculate the water level in a spent fuel pit during loss of all AC powers, and predicted results were compared with data of spent fuel pools in the Fukushima Daiichi Nuclear Power Station. The calculations gave reasonable results, but overestimated the decreasing rate of the water level and water temperature. This result indicated that decay heat was overestimated and evaporation heat transfer from the water surface was underestimated. Results of calculations with 80% decay heat and 155% (No. 4 pool) or 230% (No. 2 pool) evaporation heat flux were in good agreement with data. The data-fitted evaporation heat fluxes agreed rather well with the evaporation heat transfer correlation proposed by Fujii et al. (author)

  4. An improved FEM model for computing transport AC loss in coils made of RABiTS YBCO coated conductors for electric machines

    AC loss can be a significant problem for any applications that utilize or produce an AC current or magnetic field, such as an electric machine. The authors investigate the electromagnetic properties of high temperature superconductors with a particular focus on the AC loss in superconducting coils made from YBCO coated conductors for use in an all-superconducting electric machine. This paper presents an improved 2D finite element model for the cross-section of such coils, based on the H formulation. The model is used to calculate the transport AC loss of a racetrack-shaped coil using constant and magnetic field-dependent critical current densities, and the inclusion and exclusion of a magnetic substrate, as found in RABiTS (rolling-assisted biaxially textured substrate) YBCO coated conductors. The coil model is based on the superconducting stator coils used in the University of Cambridge EPEC Superconductivity Group's all-superconducting permanent magnet synchronous motor design. To validate the modeling results, the transport AC loss of a stator coil is measured using an electrical method based on inductive compensation by means of a variable mutual inductance. Finally, the implications of the findings on the performance of the motor are discussed.

  5. An improved FEM model for computing transport AC loss in coils made of RABiTS YBCO coated conductors for electric machines

    Ainslie, Mark D; Yuan Weijia; Flack, Timothy J; Coombs, Timothy A [Department of Engineering, University of Cambridge, 9 J J Thomson Avenue, Cambridge CB3 0FA (United Kingdom); Rodriguez-Zermeno, Victor M [Department of Mathematics, Technical University of Denmark, Kongens Lyngby 2800 (Denmark); Hong Zhiyong, E-mail: mda36@cam.ac.uk [School of Electronic, Information and Electrical Engineering, Shanghai Jiao Tong University, Shanghai (China)

    2011-04-15

    AC loss can be a significant problem for any applications that utilize or produce an AC current or magnetic field, such as an electric machine. The authors investigate the electromagnetic properties of high temperature superconductors with a particular focus on the AC loss in superconducting coils made from YBCO coated conductors for use in an all-superconducting electric machine. This paper presents an improved 2D finite element model for the cross-section of such coils, based on the H formulation. The model is used to calculate the transport AC loss of a racetrack-shaped coil using constant and magnetic field-dependent critical current densities, and the inclusion and exclusion of a magnetic substrate, as found in RABiTS (rolling-assisted biaxially textured substrate) YBCO coated conductors. The coil model is based on the superconducting stator coils used in the University of Cambridge EPEC Superconductivity Group's all-superconducting permanent magnet synchronous motor design. To validate the modeling results, the transport AC loss of a stator coil is measured using an electrical method based on inductive compensation by means of a variable mutual inductance. Finally, the implications of the findings on the performance of the motor are discussed.

  6. Hysteresis losses in MgB2 superconductors exposed to combinations of low AC and high DC magnetic fields and transport currents

    Highlights: • A method for calculating hysteresis losses in the low AC – high DC magnetic field and transport current range has been shown. • The method can be used in the design of wind turbine generators for calculating the losses in the generator DC rotor. • First estimates indicate tolerable current ripple in the 0.1% range for a 4 T DC MgB2 generator rotor coil. - Abstract: MgB2 superconductors are considered for generator field coils for direct drive wind turbine generators. In such coils, the losses generated by AC magnetic fields may generate excessive local heating and add to the thermal load, which must be removed by the cooling system. These losses must be evaluated in the design of the generator to ensure a sufficient overall efficiency. A major loss component is the hysteresis losses in the superconductor itself. In the high DC – low AC current and magnetic field region experimental results still lack for MgB2 conductors. In this article we reason towards a simplified theoretical treatment of the hysteresis losses based on available models in the literature with the aim of setting the basis for estimation of the allowable magnetic fields and current ripples in superconducting generator coils intended for large wind turbine direct drive generators. The resulting equations use the DC in-field critical current, the geometry of the superconductor and the magnitude of the AC magnetic field component as parameters. This simplified approach can be valuable in the design of MgB2 DC coils in the 1–4 T range with low AC magnetic field and current ripples

  7. Superconducting-magnetic heterostructures: a method of decreasing AC losses and improving critical current density in multifilamentary conductors.

    Glowacki, B A; Majoros, M

    2009-06-24

    Magnetic materials can help to improve the performance of practical superconductors on the macroscale/microscale as magnetic diverters and also on the nanoscale as effective pinning centres. It has been established by numerical modelling that magnetic shielding of the filaments reduces AC losses in self-field conditions due to decoupling of the filaments and, at the same time, it increases the critical current of the composite. This effect is especially beneficial for coated conductors, in which the anisotropic properties of the superconductor are amplified by the conductor architecture. However, ferromagnetic coatings are often chemically incompatible with YBa(2)Cu(3)O(7) and (Pb,Bi)(2)Sr(2)Ca(2)Cu(3)O(9) conductors, and buffer layers have to be used. In contrast, in MgB(2) conductors an iron matrix may remain in direct contact with the superconducting core. The application of superconducting-magnetic heterostructures requires consideration of the thermal and electromagnetic stability of the superconducting materials used. On one hand, magnetic materials reduce the critical current gradient across the individual filaments but, on the other hand, they often reduce the thermal conductivity between the superconducting core and the cryogen, which may cause destruction of the conductor in the event of thermal instability. A possible nanoscale method of improving the critical current density of superconducting conductors is the introduction of sub-micron magnetic pinning centres. However, the volumetric density and chemical compatibility of magnetic inclusions has to be controlled to avoid suppression of the superconducting properties. PMID:21828430

  8. Loss Prediction and Thermal Analysis of Surface-Mounted Brushless AC PM Machines for Electric Vehicle Application Considering Driving Duty Cycle

    Tianxun Chen

    2016-01-01

    Full Text Available This paper presents a computationally efficient loss prediction procedure and thermal analysis of surface-mounted brushless AC permanent magnet (PM machine considering the UDDS driving duty cycle by using a lumped parameters’ thermal model. The accurate prediction of loss and its variation with load are essential for thermal analysis. Employing finite element analysis (FEA to determine loss at every load point would be computationally intensive. Here, the finite element analysis and/or experiment based computationally efficient winding copper and iron loss and permanent magnet (PM power loss models are employed to calculate the electromagnetic loss at every operation point, respectively. Then, the lumped parameter thermal method is used to analyse the thermal behaviour of the driving PM machine. Experiments have been carried out to measure the temperature distribution in a motor prototype. The calculation and experiment results are compared and discussed.

  9. Hysteresis losses in MgB2 superconductors exposed to combinations of low AC and high DC magnetic fields and transport currents

    Magnusson, N.; Abrahamsen, Asger Bech; Liu, Dawei;

    2014-01-01

    MgB2 superconductors are considered for generator field coils for direct drive wind turbine generators. In such coils, the losses generated by AC magnetic fields may generate excessive local heating and add to the thermal load, which must be removed by the cooling system. These losses must be...... simplified theoretical treatment of the hysteresis losses based on available models in the literature with the aim of setting the basis for estimation of the allowable magnetic fields and current ripples in superconducting generator coils intended for large wind turbine direct drive generators. The resulting...

  10. AC Losses of High Temperature Superconducting Tapes and Coils%高温超导带材及线圈的交流损耗

    张国民; 林良真

    2006-01-01

    将描述超导体各向异性的有效质量理论,即各向异性Ginzburg-Landau理论(G-L理论),与临界态模型(CS模型)相结合,建立了高温超导带材的交流损耗与临界电流的各向异性理论模型;利用不可逆应变的定义,给出了临界电流与应变的关系,并利用临界电流与应变的关系及Norris方程,导出了高温超导带材的交流损耗与应变的关系;利用所建立的交流损耗与临界电流的各向异性理论公式,建立了依据超导短样带材的特性(临界电流,交流损耗),计算高温超导线圈交流损耗的数值计算模型.%Anisotropic theoretical models of critical current and AC loss of high temperature superconducting (HTS) tape in both DC and AC background fields were established based on the effective mass theory (the anisotropy Ginzburg--Landau theory) and the critical state model (CS model). A formula to describe the relationship between critical current and stress/strain was proposed by using the definition of irreversible strain. The relation between AC loss and stress/strain was developed based on the critical current-strain relation and Norris' formula. A numerical model to calculate AC loss of HTS coil was developed from the anisotropy theory of AC loss and critical current of short sample.

  11. Voltage-probe-position dependence and magnetic-flux contribution to the measured voltage in ac transport measurements: which measuring circuit determines the real losses?

    The voltage Vab measured between two voltage taps a and b during magnetic flux transport in a type-II superconductor carrying current I is the sum of two contributions, the line integral from a to b of the electric field along an arbitrary path Cs through the superconductor and a term proportional to the time rate of change of magnetic flux through the area bounded by the path Cs and the measuring circuit leads. When the current I(t) is oscillating with time t, the apparent ac loss (the time average of the product IVab) depends upon the measuring circuit used. Only when the measuring-circuit leads are brought out far from the surface does the apparent power dissipation approach the real (or true) ac loss associated with the length of sample probed. Calculations showing comparisons between the apparent and real ac losses in a flat strip of rectangular cross section will be presented, showing the behavior as a function of the measuring-circuit dimensions. Corresponding calculations also are presented for a sample of elliptical cross section

  12. Voltage-probe-position dependence and magnetic-flux contribution to the measured voltage in AC transport measurements: which measuring circuit determines the real losses?

    The voltage Vab measured between two voltage taps a and b during magnetic flux transport in a type-II superconductor carrying current I is the sum of two contributions, the line integral from a to b of the electric field along an arbitrary path Cs through the superconductor and a term proportional to the time rate of change of magnetic flux through the area bounded by the path Cs and the measuring circuit leads. When the current I(t) is oscillating with time t, the apparent AC loss (the time average of the product IVab) depends upon the measuring circuit used. Only when the measuring-circuit leads are brought out far from the surface does the apparent power dissipation approach the real (or true) AC loss associated with the length of sample probed. Calculations showing comparisons between the apparent and real AC losses in a flat strip of rectangular cross section will be presented, showing the behavior as a function of the measuring-circuit, dimensions. Corresponding calculations also are presented for a sample of elliptical cross section. (orig.)

  13. AC losses of mono- and multifilamentary high-Tc superconducting (Bi,Pb)2Sr2Ca2Cu3O10/Ag tapes

    In this thesis the ac losses of high-temperature superconductors (HTSC) were measured and analyzed by means of model calculations. The investigated silver sheathed Mono- and Multifilamentary tapes are based on the HTSC material (Bi,Pb)2Sr2Ca2Cu3O10 (Bi-2223/Ag). The losses were investigated in externally applied magnetic field changes as well as in the self-field of a transport current at temperatures of 4.2 K and 77 K. A detailed knowledge of the ac loss dependence on frequency and amplitude of these tapes is important for future transformer or magnet applications. While measuring the amplitude dependence we found - depending on the sample - a strong influence of the degree of the grain alignment (granularity) in the superconducting material upon the magnetization and hysteresis losses Qh. We could explain these effects which are not known in the technical relevant low-temperature superconductors by a superposition of the magnetic moments of the grain- and sample currents (intra- and intergranular screening currents). In the frame of this model we were able to divide the total measured losses into their inter-and intragranular contributions and we could quantitatively describe the losses of the grain and the sample system separately. The frequency dependence of the losses, depending on the extremely nonlinear voltage-current (E-j) characteristics of the high-temperature materials could be explained with a newly developed extension of the Critical State model. From the directly measured E-j relations we also calculated the internal current- and field distributions in the samples with the field change velocity B as a parameter. (author) figs., tabs., refs

  14. Comparison of AC losses, magnetic field/current distributions and critical currents of superconducting circular pancake coils and infinitely long stacks using coated conductors

    A model is presented for calculating the AC losses, magnetic field/current density distribution and critical currents of a circular superconducting pancake coil. The assumption is that the magnetic flux lines will lie parallel to the wide faces of tapes in the unpenetrated area of the coil. Instead of using an infinitely long stack to approximate the circular coil, this paper gives an exact circular coil model using elliptic integrals. A new efficient numerical method is introduced to yield more accurate and fast computation. The computation results are in good agreement with the assumptions. For a small value of the coil radius, there is an asymmetry along the coil radius direction. As the coil radius increases, this asymmetry will gradually decrease, and the AC losses and penetration depth will increase, but the critical current will decrease. We find that if the internal radius is equal to the winding thickness, the infinitely long stack approximation overestimates the loss by 10% and even if the internal radius is reduced to zero, the error is still only 60%. The infinitely long stack approximation is therefore adequate for most practical purposes. In addition, the comparison result shows that the infinitely long stack approximation saves computation time significantly.

  15. Comparison of AC losses, magnetic field/current distributions and critical currents of superconducting circular pancake coils and infinitely long stacks using coated conductors

    Yuan Weijia; Campbell, A M; Hong, Z; Ainslie, M D; Coombs, T A, E-mail: wy215@cam.ac.u [Electronic, Power and Energy Conversion Group, Electrical Engineering Division, Engineering Department, University of Cambridge, Cambridge CB3 0FA (United Kingdom)

    2010-08-15

    A model is presented for calculating the AC losses, magnetic field/current density distribution and critical currents of a circular superconducting pancake coil. The assumption is that the magnetic flux lines will lie parallel to the wide faces of tapes in the unpenetrated area of the coil. Instead of using an infinitely long stack to approximate the circular coil, this paper gives an exact circular coil model using elliptic integrals. A new efficient numerical method is introduced to yield more accurate and fast computation. The computation results are in good agreement with the assumptions. For a small value of the coil radius, there is an asymmetry along the coil radius direction. As the coil radius increases, this asymmetry will gradually decrease, and the AC losses and penetration depth will increase, but the critical current will decrease. We find that if the internal radius is equal to the winding thickness, the infinitely long stack approximation overestimates the loss by 10% and even if the internal radius is reduced to zero, the error is still only 60%. The infinitely long stack approximation is therefore adequate for most practical purposes. In addition, the comparison result shows that the infinitely long stack approximation saves computation time significantly.

  16. 高温超导YBCO薄膜中的传输交流损耗%TRANSPORT AC LOSSES IN THIN FILM OF YBCO

    赵玉峰; 何天虎; 冯旺军; 李世荣; 周又和

    2011-01-01

    基于Norris方程和Bean临界态模型,考虑薄膜超导体内的磁场和电流密度分布特性,通过解析求解的方法推导出薄膜超导体在传输外加电流时其内部的磁场和电流密度以及传输交流损耗的解析表达式,从定量的角度研究超导体截面几何形状对传输交流损耗的影响.结果表明薄膜超导体边缘处的剧烈变化的磁场和电流的分布以及无场区的电流承载能力是影响传输交流损耗的主要原因.%Based on Norris equations and Bean model, by considering the characteristics of magnetic field and current density in thin film, the magnetic field and current density in thin film are analytically derived, as well as the transport ac losses. The effect of the geometry of thin film on the transport ac losses is studied quantitatively. The results indicate that the dramatic change of magnetic field and current density at edge of thin film and the current capacity of the field-free region are the main reasons which affect the transport ac losses of thin film.

  17. Very low field ac-response at the loss of long range magnetic order in amorphous Fe90Zr10

    Low temperature ac-susceptibility measurements over 5 decades of ac-field (0.08-8000 A/m) have been carried out on amorphous ribbons of Fe90Zr10 and Fe91Zr9. The authors find that at very low fields (0.8 to 24 A/m) ac-response measurements eliminate the influence of domain and domain wall motion, the well known Hopkinson peak effects, to reveal clearly the reentrant characteristics. With such studies a reentrant freezing temperature Taf is unambiguously revealed with an evident knee in χ'(T) and a corresponding well defined peak in χ double-prime(T). The latter is found to be independent of the applied field (0.8 to 8 A/m) while being weakly dependent on the frequency (10--1,000 Hz). They thus find Tsf to be 25 K and 40 K respectively for Fe90Zr10 and Fe91Zr9 amorphous ribbons

  18. One-region model predicting water temperature and level in a spent fuel pit during loss of all AC power supplies

    A prediction system with a one-region model was developed to predict water temperature in a spent fuel pit (SFP) after the shutdown of its cooling systems based on three-dimensional (3D) thermal hydraulic behavior calculated by using the CFD software, FLUENT 6.3.26. The system was extended to calculate the water level in the SFP during loss of all AC power supplies. In the prediction system, decay heat calculated by using the burn-up calculation software, ORIGEN 2.2, and the previously proposed correlation for evaporation heat fluxes from the water surface to air were used. Predicted results were compared with 3D calculations and measured temperatures for the shutdown of cooling systems and with the water temperature and level measured in SFPs at the Fukushima Daiichi Nuclear Power Station for loss of all AC power supplies. As a result, the predicted temperatures were found to agree well with the 3D calculations and it was confirmed that ORIGEN 2.2 well predicted decay heat for fuel assemblies with large decay heat which had been taken relatively recently from the shutdown reactor core. However, it was shown that decay heat predicted by ORIGEN 2.2 was overestimated for longtime cooled fuel assemblies with small decay heat and the previously proposed evaporation heat flux correlation overestimated the water temperature in the SFP, too. (author)

  19. Scaling law and general expression for transport ac loss of a rectangular thin strip with power-law E(J) relation

    Chen, Du-Xing; Li, Shuo; Fang, Jin

    2015-12-01

    Transport ac loss Q of a superconducting rectangular thin strip obeying a power-law relation E∝Jn as a function of current amplitude Im may be, following Norris, expressed by normalized quantities as q(im). A scaling law is deduced that if Icf, Ic and f being the critical current and frequency, is multiplied by a positive constant C, then im and qm are multiplied by C 1 /(n - 1)and C 2 /(n - 1) , respectively. Based on this scaling law and the well-known Norris formula, the general function of q(im, n, f) is obtained graphically or analytically for any practical purpose, after accurate numerical computations on a set of q(im) at several values of n and a fixed value of f.

  20. Results of intercomparison test of the critical current and AC loss measurement on superconducting strands for the ITER coil

    Round robin tests of critical and hysteresis loss measurement on superconducting strands were carried out by JAERI and Japanese company-laboratories. The test samples are a (Nb, Ti)3Sn strand for the ITER CS model coil and a Nb-Ti reference strand. The testing condition and evaluation method are based upon ITER-EDA standard. Participant company-laboratories in round robin test program are Hitachi Cable, Furukawa electric, Sumitomo electric industries, Showa electric wire and cable, Mitsubishi electric, Kobe steel, From the test results, the coefficient of variation of critical currents at 12 T in (Nb, Ti)3Sn strand was 4.5% and at 9 T in NbTi strand was 1.7%, and the coefficient of variations of hysteresis loss at ± 3 T in both (Nb, Ti)3Sn and NbTi strands were 15%. Status of critical current and hysteresis loss measurement on superconducting strands in Japanese laboratories was recognized through the round robin test. (author)

  1. New approach to the ac loss measurement in the superconducting secondary circuit of an iron-core transformer

    We have developed a transformer technique to supply currents over 500 A into a tape from a high-temperature superconductor (HTS). The superconducting tape under test could form either the whole or a part of the secondary circuit winding. The ferromagnetic core, as well as the copper primary, is immersed in an LN2 bath. This results in a simple and compact design of the whole system. Our approach to the loss determination is based on the fact that the voltage on the entire secondary circuit can be easily registered with the help of a loop embracing the transformer core. In practice, it will also contain the signal from a resistive part of the secondary circuit (joint). We show how this voltage can be subtracted to obtain the pure superconductor loss signal. In our method, the problem of correctly placing the voltage signal wires in the vicinity of the superconducting object, carrying transport current, is avoided. This could be of substantial advantage in the case when the loss of a HTS object that is more complicated than the single tape (e.g. superconducting cable or coil) needs to be measured. (author)

  2. Loss of vital ac power and the residual heat removal system during mid-loop operations at Vogtle Unit 1 on March 20, 1990

    On March 20, 1990, the Vogtle Electric Generating Plant Unit 1, located in Burke County, Georgia, about 25 miles southeast of Augusta, experienced a loss of all safety (vital) ac power. The plant was in cold shutdown with reactor coolant level lowered to ''mid-loop'' for various maintenance tasks. Both the containment building personnel hatch and equipment hatch were open. One emergency diesel generator and one reserve auxiliary transformer were out of service for maintenance, with the remaining reserve auxiliary transformer supplying both Unit 1 safety buses. A truck in the low voltage switchyard backed into the support column for an offsite power feed to the reserve auxiliary transformer which was supplying safety power. The insulator broke, a phase-to-ground fault occurred, and the feeder circuit breakers for the safety buses opened. The operable emergency diesel generator started automatically because of the undervoltage condition on the safety bus, but tripped off after about 1 minute. About 20 minutes later the diesel generator load sequencer was reset, causing the diesel generator to start a second time. The diesel generator operated for about 1 minute, and tripped off. The diesel generator was restarted in the manual emergency mode 36 minutes after the loss of power. The generator remained on line and provided power to its safety bus. During the 36 minutes without safety bus power, the reactor coolant system temperature rose from about 90 degree F to 136 degree F. This report documents the results of an Incident Investigation Team sent to Vogtle by the Executive Director for Operations of the US Nuclear Regulatory Commission to determine what happened, identify the probable causes, and make appropriate findings and conclusions. 79 figs., 16 tabs

  3. Combined loss of primary and secondary coolant AC pump power design-basis event for the K-reactor safety analysis report

    The combined loss of alternating-current (ac) power to the primary coolant and secondary coolant system pumps has been included as a design-basis event in Chap. 15 of the safety analysis report for the K reactor at the U.S. Department of Energy's Savannah River site (SRS) nuclear materials production complex near Aiken, South Carolina. This event can arise from a disruption of the entire 115-kV SRS power grid or a lesser disturbance affecting the K-reactor area, combined with a failure of the standby emergency power sources. The first scenario is referred to as a open-quotes station blackout,close quotes and the second scenario is designated as a open-quotes mini-blackout.close quotes This is a condition-11 event (incident of moderate frequency) per the criterion (frequency of occurrence ≥ 1 x 10-6 per year) for credible eventualities in the design-basis envelope. The event causes the primary coolant flow to drop and stabilize at ∼27% of its full level (5.83 + 05 ell/min). Likewise, the secondary coolant flow drops and settles also at ∼27% of its full level (6.36 x 105 ell/min). The final primary coolant flow is maintained by the reduced pumping provided by diesel powered direct-current motors. The final secondary coolant flow is driven by gravity from the height differential between the supply and discharge basins. Both flows coast down gradually due to the action of flywheels in all of the six primary coolant pumps and in two of the ten secondary coolant pumps

  4. 分磁环对高温SMES磁体交流损耗的影响研究%The effect of flux diverters on AC losses of HTS solenoid magnet

    宋萌; 徐颖; 曹昆南; 王达达; 任丽; 何杰; 苏路顺; 王作帅; 孙黄迪

    2013-01-01

    高温SMES磁体的交流损耗是制约其投入实际应用的因素之一,交流损耗的大小与超导导线所承受的磁场位型关系紧密,加装分磁环是改变超导磁体磁场位型的手段之一,因此对交流损耗的抑制也有实际意义.文中对高温SMES螺线管磁体进行了有限元建模,阐述了分磁环对减小超导磁体交流损耗的原理,分别计算了超导磁体在加装分磁环与未装分磁环下交流损耗的大小、分布,分析了分磁环的降损率参数r随磁体电流的变化规律,并对提高分磁环降损率的关键问题进行了探讨.%The AC loss of HTS solenoid magnet is one of the factors that limits its practical application.The value of AC loss is closely associated with the magnet field type of superconducting wires bear,so as a means of changing the magnet field type,flux diverter would also share a practical significance in reducing AC loss.This article conducted the finite element modeling of HTS solenoid magnet,elaborated the principles in reducing the AC loss of superconducting magnet by flux diverters,calculated the magnitude and distribution of AC loss separately with flux diverters and without flux diverters,and the loss reduction rate r of flux diverters was analyzed.Along with the change of magnet current,the key problems to improve the loss reduction rate of flux diverters were discussed.

  5. 不同排列下高温超导带材交流损耗的仿真计算%Calculation of AC loss in high temperature superconducting tapes under different arrangements

    堵益高; 马勇虎; 沈锦飞

    2013-01-01

    交流损耗的数值计算对于高温超导带材具有重要的现实意义.应用有限元软件模拟仿真超导体部分计算求出不同排列下的交流损耗,与实验结果以及Norris公式的计算结果相比较,得到的仿真结果符合较好.结果说明圆筒形的排列能够有效地减少交流损耗.%The calculation of AC loss in high temperature superconducting tapes has great realistic meaning.This finite element software was used to calculate AC loss under different arrangements through simulating superconductor tapes.The calculation results were in good agreements with the experimental result and the Norris equation.The results show that the AC loss depending on the cylindrical arrangements can be effectively reduced.

  6. Global loss of a nuclear lamina component, lamin A/C, and LINC complex components SUN1, SUN2, and nesprin-2 in breast cancer

    Cancer cells exhibit a variety of features indicative of atypical nuclei. However, the molecular mechanisms underlying these phenomena remain to be elucidated. The linker of nucleoskeleton and cytoskeleton (LINC) complex, a nuclear envelope protein complex consisting mainly of the SUN and nesprin proteins, connects nuclear lamina and cytoskeletal filaments and helps to regulate the size and shape of the nucleus. Using immunohistology, we found that a nuclear lamina component, lamin A/C and all of the investigated LINC complex components, SUN1, SUN2, and nesprin-2, were downregulated in human breast cancer tissues. In the majority of cases, we observed lower expression levels of these analytes in samples' cancerous regions as compared to their cancer-associated noncancerous regions (in cancerous regions, percentage of tissue samples exhibiting low protein expression: lamin A/C, 85% [n = 73]; SUN1, 88% [n = 43]; SUN2, 74% [n = 43]; and nesprin-2, 79% [n = 53]). Statistical analysis showed that the frequencies of recurrence and HER2 expression were negatively correlated with lamin A/C expression (P < 0.05), and intrinsic subtype and ki-67 level were associated with nesprin-2 expression (P < 0.05). In addition, combinatorial analysis using the above four parameters showed that all patients exhibited reduced expression of at least one of four components despite the tumor's pathological classification. Furthermore, several cultured breast cancer cell lines expressed less SUN1, SUN2, nesprin-2 mRNA, and lamin A/C compared to noncancerous mammary gland cells. Together, these results suggest that the strongly reduced expression of LINC complex and nuclear lamina components may play fundamental pathological functions in breast cancer progression

  7. Studies of superspin glass state and AC-losses in La{sub 0.7}Sr{sub 0.3}MnO{sub 3} nanoparticles obtained by high-energy ball-milling

    Phong, P.T., E-mail: ptphong.nh@khanhhoa.edu.vn [Department of Advanced Materials Chemistry, Dongguk University-Gyeongju, 707 Suckjang-dong, Gyeongbuk, Gyeongju-Si 780-714 (Korea, Republic of); Nha Trang Pedagogic College, 1 Nguyen Chanh Street, Khanh Hoa Province, Nha Trang City (Viet Nam); Manh, D.H. [Institute of Materials Science, Vietnam Academy of Science and Technology, 18 Hoang Quoc Viet Road, Cau Giay District, Ha Noi City (Viet Nam); Nguyen, L.H. [Nha Trang Pedagogic College, 1 Nguyen Chanh Street, Khanh Hoa Province, Nha Trang City (Viet Nam); Institute of Materials Science, Vietnam Academy of Science and Technology, 18 Hoang Quoc Viet Road, Cau Giay District, Ha Noi City (Viet Nam); Tung, D.K. [Institute of Materials Science, Vietnam Academy of Science and Technology, 18 Hoang Quoc Viet Road, Cau Giay District, Ha Noi City (Viet Nam); Phuc, N.X., E-mail: phucnx1949@gmail.com [Nha Trang Pedagogic College, 1 Nguyen Chanh Street, Khanh Hoa Province, Nha Trang City (Viet Nam); Lee, I.-J., E-mail: lij@dongguk.ac.kr [Department of Advanced Materials Chemistry, Dongguk University-Gyeongju, 707 Suckjang-dong, Gyeongbuk, Gyeongju-Si 780-714 (Korea, Republic of)

    2014-11-15

    Single-phase perovskite compound La{sub 0.7}Sr{sub 0.3}MnO{sub 3} was synthesized by a high-energy ball milling method. Nanoparticle nature of this manganite with the average particle diameter of 11 nm was revealed from structure and morphology characterizations. The results of ac magnetic susceptibility measurements show that the system can be described as an ensemble of interacting magnetic nanoparticles, which indicates that the dipole–dipole interactions are strong enough to create superspin glass state in the sample. Furthermore, the specific loss power which is exhausted on the irradiation of an ensemble of particles with a magnetic field has been calculated and measured experimentally. - Highlights: • LSMO nanopowder was prepared by the high-energy ball-milling method. • The superspin glass state of LSMO nanopowder was studied. • The SLP has been calculated and measured experimentally.

  8. Studies of superspin glass state and AC-losses in La0.7Sr0.3MnO3 nanoparticles obtained by high-energy ball-milling

    Single-phase perovskite compound La0.7Sr0.3MnO3 was synthesized by a high-energy ball milling method. Nanoparticle nature of this manganite with the average particle diameter of 11 nm was revealed from structure and morphology characterizations. The results of ac magnetic susceptibility measurements show that the system can be described as an ensemble of interacting magnetic nanoparticles, which indicates that the dipole–dipole interactions are strong enough to create superspin glass state in the sample. Furthermore, the specific loss power which is exhausted on the irradiation of an ensemble of particles with a magnetic field has been calculated and measured experimentally. - Highlights: • LSMO nanopowder was prepared by the high-energy ball-milling method. • The superspin glass state of LSMO nanopowder was studied. • The SLP has been calculated and measured experimentally

  9. Reliable fabrication process for long-length multi-filamentary coated conductors by a laser scribing method for reduction of AC loss

    We have developed a reliable fabrication process based on a laser scribing method for multi-filamentary coated conductors with a low alternating current loss. This process consists of shallow laser irradiation and two-step chemical etching. The shallow laser irradiation, which penetrates into only a masking polymer tape and a silver stabilizing layer, suppresses generation of dross that is formed due to melting and hardening of a metal substrate. The two-step chemical etching individually for the stabilizing and the superconducting layers prevents over-etching of the superconducting layer and thus suppresses degradation of the critical current (Ic). By using the developed laser scribing process, we realized an improvement of processing speed and a reduction of Ic degradation at the same time. Subsequently, we developed reel-to-reel equipment to apply this process to coated conductors several hundred meters long. We succeeded in fabricating 280 m and 70 m long coated conductors with 5 mm width divided into three and five filaments, respectively. It was confirmed that they had one-third and one-fifth hysteresis loss, respectively, in comparison with that before processing, and high inter-filament resistance, over 0.1 MΩ cm. The typical degradation rates of Ic in the developed laser scribing process were less than 20%. (paper)

  10. Development and mass production of bronze-processed Nb3Sn strand with low AC loss and high critical-current density for the ITER

    The development work and mass production of high-performance bronze-processed Nb3Sn superconducting strands for the ITER pulse coils were performed. Using fine hexagonal single-core rods, the undesirable deformation of filament shape was drastically improved and uniform filament-spacing was obtained. As the result, Nb3Sn strand having a bronze/Nb ratio of 2.3 and filament diameter of 3.0 μm showed a very high non-Cu Jc of 667 A/mm2 at 12 T and 4.2 K without external strain. Sufficient low hysteresis loss of 88.2 mJ/cm3 at ±3 T was also observed. These results fully satisfy ITER specifications. The maximum piece length reached 18.9 km, while average piece length was 8.5 km, thus proving excellent workability. By applying the developed technology, mass production of 1,280 km in total was successfully completed. This means that the mass-production technology for the high-performance Nb3Sn superconducting strand of the ITER was established; thus clearing the way for construction of the reactor. (author)

  11. Energy saving in ac generators

    Nola, F. J.

    1980-01-01

    Circuit cuts no-load losses, without sacrificing full-load power. Phase-contro circuit includes gate-controlled semiconductor switch that cuts off applied voltage for most of ac cycle if generator idling. Switch "on" time increases when generator is in operation.

  12. ACAC Converters for UPS

    Rusalin Lucian R. Păun

    2008-05-01

    Full Text Available This paper propose a new control technique forsingle – phase ACAC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.

  13. AC power supply systems

    An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)

  14. AcEST: DK950971 [AcEST

    Full Text Available optera acutorost... 37 0.66 tr|B1ACS6|B1ACS6_BALBN DMP1 (Fragment) OS=Balaenoptera ...bonaerens... 37 0.66 tr|B1ACS5|B1ACS5_BALED DMP1 (Fragment) OS=Balaenoptera edeni... GN=... 37 0.66 tr|B1ACS4|B1ACS4_BALBO DMP1 (Fragment) OS=Balaenoptera borealis ... 37 0.66 tr|B1ACS3|B1ACS3..._BALMU DMP1 (Fragment) OS=Balaenoptera musculus ... 37 0.86 tr|B1ACS1|B1ACS1_MEGNO DMP1 (Fragment) OS=Megapt...1ACS2_BALPH DMP1 (Fragment) OS=Balaenoptera physalus ... 37 1.1 tr|B1ACT6|B1ACT6_MESPE DMP1 (Fragment) OS=Me

  15. AC1 Wing

    Adrian DOBRE

    2010-03-01

    Full Text Available The AC1 wing replaces the old wing of the wind tunnel model AEROTAXI, which has been made at scale 1:9. The new wing is part of CESAR program and improves the aerodynamic characteristics of the old one. The geometry of the whole wing was given by FOI Sweden and position of AC1 wing must coincide with the structure of the AEROTAXI model.

  16. AC1 Wing

    Adrian DOBRE

    2010-01-01

    The AC1 wing replaces the old wing of the wind tunnel model AEROTAXI, which has been made at scale 1:9. The new wing is part of CESAR program and improves the aerodynamic characteristics of the old one. The geometry of the whole wing was given by FOI Sweden and position of AC1 wing must coincide with the structure of the AEROTAXI model.

  17. Loss comparison of different nine-switch and twelve-switch energy conversion systems

    Bahman, Amir Sajjad; Loh, Poh Chiang; Qin, Zian;

    2014-01-01

    answer only available after performing a thorough analysis. For that, it is the intention now to compare the nine-switch and twelve-switch converters when they are used in ac-ac, ac-dc, dc-ac or dc-dc energy conversion systems. Their losses will be compared to identify when the nine-switch converter will...

  18. Heat Transfer Analysis for Industrial AC Electric Arc Furnace

    (U)nal (C)amdali; Murat Tun(c)

    2005-01-01

    The heat transfer analysis was performed for an AC electric arc furnace (EAF). Heat losses by conduction, convection and radiation from outer surface, roof, bottom and electrodes of EAF were determined in detail. Some suggestions about decreasing heat losses were presented.

  19. Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count

    Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin;

    2009-01-01

    This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low-cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled to...... semiconductor commutations, and hence, no increase in switching losses. The proposed converter therefore offers a low-cost alternative to applications that need to ride through frequent input voltage sags. For confirming the converter performance, experimental testing using a constructed laboratory prototype is...

  20. ac bidirectional motor controller

    Schreiner, K.

    1988-01-01

    Test data are presented and the design of a high-efficiency motor/generator controller at NASA-Lewis for use with the Space Station power system testbed is described. The bidirectional motor driver is a 20 kHz to variable frequency three-phase ac converter that operates from the high-frequency ac bus being designed for the Space Station. A zero-voltage-switching pulse-density-modulation technique is used in the converter to shape the low-frequency output waveform.

  1. AC/RF Superconductivity

    Ciovati, Gianluigi [JLAB

    2015-02-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  2. AC/RF Superconductivity

    Ciovati, G.

    2015-01-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  3. Transport current losses in Bi2223 high temperature superconductors

    Bi2223 high temperature superconductor (HTS) tapes are expected to be used in power industry such as fault current limiter, transformer, magnets, transmission cables. For most of applications of Bi2223 tapes, the superconductor will transport ac current and/or be exposed to applied magnetic field. AC loss is one of important parameters to evaluate the economic feasibility of HTS ceramic superconductors in those applications. Extensive investigations have been done to understand the mechanism of generation of AC loss and minimize it. In this study, AC losses in Bi2223 (HTS) tapes were measured at 77 K. The effects of different factors, such as, current distribution, heat recycling, transport current wave and applied DC magnetic field, were investigated on the AC losses in Bi2223 HTS tapes. Possible explanations were presented in the paper

  4. Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition

    The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity

  5. Hermetisk AC-Krets

    Hirsch, Carl; Smirnoff, Alexander

    2007-01-01

    Under sex månader våren 2007 har ett samarbete mellan Volvo Lastvagnar och två studenter från KTH, inriktning Integrerad produktutveckling vid institutionen för maskinkonstruktion, pågått i form av ett examensarbete på 20 poäng. Dagens AC-system i Volvos lastbilar avger 20-40 g/år av köldmediet R134a som är en kraftfull växthusgas. Detta sker främst genom diffusion via slangar och tätningsmaterial. Syftet med detta examensarbete är att ta fram förslag på tekniska lösningar på ett nytt AC-syst...

  6. Low frequency ac conduction and dielectric relaxation in poly(N-methyl pyrrole)

    Amarjeet K Narula; Ramadhar Singh; Subhas Chandra

    2000-06-01

    The ac conductivity and dielectric constant of poly(N-methyl pyrrole) thin films have been investigated in the temperature range 77–350 K and in the frequency range 102–106 Hz. The well defined loss peaks have been observed in the temperature region where measured ac conductivity approaches dc conductivity. These loss peaks are associated with the hopping of the charge carriers. The frequency and temperature dependence of ac conductivity have been qualitatively explained by considering the contribution from two mechanisms; one giving a linear dependence of conductivity on frequency and other having distribution of relaxation times giving rise to broad dielectric loss peak.

  7. Hearing Loss

    ... labor & premature birth The newborn intensive care unit (NICU) Birth defects & other health conditions Loss & grief Tools & ... labor & premature birth The newborn intensive care unit (NICU) Birth defects & other health conditions Loss & grief Ask ...

  8. Modelling ac ripple currents in HTS coated conductors

    Xu, Zhihan; Grilli, Francesco

    2015-10-01

    Dc transmission using high temperature superconducting (HTS) coated conductors (CCs) offers a promising solution to the globally growing demand for effective, reliable and economic transmission of green energy up to the gigawatt level over very long distances. The credible estimation of the losses and thereby the heat dissipation involved, where ac ripples (introduced in rectification/ac-dc conversion) are viewed as a potential source of notable contribution, is highly essential for the rational design of practical HTS dc transmission cables and corresponding cryogenic systems to fulfil this demand. Here we report a targeted modelling study into the ac losses in a HTS CC subject to dc and ac ripple currents simultaneously, by solving Maxwell’s equations using the finite element method (FEM) in the commercial software package COMSOL. It is observed that the instantaneous loss exhibits only one peak per cycle in the HTS CC subject to sinusoidal ripples, given that the amplitude of the ac ripples is smaller than approximately 20% of that of the dc current. This is a distinct contrast to the usual observation of two peaks per cycle in a HTS CC subject to ac currents only. The unique mechanism is also revealed, which is directly associated with the finding that, around any local minima of the applied ac ripples, the critical state of -J c is never reached at the edges of the HTS CC, as it should be according to the Bean model. When running further into the longer term, it is discovered that the ac ripple loss of the HTS CC in full-wave rectification decays monotonically, at a speed which is found to be insensitive to the frequency of the applied ripples within our targeted situations, to a relatively low level of approximately 1.38 × 10-4 W m-1 in around 1.7 s. Comparison between this level and other typical loss contributions in a HTS dc cable implies that ac ripple currents in HTS CCs should only be considered as a minor source of dissipation in superconducting dc

  9. Loss and Inductance Investigation in Superconducting Cable Conductors

    Olsen, Søren Krüger; Tønnesen, Ole; Træholt, Chresten;

    1999-01-01

    the layers are therefore studied theoretically. The current distribution between the superconducting layers is monitored as a function of transport current, and the results are compared with the expected current distribution given by our electrical circuit model.The AC-losses are measured as a...... Hz) the AC-loss was measured on cable #2 to 0.6W/mxphase. This is, to our knowledge, the lowest AC-loss (at 2kA and 77K) of a high temperature superconducting cable conductor reported so far....

  10. High performance AC drives

    Ahmad, Mukhtar

    2010-01-01

    This book presents a comprehensive view of high performance ac drives. It may be considered as both a text book for graduate students and as an up-to-date monograph. It may also be used by R & D professionals involved in the improvement of performance of drives in the industries. The book will also be beneficial to the researchers pursuing work on multiphase drives as well as sensorless and direct torque control of electric drives since up-to date references in these topics are provided. It will also provide few examples of modeling, analysis and control of electric drives using MATLAB/SIMULIN

  11. Superconducting ac cable

    The components of a superconducting 110 kV ac cable for power ratings >= 2000 MVA have been developed. The cable design especially considered was of the semiflexible type, with a rigid cryogenic envelope and flexible hollow coaxial cable cores pulled into the former. The cable core consists of spirally wound Nb-Al composite wires and a HDPE-tape wrapped electrical insulation. A 35 m long single phase test cable with full load terminations for 110 kV and 10 kA was constructed and successfully tested. The results obtained prove the technical feasibility and capability of our cable design. (orig.)

  12. Superconductor films with improved flux pinning and reduced AC losses

    Goyal, Amit

    2011-04-05

    The present invention relates to a method for producing a defect-containing superconducting film, the method comprising (a) depositing a phase-separable layer epitaxially onto a biaxially-textured substrate, wherein the phase-separable layer includes at least two phase-separable components; (b) achieving nanoscale phase separation of the phase-separable layer such that a phase-separated layer including at least two phase-separated components is produced; and (c) depositing a superconducting film epitaxially onto said phase-separated components of the phase-separated layer such that nanoscale features of the phase-separated layer are propagated into the superconducting film.

  13. Calculation of AC losses in large HTS stacks and coils

    Zermeno, Victor; Abrahamsen, Asger Bech; Mijatovic, Nenad;

    2012-01-01

    substrate layers are reduced while keeping the overall electromagnetic behavior. Our work extends the anisotropic bulk model originally presented by Clem et al. and later refined by Prigozhin and Sokolovsky. We disregard assumptions upon the shape of the critical region and use a power law E-J relationship...

  14. Ac Hybrid Charge Controller

    Shalini S. Durgam

    2015-03-01

    Full Text Available One of the primary needs for socio-economic development in any nation in the world is the provision of reliable electricity supply systems with lower carbon footprint levels. The purpose of this work is the development of a hybrid Power system that harnesses the renewable energy in sun and electricity to generate electricity. The working model can able to run on dual mode- solar and electricity. It can also be driven independently either by solar or electricity. The battery can be charge from solar panel (40W or by power supply. The household single phase A.C. power supply of 230V is converted into 12V D.C. using step down transformer and rectifying circuit. The working model can achieve energy saving, low carbon emission, environmental protection for the upcoming future of human life.

  15. Hidden loss

    Kieffer-Kristensen, Rikke; Johansen, Karen Lise Gaardsvig

    2013-01-01

    finding indicates that the children experienced numerous losses, many of which were often suppressed or neglected by the children to protect the ill parents. CONCLUSIONS: The findings indicated that the children seemed to make a special effort to hide their feelings of loss and grief in order to protect...

  16. AcEST: BP920072 [AcEST

    Full Text Available YMU001_000132_F11 525 Adiantum capillus-veneris mRNA. clone: YMU001_000132_F11. BP920072 - Show ... YGMYGEGEKALETFADMEKSGIVPDSVVFIAII 617 Query: 139 NACSR SCLFHECHSYFEAMSTHHGIVPCLEHHSCVV 32 ACS S L E + FE M ... KLMTRDVVSWNTLIAGYAQVGQNEGLFCTFSDMLGQRVKPDLITFVIVLNACSR ... 125 VF+ + +D VSWN++I+GY Q G F M+ + D IT++++++ +R S ... YGVHGYGKKAIQIFEEMLANGASP 384 Query: 166 DLITFVIVLNACSR SCLFHECHSYFEAMSTHHGIVPCLEHHSCVV 32 +TFV VL ACS L E ... KLMTRDVVSWNTLIAGYAQVGQNEGLFCTFSDMLGQRVKPDLITFVIVLNACSR S 122 +VFDK R + WN L G E + + M V+ D T+ VL AC S Sbjc ...

  17. Parametric study on coupling loss in subsize ITER Nb3Sn cabled specimen

    Nijhuis, Arend; Kate, ten, F.J.W.; Bruzzone, Pierluigi; Bottura, Luca

    1996-01-01

    The cable in conduit conductors for the various ITER coils are required to function under pulse conditions and fields up to 13 T. A parametric study, restricted to a limited variation of the reference cable lay out, is carried out to clarify the quantitative impact of various cable parameters on the coupling loss and to find realistic values for the coupling loss time constants to be used in ac loss computations. The investigations cover ac coupling loss measurements on jacketed sub- and full...

  18. Memory loss

    A person with memory loss needs a lot of support. It helps to show the person familiar objects, music, or and photos or play familiar music. Write down when the person should take any medicine or do other ...

  19. Induction Motor Control through AC/DC/AC Converters

    Elfadili, Abderrahim; Giri, Fouad; Ouadi, Hamid; El Magri, Abdelmounime; Dugard, Luc; Abouloifa, Abdelmajid

    2010-01-01

    We consider the problem of controlling inductions motors driven through AC/DC rectifiers and DC/AC inverters. The control objectives are threefold: (i) forcing the motor speed to track a reference signal, (ii) regulating the DC Link voltage, (iii) assuring a satisfactory power factor correction (PFC) with respect to the power supply net. First, a nonlinear model of the whole controlled system is developed in the Park-coordinates. Then, a nonlinear multi-loop controller is synthesized using th...

  20. AcEST: BP920905 [AcEST

    Full Text Available EM + + D ++S L AC Sbjct: 374 NSAYKLFERMPKKNVVAWNAIISGYSQHGHPHEALALFIEMQAQGIKPDSFAIVSVLPAC 433 Query: 71 SHSSTLNDGKLIHFYILMNNFE...EM++ ++ + V + S L +C Sbjct: 255 SSERIFEKIAKKNAVSWTAMISSYNRGEFSEKALRSFSEMIKSGIEPNLVTLYSVLSSCG 314 Query: 68 HSSTLNDGKLIHFYILMNNFE...VVVMSCLKACS 69 ++ +F RRD VTW A+I GYA HG E A+ LF+ M+ EN+ + V +S L+AC+ Sbjct: 656 DSRLMFEKSLRRDFVTWNAMICGYAHHGKGEEAIQLFERMILEN...ELEKMHNKRLQEMCVSWNSIISGYVMKEQSEDAQMLFTRMME 596 Query: 122 ENVDTDGVVVMSCLKACSHSSTLNDGKLIHFYILMNNFE ...FCEADT-NVITWNAMIASYVHCEQSEKAIALFDRMVSENFKPSSITLVTLLMAC 543 Query: 71 SHSSTLNDGKLIHFYILMNNFEL 3 ++ +L G++

  1. AcEST: DK950147 [AcEST

    Full Text Available TST38A01NGRL0007_O05 706 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0007_O05. 5' end seq ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... OS=Medicago truncatula GN=MtrDRAFT_AC149576g3v2 PE ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... (Fragment) OS=Medicago truncatula GN=MtrDRAFT_AC14 ...

  2. AcEST: DK959344 [AcEST

    Full Text Available TST39A01NGRL0004_G23 714 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0004_G23. 5' end seq ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... OS=Medicago truncatula GN=MtrDRAFT_AC149576g3v2 PE ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... (Fragment) OS=Medicago truncatula GN=MtrDRAFT_AC14 ...

  3. AcEST: DK949716 [AcEST

    Full Text Available TST38A01NGRL0006_L20 613 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0006_L20. 5' end seq ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... OS=Medicago truncatula GN=MtrDRAFT_AC149576g3v2 PE ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... (Fragment) OS=Medicago truncatula GN=MtrDRAFT_AC14 ...

  4. AC drives for industrial plants. Plant kudoyo AC drive sochi

    Miyazaki, M.; Shibata, M.; Yamada, S. (Toshiba Corp., Tokyo (Japan))

    1992-08-01

    Features and product series of AC drives for industrial plants were outlined. Configurations and features of various types of AC drives were briefly discussed which are put into market to meet various requirements for industrial plants and wide ranges of output voltage and capacity. The following product series were outlined; the power bipolar transistor inverter for 3.5-600 kVA in output capacity, IGBT inverter for AC 400 V in output voltage and 1,000 kVA or less, GTO inverter for AC 600 V and 700-2,000 kVA, and cycloconverter for AC 1,000-3,000 V and 1,000 kW-20 MW. The following subjects were outlined as current technical trends of AC drives for industrial plants; increasing in capacity of voltage-source PWM inverters, downsizing of converters through highly efficient cooling and highly dense mounting, spreading of sensorless vector controls, and development of high-voltage large-capacity PWM inverters. 6 figs., 2 tabs.

  5. Neural network based PWM AC chopper fed induction motor drive

    Venkatesan Jamuna

    2009-01-01

    Full Text Available In this paper, a new Simulink model for a neural network controlled PWM AC chopper fed single phase induction motor is proposed. Closed loop speed control is achieved using a neural network controller. To maintain a constant fluid flow with a variation in pressure head, drives like fan and pump are operated with closed loop speed control. The need to improve the quality and reliability of the drive circuit has increased because of the growing demand for improving the performance of motor drives. With the increased availability of MOSFET's and IGBT's, PWM converters can be used efficiently in low and medium power applications. From the simulation studies, it is seen that the PWM AC chopper has a better harmonic spectrum and lesser copper loss than the Phase controlled AC chopper. It is observed that the drive system with the proposed model produces better dynamic performance, reduced overshoot and fast transient response. .

  6. Flux-transfer losses in helically wound superconducting power cables

    Clem, John R; Malozemoff, A P

    2013-06-25

    Minimization of ac losses is essential for economic operation of high-temperature superconductor (HTS) ac power cables. A favorable configuration for the phase conductor of such cables has two counter-wound layers of HTS tape-shaped wires lying next to each other and helically wound around a flexible cylindrical former. However, if magnetic materials such as magnetic substrates of the tapes lie between the two layers, or if the winding pitch angles are not opposite and essentially equal in magnitude to each other, current distributes unequally between the two layers. Then, if at some point in the ac cycle the current of either of the two layers exceeds its critical current, a large ac loss arises from the transfer of flux between the two layers. A detailed review of the formalism, and its application to the case of paramagnetic substrates including the calculation of this flux-transfer loss, is presented.

  7. AcEST: DK955197 [AcEST

    Full Text Available TST39A01NGRL0022_H07 532 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0022_H07. 5' end seq ... KDEVTALPLLK 192 Query: 194 RFAFGIACELLMSRYEKEEQEMLEEPF TTMMKGILQLPIKLPGTRFSKAIVAANMLRARF 373 R+ F +AC+L S ... KDEVMALPLLK 192 Query: 194 RFAFGIACELLMSRYEKEEQEMLEEPF TTMMKGILQLPIKLPGTRFSKAIVAANMLRARF 373 R+ F +AC+L S ... KDEVKVLP 189 Query: 185 LMKRFAFGIACELLMSRYEKEEQEMLEEPF TTMMKGILQLPIKLPGTRFSKAIVAANMLR 364 L++ F IA L + +Q+ ... KDEATVLP 177 Query: 185 LMKRFAFGIACELLMSRYEKEEQEMLEEPF TTMMKGILQLPIKLPGTRFSKAIVAANMLR 364 L+K F +A L E+ QE ...

  8. AcEST: BP915640 [AcEST

    Full Text Available YMU001_000074_A01 462 Adiantum capillus-veneris mRNA. clone: YMU001_000074_A01. BP915640 CL3685C ... y: 462 GPLILRACLVYMQGAPVGSLAEDGIVSAATGKDMEQSTVGFRLMLAKI IHRLIAAFKEVG 283 G IL+AC YM+G +GSL +D V ++VGF+LMLAK ... : 1032 GYYILKACDAYMKGYLIGSLTKDASVIDERSS-ANSTSVGFKLMLAKI APKLFSALSEVG 1090 Query: 282 AYCDAYE 262 A C+ ++ Sb ... uery: 453 ILRACLVYMQGAPVGSLAEDGIVSAATGKDMEQSTVGFRLMLAKI IHRLIAAFKEVGAYC 274 +L AC YM+G PVGS A G ST GF++ML+K ... ame = -1 Query: 423 GAPVGSLAEDGIVSAATGKDMEQSTVGFRLMLAKI I----HRLIAAFKEVGAYCD 271 G P+ L D +S GK + S RL + L+ ...

  9. Speed Control of DC Motor using AC/AC/DC Converter Based on Intelligent Techniques

    Rakan Kh Antar

    2013-05-01

    Full Text Available    This paper describes the application of ac/ac/dc and ac/dc converters to control the speed of a separately excited DC motor. Artificial neural network and PI controller are trained to select the desired values of firing angles for triggering thyristors of the ac/ac/dc and ac/dc bridge converters in order to control the speed of the dc motor at a desired value with constant and different load torques in order to obtain the best speed response. Simulation results show that the rising time for ac/dc and ac/ac/dc converters at 250rpm are reduced about 79% and 89% respectively, while delay time it reduced about 69% and 64% respectively. Therefore, speed response of the dc motor is more efficient for closed loop system compared with open loop also the response of ac/ac/dc converter is better than ac/dc converter.

  10. Nuclear structure of $^{231}$Ac

    Boutami, R; Mach, H; Kurcewicz, W; Fraile, L M; Gulda, K; Aas, A J; García-Raffi, L M; Løvhøiden, G; Martínez, T; Rubio, B; Taín, J L; Tengblad, O

    2008-01-01

    The low-energy structure of 231Ac has been investigated by means of gamma ray spectroscopy following the beta-decay of 231Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a mini-orange electron spectrometer. The decay scheme of 231Ra --> 231Ac has been constructed for the first time. The Advanced Time Delayed beta-gamma-gamma(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

  11. AcEST: BP920800 [AcEST

    Full Text Available DLNLALQVHSRMVRFGFNAEVEACGALINMYGKCGKVLYAQRVFDDT 298 Query: 206 RQQDVISWNDIISACAQRGHGTEALENFSQMLHEGIVPNSMTFTSVMQA---CNSIEGG...G L +A S F ++ +D+ISW +I +Q EA+ F Sbjct: 217 SEKNEATSNCLINGYMGLGNLEQAESLFNQMPVKDIISWTTMIKGYSQNKRYREAIAVFY 276 Query: 119 QMLHEG...EKAWRIFDGVSCKNLPSWNAIITGCVQGGLLEEAIDLYRHMK 281 Query: 110 HEGIVPNSMTFTSVMQAC---NSIEGGR 36 + + PN +T +V+ AC +...N IIS AQ G +EA+E ++ M Sbjct: 383 DITIGNAVVVMYAKLGLVDSARAVFNWLPNTDVISWNTIISGYAQNGFASEAIEMYNIME 442 Query: 110 HEG...EIDLGEQIHSLSVKTGFESDMYVSGVLIDMYSKYGWLEKARRVLEML 406 Query: 206 RQQDVISWNDIISACAQRGHGTEALENFSQMLHEGIVPNSMTFTSVMQACNSIEGG

  12. AcEST: DK945549 [AcEST

    Full Text Available AGGCGATTTCATCTTTTCTGAGAACCCTGATTTTGTGATTGTGTAATTACA ACTGTGGAACAGAAGGATGAGAAGTCTACTGACACAACAAGATATCTCTGGAGAGGAGA...A AATTGAGAAGGTTTGAGTTCTCAACAATGGGCTATGAGGCAATAATGGGAAGGCACCGAT TGTGGGCTTGTATAGGTTTTGAC...LCTG 239 L++R+LRR + + ++ G AC+ DP +P PLC+G Sbjct: 108 LQQRELRRKLLADSGALNTNSVNGPRNWKACVQQDPSSRPGTPLCSG 154 >sp|A6UUY8|RNZ_META3...49 Tissue type young leaves Developmental stage sporophyte Contig ID CL454Contig1 Sequence GATGAGCGA...CCACCTGTGCAACCGTCAGCGCCTTTGTGCACTGGTG CAATGTCCTGTGGTTACCTTGTTTGGAATCTTAATTGTTCTCATGTAT

  13. AcEST: BP917632 [AcEST

    Full Text Available YMU001_000103_D10 554 Adiantum capillus-veneris mRNA. clone: YMU001_000103_D10. BP917632 - Show ... YSKCKIHQKALELLVLML 154 Query: 466 KDSLEPDEVTYLNVLKACARE EDLKV 543 +D++ P+ TY +VL++C D+++ Sbjct: 155 RDNVRPN ... 185 Query: 415 GHSDSS--KEALKLLTQMRKDSLEPDEVTYLNVLKACARE EDLK 540 + EA KL +M+ ++ PDE+ N++ AC R +++ Sbjct: 18 ...

  14. AcEST: DK961189 [AcEST

    Full Text Available OS=A... 127 7e-29 sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS... 125 2e-28 sp|P00785|AC...IRNSWGLNWGDSGYVKLQRNIDDPFGKCGIAMMPSYP 347 >sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS=

  15. AcEST: DK946687 [AcEST

    Full Text Available YMU02A01NGRL0013_G11 544 Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0013_G11. 5' end seq ... + G P+ TY+ + AC+ E Sbjct: 97 YSFNYMIRGLTNTWN-------DHEA ---ALSLYRRMKFSGLKPDKFTYNFVFIACAKLE 146 Query: 214 A ... Sbjct: 71 LIPKAVELGDFNYSSFLFSVTEEPNHYSFNYMIRGLTNTWNDHEA ALSLYRRMKFSGLKP 130 Query: 469 DGATFSCVLRACGNVGALDV ...

  16. AcEST: DK949372 [AcEST

    Full Text Available TST38A01NGRL0005_N02 627 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0005_N02. 5' end seq ... 363 DQLREKTC-GVDKFDDIVMACXXXXXXXXXXXXXXXXXXKARVHAYGVCD DPEYFYDYVQ 539 Q++EK G+ FDDIV+AC KA+VHA+ VCD DP+YFYD ... 264 QQVQEKKVPGITFFDDIVVACGSGGSIAGLSLGSYLSNLKAKVHAFAVCD DPDYFYDYTQ 323 Query: 540 GLLDGMNANIASRDIVNVIDAKGLG ...

  17. Alternating current losses of a 10 metre long low loss superconducting cable conductor determined from phase sensitive measurements

    Olsen, Søren Krüger; Kühle (fratrådt), Anders Van Der Aa; Træholt, Chresten;

    1999-01-01

    The ac loss of a superconducting cable conductor carrying an ac current is small. Therefore the ratio between the inductive (out-of-phase) and the resistive (in-phase) voltages over the conductor is correspondingly high. In vectorial representations this results in phase angles between the current...... and the voltage over the cable close to 90 degrees. This has the effect that the loss cannot be derived directly using most commercial lock-in amplifiers due to their limited absolute accuracy. However, by using two lock-in amplifiers and an appropriate correction scheme the high relative accuracy of...... such lock-in amplifiers can be exploited. In this paper we present the results from ac-loss measurements on a low loss 10 metre long high temperature superconducting cable conductor using such a correction scheme. Measurements were carried out with and without a compensation circuit that could reduce...

  18. Apuntes de Acústica

    Martín Domingo, Agustín

    2014-01-01

    Esta publicacion contiene unos apuntes para la parte de Acústica de las asignaturas de la ETSAM, junto con cierta cantidad de material adicional que excede el ámbito del curso. Aunque está lejos de ser completa y de estar libre de errores, el autor espera sea útil.

  19. SSTI Clark ACS Technology Demonstrations

    Freesland, Douglas

    1997-01-01

    SSTI Clark, one of two spacecraft built under NASA's Small Satellite Technology Initiative, includes seven ACS technology demonstrations. The technologies redefine the performance cost envelope, providing improved sensor and actuator performance at reduced costs. Six sensing technologies are being flown consisting of both hardware and algorithmic demonstrations: autonomous star tracker, hemispherical resonating gyro, GPS attitude determination, miniature horizon sensors, low cost course sun s...

  20. Evaluating conversion of AC power transmission lines to DC

    Edris, A. [EPRI, Palo Alto, CA (United States); Barthold, L. [IMod Inc., Lafayette, LA (United States); Douglass, D. [Power Delivery Consultants, Ballston Lake, NY (United States); Litzenberger, W. [Litzenberger Consultant (United States); Woodford, D. [Electranix, Winnipeg, MB (Canada)

    2008-07-01

    Conversion of alternating current (AC) transmission lines has been of significant interest for several years but has never been implemented to expand transmission line capacity or improve system security. This paper outlined the procedures necessary to identify and assess feasibility of specific AC to direct current (DC) conversion opportunities, with special focus on emerging DC transmission technologies. The paper outlined the process for investigating the conversion of an AC transmission line to DC. The investigation examined both bipole and tripole applications. A summary of the characteristics for alternative DC conversion configuration was presented. These characteristics included maximum transfer capability; redundancy; losses; overhead ratio; switching requirements; reactive power requirement; and accommodation of taps. The challenges and objectives of the project were also described. The paper provided a summary of the cost and benefit analysis for the various AC to DC conversion technologies for the Grand Coulee to Olympia transmission line. It was concluded that the project was particularly timely in that current work on the prospect of major North American system segmentation could benefit substantially, both technically and economically by having inter-system links take fuller advantage of the inherent DC capability of the circuits involved, thereby encouraging greater inter-regional energy exchange and providing the basis for lower energy supply costs. 12 refs., 2 tabs., 3 figs., 1 appendix.

  1. ac MH loop measurements on Mn doped YBa2Cu3O7– superconductors

    E Isaac Samuel; V Seshu Bai

    2006-06-01

    Isothermal ac MH (magnetization-field) loops for varying field amplitudes were recorded at 77 K on YBa2(Cu1–Mn)3O7– with = 0, 0.010, 0.015, 0.020, 0.025, 0.035 and 0.050, YBa2(Cu0.075Fe0.025)3O7–, YBa2(Cu0.075Ni0.025)3O7– and YBa2(Cu0.075Zn0.025)3O7– samples up to a maximum field amplitude of 80 Oe. Flat band susceptibility, ac losses and flux profiles were deduced from the ac MH loops. The undoped sample exhibited a minimum weak link ac loss and the 5.0% doped sample showed maximum weak link ac loss. Ni and Fe doped samples showed higher granular losses. cg estimated from the flux profiles decreases monotonically with increasing concentrations of Mn up to 2.5%.

  2. Development of an AC Module System: Final Technical Report

    Suparna Kadam; Miles Russell

    2012-06-15

    The GreenRay Inc. program focused on simplifying solar electricity and making it affordable and accessible to the mainstream population. This was accomplished by integrating a solar module, micro-inverter, mounting and monitoring into a reliable, 'plug and play' AC system for residential rooftops, offering the following advantages: (1) Reduced Cost: Reduction in installation labor with fewer components, faster mounting, faster wiring. (2) Maximized Energy Production: Each AC Module operates at its maximum, reducing overall losses from shading, mismatch, or module downtime. (3) Increased Safety. Electrical and fire safety experts agree that AC Modules have significant benefits, with no energized wiring or live connections during installation, maintenance or emergency conditions. (4) Simplified PV for a Broader Group of Installers. Dramatic simplification of design and installation of a solar power system, enabling faster and more efficient delivery of the product into the market through well-established, mainstream channels. This makes solar more accessible to the public. (5) Broadened the Rooftop Market: AC Modules enable solar for many homes that have shading, split roofs, or obstructions. In addition, due to the smaller building block size of 200W vs. 1000W, homeowners with budget limitations can start small and add to their systems over time. Through this DOE program GreenRay developed the all-in-one AC Module system with an integrated PV Module and microinverter, custom residential mounting and performance monitoring. Development efforts took the product from its initial concept, through prototypes, to a commercial product sold and deployed in the residential market. This pilot deployment has demonstrated the technical effectiveness of the AC Module system in meeting the needs and solving the problems of the residential market. While more expensive than the traditional central inverter systems at the pilot scale, the economics of AC Modules become

  3. AcEST: DK950895 [AcEST

    Full Text Available |A7SFA3|A7SFA3_NEMVE Predicted protein OS=Nematostella vectens... 210 5e-53 tr|Q0CVA9|Q0CVA9_ASPTN ATP-citrate synthase subunit...stX Result : Swiss-Prot sp_hit_id Q54YA0 Definition sp|Q54YA0|ACLY_DICDI Probable ATP-citrate synthase OS=Dictyos...PIDYSWAQELGLIRKPAAFISTI 404 >sp|Q8X097|ACL1_NEUCR Probable ATP-citrate synthase subunit 1 OS=Neurospora cras...IRKPASFMTSI 844 >sp|Q9P7W3|ACL1_SCHPO Probable ATP-citrate synthase subunit 1 OS=Schizosaccharomyces pombe G....done Score E Sequences producing significant alignments: (bits) Value sp|Q54YA0|ACLY_DICDI Probable ATP-citrate synthase OS=Dictyos

  4. AcEST: BP914304 [AcEST

    Full Text Available IDEHTFVFTLRAC 4 V+ NA++ Y G+ E A++ + +M+ E++ + TF+ LRAC Sbjct: 670 VTWNAMICGYAHHGKGEEAIQLFERMILENIKPNHVTFISI...KSLRRDFVTWNAMICGYAHHGKGEEAIQLFERMILENIKPN 703 Query: 339 NLTYVSLFKACGNVLDFGQG-RTIHGEARANGFSSDRFICTTLI...TFVFTLRAC 4 +F + + V+ N ++ +YV A +++M + D TL+AC Sbjct: 484 QIFERMCDRDNVTWNTIIGSYVQDENESEAFDLFKRMNLCGIVSDGACL...K + A+Q+ + R + +W++MI++ +A + ++ M Sbjct: 93 LGNSLINFYSKFEDVASAEQVFRRMTLRDVVTWSSMIAAYAGNNHPAKAFDTFERMTDAN 152... + R + +W++MI++ +A + ++ M Sbjct: 93 LGNSLINFYSKFEDVASAEQVFRRMTLRDVVTWSSMIAAYAGNNHPAKAFDTFERM

  5. AcEST: BP911793 [AcEST

    Full Text Available + +VSWN +++ Y QHG + ++L+ M+AE T N + + A Sbjct: 58 EAKFVFERIQNKDVVSWNCIINGYSQHGPSGSSHVMELFQRMRAENTAPNAHTFAGVF... N + + A Sbjct: 58 EAKFVFERIQNKDVVSWNCIINGYSQHGPSGSSHVMELFQRMRAENTAPNAHTFAGVFTA 117 Query: 359 CIQTGNLELCKQM...D VT S+LSACSH G + +G YF Sbjct: 602 IIGGSAQHGRGQDALQLFERMKMEGVKPDIVTFVSLLSACSHAGLLEEGRRYF 654 Score = 115 bit...53 QTGNLELCKQMHFNIVSAGNELNPSLASSLIRTYGNCGSMLDAHAVFDSLPLPDIVSWNV 174 Q +E+ K++ F+++ N S +++I Y CG + +A +FD +P D VSW Sbjct: 324 QGERME... L+ M +E + I+LV +L AC+ TG+LE + +H Sbjct: 498 VITWNAMIASYVHCEQSEKAIALFDRMVSENFKPSSITLVTLLMACVNTGSLER

  6. AcEST: BP921649 [AcEST

    Full Text Available 40 + ++LV YAK L + ++ +P R W+ +I+ + + ++E AL+ + M+ G Sbjct: 144 VASSLVGMYAKFNLFENSLQVFDEMPERDVASWNTVISCFYQSGEAEKALELFGRME...LDCYKEM 52 ++L +GNALVD YAKCG L A ++ +R+ R V W+ +I Y + E A D +K M Sbjct: 461 KNLFVGNALVDMYAKCGALEDARQIFERMCDRDNVTWNTIIGSYVQDEN...RD+ WNA+I Sbjct: 237 LEQGKQIHCYAIRSG-IESDVLVVNGLVNMYAKCGNVNTAHKLFERMPIRDVASWNAIIG 295 Query: 411 GYVNHGRAEVALDCFGKME...SNDVV-GNALVNMYAKCGNVNSAYKLFERMPKKNVVAWNAIIS 396 Query: 411 GYVNHGRAEVALDCFGKME... HGR + AL F +M+ EG PD +TF +L AC G + + + + Sbjct: 603 IGGSAQHGRGQDALQLFERMKMEGVKPDIVTFVSLLSACSHAGLLEEGRRYFCSM

  7. AcEST: BP919669 [AcEST

    Full Text Available D + RDV SW ++S + + G+ ++F M G +P+ Sbjct: 148 LVGMYAKFNLFENSLQVFDEMPERDVASWNTVISCFYQSGEAEKALELFGRMESSGFEPN 20...+ +++AC L + +G+E+H + K+G EL V Sbjct: 190 EKALELFGRMESSGFEPNSVSLTVAISACSRLLWLERGKE...F Sbjct: 468 IY---VVNSLIDSYGKCSHVEDAERIFEECTIGDLVSFTSMITAYAQYGQGEEALKLFLE 524 Query: 226 MVGEGTKPDSISLLVVLRA-YNF...+ IR DV W +LMSGY+K D ++F ++ Sbjct: 44 SLINVYFTCKDHCSARHVFENFDIRSDVYIWNSLMSGYSKNSMFHDTLEVFKRLLNCSIC 103 Query: 208 KPDSISLLVVLRAYNF...KPD Sbjct: 261 VDMYAKCGCIETAVEVFEKLTRRNVFSWAALIGGYAAYGYAKKATTCLDRIEREDGIKPD 320 Query: 199 SISLLVVLRAYNFLGFP

  8. AcEST: DK957916 [AcEST

    Full Text Available PQKQPVPAVSHSPQKSSTPPTPAATKPKEEPSVPKEVPKLQQGKLEKT 967 Query: 577 --TTEASQGIPVEEG...G E+ P+ P Sbjct: 1974 QEQGRAPSQDQEAPSPEALPSPGQEPAAGASPRRGELRRGSSAESALPRAGP 2025 >sp|Q05175|BASP_RAT Brain ac... +P AP P Sbjct: 388 ERETAASAGPQG----AFPEPRPAQPSAGPEPRPAQPSAGPEPRPAQPSAAPEPRP---- 439 Query: 571 GQTTE... L ++ +A+ +E AP Sbjct: 406 IVTTPEPEGSGEEDVPKPDEIPEKEVTEEELIKVSTAAPAKASPEEEVVKATTLAPSEED 465 Query: 550 VSPYIASGQTTE... Query: 424 KGQAYEAIPDPHVDPAAGVHERLAQLQLGDEPEATKPKEAPG-VSPYI--ASGQTTEASQ 594 K A E P + + G E + E EA P A G +P

  9. AcEST: DK956923 [AcEST

    Full Text Available CCATAGTCTCAA CAGCGATAAGCAGGAAATGCATGCAGTGACCATGGGTAAGAAAAGGGTCATGGTGGGCGC CATTAACACGATACTTATCCTA...CTCCTCTTGCAGTTTATGAAGCAATGTTCTTCCTCTTC TAGTCATGATGATGATGGCGATGCCTTTGCGGATGACACTCTAAGCAGACGCAACGAT...AC GGTCGAGTCTGCTCCTCGACATTGGCCAAGGCGAATGCTGGGCAGCCAAGAACCTGCCTC CAACAAGACTTCATATGGTATTCCTGAT...H At1g73965 (CLE13 / CLAVATA3/ESR-Related 13) (CLE13) OS=Arabidopsis thaliana Align length 25 Sco...icant alignments: (bits) Value tr|Q6NMF0|Q6NMF0_ARATH At1g73965 (CLE13 / CLAVATA3/ESR-Related 1... 49 3e-04

  10. AcEST: BP921492 [AcEST

    Full Text Available + AL +G+ +H Sbjct: 286 DVASWNAIIGGYSLNSQHHEALAFFNRMQVRGIKPNSITMVSVLPACAHLFAL... ++ L +GK +H Sbjct: 178 NLVSWTAMVSGYAQGGFADEALRMFYEMQGEDVKANYVTVASVLPACAQLSDLQQGKEIH 237 Query: 153 AC...FDRMPEK 171 Query: 333 DVVSWSAMIAMYGQQGCGKEAFQLFQEMACEGGMPNRVTYVSILDACASVAALPEGKLVH 154 +V+W+++++ + Q G EA Q+F +M G P+ T+VS+L ACA...333 DVVSWSAMIAMYGQQGCGKEAFQLFQEMACE-GGMPNRVTYVSILDACASVAALPEGKLV 157 +V +W+AMI+ YG G G++A +LF +M + G +PN VT+V++L ACA...SKL 85 Query: 288 GCGKEAFQLFQEMACEGGMPNRVTYVSILDACASVAALPEGKLVHACFMESELELDVVVG 109 ++ M P+ T+ S++ +CA ++AL G

  11. [Intestinal occlusion and abdominal compartment syndrome (ACS)].

    Stagnitti, Franco

    2009-01-01

    Intestinal occlusion is defined as an independent predictive factor of intra-abdominal hypertension (IAH) which represents an independent predictor of mortality. Baggot in 1951 classified patients operated with intestinal occlusion as being at risk for IAH ("abdominal blow-out"), recommending them for open abdomen surgery proposed by Ogilvie. Abdominal surgery provokes IAH in 44.7% of cases with mortality which, in emergency, triples with respect to elective surgery (21.9% vs 6.8%). In particular, IAH is present in 61.2% of ileus and bowel distension and is responsible for 52% of mortality (54.8% in cases with intra-abdominal infection). These patients present with an increasing intra-abdominal pressure (IAP) which, over 20-25 mmHg, triggers an Abdominal Compartment Syndrome (ACS) with altered functions in some organs arriving at Multiple Organ Dysfunction Syndrome (MODS). The intestine normally covers 58% of abdominal volume but when there is ileus distension, intestinal pneumatosis develops (third space) which can occupy up to 90% of the entire cavity. At this moment, Gastro Intestinal Failure (GIF) can appear, which is a specific independent risk factor of mortality, motor of "Organ Failure". The pathophysiological evolution has many factors in 45% of cases: intestinal pneumatosis is associated with mucosal and serous edema, capillary leakage with an increase in extra-cellular volume and peritoneal fluid collections (fourth space). The successive loss of the mucous barrier permits a bacterial translocation which includes bacteria, toxins, pro-inflammatory factors and oxygen free radicals facilitating the passage from an intra-abdominal to inter-systemic vicious cyrcle. IAH provokes the raising of the diaphragm, and vascular and visceral compressions which induce hypertension in the various spaces with compartmental characteristics. These trigger hypertension in the renal, hepatic, pelvic, thoracic, cardiac, intracranial, orbital and lower extremity areas, giving

  12. Performance of AC/graphite capacitors at high weight ratios of AC/graphite

    Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)

    2008-03-01

    The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)

  13. Simultaneous distribution of AC and DC power

    Polese, Luigi Gentile

    2015-09-15

    A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.

  14. AcEST: DK948526 [AcEST

    Full Text Available TST38A01NGRL0003_I19 675 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0003_I19. 5' end seq ... IAMVRTTTPVYV 214 Query: 542 ALALFNQARVSSLPIIDDNGSLIDIY ARSDITALARDDTY 661 AL +F Q RVS+LP++D+ G ++DIY ++ D+ ... LA + TY Sbjct: 215 ALGIFVQHRVSALPVVDEKGRVVDIY SKFDVINLAAEKTY 254 >sp|Q09138|AAKG1_PIG 5'-AMP-acti ... IAMVRTTTPVYV 215 Query: 542 ALALFNQARVSSLPIIDDNGSLIDIY ARSDITALARDDTY 661 AL +F Q RVS+LP++D+ G ++DIY ++ D+ ... LA + TY Sbjct: 216 ALGIFVQHRVSALPVVDEKGRVVDIY SKFDVINLAAEKTY 255 >sp|O54950|AAKG1_MOUSE 5'-AMP-ac ...

  15. AcEST: DK962916 [AcEST

    Full Text Available TST39A01NGRL0015_C06 596 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0015_C06. 5' end seq ... NA. clone: TST39A01NGRL0015_C06. 5' end sequence. Acce ssion DK962916 Tissue type prothallia with plantlet ... 2 Query: 317 MPKSKEPCSQEACDIQTCLVKNNFITERCFPVIEALQACCE K 442 MP+ K+PC ++AC+IQ CL NN++ +C VI+ L+ CC + Sbjct ... me = +2 Query: 335 PCSQEACDIQTCLVKNNFITERCFPVIEALQACCE K 442 PC +EAC IQ CL+ + + +C VI+ L CC K Sbjct: 4 PCQ ... = +2 Query: 326 SKEPCSQEACDIQTCLVKNNFITERCFPVIEALQACCE KCNSK 454 + E C+ CD +TC +K F +C AL CCE KC K Sbjct: 4 ...

  16. AcEST: DK955705 [AcEST

    Full Text Available TST39A01NGRL0023_N02 635 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0023_N02. 5' end seq ... NA. clone: TST39A01NGRL0023_N02. 5' end sequence. Acce ssion DK955705 Tissue type prothallia with plantlet ... 2 Query: 296 MPKSKEPCSQEACDIQTCLVKNNFITERCFPVIEALQACCE K 421 MP+ K+PC ++AC+IQ CL NN++ +C VI+ L+ CC + Sbjct ... me = +2 Query: 314 PCSQEACDIQTCLVKNNFITERCFPVIEALQACCE K 421 PC +EAC IQ CL+ + + +C VI+ L CC K Sbjct: 4 PCQ ... = +2 Query: 305 SKEPCSQEACDIQTCLVKNNFITERCFPVIEALQACCE KCNSK 433 + E C+ CD +TC +K F +C AL CCE KC K Sbjct: 4 ...

  17. AcEST: DK961330 [AcEST

    Full Text Available FWVPCMHTPIKQEKHTHA 405 +AR P W +++PI+ ++C++ P + AK+ PL DVTH+F+V + +QE Sbjct: 61 VARRTRP-SWHEDNPINYVQCDISDPDD...+IL +D PGGPWKVYG Sbjct: 4 WWAGAIGAAKKKLEEDDAPPKHS---SVALIVGVTGIIGNSLAEILPLADTPGGP...AWHEDNPINYIQCDISDPDDSLAKLSPLTDVTHVFYVTCANR--STEPENCE 117 Query: 406 MATHMFENIIGVLLTHAPNLQHVCMQTSDKHY-... : Swiss-Prot sp_hit_id Q7MXT7 Definition sp|Q7MXT7|LPXD_PORGI UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac...lue sp|Q7MXT7|LPXD_PORGI UDP-3-O-[3-hydroxymyristoyl] glucosamine N-... 34 0.62 sp|P60369|KR103_HUMAN Kerati

  18. AcEST: BP913772 [AcEST

    Full Text Available N VT V L C+ G G+ H Sbjct: 350 NVVTWSAVIAGYAQRGLGFEALDVFRQMRLCGSEPNVVTLVSLLSGCALAGTLLHGKETH 409 Query: 376 IEIER--RGLLEVDP-...VFNKLSVQDIVSW 236 + + A ++G+++H I RRGL + PV+ + LV MY R G L Q VF+++ +D+VSW Sbjct: 296 ASLAALEQGKLIHGYILRRGLDSILPVI-S... TF M+ +PN+VT V VL+AC+ + Q + Sbjct: 250 SWSAMIACYAKNGKAFEALRTFREMMRETKDSSPNSVTMVSVLQACASLA...MIEGGVAPNAVTFVVVLRACSQTGSYSQSQTFFEAMSKNF 50 + G A G + F+ M + GV PNAVTFV VLR CS G + Q F++M F Sbjct: 312 ALNGLAMNGFGEKCLELFSL...L YA G + + +F++ D+ +TA + + Sbjct: 48 IHAAILRHNLLLHPRYPVLNLKLHRAYASHGKIRHSLALFHQTIDP

  19. AcEST: DK952954 [AcEST

    Full Text Available TST38A01NGRL0015_H21 616 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0015_H21. 5' end seq ... LIHAHIVCSCNDVDNFVRSTLVNLYSKCGSIEDAHNVFAKLATRRSVDWSMMIS ... 541 ++ Q K +HA I + D + V + L+++Y+KCGSI DA F +++T+ ... LIHAHIVCSCNDVDNFVRSTLVNLYSKCGSIEDAHNVFAKLATRRSVDWSMMIS GS 547 + + IHA S D ++ LV LYS+CG IE+++ F + ++ W+ ++S ... LIHAHIVCSCNDVDNFVRSTLVNLYSKCGSIEDAHNVFAKLATRRSVDWSMMIS ... 541 DL + IH+ I+ + ++ +V S L+++Y+K G ++ A ++ + A + ... EA+ LF +M G+ P + + L AC Sbjct: 243 RVFDGLRLKDHSSWVAMIS GLSKNECEAEAIRLFCDMYVLGIMPTPYAFSSVLSACKKIE 302 Query ...

  20. AcEST: BP912540 [AcEST

    Full Text Available YMU001_000020_B03 501 Adiantum capillus-veneris mRNA. clone: YMU001_000020_B03. BP912540 - Show ... 2 EELTVHHTASVGDVEALKALLAEGADKDEKDSEGRTALHFACGYGEVMCAE VLLEAGVAV 181 EE VH TAS+GDVE LKA LA G +KDE+DSEGRTAL ... ry: 14 VHHTASVGDVEALKALLAEGADKDEKDSEGRTALHFACGYGEVMCAE VLLEAGVAVDAVD 193 +H A V ++ LL GAD KD G LH AC YG AE ... uery: 26 ASVGDVEALKALLAEGADKDEKDSEGR--TALHFACGYGEVMCAE VLLEAGVAVDAVDKN 199 + GD+E +K L + + + +D EGR T LHFA ... ry: 14 VHHTASVGDVEALKALLAEGADKDEKDSEGRTALHFACGYGEVMCAE VLLEAGVAVDAVD 193 +H A ++E + LL GAD + +D G LH A YG ...

  1. A decomposition method for network-constrained unit commitment with AC power flow constraints

    To meet the increasingly high requirement of smart grid operations, considering AC power flow constraints in the NCUC (network-constrained unit commitment) is of great significance in terms of both security and economy. This paper proposes a decomposition method to solve NCUC with AC power flow constraints. With conic approximations of the AC power flow equations, the master problem is formulated as a MISOCP (mixed integer second-order cone programming) model. The key advantage of this model is that the active power and reactive power are co-optimised, and the transmission losses are considered. With the AC optimal power flow model, the AC feasibility of the UC result of the master problem is checked in subproblems. If infeasibility is detected, feedback constraints are generated based on the sensitivity of bus voltages to a change in the unit reactive power generation. They are then introduced into the master problem in the next iteration until all AC violations are eliminated. A 6-bus system, a modified IEEE 30-bus system and the IEEE 118-bus system are used to validate the performance of the proposed method, which provides a satisfactory solution with approximately 44-fold greater computational efficiency. - Highlights: • A decomposition method is proposed to solve the NCUC with AC power flow constraints • The master problem considers active power, reactive power and transmission losses. • OPF-based subproblems check the AC feasibility using parallel computing techniques. • An effective feedback constraint interacts between the master problem and subproblem. • Computational efficiency is significantly improved with satisfactory accuracy

  2. Speed Control of DC Motor using AC/AC/DC Converter Based on Intelligent Techniques

    Rakan Kh Antar

    2013-01-01

       This paper describes the application of ac/ac/dc and ac/dc converters to control the speed of a separately excited DC motor. Artificial neural network and PI controller are trained to select the desired values of firing angles for triggering thyristors of the ac/ac/dc and ac/dc bridge converters in order to control the speed of the dc motor at a desired value with constant and different load torques in order to obtain the best speed response. Simulation results show that the rising time fo...

  3. Water-induced dc and ac degradations in TiO2-based ceramic capacitors

    Water-induced degradations of TiO2-based ceramic capacitors in the presence of dc and ac voltages are reported in this paper. Atomic hydrogen generated by electrolysis of water using dc voltages reduced TiO2-based ceramics at ambient temperature. The resulting degradation was characterized by an increase in capacitance, a large dielectric loss and a dramatic decrease in insulation resistance. Hydrogen and oxygen generated by the electrolysis of water using ac voltages reacted with TiO2-based ceramics. The resulting degradation was characterized by a decrease in capacitance, a large dielectric loss, but no noticeable changes in insulation resistance. Water played a vital role in both dc and ac degradations of TiO2-based capacitors and an effort should be made to prevent water-induced degradations

  4. Electromechanical systems with transient high power response operating from a resonant ac link

    Burrows, Linda M.; Hansen, Irving G.

    1992-01-01

    The combination of an inherently robust asynchronous (induction) electrical machine with the rapid control of energy provided by a high frequency resonant ac link enables the efficient management of higher power levels with greater versatility. This could have a variety of applications from launch vehicles to all-electric automobiles. These types of systems utilize a machine which is operated by independent control of both the voltage and frequency. This is made possible by using an indirect field-oriented control method which allows instantaneous torque control all four operating quadrants. Incorporating the ac link allows the converter in these systems to switch at the zero crossing of every half cycle of the ac waveform. This zero loss switching of the link allows rapid energy variations to be achieved without the usual frequency proportional switching loss. Several field-oriented control systems were developed under contract to NASA.

  5. Vision Loss, Sudden

    ... of age-related macular degeneration. Spotlight on Aging: Vision Loss in Older People Most commonly, vision loss ... Some Causes and Features of Sudden Loss of Vision Cause Common Features* Tests Sudden loss of vision ...

  6. Universality of ac conduction in disordered solids

    Dyre, Jeppe; Schrøder, Thomas

    2000-01-01

    non-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally......The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual...

  7. AC-DC integrated load flow calculation for variable speed offshore wind farms

    Zhao, Menghua; Chen, Zhe; Blaabjerg, Frede

    2005-01-01

    This paper proposes a sequential AC-DC integrated load flow algorithm for variable speed offshore wind farms. In this algorithm, the variable frequency and the control strategy of variable speed wind turbine systems are considered. In addition, the losses of wind turbine systems and the losses of...... converters are also integrated into the load flow algorithm. As a general algorithm, it can be applied to different types of wind farm configurations, and the load flow is related to the wind speed....

  8. Short term dynamic aperture with AC dipoles

    Mönig, Saskia; Persson, Tobias Hakan Bjorn; Coello De Portugal, Jaime; Langner, Andy; Tomas, Rogelio; CERN. Geneva. ATS Department

    2015-01-01

    The dynamic aperture of an accelerator is determined by its non-linear components and errors. Control of the dynamic aperture is important for a good understanding and operation of the accelerator. The AC dipole, installed in the LHC for the diagnostic of linear and non-linear optics, could serve as a tool for the determination of the dynamic aperture. However, since the AC dipole itself modifies the non-linear dynamics, the dynamic aperture with and without AC dipole are expected to differ. The effect of the AC dipole on the dynamic aperture is studied within this note.

  9. ac electroosmosis in rectangular microchannels.

    Campisi, Michele; Accoto, Dino; Dario, Paolo

    2005-11-22

    Motivated by the growing interest in ac electroosmosis as a reliable no moving parts strategy to control fluid motion in microfluidic devices for biomedical applications, such as lab-on-a-chip, we study transient and steady-state electrokinetic phenomena (electroosmosis and streaming currents) in infinitely extended rectangular charged microchannels. With the aid of Fourier series and Laplace transforms we provide a general formal solution of the problem, which is used to study the time-dependent response to sudden ac applied voltage differences in case of finite electric double layer. The Debye-Huckel approximation has been adopted to allow for an algebraic solution of the Poisson-Boltzmann problem in Fourier space. We obtain the expressions of flow velocity profiles, flow rates, streaming currents, as well as expressions of the complex hydraulic and electrokinetic conductances. We analyze in detail the dependence of the electrokinetic conductance on the extension of linear dimensions relative to the Debye length, with an eye on finite electric double layer effects. PMID:16351310

  10. DESARROLLO RURAL A.C.

    Alfredo Aguilar Valdés

    2015-01-01

    Full Text Available El objetivo de este trabajo fue analizar el diagnostico situacional de una Empresa de Servicios Profesionales en el caso de: Instituto de Promoción Para el Desarrollo Rural A.C., a través de la Metodología “UALAE” así como la oportunidad que como empresa presenta. Este estudio se realizó en el municipio de Saltillo, Coahuila, México. Adoptó esta Metodología UALAE y se difundió su opinión. El Instituto de Promoción Para el Desarrollo Rural A.C., está formado por profesionistas y productores cuya finalidad es la de contribuir al desarrollo del medio rural con proyectos de viabilidad técnica, económica y social, sobre la base de necesidades reales y al aprovechamiento sustentable del potencial de los recursos naturales. Su buen funcionamiento es indispensable e importante para el desarrollo de los productores agropecuarios principalmente, debido a que se ven muy beneficiados con todos los servicios que se les brinda, se han logrado buenos proyectos, buenas capacitaciones y un gran crecimiento de sus productos. Mediante el proceso de asistencia técnica a organizaciones de productores, se induce la formulación adecuada de proyectos viables desde el punto visto del mercado, la rentabilidad económica, las tecnologías disponibles y de la organización social.

  11. AcEST: BP920845 [AcEST

    Full Text Available 45|Adiantum capillus-veneris mRNA, clone: YMU001_000142_D08. (514 letters) Database: uniprot_sprot.fasta 412,525 seq...P7 OS=Magnapor... 33 1.0 sp|Q7VF68|SYH_HELHP Histidyl-tRNA synthetase OS=Helicobacter hep... 31 3.8 sp|P1305...90 FTGFLVLHSEPRQQPQVDL 1608 >sp|A4QX49|DBP7_MAGGR ATP-dependent RNA helicase DBP7 OS=Magnaporthe grise...T PT VT+H + T+ AC+ A+TT+ H H Sbjct: 481 PPKETKPTK------PVTNHTESTVGKACYITSAANTTITLHKLH 519 >sp|Q7VF68|SYH_HELHP His...rot_trembl.fasta 7,341,751 sequences; 2,391,615,440 total letters Searching.................................

  12. AcEST: DK960083 [AcEST

    Full Text Available ome P450 71D7 OS=Solanum chacoense ... 96 1e-19 sp|Q9SAB6|C71AI_ARATH Cytochrome ...... 96 2e-19 sp|P93530|C71D6_SOLCH Cytochrome P450 71D6 OS=Solanum chacoense ... 94 5e-19 sp|Q9T0K2|C71AK_AR... paten... 176 1e-42 tr|Q9AXP9|Q9AXP9_POPJC Cinnamate 4-hydroxylase OS=Populus jackii... 176 2e-42 tr|Q40907|Q40907_POPKI Cinnamic ac...8 KVVQQSRGAWEDEALRVIQDLKA 160 >tr|Q9AXP9|Q9AXP9_POPJC Cinnamate 4-hydroxylase OS=Populus jackii GN=C4H PE=2 ...e-42 tr|A9PBZ7|A9PBZ7_POPTR Putative uncharacterized protein OS=Popul... 176 2e-4

  13. AcEST: DK955376 [AcEST

    Full Text Available TST39A01NGRL0022_O23 611 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0022_O23. 5' end seq ... LMDETRAAGIKL 210 Query: 602 AIC 610 A+C Sbjct: 211 AVC ... 213 >tr|A9SM81|A9SM81_PHYPA Predicted protein OS=P ... C 610 VLELMD A+ KGLKVA+C Sbjct: 196 VLELMDAAREKGLKVAVC ... 213 >tr|Q8L7U1|Q8L7U1_ARATH AT4g39970/T5J17_140 OS ... LKVAIC 610 LMDEA+A G K+A+C Sbjct: 182 RLMDEAKAAGKKLAVC ... 197 >tr|Q680K2|Q680K2_ARATH MRNA, complete cds, cl ... LKVAIC 610 LMDEA+A G K+A+C Sbjct: 182 RLMDEAKAAGKKLAVC ... 197 >tr|Q8LAS1|Q8LAS1_ARATH Putative uncharacteriz ...

  14. AcEST: BP913416 [AcEST

    Full Text Available GCATGTAGTTTGGA CAGAGATG ■■Homology search results ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swi...AC_BACFN Uronate isomerase OS=Bacteroides fragilis (... 30 4.5 sp|Q3ITT7|SYA_NATPD Alanyl-tRNA synthetase OS=Natronomonas phar...C++ N IP+ M C Sbjct: 417 LSYPRHEYFRRTLCNLLGCDVENGEIPLSEMERVC 451 >sp|Q3ITT7|SYA_NATPD Alanyl-tRNA synthetase OS=Natronomonas phar...ng, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database searc...148,809,765 total letters Searching..................................................done Score E Sequences

  15. AcEST: DK947388 [AcEST

    Full Text Available Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Ac...ids Res. 25:3389-3402. Query= DK947388|Adiantum capillus-veneris mRNA, clone: YMU02A01NGRL0015_L18, 5' (587 letters) Databa... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK947388|Adiantum c...apillus-veneris mRNA, clone: YMU02A01NGRL0015_L18, 5' (587 letters) Database: uniprot_trembl.fasta...-ribosylation factor 1 OS=Salix bakko GN... 268 1e-71 sp|P49076|ARF_MAIZE ADP-ribosylation factor OS=Zea may

  16. AcEST: BP916217 [AcEST

    Full Text Available inase kinase 7-interacting protein 3 OS=Mus musculus Align length 119 Score (bit) 35.0 E-value 0.16 Report B...visiae GN... 30 6.8 >sp|Q571K4|TAB3_MOUSE Mitogen-activated protein kinase kinase kinase 7-interacting protein 3 OS=Mus musculus...protein kinase kinase kinase 7 interacting protein 3 OS=Mus musculus GN=Map3k7ip3 PE=2 SV=1 Length = 716 Sco...(3)malignant brain tumor-like 2 prot... 31 2.3 sp|P33234|ADIY_ECOLI HTH-type transcriptional regulator adiY ...ZZC3_PSEU2 Membrane protein, putative OS=Pseudomonas... 35 2.5 tr|Q5U7D5|Q5U7D5_9BACI OpuAC OS=Halobacillus trueperi GN=opu

  17. AcEST: DK953324 [AcEST

    Full Text Available |LSRR_PHOLL Transcriptional regulator lsrR OS=Photorhab... 30 6.1 sp|A0JY64|ATPB_ARTS2 ATP synthase subunit beta OS=Arthroba...cter s... 30 6.1 sp|A1R7V3|ATPB_ARTAT ATP synthase subunit beta OS=Arthroba...ATP synthase subunit beta OS=Arthrobacter sp. (strain FB24) GN=atpD PE=3 SV=1 Len...KD 372 Query: 311 HLHFTHRGKQRL 346 H + R KQ L Sbjct: 373 HYNTAVRVKQIL 384 >sp|A1R7V3|ATPB_ARTAT ATP synthase subunit beta OS=Arthroba...T and PSI-BLAST: a new generation of protein database search programs, Nucleic Ac

  18. AcEST: DK945049 [AcEST

    Full Text Available R 148 >sp|Q9X5X3|ATCU_SINMW Copper-transporting P-type ATPase OS=Sinorhizobium medicae (strain WSM419) GN=ac...|Q4EPP8|Q4EPP8_LISMO Heavy metal-binding protein OS=Listeria m... 34 3.2 tr|A6AST1|A6AST1_VIBHA Copper-trans..... 31 2.7 sp|Q4X0S7|DPH1_ASPFU Diphthamide biosynthesis protein 1 OS=Asper... 30 4.5 sp|A2VDJ0|T131L_HUMAN Transmembran...P58342|ATCU2_RHIME Copper-transporting ATPase 2 OS=Rhizobium meliloti Align length 75 Score (bit) 34.7 E-val...sophila ... 30 7.8 >sp|P58342|ATCU2_RHIME Copper-transporting ATPase 2 OS=Rhizobium me

  19. High benefits approach for electrical energy conversion in electric vehicles from DC to PWM-AC without any generated harmonic

    Highlights: • Novel hybrid power source including AC feature for using in electric/hybrid vehicles. • Minimizing the energy loss in electric/hybrid vehicles by using the proposed system. • Suitable AC wave form for braking/accelerating purposes in electric/hybrid vehicles. • A novelty is that the harmonic generated by the added AC feature is really zero. • Another novelty is the capability of choosing arbitrary frequency for AC feature. - Abstract: This paper presents a novel hybrid power source, including a Li-ion battery together with an interface, which generates simultaneously electrical energy with the forms of both DC and AC for electric vehicles. A novel and high benefits approach is applied to convert the electrical energy of the Li-ion battery from DC form to single-phase symmetric pulse-width modulation (PWM)-AC form. Harmonic generation is one of the important problems when electrical energy is converted from DC to AC but there are not any generated harmonic during the DC/AC conversion using the proposed technique. The proposed system will be widely used in electric/hybrid vehicles because it has many benefits. Minimizing the energy loss (saving energy), no generated harmonic (it is really zero), the capability of arbitrary/necessary frequency selection for output AC voltage and the ability of long distance energy transmission are some novelties and advantages of the proposed system. The proposed hybrid power source including DC/AC PWM inverter is simulated in Proteus 6 software environment and a laboratory-based prototype of the hybrid power source is constructed to validate the theoretical and simulation results. Simulation and experimental results are presented to prove the superiority of the proposed hybrid power supply

  20. Study of Power Flow Algorithm of AC/DC Distribution System including VSC-MTDC

    Haifeng Liang

    2015-08-01

    Full Text Available In recent years, distributed generation and a large number of sensitive AC and DC loads have been connected to distribution networks, which introduce a series of challenges to distribution network operators (DNOs. In addition, the advantages of DC distribution networks, such as the energy conservation and emission reduction, mean that the voltage source converter based multi-terminal direct current (VSC-MTDC for AC/DC distribution systems demonstrates a great potential, hence drawing growing research interest. In this paper, considering losses of the reactor, the filter and the converter, a mathematical model of VSC-HVDC for the load flow analysis is derived. An AC/DC distribution network architecture has been built, based on which the differences in modified equations of the VSC-MTDC-based network under different control modes are analyzed. In addition, corresponding interface functions under five control modes are provided, and a back/forward iterative algorithm which is applied to power flow calculation of the AC/DC distribution system including VSC-MTDC is proposed. Finally, by calculating the power flow of the modified IEEE14 AC/DC distribution network, the efficiency and validity of the model and algorithm are evaluated. With various distributed generations connected to the network at appropriate locations, power flow results show that network losses and utilization of transmission networks are effectively reduced.

  1. Magnetization losses in superconducting YBCO conductor-on-round-core (CORC) cables

    Majoros, M.; Sumption, M. D.; Collings, E. W.; van der Laan, D. C.

    2014-12-01

    Described are the results of magnetization loss measurements made at 77 K on several YBCO conductor-on-round-core (CORC) cables in ac magnetic fields of up to 80 mT in amplitude and frequencies of 50 to 200 Hz, applied perpendicular to the cable axis. The cables contained up to 40 tapes that were wound in as many as 13 layers. Measurements on the cables with different configurations were made as functions of applied ac field amplitude and frequency to determine the effects of their layout on ac loss. In large scale devices such as e.g. Superconducting Magnetic Energy Storage (SMES) magnets, the observed ac losses represent less than 0.1% of their stored energy.

  2. Living with vision loss

    Diabetes - vision loss; Retinopathy - vision loss; Low vision; Blindness - vision loss ... Low vision is a visual disability. Wearing regular glasses or contacts does not help. People with low vision have ...

  3. Autonomous operation of hybrid AC-DC microgrids with progressive energy flow tuning

    Loh, Poh Chiang; Li, Ding; Chai, Yi Kang;

    2012-01-01

    accompanied losses. Hybrid microgrids are therefore more efficient with a control scheme now proposed for controlling them. The scheme allows the hybrid microgrids to operate autonomously without fast communication links, while yet maintaining high efficiency through progressive energy flow tuning....... Experimental testing has already been performed with results presented in a later section for verifying the control concepts discussed.......Modern distributed sources can either be ac or dc. It is thus possible to form hybrid microgrids with ac and dc sub-grids inter-tied by power converters. The resulting hybrid architecture allows loads to be flexibly placed so as to minimize the amount of energy conversion needed and hence its...

  4. Generator method of 225Ac production without a carrier for nuclear medicine

    The two-steps isotope generator scheme of 225Ac production from 229Th has been developed. The first step is used for separation of thorium, actinium, radium and daughter decay products (DDP), and removals of parent radionuclide. The second step provides additional separation of actinium from traces of radium and DDP, and conversion of actinium in the nitrate form. The chosen solutions provide optimal conditions for carry out of process. The yield of the 225Ac was 99.9% at minimal losses of parent 229Th (less than 0.1%)

  5. SINGLE PHASE HIGH FREQUENCY AC CONVERTER FOR INDUCTION HEATING APPLICATION

    M.A INAYATHULLAAH,; Dr. R. Anita

    2010-01-01

    The proposed topology reduces the total harmonic distortion (THD) of a high frequency AC/AC Converter well below the acceptable limit. This paper deals with a novel single phase AC/DC/AC soft switching utility frequency AC to high frequency AC converter. In this paper a single phase full bridge inverter with Vienna rectifier as front end is used instead of conventional diode bridge rectifier to provide continuous sinusoidal input current with nearly unity power factor at the source side with ...

  6. Economic Loan Loss Provision and Expected Loss

    Stefan Hlawatsch

    2010-10-01

    Full Text Available The intention of a loan loss provision is the anticipation of the loan's expected losses by adjusting the book value of the loan. Furthermore, this loan loss provision has to be compared to the expected loss according to Basel II and, in the case of a difference, liable equity has to be adjusted. This however assumes that the loan loss provision and the expected loss are based on a similar economic rationale, which is only valid conditionally in current loan loss provisioning methods according to IFRS. Therefore, differences between loan loss provisions and expected losses should only result from different approaches regarding the parameter estimation within each model and not due to different assumptions regarding the outcome of the model. The provisioning and accounting model developed in this paper overcomes the before-mentioned shortcomings and is consistent with an economic rationale of expected losses. Additionally, this model is based on a close-to-market valuation of the loan that is in favor of the basic idea of IFRS. Suggestions for changes in current accounting and capital requirement rules are provided.

  7. Characterization of AcMNPV with a deletion of ac69 gene

    Jianhao Ke

    2011-07-01

    Full Text Available ORF69 (Ac69 of Autographa californica multiple nucleopolyhedrovirus (AcMNPV is conserved in some baculovirus genomes. Although it has been shown that Ac69 has cap 0-dependent methyltransferase activity and is not required for budded virus production in Spodoptera frugiperda Sf-9 cells, its role in occlusion-derived virus synthesis and virus oral infectivity is not known. This paper describes generation of an ac69 knockout AcMNPV bacmid mutant and analyses of the influence of ac69 deletion on the viral infectivity in Sf-9 cells and Trichoplusia ni larvae so as to investigate the role of ac69 in the viral life cycle. Results indicated that ac69 deletion has little effect on the production rates and morphogenesis of budded virus and occlusion-derived virus in Sf-9 cells. In addition, animal experiment revealed that the deletion mutant did not affect AcMNPV infectivity for Trichoplusia ni larvae in LD50 and LT50 bioassay when administered orally. These results suggest that ac69 may be dispensable for viral infectivity both in vitro and in vivo.

  8. Noise reduction in AC-coupled amplifiers

    Serrano Finetti, Roberto Ernesto; Pallàs Areny, Ramon

    2014-01-01

    AC-coupled amplifiers are noisier than dc-coupled amplifiers because of the thermal noise of the resistor(s) in the ac-coupling network and the increased contribution of the amplifier input noise current i(n). Both contributions, however, diminish if the corner frequency f(c) of the high-pass filter observed by the signal is lowered, the cost being a longer transient response. At the same time, the presence of large resistors in the ac-coupling network suggests that the use of FET-input ampli...

  9. Alternating magnetic field losses in ATLAS type aluminium stabilized NbTi superconductors

    Boxman, E W; ten Kate, H H J

    2002-01-01

    During ramping up- and down of the current in large-scale magnets the ramp losses are an important factor affecting the thermal and electro-magnetic stability of the system. The calculation of the losses is not straightforward due to the large dimensions of the conductor (~600 mm/sup 2/) implying that diffusion effects have to be taken into account. The AC-losses of the Al stabilized NbTi cable conductors used in the ATLAS magnet system were measured in 0.5 m long samples, using an inductive method with pick-up coils as well as the calorimetric method. External varying magnetic fields up to 2 tesla amplitude were applied parallel and perpendicular to the conductor wide surface. The results are compared to theory. It is found that hysteresis loss, eddy current loss in the Aluminum cladding and cable-to-cladding coupling loss contribute most to the AC loss. (5 refs).

  10. Menopause and Bone Loss

    Fact Sheet & Menopause Bone Loss How are bone loss and menopause related? Throughout life your body keeps a balance between the loss ... The sooner you take steps to prevent bone loss, the lower your risk of osteoporosis later in life. If you are skipping menstrual periods, have had ...

  11. Estimation of Transformer Parameters and Loss Analysis for High Voltage Capacitor Charging Application

    Thummala, Prasanth; Schneider, Henrik; Ouyang, Ziwei;

    2013-01-01

    In a bi-directional DC-DC converter for capacitive charging application, the losses associated with the transformer makes it a critical component. In order to calculate the transformer losses, its parameters such as AC resistance, leakage inductance and self capacitance of the high voltage (HV...

  12. Hair loss in women.

    Harfmann, Katya L; Bechtel, Mark A

    2015-03-01

    Hair loss is a common cause of morbidity for many women. As a key member of the woman's health care team, the obstetrician/gynecologist may be the first person to evaluate the complaint of hair loss. Common types of nonscarring hair loss, including female pattern hair loss and telogen effluvium, may be diagnosed and managed by the obstetrician/gynecologist. A systematic approach to diagnosis and management of these common forms of hair loss is presented. PMID:25517757

  13. Guiding Principles in Selecting AC To DC Converters For Power Factor Corrections in AC Transmission System

    Ibekwe B.E

    2014-10-01

    Full Text Available The ac to dc converters’ power factors correction in ac transmission system were investigated. The studies include: phase-controlled converter; pulse width modulated (PWM converter and ac input current shaped converter. Using Fourier series, power factors of these converters were calculated and simulated using MATLAB. The resulting curves are displayed in the hard copies for practical guides in the choice of converters; and comparatively, current shaped type is the best.

  14. Physical aspects of magnetic hyperthermia: Low-frequency ac field absorption in a magnetic colloid

    A uniaxially anisotropic superparamagnetic particle suspended in a viscous fluid and subjected to an ac field is considered. Consistently taking into account both internal (Néel) and external (Brownian) magnetic relaxations, a simple expression for the dynamic susceptibility is obtained. This result, with regard to the ac field energy absorption, is compared to the common heuristic approach. This is done for a model polydisperse colloid containing maghemite nanoparticles, which are assumed to posses either bulk or surface magnetic anisotropy. It is shown that viscous losses caused by the particle motion in a fluid matrix make important contribution to the full magnetic response of a ferrocolloid and, thus, its ability to absorb the ac field energy. The obtained exact expression, which takes in both dissipation mechanisms, paves the way to correct optimization of the nanoparticle-mediated heating effect. - Highlights: • A uniaxially anisotropic superparamagnetic particle suspended in a viscous fluid and subjected to an ac field is considered. • Consistently taking into account both internal (Néel) and external (Brownian) magnetic relaxations, a simple expression for the dynamic susceptibility is obtained. • This result, with regard to the ac field energy absorption, is compared to the common heuristic approach using as a benchmark a model polydisperse colloid containing maghemite nanoparticles, which are assumed to posses either bulk or surface magnetic anisotropy. • It is shown that viscous losses caused by the particle motion in a fluid matrix make important contribution to the full magnetic response of a ferrocolloid and, thus, its ability to absorb the ac field energy. • The obtained exact expression, which takes in both dissipation mechanisms, paves the way to correct optimization of the nanoparticle-mediated heating effect

  15. A Simple Load Power Estimator For Quasi-Direct AC-AC Converter System

    Marian GAICEANU; Emil ROSU

    2003-01-01

    In this paper a simple load power estimator for the three-phase quasi-direct acac converter system is reported. Since the ac-ac converter control by means of pulsewidth modulation (PWM) is based on the power balance concept, its load power should be known. Two control boards, based on the dSMC (digital Smart Motion Controller) 30 MIPS 32-bit fixed-point digital signal processor (DSP), were involved in the ac-ac system driving. By using the power balance control, the DC link voltage variation ...

  16. Interior point algorithm-based power flow optimisation of a combined AC and DC multi-terminal grid

    Farhan Beg

    2015-01-01

    Full Text Available The high cost of power electronic equipment, lower reliability and poor power handling capacity of the semiconductor devices had stalled the deployment of systems based on DC (multi-terminal direct current system (MTDC networks. The introduction of voltage source converters (VSCs for transmission has renewed the interest in the development of large interconnected grids based on both alternate current (AC and DC transmission networks. Such a grid platform also realises the added advantage of integrating the renewable energy sources into the grid. Thus a grid based on DC MTDC network is a possible solution to improve energy security and check the increasing supply demand gap. An optimal power solution for combined AC and DC grids obtained by the solution of the interior point algorithm is proposed in this study. Multi-terminal HVDC grids lie at the heart of various suggested transmission capacity increases. A significant difference is observed when MTDC grids are solved for power flows in place of conventional AC grids. This study deals with the power flow problem of a combined MTDC and an AC grid. The AC side is modelled with the full power flow equations and the VSCs are modelled using a connecting line, two generators and an AC node. The VSC and the DC losses are also considered. The optimisation focuses on several different goals. Three different scenarios are presented in an arbitrary grid network with ten AC nodes and five converter stations.

  17. Electromechanical systems with transient high power response operating from a resonant AC link

    Burrows, Linda M.; Hansen, Irving G.

    1992-01-01

    The combination of an inherently robust asynchronous (induction) electrical machine with the rapid control of energy provided by a high frequency resonant AC link enables the efficient management of higher power levels with greater versatility. This could have a variety of applications from launch vehicles to all-electric automobiles. These types of systems utilize a machine which is operated by independent control of both the voltage and frequency. This is made possible by using an indirect field-oriented control method which allows instantaneous torque control in all four operating quadrants. Incorporating the AC link allows the converter in these systems to switch at the zero crossing of every half cycle of the AC waveform. This zero loss switching of the link allows rapid energy variations to be achieved without the usual frequency proportional switching loss. Several field-oriented control systems were developed by LeRC and General Dynamics Space Systems Division under contract to NASA. A description of a single motor, electromechanical actuation system is presented. Then, focus is on a conceptual design for an AC electric vehicle. This design incorporates an induction motor/generator together with a flywheel for peak energy storage. System operation and implications along with the associated circuitry are addressed. Such a system would greatly improve all-electric vehicle ranges over the Federal Urban Driving Cycle (FUD).

  18. Corona helps curb losses

    Laasonen, M.; Lahtinen, M.; Lustre, L.

    1996-11-01

    The greatest power losses in electricity transmission arise through a phenomenon called load losses. Corona losses caused by the surface discharge of electricity also constitute a considerable cost item. IVS, the nationwide network company, is investigating corona- induced losses, and has also commissioned similar research from IVO International, the Technical Research Centre of Finland (VTT) and from Tampere University of Technology. The research work strives to gain more in-depth knowledge on the phenomenon of frosting and its impact on corona losses. The correct prediction of frost helps reduce corona losses, while also cutting costs considerably. (orig.)

  19. Experimental Study on Electrical Characteristics of Advanced Unipolar Power Electronics Devices for High Current Operation of AC/DC Converter

    Large capacity power supply is required for energizing the magnetic field coil system of nuclear fusion experimental machine in future, and high efficiency and low operational loss of such power supply are important issues. Especially, for high current operation of large capacity power supply, the switching power electronics device of AC/DC converter for power supply should be more efficient and have lower on-state resistance than conventional one. Recently, some advanced power electronics devices have been developed, which are unipolar power device based on crystallized SiC material or super junction type modified unipolar power device based on crystallized Si material. Concerning the efficiency improvement of AC/DC converter, the temperature dependence of electrical characteristics of switching device is the key issue on operational loss reduction. On-state resistance and allowable operational temperature of switching device are directly related to the operational loss of AC/DC converter. The former one is the main parameter of conductive loss, which is dominant one of the operational loss of high current AC/DC converter, and it is effective to reduce the conductive loss for efficiency improvement. The latter one is related to the cooling capability of cooling equipment, which is a main auxiliary component of large capacity AC/DC converter. The temperature dependence of on-state resistance of SiC-based or Si-based advanced unipolar power electronics device will be expected to reduce the conductive loss and to simplify the cooling equipment of AC/DC converter. The allowable operational temperature of SiC power device is higher than that of Si power device, therefore it is also expected to minimize the cooling capability. Such electrical characteristics of SiC-based or Si-based advanced unipolar power electronics device will contribute to reduce the operational loss and to improve the operational efficiency of AC/DC converter. With the experimental results of

  20. Genetics of Hearing Loss

    ... in Latin America Information For... Media Policy Makers Genetics of Hearing Loss Language: English Español (Spanish) Recommend ... of hearing loss in babies is due to genetic causes. There are also a number of things ...

  1. Pregnancy Loss and Miscarriage

    ... Share this: Page Content What is pregnancy loss/miscarriage? A miscarriage, also called pregnancy loss or spontaneous abortion, is ... D.A.M. Medical Encyclopedia. (2010, November 21). Miscarriage . Retrieved May 21, 2012, from http://www.ncbi. ...

  2. Hair Loss (Alopecia Areata)

    ... rash and rashes clinical tools newsletter | contact Share | Hair Loss (Alopecia Areata) Information for adults A A A This ... scalp with a round area of non-scarring hair loss typical of alopecia areata. Overview Alopecia areata is ...

  3. Coping with Memory Loss

    ... Consumers Home For Consumers Consumer Updates Coping With Memory Loss Share Tweet Linkedin Pin it More sharing ... a health professional. back to top What Causes Memory Loss? Anything that affects cognition—the process of ...

  4. Hair Loss (Alopecia)

    ... Eating disorder: When a person has an eating disorder, hair loss is common. Anorexia (not eating enough) and bulimia (vomiting after eating) can cause hair loss. Medicine Some prescription medicines can cause ...

  5. Genes and Hearing Loss

    ... Meeting Calendar Find an ENT Doctor Near You Genes and Hearing Loss Genes and Hearing Loss Patient ... mutation may only have dystopia canthorum. How Do Genes Work? Genes are a road map for the ...

  6. The Sloan Lens ACS Survey. V. The full ACS strong-lens sample

    Bolton, Adam S.; Burles, Scott; Koopmans, Leon V. E.; Treu, Tommaso; Gavazzi, Raphael; Moustakas, Leonidas A.; Wayth, Randall; Schlegel, David J.

    2008-01-01

    We present the definitive data for the full sample of 131 strong gravitational lens candidates observed with the Advanced Camera for Surveys (ACS) aboard the Hubble Space Telescope by the Sloan Lens ACS (SLACS) Survey. All targets were selected for higher redshift emission lines and lower redshift c

  7. Hearing loss and music

    Noise induced hearing loss - music; Sensory hearing loss - music ... damaged by loud sounds. The human ear is like any other body part -- too much use can damaged it. Over time, repeated exposure to loud noise and music can cause hearing loss.

  8. Single-stage active clamp power factor correction AC/DC converter

    2007-01-01

    A simple single-stage AC/DC converter circuit with active clamp is presented. The operation theory and state are analyzed. The experimental results show that the voltage across main switch can be clamped to a certain value, and zero voltage switching (ZVS) can be achieved. The voltage stress and switching loss are both decreased. In range of the whole load, power factors can be always more than 97%, and the highest efficiency can reach 88%.

  9. Study on interstrand coupling losses in Rutherford-type superconducting cables

    Two sets of experimental apparatus for measuring the AC losses in superconducting strands and Rutherford-type cable conductors have been constructed. A few strand samples and a number of compacted cable samples with and without a CuMn matrix have been measured. The hysteresis loss, loss from coupling within strands and loss from coupling between strands in cables have been distinguished from each other. The results show that, even for Rutherford cables without any soldering and coating, their AC losses may be quite different from each other due to the variation of the interstrand coupling loss. For cables without a CuMn matrix, interstrand coupling loss increases nearly according to a geometrical series with an increase of curing temperature simulating coil fabrication. However, cables with the CuMn matrix show a relatively small curing temperature dependence. For most of the samples, losses do not show any evident dependence on the mechanical pressure. Interstrand resistances in one of these cables have also been measured; the results indicate that the tendency for a decrease in the interstrand resistances is consistent with the results of AC loss measurements. (author)

  10. Beam Loss in Linacs

    Plum, M A

    2016-01-01

    Beam loss is a critical issue in high-intensity accelerators, and much effort is expended during both the design and operation phases to minimize the loss and to keep it to manageable levels. As new accelerators become ever more powerful, beam loss becomes even more critical. Linacs for H- ion beams, such as the one at the Oak Ridge Spallation Neutron Source, have many more loss mechanisms compared to H+ (proton) linacs, such as the one being designed for the European Spallation Neutron Source. Interesting H- beam loss mechanisms include residual gas stripping, H+ capture and acceleration, field stripping, black-body radiation and the recently discovered intra-beam stripping mechanism. Beam halo formation, and ion source or RF turn on/off transients, are examples of beam loss mechanisms that are common for both H+ and H- accelerators. Machine protection systems play an important role in limiting the beam loss.

  11. ac propulsion system for an electric vehicle

    Geppert, S.

    1980-01-01

    It is pointed out that dc drives will be the logical choice for current production electric vehicles (EV). However, by the mid-80's, there is a good chance that the price and reliability of suitable high-power semiconductors will allow for a competitive ac system. The driving force behind the ac approach is the induction motor, which has specific advantages relative to a dc shunt or series traction motor. These advantages would be an important factor in the case of a vehicle for which low maintenance characteristics are of primary importance. A description of an EV ac propulsion system is provided, taking into account the logic controller, the inverter, the motor, and a two-speed transmission-differential-axle assembly. The main barrier to the employment of the considered propulsion system in EV is not any technical problem, but inverter transistor cost.

  12. Optimizing efficiency on conventional transformer based low power AC/DC standby power supplies

    Nielsen, Nils

    2004-01-01

    This article describes the research results for simple and cheap methods to reduce the idle- and load-losses in very low power conventional transformer based power supplies intended for standby usage. In this case "very low power" means 50 Hz/230 V-AC to 5 V-DC@1 W. The efficiency is measured on...... two common power supply topologies designed for this power level. The two described topologies uses either a series (or linear) or a buck regulation approach. Common to the test power supplies is they either are using a standard cheap off-the-shelf transformer, or one, which are loss optimized by very...

  13. ACS air bearing test-bed design

    Glitt, Sascha

    2010-01-01

    This thesis is about the construction and design of a new air bearing test-bed to verify the programmed ACS attitude control algorithm and to validate the ACS MATLAB/SimuLink¬ model of NPSAT1, the second small satellite currently under development at the Naval Postgraduate School Space Systems Academic Group. The software was already verified and validated using a comparable air bearing test-bed. But due to changes in hardware from commercial magnetic torque rods to custom, NPS-built, magneti...

  14. The Effective AC Response of Nonlinear Composites

    WEI En-Bo; GU Guo-Qing

    2001-01-01

    A perturbative approach is used to study the AC response of nonlinear composite media, which obey a current-field relation of the form J = σ E + χ|E|2 E with components having nonlinear response at finite frequencies. For a sinusoidal applied field, we extend the local potential in terms of sinusoidal components at fundamental frequency and high-order harmonic frequencies to treat the nonlinear composites. For nonlinear composite media vith a low concentrations of spherical inclusions, we give the formulae of the nonlinear effective AC susceptibility χ*3ω at the third harmonic frequency.

  15. Glass-like low frequency ac response of ZrB$_{12}$ and Nb single crystals in the surface superconducting state

    Tsindlekht, Menachem I.; Leviev, Grigory I.; Genkin, Valery M.; Felner, Israel; Paderno, Yurii B.; Filippov, Vladimir B.

    2005-01-01

    We report experimental studies of the low frequency electrodynamics of ZrB$_{12}$ and Nb single crystals. AC susceptibility at frequencies 3 - 1000 Hz have been measured under a dc magnetic field, $H_0$, applied parallel to the sample surface. In the surface superconducting state, for several $H_0$, the real part of the ac magnetic susceptibility exhibits a logarithmic frequency dependence as for spin-glass systems. Kramers-Kronig analysis of the experimental data, shows large losses at ultra...

  16. YBCO thin films in ac and dc films

    Shahzada, S

    2001-01-01

    We report studies on the dc magnetization of YBCO thin films in simultaneously applied dc and ac fields. The effect of the ac fields is to decrease the irreversible magnetization drastically leading to complete collapse of the hysteresis loops for relatively small ac fields (250e). The magnitude of the decrease depends on the component of the ac field parallel to the c-axis. The decrease is non-linear with ac amplitude and is explained in the framework of the critical state response of ultra thin films in perpendicular geometry. The ac fields increase the relaxation rapidly at short times while the long time response appears unaffected. (author)

  17. SINGLE PHASE HIGH FREQUENCY AC CONVERTER FOR INDUCTION HEATING APPLICATION

    M.A INAYATHULLAAH,

    2010-12-01

    Full Text Available The proposed topology reduces the total harmonic distortion (THD of a high frequency AC/AC Converter well below the acceptable limit. This paper deals with a novel single phase AC/DC/AC soft switching utility frequency AC to high frequency AC converter. In this paper a single phase full bridge inverter with Vienna rectifier as front end is used instead of conventional diode bridge rectifier to provide continuous sinusoidal input current with nearly unity power factor at the source side with extremely low distortion.. This power converter is more suitable and acceptable for cost effective high frequency (HF consumer induction heating applications.

  18. AcsA-AcsB: The core of the cellulose synthase complex from Gluconacetobacter hansenii ATCC23769.

    McManus, John B; Deng, Ying; Nagachar, Nivedita; Kao, Teh-hui; Tien, Ming

    2016-01-01

    The gram-negative bacterium, Gluconacetobacter hansenii, produces cellulose of exceptionally high crystallinity in comparison to the cellulose of higher plants. This bacterial cellulose is synthesized and extruded into the extracellular medium by the cellulose synthase complex (CSC). The catalytic component of this complex is encoded by the gene AcsAB. However, several other genes are known to encode proteins critical to cellulose synthesis and are likely components of the bacterial CSC. We have purified an active heterodimer AcsA-AcsB from G. hansenii ATCC23769 to homogeneity by two different methods. With the purified protein, we have determined how it is post-translationally processed, forming the active heterodimer AcsA-AcsB. Additionally, we have performed steady-state kinetic studies on the AcsA-AcsB complex. Finally through mutagenesis studies, we have explored the roles of the postulated CSC proteins AcsC, AcsD, and CcpAx. PMID:26672449

  19. ACS6, a Hydrogen sulfide-donating derivative of sildenafil, inhibits homocysteine-induced apoptosis by preservation of mitochondrial function

    Tang Xiao-Qing

    2011-08-01

    Full Text Available Abstract Background The hydrogen sulfide-releasing sildenafil, ACS6, has been demonstrated to inhibit superoxide formation through donating hydrogen sulfide (H2S. We have found that H2S antagonizes homocysteine-induced oxidative stress and neurotoxicity. The aim of the present study is to explore the protection of ACS6 against homocysteine-triggered cytotoxicity and apoptosis and the molecular mechanisms underlying in PC12 cells. Methods Cell viability was determined by Cell Counting Kit-8 assay. Cell apoptosis was observed using the chromatin dye Hoechst 33258 and analyzed by Flow Cytometry after propidium iodide staining. Mitochondrial membrane potential was monitored using the fluorescent dye Rh123. Intracellular reactive oxygen species were determined by oxidative conversion of cell permeable 2',7'-dichlorfluorescein-diacetate to fluorescent 2',7'-dichlorfluorescein. The expression of cleaved caspase-3 and bcl-2 and the accumulation of cytosolic cytochrome c were analyzed by Western blot. Results We show that ACS6 protects PC12 cells against cytotoxicity and apoptosis induced by homocysteine and blocks homocysteine-triggered cytochrome c release and caspase-3 activation. ACS6 treatment results in not only prevention of homocysteine-caused mitochondrial membrane potential (Δψ loss and reactive oxygen species (ROS overproduction but also reversal of Bcl-2 down-expression. Conclusions These results indicate that ACS6 protects PC12 cells against homocysteine-induced cytotoxicity and apoptosis by preservation of mitochondrial function though inhibiting both loss of Δψ and accumulation of ROS as well as modulating the expression of Bcl-2. Our study provides evidence both for a neuroprotective effect of ACS6 and for further evaluation of ACS6 as novel neuroprotectants for Alzheimer's disease associated with homocysteine.

  20. AC power generation from microbial fuel cells

    Lobo, Fernanda Leite; Wang, Heming; Forrestal, Casey; Ren, Zhiyong Jason

    2015-11-01

    Microbial fuel cells (MFCs) directly convert biodegradable substrates to electricity and carry good potential for energy-positive wastewater treatment. However, the low and direct current (DC) output from MFC is not usable for general electronics except small sensors, yet commercial DC-AC converters or inverters used in solar systems cannot be directly applied to MFCs. This study presents a new DC-AC converter system for MFCs that can generate alternating voltage in any desired frequency. Results show that AC power can be easily achieved in three different frequencies tested (1, 10, 60 Hz), and no energy storage layer such as capacitors was needed. The DC-AC converter efficiency was higher than 95% when powered by either individual MFCs or simple MFC stacks. Total harmonic distortion (THD) was used to investigate the quality of the energy, and it showed that the energy could be directly usable for linear electronic loads. This study shows that through electrical conversion MFCs can be potentially used in household electronics for decentralized off-grid communities.

  1. Performance of Halbach magnetized brushless AC motors

    Zhu, Z.Q.; Xia, Z.P.; Shi, Y.F.; Howe, D.; Pride, A.; X. J. Chen

    2003-01-01

    The steady-state performance of Halbach magnetized brushless ac machines when operated in constant torque and flux-weakening modes is investigated both theoretically and experimentally, with particular emphasis on the influence of cross-coupling magnetic saturation on the torque capability.

  2. Ac-dc converter firing error detection

    Each of the twelve Booster Main Magnet Power Supply modules consist of two three-phase, full-wave rectifier bridges in series to provide a 560 VDC maximum output. The harmonic contents of the twelve-pulse ac-dc converter output are multiples of the 60 Hz ac power input, with a predominant 720 Hz signal greater than 14 dB in magnitude above the closest harmonic components at maximum output. The 720 Hz harmonic is typically greater than 20 dB below the 500 VDC output signal under normal operation. Extracting specific harmonics from the rectifier output signal of a 6, 12, or 24 pulse ac-dc converter allows the detection of SCR firing angle errors or complete misfires. A bandpass filter provides the input signal to a frequency-to-voltage converter. Comparing the output of the frequency-to-voltage converter to a reference voltage level provides an indication of the magnitude of the harmonics in the ac-dc converter output signal

  3. Digital model for harmonic interactions in AC/DC/AC systems

    Guarini, A.P.; Rangel, R.D.; Pilotto, L.A.S.; Pinto, R.J.; Passos Junior, R. [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)

    1994-12-31

    The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.

  4. A Comparison Between Two Average Modelling Techniques of AC-AC Power Converters

    Pawel Szczesniak

    2015-03-01

    Full Text Available In this paper, a comparative evaluation of two modelling tools for switching AC-AC power converters is presented. Both of them are based on average modelling techniques. The first approach is based on the circuit averaging technique and consists in the topological manipulations, applied to a converters states. The second approach makes use of state-space averaged model of the converter and is based on analytical manipulations using the different state representations of a converter. The two modelling techniques are applied to a same AC-AC converter called matrix-reactance frequency converter based on buck-boost topology. These techniques are compared on the basis of their rapidity, quantity of calculations and transformations and its limitations.

  5. High voltage AC/AC electrochemical capacitor operating at low temperature in salt aqueous electrolyte

    Abbas, Qamar; Béguin, François

    2016-06-01

    We demonstrate that an activated carbon (AC)-based electrochemical capacitor implementing aqueous lithium sulfate electrolyte in 7:3 vol:vol water/methanol mixture can operate down to -40 °C with good electrochemical performance. Three-electrode cell investigations show that the faradaic contributions related with hydrogen chemisorption in the negative AC electrode are thermodynamically unfavored at -40 °C, enabling the system to work as a typical electrical double-layer (EDL) capacitor. After prolonged floating of the AC/AC capacitor at 1.6 V and -40°C, the capacitance, equivalent series resistance and efficiency remain constant, demonstrating the absence of ageing related with side redox reactions at this temperature. Interestingly, when temperature is increased back to 24 °C, the redox behavior due to hydrogen storage reappears and the system behaves as a freshly prepared one.

  6. Rapid cycling synchrotron magnet with separate ac and dc circuit

    In present rapid cycling synchrotron magnets ac and dc currents flow in the same coil to give the desired field. The circuit reactance is made zero at dc and the operating frequency by running the magnet in series with an external parallel resonant LC current. We propose to return the ac flux in a gap next to the synchrotron. The dc coil encloses the ac magnetic circuit and thus links no ac flux. A shorted turn between the dc coil and ac flux enhances the separation of the two circuits. Several interesting developments are possible. The dc coil could be a stable superconductor to save power. The ac flux return gap could be identical with the synchrotron gap and contain a second synchrotron. This would double the output of the system. If the return flux gap were used for a booster, the ac coil power could be greatly reduced or radiation hardening of the ac coil could be simplified

  7. I-V curve of Bi-2223/Ag tapes in overload conditions determined from AC transport data

    The influence of dynamics on the dissipation at electrical charge transport in superconductors can be investigated by comparing the resistive part of AC transport loss with the prediction deduced from DC I-V curve. The complication is that in the AC regime a hysteretic loss is present, generating a voltage that is similar to that produced by the I-V curve. We present how the signal due to hysteresis loss can be eliminated from the total voltage measured with AC transport current, and the DC I-V curve deduced from its fundamental and higher harmonics can be constructed. The experiments were performed on two samples prepared from the same tape. The voltage was monitored using contact as well as contact-less method. Its harmonics (up to 7th) were decomposed to the parts that are out of phase and in phase with transport current, using a lock-in amplifier. The experiments were focused on the over critical current regime up to AC currents with amplitudes 3 times exceeding the tape critical current. We show how from these data the basic parameters characterising the I-V curve of the composite tape, i.e. its critical current, the slope and the normal state resistivity, can be determined

  8. Design of Three Phase Matrix Converter AC-AC Utility Power Supply using SPWM Technique

    Sagar.S.Pawar; Prakash.T.Patil

    2015-01-01

    This paper describes the control analysis and design of an three phase matrix AC-AC utility power supply .The SPWM modulation techniques is used to control the desired output voltage and gives the control output voltage and reduced input harmonic distortions .In this Matrix converter Input is directly connected to output no DC link components is required. Simulation had been done using mat lab simulink and Simulated results are observed

  9. Design of Three Phase Matrix Converter AC-AC Utility Power Supply using SPWM Technique

    Sagar. S. Pawar

    2015-04-01

    Full Text Available This paper describes the control analysis and design of an three phase matrix AC-AC utility power supply .The SPWM modulation techniques is used to control the desired output voltage and gives the control output voltage and reduced input harmonic distortions .In this Matrix converter Input is directly connected to output no DC link components is required. Simulation had been done using mat lab simulink and Simulated results are observed

  10. A Comparison Between Two Average Modelling Techniques of AC-AC Power Converters

    Pawel Szczesniak

    2015-01-01

    In this paper, a comparative evaluation of two modelling tools for switching AC-AC power converters is presented. Both of them are based on average modelling techniques. The first approach is based on the circuit averaging technique and consists in the topological manipulations, applied to a converters states. The second approach makes use of state-space averaged model of the converter and is based on analytical manipulations using the different state representations of a converter. The two m...

  11. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    Ljusev, P.; Andersen, Michael A.E.

    2005-07-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration. (au)

  12. Implementation of Low Frequency Ac to High Frequency Ac with Single Stage Zvs-Pwm Inverter

    S. Arumugam S. Ramareddy M. Sridhar

    2011-01-01

    This paper presents a novel soft-switching pulse width modulation (PWM) utility frequency AC to high frequency (HF) AC power conversion circuit incorporating boost-active clamp single stage inverter topology. This power converter is more suitable and acceptable for cost effective HF consumer induction heating applications. Its operating principle is presented. The operating performances of this high frequency inverter using the latest insulated gate bipolar transistors are illustrated, which ...

  13. Adaptive Nonlinear Control of Induction Motors through AC/DC/AC Converters

    Elfadili, Abderrahim; Giri, Fouad; El Magri, Abdelmounime; Dugard, Luc; Chaoui, Fatima Zara

    2012-01-01

    The problem of controlling induction motors, together with associated AC/DC rectifiers and DC/AC inverters, is addressed. The control objectives are threefold: (i) the motor speed should track any reference signal despite mechanical parameter uncertainties and variations; (ii) the DC Link voltage must be tightly regulated; (iii) the power factor correction (PFC) w.r.t. the power supply net must be performed in a satisfactory way. First, a nonlinear model of the whole controlled system is deve...

  14. Robust control of synchronous motors through AC/DC/AC converters

    El Magri, Abdelmounime; Giri, Fouad; Abouloifa, Abdelmajid; Chaoui, Fatima Zara

    2010-01-01

    The problem of controlling synchronous motors, driven through AC/DC rectifiers and DC/AC inverters is addressed. The control objectives are three fold: (i) forcing the motor speed to track a varying reference signal in presence of motor parameter uncertainties;(ii) regulating the DC Link voltage; (iii )assuring a satisfactory power factor correction (PFC) with respect to the power supply net .First, a nonlinear model of the whole controlled system is developed in the Park-coordinates. Then, a...

  15. A new class of hybrid AC/AC direct power converters

    Klumpner, Christian; Wijekoon, Thiwanka; Wheeler, Patrick

    2005-01-01

    Variable voltage and variable frequency conversion of electrical energy from an AC source to an AC load is done in traditional power converters via a DC-link where an energy storage element (electrolytic capacitors) is situated. Despite its well-known benefits, it has the disadvantage of being bulky and to limit the converter lifetime. On the other hand, Direct Power Conversion (DPC) is an attractive concept, which doesn’t need an energy storage buffer, but has two main disadvantages: reduced...

  16. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...... will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration....

  17. Magnetization loop modelling for superconducting/ferromagnetic tube of an ac magnetic cloak

    From the combination of superconducting (SC) and ferromagnetic (FM) materials, one can prepare composites with unusual magnetic properties, e.g. for the cloaking of a dc or low-frequency ac magnetic field by a shell from a SC/FM composite. In the design and optimisation of such SC/FM structures, numerical modelling is essential. Non-linear magnetic permeability, as well as the hysteresis of both kinds of materials, are to be incorporated in the calculations aimed at achieving reliable estimates. We present a technique that allows the prediction of the ac magnetization loops of SC/FM composites. The critical state model-based approach is used to describe the properties of the superconducting material. The ferromagnetic part is characterized by its (non-hysteretic) nonlinear permeability. With these ingredients, the distributions of the magnetic field are calculated in subsequent instants of the ac cycle and are used to evaluate the preliminary data for the magnetization loop, which is still missing the hysteresis of the FM part. Afterward, the latter component is added to the magnetization loop by an approximation deduced from the known dependence of the hysteresis loss in the FM material on the ac magnetic field. In spite of its approximate nature, this approach demonstrated very good predictability in experimental tests. (paper)

  18. DC voltage increment due to Ac coupling in a high-Tc superconducting coil

    In this work the interplay between Ac and DC currents is investigated in a High-Tc Superconducting (Hats) coil. The coil, made of multifilamentary silver-sheathed Bi-2223 tape, stores energy of 4.2a at 77K where the critical current is 22.2A. We observed that the application of a sinusoidal current component in the frequency range of 50-500Hz into the coil, while it is already carrying DC current in the range of 16-22.5A, caused an increase in the coil DC voltage. The DC voltage increment due to AC application is found to increase linearly with frequency and quadratically with amplitude. This phenomenon might be caused by the enhancement of Box creep in the HTS filaments due to excitation of pinned vortices by the AC current. The DC voltage increment increases as the coil current grows towards its critical value. A relative increment of 24 and 205Hz at the critical current. Clearly, the DC power loss in the coil increases in the same proportion. This result can be important in power applications based on HTS coils driven by a subcritical DC current and loaded by a relatively small AC current such as SMES and ECL. This research has been supported by the Ministry of Infrastructure, grant 95-11-09. A.F. acknowledges a support from the ministry of science. I.A.A. acknowledges the support from Jordan University of Science and Technology

  19. AC Conductivity and Dielectric Relaxation Behavior of Sb2S3 Bulk Material

    Abd El-Rahman, K. F.; Darwish, A. A. A.; Qashou, Saleem I.; Hanafy, T. A.

    2016-07-01

    The Sb2S3 bulk material was used for next-generation anode for lithium-ion batteries. Alternative current (AC) conductivity, dielectric properties and electric modulus of Sb2S3 have been investigated. The measurements were carried out in the frequency range from 40 Hz to 5 MHz and temperature range from 293 K to 453 K. The direct current (DC) conductivity, σ DC, shows an activated behavior and the calculated activation energy is 0.50 eV. The AC conductivity, σ AC, was found to increase with the increase of temperature and frequency. The conduction mechanism of σ AC was controlled by the correlated barrier hopping model. The behavior of the dielectric constant, ɛ', and dielectric loss index, ɛ'', reveal that the polarization process of Sb2S3 is dipolar in nature. The behavior of both ɛ' and ɛ'' reveals that bulk Sb2S3 has no ferroelectric or piezoelectric phase transition. The dielectric modulus, M, gives a simple method for evaluating the activation energy of the dielectric relaxation. The calculated activation energy from M is 0.045 eV.

  20. Poly Meta-Aminophenol: Chemical Synthesis, Characterization and Ac Impedance Study

    Thenmozhi Gopalasamy

    2014-01-01

    Full Text Available The present work is an investigation of AC impedance behaviour of poly(meta-aminophenol. The polymer was prepared by oxidative chemical polymerization of meta-aminophenol in aqueous HCl using ammonium persulfate as an oxidant at 0–3°C. The synthesized polymer was characterized by GPC, Elemental analysis, UV-VIS-NIR, FT-IR, 1H NMR, XRD, SEM, and TGA-DTA. The AC conductivity and dielectric response were measured at a temperature range from 303 to 383 K in the frequency range of 20 Hz to 106 Hz. The AC conductivity data could be described by the relation σacω=AωS, where the parameter “S” and Rb values decrease in the entire range of study and hence follow Correlated Barrier Hopping conduction mechanism. Both dielectric constant and dielectric loss increase with the decrease of frequency exhibiting strong interfacial polarization at low frequency and the dissipation factor also decreases with frequency. Complex electric modulus and dissipation factor exhibit two relaxation peaks, indicating two-phase structure as indicated by a bimodal distribution of relaxation process. The activation energies corresponding to these two relaxation processes were found to be 0.07 and 0.1 eV.

  1. Hereditary Hearing Loss.

    Tran, LenhAnh P.; Grundfast, Kenneth M.

    1997-01-01

    This article discusses inheritance patterns in hearing loss, epidemiology, clues to genetic causes, locating genes that cause hereditary disorders, genes related to hearing loss disorders in individuals with Usher syndrome, Waardenburg syndrome, Treacher-Collins syndrome, Branchio-oto-renal and Pendred syndromes, and the significance of finding…

  2. Understanding Rural Population Loss.

    McGranahan, David A.; Beale, Calvin L.

    2002-01-01

    A quarter of nonmetro counties lost population in the 1990s, but population loss was not related to poverty rate or low educational levels, perhaps because low-skill workers can no longer expect better wages in urban areas. Population loss was related to low population density and remoteness (which decrease access to services), lack of natural…

  3. Loss muinasjuturaamatust / Agu Veetamm

    Veetamm, Agu, 1953-

    2004-01-01

    Ballindaloch on üks väheseid Shoti losse, kus omanikud aastaringselt elavad. 450 aastat on loss kuulunud Macpherson-Grantide suguvõsale. Praegu on lossi omanikuks Clare Nancy Macpherson-Grant Russell, kelle kujundatud on kiviktaimla ja rosaarium. Lossi ajaloost, omanikest, ümberehitustest, ringkäigust lossis, pargist. 14 ill

  4. Help! It's Hair Loss!

    ... Homework? Here's Help White House Lunch Recipes Help! It's Hair Loss! KidsHealth > For Kids > Help! It's Hair Loss! Print A A A Text Size ... part above the skin, is dead. (That's why it doesn't hurt to get a haircut!) This ...

  5. Weight Loss Surgery

    Weight loss surgery helps people with extreme obesity to lose weight. It may be an option if you cannot lose weight through diet and exercise or have serious health problems caused by obesity. There are different types of weight loss surgery. They often limit the ...

  6. [Inner Ear Hearing Loss].

    Hesse, G

    2016-06-01

    Hearing loss is one of the most dominant handicaps in modern societies, which additionally very often is not realized or not admitted. About one quarter of the general population suffers from inner ear hearing loss and is therefore restricted in communicational skills. Demographic factors like increasing age play an important role as well as environmental influences and an increasing sound and noise exposure especially in leisure activities. Thus borders between a "classical" presbyacusis - if it ever existed - and envirionmentally induced hearing loss disappear. Today restrictions in hearing ability develop earlier in age but at the same time they are detected and diagnosed earlier. This paper can eventually enlighten the wide field of inner ear hearing loss only fragmentarily; therefore mainly new research, findings and developments are reviewed. The first part discusses new aspects of diagnostics of inner ear hearing loss and different etiologies. PMID:27259171

  7. Acute loss of consciousness.

    Tristán, Bekinschtein; Gleichgerrcht, Ezequiel; Manes, Facundo

    2015-01-01

    Acute loss of consciousness poses a fascinating scenario for theoretical and clinical research. This chapter introduces a simple yet powerful framework to investigate altered states of consciousness. We then explore the different disorders of consciousness that result from acute brain injury, and techniques used in the acute phase to predict clinical outcome in different patient populations in light of models of acute loss of consciousness. We further delve into post-traumatic amnesia as a model for predicting cognitive sequels following acute loss of consciousness. We approach the study of acute loss of consciousness from a theoretical and clinical perspective to conclude that clinicians in acute care centers must incorporate new measurements and techniques besides the classic coma scales in order to assess their patients with loss of consciousness. PMID:25702218

  8. 21 CFR 880.5500 - AC-powered patient lift.

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered patient lift. 880.5500 Section 880.5500... Devices § 880.5500 AC-powered patient lift. (a) Identification. An AC-powered lift is an electrically powered device either fixed or mobile, used to lift and transport patients in the horizontal or...

  9. Effect of silicon on the loss separation and permeability of laminated steels

    Hou, Chun-Kan

    1996-09-01

    The effect of silicon content in the range from 0.21 to 2.0 wt% on the ac and dc magnetic properties of laminated steels after box annealing at 800°C for 5 h measured at 1.0 and 1.5 T induction has been investigated. Because of the combined effect of the hot-rolled plate grain size and the slowing down of grain boundary movement by silicon, steel containing 1.26 wt% silicon content had a maximum grain diameter after box annealing. Besides steel containing 1.26 wt% silicon, the texture of laminated steels was improved with increasing silicon content. The electrical resistivity of laminated steels increased linearly with increasing silicon content. The ac core loss, apparent eddy current loss, and classical eddy current loss of laminated steels decreased with increasing silicon content at both inductions. Silicon improved the ac core loss, hysteresis loss, classical eddy current loss and apparent eddy current loss through the combined effects of grain coarsening, texture improvement and increasing electrical resistivity. At 1.0 T induction, the variation of the ac and dc permeability with respect to silicon content was similar to that of grain size. It is suggested that the effect of grain size on permeability is more pronounced than that of texture at low induction. On the other hand, at 1.5 T induction, the variation of the ac and dc permeability and magnetic flux density with respect to silicon content were similar to that of the texture component ( I/ IR) 200. It is suggested that the effect of texture on permeability and magnetic flux density is more significant than that of grain size at high induction.

  10. AC LED的研究现状与发展%Current research and development of AC LED

    满瑞; 李秋俊

    2012-01-01

    介绍了AC LED的特征及其工作原理,分析了AC LED相比于DC LED的优缺点,概述了AC LED在国内外的研究进展及其应用现状,讨论了AC LED技术发展过程中面临的挑战,并展望了其发展趋势.%The characteristics and operation principles of AC LED were presented.The advantages and disadvantages of AC LED compared with the DC LED were analyzed.The development and the latest application of AC LED were described.The challenges of the competition with the traditional light source were discussed,as well as the development trend of AC LED.

  11. A Sequential AC/DC Power Flow Algorithm for Networks Containing Multi-terminal VSC HVDC Systems

    Beerten, Jef; Cole, Stijn; Belmans, Ronnie

    2010-01-01

    In this paper, a sequential AC/DC power flow algorithm is proposed to solve networks containing Multi-terminal Voltage Source Converter High Voltage Direct Current (VSC MTDC) systems. In VSC HVDC technology, the converter losses add up to a significant fraction of the overall system losses. However, they are often neglected or not taken into account in a proper manner in VSC HVDC power flows. The algorithm put forward in this paper takes the converter losses into account using a generalized c...

  12. AC conductivity and dielectric measurements of metal-free phthalocyanine thin films dispersed in polycarbonate

    Riad, A. S.; Korayem, M. T.; Abdel-Malik, T. G.

    1999-10-01

    The dielectric constant and the dielectric loss of thin films of metal-free phthalocyanine dispersed in polycarbonate using ohmic gold electrodes are investigated in the frequency range 20-10 5 Hz and within the temperature range 300-388 K. The frequency dependence of the impedance spectra plotted in the complex plane shows semicircles. The Cole-Cole diagrams have been used to determine the molecular relaxation time, τ, The temperature dependence of τ is expressed by thermally activated process. The AC conductivity σ AC (ω) is found to vary as ωs with the index s⩽1, indicating a dominant hopping process at low temperatures. From the temperature dependence of AC conductivity, free carrier conduction with mean activation energy of 0.33 eV is observed at higher temperatures. Capacitance and loss tangent are found to decrease with increasing frequency and increase with increasing temperature. Such characteristics are found to be in good qualitative agreement with existing equivalent circuit model assuming ohmic contacts.

  13. Effect of nanosilica on optical, electric modulus and AC conductivity of polyvinyl alcohol/polyaniline films

    Nanosilica (NS) was synthesized by a sol–gel method and mixed with 0.98 polyvinyl alcohol (PVA)/0.02 polyaniline (PANI) in different amounts to produce nanocomposite films. High-resolution transmission electron microscopy (HR-TEM) revealed the average particle size of the NS to be ca. 15 nm. Scanning electron microscopy (SEM) showed that the NS was well-dispersed on the surface of the PVA/PNAI films. The Fourier transform infrared (FTIR) spectra of the samples showed a significant change in the intensity of the characteristic peak of the functional groups in the composite films with the amount of NS added. The absorbance and refractive index (n) of the composites were studied in the UV–vis range, and the optical energy band gap, Eg, and different optical parameters were calculated. The dielectric loss modulus, M″ and ac conductivity, σac, of the samples were studied within 300–425 K and 0.1 kHz–5 MHz, respectively. Two relaxation peaks were observed in the frequency dependence of the dielectric loss modulus, M″. The behavior of σac(f) for the composite films indicated that the conduction mechanism was correlated barrier hopping (CBH). The results of this work are discussed and compared with those of previous studies of similar composites

  14. AC conductivity and dielectric properties of Te doped LaMnO3

    We have studied the structural and dielectric properties of La1-xTexMnO3 (x=0.00, 0.10 and 0.20) samples. All the samples show a rhombohedral structure with space group R3-bar c, at room temperature. The dielectric constant and the ac conductivity are measured at room temperature as a function of frequency, ranging from (75 KHz-7MHz).The dielectric constant shows a normal behaviour and the dielectric loss tangent exhibit anomalous behaviour. The ac conductivity obeys super linear power law σ(ω)= Bωn. The real part (ω'), imaginary part (ω) of dielectric constant, loss tangent, and ac conductivity have been explained on the basis of space charge polarization according to Maxwell-Wagner's two layer model and Koops phenomenological theory. The occurrence of giant or colossal dielectric constant is most likely due to electrode polarization or interface polarization effect. The depletion layers arising due to the formation of Schottky diodes at the metallic contacts of semiconducting samples, which may be formed by grain boundaries, can give rise to Maxwell-Wagner type relaxation and apparently very high dielectric constants. (author)

  15. Dicty_cDB: FCL-AC08 [Dicty_cDB

    Full Text Available FCL (Link to library) FCL-AC08 (Link to dictyBase) - - - Contig-U15080-1 FCL-AC08P ...(Link to Original site) FCL-AC08F 616 FCL-AC08Z 291 FCL-AC08P 907 - - Show FCL-AC08 Library FCL (Link to library) Clone ID FCL-...-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-AC08Q....Seq.d/ Representative seq. ID FCL-AC08P (Link to Original site) Representative DNA sequence >FCL-AC08 (FCL-AC08Q) /CSM/FCL/FCL-...ignificant alignments: (bits) Value FCL-AC08 (FCL-AC08Q) /CSM/FCL/FCL-AC/FCL-AC08Q.Seq.d/ 1322 0.0 SFA226 (S

  16. Fractional ac Josephson effect in unconventional superconductors

    For certain orientations of Josephson junctions between two px-wave or two d-wave superconductors, the subgap Andreev bound states produce a 4π-periodic relation between the Josephson current I and the phase difference ψ: I propor to sin(ψ/2) . Consequently, the ac Josephson current has the fractional frequency eV/h where V is the dc voltage. In the tunneling limit, the Josephson current is proportional to the first power (not square) of the electron tunneling amplitude. Thus, the Josephson current between unconventional superconductors is carried by single electrons, rather than by Cooper pairs. The fractional ac Josephson effect can be observed experimentally by measuring frequency spectrum of microwave radiation from the junction

  17. AC motor drive system for electric cars

    Morohoshi, Yukinobu; Yoshinori, Naoto; Naito, Hironobu (Fuji Electric Co., Ltd., Tokyo, (Japan))

    1989-08-10

    Various main circuit equipment with large capacity GTO thyristors are outlined for AC and DC electric cars. The configuration of a PWM converter system is presented for the AC main motor drive system of the Shinkansen trains, and its following features are described: the high power factor control capable of keeping a power factor 100% constantly, energy saving by power regenerative braking, the small triple structure with large capacity reverse-conducting GTO thyristors of 4,500V/3,000A, and the reduction of equivalent interfering current and harmonic current by three phase-triple phase difference operation. Furthermore, a control logic equipment with 16 bit MPU and a main transformer are outlined, and the verification test results of the control logic equipment by an analog model simulation and the combinational test results of the commercial equipment are reported. Prototype VVVF inverter system for DC electric cars is also presented. 6 refs., 13 figs., 3 tabs.

  18. β-delayed fission from 230Ac

    ThO2 is irradiated with 60 MeV/u 18O beams. 230Ra is produced via the multi-nucleon transfer and dissipative fragmentation reactions of the target. 230Ra is radio-chemical separated from ThO2 and the other reaction products. The thin Ra sources are prepared. The mica fission track detectors are exposed to the Ra sources. γ-rays of Ra decay in the sources are measured by a HPGe detector. The mica foil is etched in HF solution. The etched mica foil is scanned with an optical microscope. The fission tracks that should come from β-delayed fission of 230Ac are observed. The β-delayed fission probability of 230Ac is determined to be (1.19 +- 0.85) x 10-8

  19. Calculation of AC losses in HTS stacks and coils for large scale applications

    Rodriguez Zermeno, Victor Manuel; Abrahamsen, Asger Bech; Mijatovic, Nenad; Jensen, Bogi Bech; Sørensen, Mads Peter

    tapes. The idea is to find an anisotropic bulk equivalent for the stack of tapes: “washing out” the geometric internal features of the stack while keeping its overall electromagnetic behavior. Our work extends the anisotropic bulk model originally presented by Clem et al. and later refined by Prigozhin...

  20. Flex concept for US-A BWR extended loss of AC power events

    The US-Advanced Boiling Water Reactor (US-A BWR), certified by the US NRC, is a third generation, evolutionary boiling water reactor design which is the reference for the South Texas Project Units 3 and 4 (Stp 3 and 4) Combined License Application (Cola) and incorporates numerous design and technology enhancements for improved safety performance. Nuclear Innovation North America (NINA) is the License Applicant for this new build project, and Toshiba is the selected primary technology contractor. The Stp 3 and 4 project has finished the US NRC technical review of the Cola, and the final safety evaluation report (FSER) is scheduled to be issued by the US NRC in 2015. Following the accident at the Fukushima Dai-ichi plant, the US-A BWR was reviewed for Beyond Design Basis Event (BDBE) safety using industry and regulatory guidance for US NRC Order EA-12-049 Order Modifying Licenses with Regard to Requirements for Mitigation of Beyond Design Basis External Events (BDBEE). By virtue of the design approach, the US-A BWR is capable of providing an indefinite coping period for a station blackout. The use of installed systems with extended coping times is a significant advantage of the US-A BWR compared to most of the plants currently operating in the U.S. In addition, the Stp 3 and 4 design incorporates enhancements consistent with the current US industry Diverse and Flexible Coping Strategies (Flex) initiative. The final technical topic requiring review by the US NRC Advisory Committee on Reactor Safeguards was the Flex Integrated Plan submitted by NINA, and this review was successfully completed. This paper summarizes the progress of the US-A BWR in licensing the Flex Integrated Plan for the project, and describes the technology and features of the US-A BWR design that contribute to safety post-Fukushima. It also provides an informational comparison of the design capabilities of the US-A BWR for extreme external events, and relates these capabilities to re-assessments performed for the Laguna Verde site following the Fukushima event. (Author)

  1. Flex concept for US-A BWR extended loss of AC power events

    Powers, J. [Toshiba America Nuclear Energy, Charlotte, North Carolina (United States); Aoyagi, Y.; Kataoka, K. [Toshiba Corporation, Kawasaki, Kanagawa (Japan); Thomas, S.; Mookhoek, B., E-mail: jim.powers@toshiba.com [Nuclear Innovation North America, Lake Jackson, Texas (United States)

    2015-09-15

    The US-Advanced Boiling Water Reactor (US-A BWR), certified by the US NRC, is a third generation, evolutionary boiling water reactor design which is the reference for the South Texas Project Units 3 and 4 (Stp 3 and 4) Combined License Application (Cola) and incorporates numerous design and technology enhancements for improved safety performance. Nuclear Innovation North America (NINA) is the License Applicant for this new build project, and Toshiba is the selected primary technology contractor. The Stp 3 and 4 project has finished the US NRC technical review of the Cola, and the final safety evaluation report (FSER) is scheduled to be issued by the US NRC in 2015. Following the accident at the Fukushima Dai-ichi plant, the US-A BWR was reviewed for Beyond Design Basis Event (BDBE) safety using industry and regulatory guidance for US NRC Order EA-12-049 Order Modifying Licenses with Regard to Requirements for Mitigation of Beyond Design Basis External Events (BDBEE). By virtue of the design approach, the US-A BWR is capable of providing an indefinite coping period for a station blackout. The use of installed systems with extended coping times is a significant advantage of the US-A BWR compared to most of the plants currently operating in the U.S. In addition, the Stp 3 and 4 design incorporates enhancements consistent with the current US industry Diverse and Flexible Coping Strategies (Flex) initiative. The final technical topic requiring review by the US NRC Advisory Committee on Reactor Safeguards was the Flex Integrated Plan submitted by NINA, and this review was successfully completed. This paper summarizes the progress of the US-A BWR in licensing the Flex Integrated Plan for the project, and describes the technology and features of the US-A BWR design that contribute to safety post-Fukushima. It also provides an informational comparison of the design capabilities of the US-A BWR for extreme external events, and relates these capabilities to re-assessments performed for the Laguna Verde site following the Fukushima event. (Author)

  2. AC Dielectrophoresis Using Elliptic Electrode Geometry

    S. M. Rezaul Hasan; Aanan Khurma

    2011-01-01

    This paper presents negative AC dielectrophoretic investigations using elliptic electrode geometry. Simulations of the electric field gradient variation using various ratios of the semimajor and the semiminor axis were carried out to determine the optimum elliptic geometry for the dielectrophoretic electrokinetics of specimen in an assay with laminar (low Reynolds number) fluid flow. Experimental setup of the elliptic electrode assembly using PCB fabrication and electrokinetic accumulation of...

  3. Lazy AC-Pattern Matching for Rewriting

    Belkhir, Walid; 10.4204/EPTCS.82.3

    2012-01-01

    We define a lazy pattern-matching mechanism modulo associativity and commutativity. The solutions of a pattern-matching problem are stored in a lazy list composed of a first substitution at the head and a non-evaluated object that encodes the remaining computations. We integrate the lazy AC-matching in a strategy language: rewriting rule and strategy application produce a lazy list of terms.

  4. Entropy production in ac-calorimetry

    Garden, Jean-Luc; Richard, Jacques

    2007-01-01

    In calorimetry and particularly in heat capacity measurements, different characteristic relaxation time constants may perturb the experiment which cannot be considered at thermodynamic equilibrium. In this case, thermodynamics of irreversible processes has to be taken into account and the calorimetric measurements must be considered as dynamic. In a temperature modulated experiment, such as ac-calorimetry, these non-equilibrium experiments give rise to the notion of frequency dependent comple...

  5. What's Hearing Loss?

    ... cochlea during an operation. It takes over the job of the damaged or destroyed hair cells in the ... and Communicating A kid with hearing loss may attend a special school, special classes within ...

  6. Bone Loss in IBD

    ... DENSITY? Although bone seems as hard as a rock, it’s actually living tissue. Throughout your life, old ... available Bone Loss (.pdf) File: 290 KB 733 Third Avenue, Suite 510, New York, NY 10017 | 800- ...

  7. Weight loss - unintentional

    ... of laxatives Other causes such as: Eating disorders, anorexia nervosa that have not been diagnosed yet Diabetes that ... do not know the reason. You have other symptoms along with the weight loss.

  8. Understanding Grief and Loss

    ... Other common behaviors include restlessness and excessive activity. Religion and spirituality Grief and loss may also cause ... The grieving person’s age and gender The life history of the person who is grieving, including previous ...

  9. Nickel hydrogen capacity loss

    Goualard, Jacques; Paugam, D.; Borthomieu, Y.

    1993-01-01

    The results of tests to assess capacity loss in nickel hydrogen cells are presented in outline form. The effects of long storage (greater than 1 month), high hydrogen pressure storage, high cobalt content, and recovery actions are addressed.

  10. Prizes for weight loss.

    Englberger, L.

    1999-01-01

    A programme of weight loss competitions and associated activities in Tonga, intended to combat obesity and the noncommunicable diseases linked to it, has popular support and the potential to effect significant improvements in health. PMID:10063662

  11. Types of Hearing Loss

    ... on this topic can be found in our Audiology Information Series [PDF]. Hearing loss can be categorized ... speech-language pathologists; speech, language, and hearing scientists; audiology and speech-language pathology support personnel; and students. ...

  12. Occupational hearing loss

    ... music can cause hearing loss. Sounds above 80 decibels (dB, a measurement of the loudness or strength ... is allowed. Both the length of exposure and decibel level are considered. If the sound is at ...

  13. Prizes for weight loss.

    Englberger, L

    1999-01-01

    A programme of weight loss competitions and associated activities in Tonga, intended to combat obesity and the noncommunicable diseases linked to it, has popular support and the potential to effect significant improvements in health.

  14. Comparing energy loss phenomenology

    van Leeuwen, M.(Institute for Subatomic Physics of Utrecht University, Utrecht, Netherlands)

    2009-01-01

    High-pT particle production is suppressed in heavy ion collisions due to parton energy loss in dense QCD matter. Here we present a systematic comparison of two different theoretical approximations to parton energy loss calculations: the opacity expansion and the multiple-soft scattering approximation for the simple case of a quark traversing a homogeneous piece of matter with fixed length (the TECHQM 'brick problem'), with focus on the range of parameters that is relevant for interpreting RHI...

  15. Sleep Loss and Inflammation

    Mullington, Janet M.; Simpson, Norah S.; Meier-Ewert, Hans K.; Haack, Monika

    2010-01-01

    Controlled, experimental studies on the effects of acute sleep loss in humans have shown that mediators of inflammation are altered by sleep loss. Elevations in these mediators have been found to occur in healthy, rigorously screened individuals undergoing experimental vigils of more than 24 hours, and have also been seen in response to various durations of sleep restricted to between 25 and 50% of a normal 8 hour sleep amount. While these altered profiles represent small changes, such sub-cl...

  16. Female pattern hair loss

    İdil Ünal

    2014-06-01

    Full Text Available Female androgenetic alopecia is the commonest cause of hair loss in women. It is characterized by a diffuse reduction in hair density over the crown and frontal scalp with retention of the frontal hairline and a characteristic pattern distribution in genetically predisposed women. Because of the uncertain relationship with the androgens Female Pattern Hair Loss (FPHL is the most preferred definition of the condition. This review has been focused on the clinical features, diagnosis and treatment alternatives of FPHL.

  17. Female pattern hair loss

    İdil Ünal

    2014-01-01

    Female androgenetic alopecia is the commonest cause of hair loss in women. It is characterized by a diffuse reduction in hair density over the crown and frontal scalp with retention of the frontal hairline and a characteristic pattern distribution in genetically predisposed women. Because of the uncertain relationship with the androgens Female Pattern Hair Loss (FPHL) is the most preferred definition of the condition. This review has been focused on the clinical features, diagnosis and treatm...

  18. Female pattern hair loss

    Archana Singal; Sidharth Sonthalia; Prashant Verma

    2013-01-01

    Female pattern hair loss (FPHL) is a common cause of hair loss in women characterized by diffuse reduction in hair density over the crown and frontal scalp with retention of the frontal hairline. Its prevalence increases with advancing age and is associated with significant psychological morbidity. The pathophysiology of FPHL is still not completely understood and seems to be multifactorial. Although androgens have been implicated, the involvement of androgen-independent mechanisms is evident...

  19. Female Pattern Hair Loss

    Herskovitz, Ingrid; Tosti, Antonella

    2013-01-01

    Context: Female pattern hair loss (FPHL) also known as female androgenetic alopecia is a common condition afflicting millions of women that can be cosmetically disrupting. Prompt diagnosis and treatment are essential for obtaining optimal outcome. This review addresses the clinical presentation of female pattern hair loss, its differential diagnosis and treatment modalities. Evidence Acquisition: A) Diffuse thinning of the crown region with preservation of the frontal hairline (Ludwig’s type)...

  20. Loss measurement and analysis for the prototype generator with HTS stator and permanent magnet rotor

    Song, Peng, E-mail: songp10@mails.tsinghua.edu.cn [Applied Superconductivity Research Center, Department of Physics, Tsinghua University, Beijing 100084 (China); Qu, Timing, E-mail: tmqu@mail.tsinghua.edu.cn [Applied Superconductivity Research Center, Department of Physics, Tsinghua University, Beijing 100084 (China); Department of Mechanical Engineering, Tsinghua University, Key Laboratory for Advanced Materials Processing Technology, Ministry of Education, Beijing 100084 (China); Yu, Xiaoyu [Department of Mechanical Engineering, Tsinghua University, Key Laboratory for Advanced Materials Processing Technology, Ministry of Education, Beijing 100084 (China); Li, Longnian; Gu, Chen [Applied Superconductivity Research Center, Department of Physics, Tsinghua University, Beijing 100084 (China); Li, Xiaohang [Innova Superconductor Technology Co., Ltd., Beijing 100084 (China); Wang, Dewen; Hu, Boping [Beijing Zhong Ke San Huan Hi-Tech Co., Ltd., Beijing 100084 (China); Chen, Duxing [Department Fis, University Autonoma Barcelona, Barcelona 08193 (Spain); Han, Zhenghe [Applied Superconductivity Research Center, Department of Physics, Tsinghua University, Beijing 100084 (China)

    2013-11-15

    Highlights: •A novel prototype HTS generator with HTS armature windings was developed. •No-load loss and the iron loss at low temperature were measured. •The total loss at low temperature is much larger than the room temperature case. •The reason for no-load loss increment at low temperature is discussed. -- Abstract: A prototype HTS synchronous generator with a permanent magnet rotor and HTS armature windings was developed. The rated armature frequency is 10 Hz. The cryogenic Dewar is tightly surrounded outside the iron core. Both HTS coils and the iron core were cooled by using conduction cooling method. During the process of no-load running, the no-load loss power data were obtained through the torque measurement. The temperature evolution characteristics of the stator was measured by PT-100 temperature sensors. These results show that the no-load loss power at around 77 K are much larger than that at room temperature. The possible reason for the no-load loss increment is discussed. The ac loss power of one individual HTS coil used in this generator was also tested. Compared with the iron loss power, the ac loss power is rather small and could be neglected.

  1. Eddy current losses in multiwire superconductors duel to external perpendicular magnetic field

    Approximate method is presented of calculation of eddy current losses in a multiwire superconductor from an ac magnetic field perpendicular to the conductor axis, based on the solution of the equivalent magnetic circuit. The results of the solution show that the loss power output of the eddy currents from this field is neglibible inside the wire zone. A relatively greater loss power output appears in the stabilizing sheath of the conductor if it has greater thickness. The thickness of the stabilizing sheath influences the loss power outut proportionally to the third and fourth powers. (authors). 5 figs., 2 tabs., 5 refs

  2. Structure-guided creation of AcAP5-derived and platelet targeted factor Xa inhibitors.

    Zhu, Yuanjun; Lin, Yuan; Liu, Aihua; Shui, Mengyang; Li, Ruyi; Liu, Xiaoyan; Hu, Wenhui; Wang, Yinye

    2015-06-15

    Anticoagulants and anti-platelet agents are simultaneously administrated in clinical practice (i.e. percutaneous coronary intervention), which cause significant risk of systemic bleeding. Targeted delivery of anticoagulants to the activated platelets at sites of vascular injuries may condense the site-specific anticoagulant effect and reduce the hemorrhage side effects in uninjured vessels. To this end, we prepared three ancylostoma caninum anticoagulant peptide 5 (AcAP5) variants NR1, NR2 and NR3 engineered with a platelet-binding Arg-Gly-Asp (RGD) motif and evaluated their anti-Factor Xa (FXa) and platelet-binding effects. These RGD-containing AcAP5 variants were capable of interacting with platelet receptor αIIbβ3 as shown in computational analysis. All variants, especially NR2 and NR3, retained entirely the anti-FXa function of parent AcAP5. Moreover, they prevented the formation of occlusive thrombi in rat carotid artery injury model, suggesting that they inhibit platelet aggregation in vivo. Further functional investigation of NR3 demonstrated that NR3 inhibited platelet aggregation in vitro and FXa activity in vivo, and prolonged the coagulation time, all in a dose-dependent manner. Through flow cytometry assay, we confirmed the binding of NR3 to αIIbβ3 receptor. In mouse model of carotid artery endothelium injury, NR3-treated mice showed less tail bleeding time than AcAP5-treated mice, and aspirin plus NR3 treatment exhibited moderate reduction of blood loss compared with aspirin plus AcAP5 treatment. These results indicate the feasibility to engineer a novel FXa inhibitor specifically targeting the activated platelets, which centralizes its anticoagulation efficacy in the injured vascular endothelium and reduces the risk of systemic bleeding. PMID:25887920

  3. Sensorless Vector Control of AC Induction Motor Using Sliding-Mode Observer

    Phuc Thinh Doan

    2013-06-01

    Full Text Available This paper develops a sensorless vector controlled method for AC induction motor using sliding-mode observer. For developing the control algorithm, modeling of AC induction motor is presented. After that, a sliding mode observer is proposed to estimate the motor speed, the rotor flux, the angular position of the rotor flux and the motor torque from monitored stator voltages and currents. The use of the nonlinear sliding mode observer provides very good performance for both low and high speed motor operation. Furthermore, the proposed system is robust in motor losses and load variations. The convergence of the proposed observer is obtained using the Lyapunov theory. Hardware and software for simulation and experiment of the AC induction motor drive are introduced. The hardware consists of a 1.5kw AC induction motor connected in series with a torque sensor and a powder brake. A controller is developed based on DSP TMS320F28355. The simulation and experimental results illustrate that fast torque and speed response with small torque ripples can be achieved. The proposed control scheme is suitable to the application fields that require high performance of torque response such as electric vehicles. doi:http://dx.doi.org/10.12777/ijse.4.2.2013.39-43 [How to cite this article: Doan, P. T., Nguyen, T. T., Jeong, S. K., Oh, S. J., & Kim, S. B. (2013. Sensorless Vector Control of AC Induction Motor Using Sliding-Mode Observer. INTERNATIONAL JOURNAL OF SCIENCE AND ENGINEERING, 4(2, 39-43; doi: http://dx.doi.org/10.12777/ijse.4.2.2013.39-43

  4. Development of a hardware-based AC microgrid for AC stability assessment

    Swanson, Robert R.

    As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.

  5. Loss Allocation in Securitization Transactions

    Günter Franke; Markus Herrmann; Thomas Weber

    2011-01-01

    This paper analyses the loss allocation to First, Second and Third Loss Positions in European collateralized debt obligation transactions. The quality of the underlying asset pool plays a predominant role for the loss allocation. A lower asset pool quality induces the originator to take a higher First Loss Position, but, in a synthetic transaction, a smaller Third Loss Position. The share of expected default losses, borne by the First Loss Position, is largely independent of asset pool qualit...

  6. Experimental setup for precise measurement of losses in high-temperature superconducting transformer

    Janů, Zdeněk; Wild, J.; Řepa, P.; Jelínek, Z.; Žížek, F.; Peksa, L.; Soukup, František; Tichý, Rudolf

    2006-01-01

    Roč. 46, - (2006), s. 759-761. ISSN 0011-2275 R&D Projects: GA ČR GA102/05/0942 Institutional research plan: CEZ:AV0Z10100520 Keywords : superconducting transformer * AC losses * calorimeters Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 0.927, year: 2006

  7. Behaviour of small coils. Current sharing and losses with resistive barriers

    Owing to a resistive barrier between composites in a superconducting conductor it is possible to share current when composites are broken without important extra losses in pulsed conditions. With a copper oxide obtained by heating in dry air no degradation in DC or AC conditions appears with about 30% of faulty composites

  8. Investigations on the flux pinning and an irreversibility line in different YBCO modifications by ac susceptibility measurements

    On polycrystalline specimens, melt grown thick films and sputtered thin films of YBa2Cu3O7-x we have investigated the imaginary part (χ'') of the ac susceptibility in dependence of frequency (1-50) kHz and ac amplitude (1 mOe-25 Oe). For the melt grown thick films and the sputtered thin films the observed loss-peak temperature (Tp) shifts only slightly to lower temperatures with increasing ac amplitude. This behavior is due to a strong flux-pinning mechanism. For the polycrystalline specimen the intergranular Tp decreases strongly with increasing ac amplitude above 1.5 Oe, resulting in a strong temperature dependence of the intergranular critical current density Jcj. With increasing frequency we observe an enhancement of Tp for all investigated YBCO modifications. From the frequency dependence of Tp we determine the flux pinning potential U0(T=0, HAC=0) to some eV. A irreversibility line was derived from the Tp dependence of the ac amplitude and will be discussed in terms of a phase transition from flux glass to flux flow. (orig.)

  9. dc and ac magnetic properties of thin-walled Nb cylinders with and without a row of antidots.

    Tsindlekht, M I; Genkin, V M; Felner, I; Zeides, F; Katz, N; Gazi, Š; Chromik, Š; Dobrovolskiy, O V; Sachser, R; Huth, M

    2016-06-01

    dc and ac magnetic properties of two thin-walled superconducting Nb cylinders with a rectangular cross-section are reported. Magnetization curves and the ac response were studied on as-prepared and patterned samples in magnetic fields parallel to the cylinder axis. A row of micron-sized antidots (holes) was made in the film along the cylinder axis. Avalanche-like jumps of the magnetization are observed for both samples at low temperatures for magnetic fields not only above H c1, but in fields lower than H c1 in the vortex-free region. The positions of the jumps are not reproducible and they change from one experiment to another, resembling vortex lattice instabilities usually observed for magnetic fields larger than H c1. At temperatures above [Formula: see text] and [Formula: see text] the magnetization curves become smooth for the patterned and the as-prepared samples, respectively. The magnetization curve of a reference planar Nb film in the parallel field geometry does not exhibit jumps in the entire range of accessible temperatures. The ac response was measured in constant and swept dc magnetic field modes. Experiment shows that ac losses at low magnetic fields in a swept field mode are smaller for the patterned sample. For both samples the shapes of the field dependences of losses and the amplitude of the third harmonic are the same in constant and swept field near H c3. This similarity does not exist at low fields in a swept mode. PMID:27143621

  10. Mass loss from stars

    This article discusses the different mass-loss processes of stars and how mass-loss rates determine the fate of stars in advanced stages of stellar evolution. Main sequence stars have their atmospheric structure dominated by radiation pressure. The pressure exerted by energetic photons is sufficient to drive gases off into space. This process can impact enormous turbulence to the local interstellar medium. Evolutionary effects keep these stars from fully evaporating, but the very course of their evolution is determined by this mass shedding process. Lower main sequence stars, like the sun, have a turbulent atmosphere enveloped in hot, thin coronal gas, blowing off a light stellar breeze. As the main sequence star evolves to a giant, its corona dissipates and the breeze turns into a strong stellar wind. Intermitten sputters combined with pulsational instabilities can lead to partial ejection of the atmosphere and envelope of a red giant, i.e. a planetary nebula results. The mass-loss from stars through planetary nebule combined with other mass-loss processes such as stellar winds returns a substantial amount of material to the interstellar environment. Mass-loss in binary systems is also discussed

  11. Implementation of Low Frequency Ac to High Frequency Ac with Single Stage Zvs-Pwm Inverter

    S. Arumugam S. Ramareddy M. Sridhar

    2011-12-01

    Full Text Available This paper presents a novel soft-switching pulse width modulation (PWM utility frequency AC to high frequency (HF AC power conversion circuit incorporating boost-active clamp single stage inverter topology. This power converter is more suitable and acceptable for cost effective HF consumer induction heating applications. Its operating principle is presented. The operating performances of this high frequency inverter using the latest insulated gate bipolar transistors are illustrated, which includes HFAC power regulation ranges and actual efficiency characteristics based on zero voltage soft switching operation ranges.. The simulation circuits are models are developed and they are simulated using ORCAD.

  12. Implementation and Control of an AC/DC/AC Converter for Double Wound Flywheel Application

    Oliveira, J. G.; Schettino, H.; Gama, V; Carvalho, R.; H. Bernhoff

    2012-01-01

    An all-electric driveline based on a double wound flywheel, connected in series between main energy storage and a wheel motor, is presented. The flywheel works as a power buffer, allowing the battery to deliver optimized power. It also separates electrically the system in two sides, with the battery connected to the low voltage side and the wheel motor connected to the high voltage side. This paper presents the implementation and control of the AC/DC/AC converter, used to connect the flywheel...

  13. GRID-CONNECTECD DOUBLE-STAGE AC-AC POWER CONVERTER FOR CSP RENEWABLE ENERGY SYSTEMS

    Sorrentino, Vincenzo

    2015-01-01

    In the last years the renewable energy sources have known a state of their advanced diffusion considering their advantages compared to the traditional energy sources like fossil fuels. For this reason the combined heat and power (CHP) plant fueled by renewable sources are widely used. The purpose of this Ph.D. thesis is the design of a new Grid-connected Double-Stage AC-DC/DC-AC Power Converter (DSACPC) for a Concentrating Solar plant for Combined generation of Heat and Power (CS-CHP), th...

  14. AcEST Contig - AcEST | LSDB Archive [Life Science Database Archive metadata

    Full Text Available [ Credit s ] BLAST Search Image Search Home About Archive Update History Contact us AcEST AcEST C ... c.jp/togodb/view/archive_acestcontig#en Data acquisit ion method - Data analysis method - Number of data ... entries 4,298 entries Data it em Description Contig ID ID of contig sequence of A ... ris Number of clones The number of EST clones constit uting the contig sequence of Adiantum capillus-vene ... ris Definit ion Definit ion Link to clone list In the TogoDB edi ...

  15. Realization of a Direct Soft Switching AC/AC Converter for Wireless Power Transfer Applications

    Vuorsalo, Simo

    2015-01-01

    This thesis describes the design, realization and testing of a three-phase to one-phase direct AC/AC converter, also known as the matrix converter. The switching is using the soft-switching strategy which is also known in the literature as the Zero Current Switching strategy. To achieve ZCS, the circuit needs resonant behavior which is achieved by the transmitter primary side that is an LC circuit. This circuit acts as a tank circuit and the switching frequency is the resonant frequency of th...

  16. Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count

    Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin;

    2007-01-01

    This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled to...... low cost alternative to sensitive applications that need to ride-through frequent input voltage sags. For confirming the converter performance, experimental testing using a constructed laboratory prototype is performed with its captured results presented in a later section of the paper....

  17. Influence of gear loss factor on the power loss prediction

    C. M. C. G. Fernandes; P. M. T. Marques; R. C. Martins; J. H. O. Seabra

    2015-01-01

    In order to accurately predict the power loss generated by a meshing gear pair the gear loss factor must be properly evaluated. Several gear loss factor formulations were compared, including the author's approach. A gear loss factor calculated considering the load distribution along the path of contact was implemented. The importance of the gear loss factor in the power loss predictions was put in evidence comparing the predictions with experimental results. It was ...

  18. Electrical properties of AC3B4O12-type perovskite ceramics with different cation vacancies

    Highlights: • AC3B4O12 perovskite with different concentration cation vacancies were prepared. • Cell parameter decreases with the increase of concentration of cation vacancies. • PTCO and CTO remain high dielectric permittivity but depress loss greatly. • Dielectric loss associates with cation vacancies and motion of oxygen vacancies. - Abstract: AC3B4O12-type perovskite CaCu3Ti4O12 (CCTO), □0.34Pr0.67Cu3Ti4O12 (PCTO), □1Cu3Ta2Ti2O12 (CTTO), □2Cu2Ta4O12 (CTO) ceramics with different concentration cation vacancies were prepared through traditional solid state reaction method. X-ray diffraction analysis indicated that CCTO and PCTO are perovskite cubic with space group Im-3 (no. 204) while CTTO and CTO are Pm-3 (no. 200). Cell parameter of the samples dramatically increases with the increase of cation vacancies. Dielectric permittivity of them maintains very high value of ∼104 from room temperature to 550 K but the dielectric loss is depressed with the increase of cation vacancies in the same space group. The dielectric properties and conductivity behavior were described by the Debye relaxation and the universal dielectric response, respectively. The effect mechanism of cation vacancy and crystal structure on carrier transposition were discussed

  19. Congenital sensorineural hearing loss

    The ears of 47 selected patients with congenital sensorineural hearing loss were examined with complex-motion tomography. The patients were divided into 3 general categories: those with a recognized syndrome, those with sensorineural hearing loss unrelated to any known syndrome, and those with microtia. A great variety of inner ear anomalies was detected, but rarely were these characteristic of a particular clinical entity. The most common finding was the Mondini malformation or one of its variants. Isolated dysplasia of the internal auditory canal or the vestibular aqueduct may be responsible for sensorineural hearing loss in some patients. Patients with microtia may also have severe inner ear abnormalities despite the fact that the outer and inner ears develop embryologically from completely separate systems

  20. Weight Loss Nutritional Supplements

    Eckerson, Joan M.

    Obesity has reached what may be considered epidemic proportions in the United States, not only for adults but for children. Because of the medical implications and health care costs associated with obesity, as well as the negative social and psychological impacts, many individuals turn to nonprescription nutritional weight loss supplements hoping for a quick fix, and the weight loss industry has responded by offering a variety of products that generates billions of dollars each year in sales. Most nutritional weight loss supplements are purported to work by increasing energy expenditure, modulating carbohydrate or fat metabolism, increasing satiety, inducing diuresis, or blocking fat absorption. To review the literally hundreds of nutritional weight loss supplements available on the market today is well beyond the scope of this chapter. Therefore, several of the most commonly used supplements were selected for critical review, and practical recommendations are provided based on the findings of well controlled, randomized clinical trials that examined their efficacy. In most cases, the nutritional supplements reviewed either elicited no meaningful effect or resulted in changes in body weight and composition that are similar to what occurs through a restricted diet and exercise program. Although there is some evidence to suggest that herbal forms of ephedrine, such as ma huang, combined with caffeine or caffeine and aspirin (i.e., ECA stack) is effective for inducing moderate weight loss in overweight adults, because of the recent ban on ephedra manufacturers must now use ephedra-free ingredients, such as bitter orange, which do not appear to be as effective. The dietary fiber, glucomannan, also appears to hold some promise as a possible treatment for weight loss, but other related forms of dietary fiber, including guar gum and psyllium, are ineffective.

  1. The peculiarities of ac magnetic susceptibility in thin superconducting films with a high critical current

    The peculiarities of ac magnetic susceptibility, arising in thin superconductive films with a high critical current were investigated for the first time. Such peculiarities were found in magnetic field and temperature dependencies of susceptibility of some YBa2Cu3O7-δ films. They manifest themselves as a Z-like step in the real component dependencies, χ'm(H) or χ'm(T), and a V-like depression in the imaginary curves, χ''m(H) or χ''m(T), where subscript m corresponds to the measurements at the maximum of the Cole-Cole diagram χ''(χ') ('loss maximum'). Out of the loss maximum the effect is observed as well, and its magnitude depends on vortices repenetration depth. It was supposed that the effect appeared owing to the magnetic field dependence of critical current and flux creep. We provided the approximate calculations of ac magnetic susceptibility using the modified Clem-Sanchez formulae to which the dependence of critical current density from applied magnetic field, jc(H), had been included. The calculations based on the real jc(H) in the investigated films and with the simplest account of flux creep provided the dependences χ'm(H) and χ''m(H) that are qualitatively similar to the experimental ones including those with Z- and V-like peculiarities at high critical current. It is shown that for these samples the Clem-Sanchez relations between critical current density on the one hand, and magnetic susceptibility components and the ac field amplitude at the loss maximum on the other hand, are violated.

  2. Dicty_cDB: FCL-AC03 [Dicty_cDB

    Full Text Available FCL (Link to library) FCL-AC03 (Link to dictyBase) - - - Contig-U16477-1 FCL-AC03P ...(Link to Original site) FCL-AC03F 538 FCL-AC03Z 570 FCL-AC03P 1108 - - Show FCL-AC03 Library FCL (Link to library) Clone ID FCL-...7-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-AC03Q....Seq.d/ Representative seq. ID FCL-AC03P (Link to Original site) Representative DNA sequence >FCL-AC03 (FCL-AC03Q) /CSM/FCL/FCL-...AC/FCL-AC03Q.Seq.d/ AATTTTTAAAAAAAAAAGAAAATAAAAAAAAAAATAATATTTTATTAGTCATTATAAAAT TGTGAAT

  3. Dicty_cDB: FCL-AC20 [Dicty_cDB

    Full Text Available FCL (Link to library) FCL-AC20 (Link to dictyBase) - - - Contig-U15117-1 FCL-AC20Z ...(Link to Original site) - - FCL-AC20Z 600 - - - - Show FCL-AC20 Library FCL (Link to library) Clone ID FCL-A... http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-AC20Q.Seq.d/ Representative seq. ID FCL-...AC20Z (Link to Original site) Representative DNA sequence >FCL-AC20 (FCL-AC20Q) /CSM/FCL/FCL-AC/FCL-...Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FCL-AC20 (FCL-AC20Q) /CSM/FCL/FCL-AC/FCL-

  4. Levantamiento del campo acústico de una fuente sonora subacuática en el tanque hidroacústico del Instituto de Acústica

    Ranz Guerra, Carlos; Cobo, Pedro

    2000-01-01

    6 pp.-- PACS nrs.: 43.30.Jx, 43.30.Sf.-- Comunicación presentada en los siguientes congresos: Acústica 2000, II Congreso Iberoamericano de Acústica. XXXI Congreso Nacional de Acústica: TecniAcústica 2000. II Congreso Ibérico de Acústica. II Jornadas Iberoamericanas de Acústica. EAA Symposium on Architectural Acoustics.

  5. ac susceptibility study of a magnetite magnetic fluid

    Ayala-Valenzuela, O. E.; Matutes-Aquino, J. A.; Galindo, J. T. Elizalde; Botez, C. E.

    2009-04-01

    Magnetite nanometric powder was synthesized from metal salts using a coprecipitation technique. The powders were used to produce magnetic fluid via a peptization method, with hydrocarbon Isopar M as liquid carrier and oleic acid as surfactant. The complex magnetic susceptibility χ =χ'+iχ″ was measured as a function of temperature T in steps of 2.5 K from 3 to 298 K for frequencies ranging from f =10 to 10 000 Hz. The magnetic fluid real and imaginary components of the ac susceptibility show a prominent maximum at temperatures that increase with the measuring frequency, which is attributed to a spin-glass-like behavior. The peak temperature Tp1 of χ″ depends on f following the Vogel-Fulcher law f =f0 exp[E /kB(Tp1-T0)], where f0 and E are positive constants and T0 is a parameter related to particle interactions. There is another kind of peak temperature, Tp2, in the loss factor tan δ =χ″/χ' which is related to a magnetic aftereffect. The peak temperature Tp2 is far less than Tp1 and shows an Arrhenius-type dependence on f.

  6. DC injection into low voltage AC networks

    NONE

    2005-07-01

    This report summarises the results of a study investigating the impact of levels of injected DC current injections on a low voltage AC distribution network systems in order to recommend acceptable limits of DC from microgeneration. Relevant literature is reviewed, and the impact of DC levels in distribution transformers, transformer modelling, and instrumental transformers are discussed. The impact of DC in residual current devices (RCD) and in domestic electricity watt hour meters is examined along with DC enhanced corrosion, corrosion failure, and the measurement of DC current injection. Sources of DC injection outlined include DC from computer power supplies, network faults, geomagnetic phenomena, lighting circuits/dimmers, and embedded generators.

  7. Mapa acústico parcial de Benetusser

    MORILLA CASTELLANOS, EMILIO

    2012-01-01

    Se establece el mapa de ruido del municipio de Benetússer para evaluar y conocer su exposición al ruido ambiental y así poder dar cumplimiento a la Directiva Europea sobre Gestión y Evaluación de Ruido Ambiental (2002/49/CE) y a la Ley nacional 37/2003 del Ruido. Los mapas estratégicos de ruido nos aportan la información fundamental para diagnosticar la situación acústica y para la gestión del ruido ambiental.

  8. An ac biased superconducting flux transformer

    The coupled motion of the vortex lattice of two electrically insulated, superimposed, superconducting thin films (primary and secondary) in a perpendicular magnetic field, is predicted to exhibit a Josephson-like behavior. For a dc applied current flowing in the primary film, the voltage difference between the time-averaged primary and secondary flux flow voltages obeys the equations of a resistively shunted junction model. If an ac current is superimposed on the dc current. Shapiro-type steps are predicted in the current-voltage characteristic. In contrast to the conventional Josephson effect, the voltage positions of these steps can be tuned by the applied magnetic field. (orig.)

  9. Flexible AC transmission systems modelling and control

    Zhang, Xiao-Ping; Pal, Bikash

    2012-01-01

    The extended and revised second edition of this successful monograph presents advanced modeling, analysis and control techniques of Flexible AC Transmission Systems (FACTS). The book covers comprehensively a range of power-system control problems: from steady-state voltage and power flow control, to voltage and reactive power control, to voltage stability control, to small signal stability control using FACTS controllers. In the six years since the first edition of the book has been published research on the FACTS has continued to flourish while renewable energy has developed into a mature and

  10. Compensation methods applied in current control schemes for large AC drive systems

    Rus, D. C.; Preda, N. S.; Teodorescu, Remus; Imecs, M.

    The paper deals with modified PI current control structures for large AC drive systems which use surface mounted permanent magnet synchronous machines or squirrel-cage induction motors supplied with voltage source inverters. In order to reduce the power losses caused by high frequency switching of...... the semiconductor devices, various compensation methods are used and a modified structure for a PI current controller is proposed, to reduce the switching frequency of the inverter for the same operating frequency of the drive. Simulation, experimental development and test results are presented in...

  11. Similar genetic basis of resistance to Bt toxin Cry1Ac in Boll-selected and diet-selected strains of pink bollworm.

    Jeffrey A Fabrick

    Full Text Available Genetically engineered cotton and corn plants producing insecticidal Bacillus thuringiensis (Bt toxins kill some key insect pests. Yet, evolution of resistance by pests threatens long-term insect control by these transgenic Bt crops. We compared the genetic basis of resistance to Bt toxin Cry1Ac in two independently derived, laboratory-selected strains of a major cotton pest, the pink bollworm (Pectinophora gossypiella [Saunders]. The Arizona pooled resistant strain (AZP-R was started with pink bollworm from 10 field populations and selected with Cry1Ac in diet. The Bt4R resistant strain was started with a long-term susceptible laboratory strain and selected first with Bt cotton bolls and later with Cry1Ac in diet. Previous work showed that AZP-R had three recessive mutations (r1, r2, and r3 in the pink bollworm cadherin gene (PgCad1 linked with resistance to Cry1Ac and Bt cotton producing Cry1Ac. Here we report that inheritance of resistance to a diagnostic concentration of Cry1Ac was recessive in Bt4R. In interstrain complementation tests for allelism, F(1 progeny from crosses between AZP-R and Bt4R were resistant to Cry1Ac, indicating a shared resistance locus in the two strains. Molecular analysis of the Bt4R cadherin gene identified a novel 15-bp deletion (r4 predicted to cause the loss of five amino acids upstream of the Cry1Ac-binding region of the cadherin protein. Four recessive mutations in PgCad1 are now implicated in resistance in five different strains, showing that mutations in cadherin are the primary mechanism of resistance to Cry1Ac in laboratory-selected strains of pink bollworm from Arizona.

  12. Telogen Effluvium Hair Loss

    ... for Authors Information for Reviewers Human & Animal Rights Job Postings Sections of the JAOCD JAOCD Archive Published Members Online Dermatology Journals Edit This Favorite Name: Category: Share: Yes No, Keep Private Telogen Effluvium Hair Loss Share | It is normal to lose up to ...

  13. OI Issues: Hearing Loss

    ... that focuses on hearing loss and hearing issues. Miracle Ear Children’s Foundation P.O. Box 59261 Minneapolis, MN 55459-0261 (800) 234-5422 www.miracle-ear.com Miracle Ear Children’s Foundation provides free ...

  14. Autism and Hearing Loss.

    Rosenhall, Ulf; Nordin, Viviann; Sandstrom, Mikael; Ahlsen, Gunilla; Gillberg, Christopher

    1999-01-01

    Children and adolescents (N=199) with autistic disorder were audiologically evaluated. Mild to moderate hearing loss was diagnosed in 7.9 percent, with deafness diagnosed in 3.5 percent of all cases, which represented a prevalence considerably above that in the general population and comparable to the prevalence found in populations with mental…

  15. Cascadia's Staggering Losses

    Wang, Y.; Vogt, B.

    2001-05-01

    Recent worldwide earthquakes have resulted in staggering losses. The Northridge, California; Kobe, Japan; Loma Prieta, California; Izmit, Turkey; Chi-Chi, Taiwan; and Bhuj, India earthquakes, which range from magnitudes 6.7 to 7.7, have all occurred near populated areas. These earthquakes have resulted in estimated losses between \\3 and \\300 billion, with tens to tens of thousands of fatalities. Subduction zones are capable of producing the largest earthquakes. The 1939 M7.8 Chilean, the 1960 M9.5 Chilean, the 1964 M9.2 Alaskan, the 1970 M7.8 Peruvian, the 1985 M7.9 Mexico City and the 2001 M7.7 Bhuj earthquakes are damaging subduction zone quakes. The Cascadia fault zone poses a tremendous hazard in the Pacific Northwest due to the ground shaking and tsunami inundation hazards combined with the population. To address the Cascadia subduction zone threat, the Oregon Department of Geology and Mineral Industries conducted a preliminary statewide loss study. The 1998 Oregon study incorporated a M8.5 quake, the influence of near surface soil effects and default building, social and economic data available in FEMA's HAZUS97 software. Direct financial losses are projected at over \\$12 billion. Casualties are estimated at about 13,000. Over 5,000 of the casualties are estimated to result in fatalities from hazards relating to tsunamis and unreinforced masonry buildings.

  16. Heat loss from Buildings

    Karlsson, Kenneth; Næraa, Rikke

    1997-01-01

    Determination of heat loss coefficients for buildings in Denmark. The coefficient are determined for 15 building groups and 3 year intervals. They are based on the BBR-registre and assumptions of U-values(W/K*m2)and computed in a simple spreed sheet model.The results are used in the REVEILLE...

  17. Independents' group posts loss

    Low oil gas prices and special charges caused the group of 50 U.S. independent producers Oil and Gas Journal tracks to post a combined loss in first half 1992. The group logged a net loss of $53 million in the first half compared with net earnings of $354 million in first half 1991, when higher oil prices during the Persian Gulf crisis buoyed earnings in spite of crude oil and natural gas production declines. The combined loss in the first half follows a 45% drop in the group's earnings in 1991 and compares with the OGJ group of integrated oil companies whose first half 1992 income fell 47% from the prior year. Special charges, generally related to asset writedowns, accounted for most of the almost $560 million in losses posted by about the third of the group. Nerco Oil and Gas Inc., Vancouver, Wash., alone accounted for almost half that total with charges related to an asset writedown of $238 million in the first quarter. Despite the poor first half performance, the outlook is bright for sharply improved group earnings in the second half, assuming reasonably healthy oil and gas prices and increased production resulting from acquisitions and in response to those prices

  18. Muscle function loss

    ... nerve injury, or brain damage ( stroke or other brain injury) The loss of muscle function after these types of events can be severe. Often it will not completely return, even with treatment. Paralysis can be temporary or permanent. It can affect ...

  19. Application of Multi-Objective Evolutionary Algorithm for Optimal Reactive Power Dispatch with Flexible AC Transmission System Devices

    Abdarrazak OUALI; Hsan HADJ ABDALLAH; Tawfik GUESMI; Ismail MAROUANI

    2011-01-01

    Because their capability to change the network parameters with a rapid response and enhanced flexibility, flexible AC transmission system (FACTS) devices have taken more attention in power systems operations as improvement of voltage profile and minimizing system losses. In this way, this paper presents a multi-objective evolutionary algorithm (MOEA) to solve optimal reactive power dispatch (ORPD) problem with FACTS devices. This nonlinear multi-objective problem (MOP) consists to minimize si...

  20. Refined localization of the Escherichia coli F4ab/F4ac receptor locus on pig chromosome 13

    Joller, D.; Jørgensen, Claus Bøttcher; Bertschinger, H.U.;

    2009-01-01

    Diarrhoea in newborn and weaned pigs caused by enterotoxigenic Escherichia coli (ETEC) expressing F4 fimbriae leads to considerable losses in pig production. In this study, we refined the mapping of the receptor locus for ETEC F4ab/F4ac adhesion (F4bcR) by joint analysis of Nordic and Swiss data...

  1. Estudio acústico del Conservatorio de Piles

    VILLA MORANT, SARA

    2014-01-01

    El objetivo de este proyecto es realizar un estudio acústico general de la "Casa de la Cultura" de Piles, sobre todo de los recintos que más lo requieren, como la sala principal de música. El edificio, al tratarse de una construcción antigua, no reúne las especificaciones acústicas establecidas en el Código Técnico vigente en la actualidad. En primer lugar, se realiza el estudio del acondicionamiento acústico de la sala principal, entendiéndose como acondicionamiento acústico la definición de...

  2. AC Own Motion Percentage of Randomly Sampled Cases

    Social Security Administration — Longitudinal report detailing the numbers and percentages of Appeals Council (AC) own motion review actions taken on un-appealed favorable hearing level decisions...

  3. AC electric motors control advanced design techniques and applications

    Giri, Fouad

    2013-01-01

    The complexity of AC motor control lies in the multivariable and nonlinear nature of AC machine dynamics. Recent advancements in control theory now make it possible to deal with long-standing problems in AC motors control. This text expertly draws on these developments to apply a wide range of model-based control designmethods to a variety of AC motors. Contributions from over thirty top researchers explain how modern control design methods can be used to achieve tight speed regulation, optimal energetic efficiency, and operation reliability and safety, by considering online state var

  4. Study of AC electrical conduction mechanisms in an epoxy polymer

    Jilani, Wissal; Mzabi, Nissaf; Gallot-Lavallée, Olivier; Fourati, Najla; Zerrouki, Chouki; Zerrouki, Rachida; Guermazi, Hajer

    2015-11-01

    The AC conductivity of an epoxy resin was investigated in the frequency range 10^{-1} - 106 Hz at temperatures ranging from -100 to 120 °C. The frequency dependence of σ_{ac} was described by the law: σ_{ac}=ω \\varepsilon0\\varepsilon^''_{HN}+Aωs. The study of temperature variation of the exponent (s) reveals two conduction models: the AC conduction dependence upon temperature is governed by the small polaron tunneling mechanism (SPTM) at low temperature (-100 -60 °C) and the correlated barrier hopping (CHB) model at high temperature (80-120 °C).

  5. Djungle power. A more remote AC bus

    Boehnke, Heinz W. [Technosol, Jork (Germany)

    2010-07-01

    The Dzanga-Sangha Reserve in the Central African Republic is probably one of the world's most remote protected rainforest areas, much to the benefit of the rare species of lowland gorilla, forest elephant and local pygmy population Ba'Aka. The park is co-managed by the ''WWF-World Wide Fund for Nature'' with sponsoring from the German Regenwald-Stiftung. In 2008 wwf decided to switch from the old, failing generator supply to a solar hybrid mini-grid, along with stringent measures of energy conservation and management. After a careful energy audit Technosol designed an AC-bus system with a 22 kWp PV generator which should overcome the dependency on the old generators and their fuel demands. For 15 buildings, an entirely new distribution network was installed, state of the art energy saving devices introduced and an energy metering system deviced. The installation is operating since August 2009. In such remote locations, the reliability of the AC-bus over other generator-based solutions will be demonstrated and with the support of international organisations like the wwf the practical application of solar hybrid supply becomes a landmark of sustainable energy concepts. (orig.)

  6. An improved AC-amplifier for electrophysiology

    Jorgovanović Nikola

    2009-01-01

    Full Text Available We present the design, simulation and test results of a new AC amplifier for electrophysiological measurements based on a three op-amp instrumentation amplifier (IA. The design target was to increase the common mode rejection ratio (CMRR, thereby improving the quality of the recorded physiological signals in a noisy environment. The new amplifier actively suppresses the DC component of the differential signal and actively reduces the common mode signal in the first stage of the IA. These functions increase the dynamic range of the amplifier's first stage of the differential signal. The next step was the realization of the amplifier in a single chip technology. The design and tests of the new AC amplifier with a differential gain of 79.2 dB, a CMRR of 130 dB at 50 Hz, a high-pass cutoff frequency at 0.01 Hz and common mode reduction in the first stage of the 49.8 dB are presented in this paper.

  7. Metal-to-insulator transition in thin-film polymeric AC60

    We present an electron spectroscopy study of phase-pure AC60 thin films (A= Rb, Cs) in their monomer (face-centred cubic (fcc)) and polymer phases. A surface electronic reconstruction is observed in polymeric RbC60, analogous to that reported for the fcc phase. As for pristine C60, the occupied electronic states of AC60 fullerides are not dramatically affected by polymerization. The energy separation between the leading feature in photoemission and inverse photoemission is similar in both stable AC60 phases. These observations suggest that electron correlation effects are similar in the two phases, and that their different electronic behaviour is mainly related to the reduction of degeneracy of the polymer frontier states. Photoemission and electron-energy loss spectroscopy data show that the thin-film form of the RbC60 polymer is metallic at room temperature, and that it undergoes a metal-insulator transition at around 100 K. This transition temperature is much higher than that reported for the corresponding bulk phase and signals a poorer screening of Coulomb interactions at the film surface.

  8. Dielectric parameters and a.c. conductivity of pure and doped poly (methyl methacrylate) films at microwave frequencies

    Anju Tanwar; K K Gupta; P J Singh; Y K Vijay

    2006-08-01

    Dielectric properties of pure and doped poly (methyl methacrylate) (PMMA) films at microwave frequency, 8.92 GHz, have been studied at 35°C. Iodine, benzoic acid and FeCl3 have been used as dopants. The losses in doped films are found to be larger than in pure PMMA films. The increased losses account for increased a.c. conductivity in doped films. The increase in conductivity is accounted due to creation of additional hopping sites for the charge carriers in doped samples. The dielectric data has also been used to evaluate optical constants, absorption index () and refractive index () of the films.

  9. Dielectric behaviour and a.c. conductivity in CuFe3–O4 ferrite

    A N Patil; M G Patil; K K Patankar; V L Mathe; R P Mahajan; S A Patil

    2000-10-01

    The dielectric properties (dielectric constant and loss) for the system CuFe3–O4 with = 1.0, 0.8, 0.6, 0.4 and 0.2, were studied in the temperature range 300 ∼ 800 K and also in the frequency range 1 kHz ∼ 1 MHz. A.c. conductivity was derived from dielectric constant and loss tangent data. The conduction in this system is interpreted as due to small polaron hopping. The dielectric relaxation was observed for the compositions with tetragonal structure whereas normal behaviour was observed for cubic structure.

  10. AC impedance electrochemical modeling of lithium-ion positive electrodes

    Under Department of Energy's Advanced Technology Development Program,various analytical diagnostic studies are being carried out to examine the lithium-ion battery technology for hybrid electric vehicle applications, and a series of electrochemical studies are being conducted to examine the performance of these batteries. An electrochemical model was developed to associate changes that were observed in the post-test analytical diagnostic studies with the electrochemical performance loss during testing of lithium ion batteries. While both electrodes in the lithium-ion cell have been studied using a similar electrochemical model, the discussion here is limited to modeling of the positive electrode. The positive electrode under study has a composite structure made of a layered nickel oxide (LiNi0.8Co0.15Al0.05O2) active material, a carbon black and graphite additive for distributing current, and a PVDF binder all on an aluminum current collector. The electrolyte is 1.2M LiPF6 dissolved in a mixture of EC and EMC and a Celgard micro-porous membrane is used as the separator. Planar test cells (positive/separator/negative) were constructed with a special fixture and two separator membranes that allowed the placement of a micro-reference electrode between the separator membranes (1). Electrochemical studies including AC impedance spectroscopy were then conducted on the individual electrodes to examine the performance and ageing effects in the cell. The model was developed by following the work of Professor Newman at Berkeley (2). The solid electrolyte interface (SEI) region, based on post-test analytical results, was assumed to be a film on the oxide and an oxide layer at the surface of the oxide. A double layer capacity was added in parallel with the Butler-Volmer kinetic expression. The pertinent reaction, thermodynamic, and transport equations were linearized for a small sinusoidal perturbation (3). The resulting system of differential equations was solved numerically

  11. Identification of some additional loss components in high-power low-voltage permanent magnet generators

    Hamalainen, H.

    2013-11-01

    done by dividing the conductor into transposed subconductors. However, this comes with the expense of an increase in the DC resistance. In the doctoral thesis, a new method is presented to minimize the winding losses by applying a litz wire with noninsulated strands. The construction is the same as in a normal litz wire but the insulation between the subconductors has been left out. The idea is that the connection is kept weak to prevent harmful eddy currents from flowing. Moreover, the analytical solution for calculating the AC resistance factor of the litz-wire is supplemented by including an end-winding resistance in the analytical solution. A simple measurement device is developed to measure the AC resistance in the windings. In the case of a litz-wire with originally noninsulated strands, vacuum pressure impregnation (VPI) is used to insulate the subconductors. In one of the two cases studied, the VPI affected the AC resistance factor, but in the other case, it did not have any effect. However, more research is needed to determine the effect of the VPI on litz-wire with noninsulated strands. An empirical model is developed to calculate the AC resistance factor of a single-layer formwound winding. The model includes the end-winding length and the number of strands and turns. The end winding includes the circulating current (eddy currents that are traveling through the whole winding between parallel strands) and the main current. The end-winding length also affects the total AC resistance factor. (orig.)

  12. Dicty_cDB: FCL-AC29 [Dicty_cDB

    Full Text Available FCL (Link to library) FCL-AC29 (Link to dictyBase) - - - Contig-U15392-1 FCL-AC29P ...(Link to Original site) FCL-AC29F 104 FCL-AC29Z 591 FCL-AC29P 695 - - Show FCL-AC29 Library FCL (Link to library) Clone ID FCL-...-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-AC29Q....Seq.d/ Representative seq. ID FCL-AC29P (Link to Original site) Representative DNA sequence >FCL-AC29 (FCL-AC29Q) /CSM/FCL/FCL-...roducing significant alignments: (bits) Value VSC293 (VSC293Q) /CSM/VS/VSC2-D/VSC293Q.Seq.d/ 1063 0.0 FCL-AC29 (FCL-

  13. A Non-linear Controller for Single-Phase AC-AC Power Converter to meet UPS Performance Index

    Abdelhafid Ait Elmahjoub

    2012-07-01

    Full Text Available This article focuses on AC-AC power converter that can be used for uninterruptible power supply (UPS. The converter is built on two stages: a AC-DC input stage and a DC-AC output stage. The two blocks are connected by an intermediate DC bus. The aim of control is threefold: i power factor correction ii regulation of DC bus iii generating a sinusoidal voltage at the output. The synthesis of controllers has been achieved through the technique of nonlinear backstepping control. A detailed analysis of the stability control system is presented. The performances of regulators have been validated by numerical simulation in MATLAB / SIMULINK.

  14. Leakage current and commutation losses reduction in electric drives for Hybrid Electric Vehicle

    Miliani, El Hadj

    2014-06-01

    Nowadays, leakage current and inverter losses, produced by adjustable-speed AC drive systems become one of the main interested subject for researchers on Electric Vehicle (EV) and Hybrid Electric Vehicle (HEV) technology. The continuous advancements in solid state device engineering have considerably minimized the switching transients for power switches but the high dv/dt and high switching frequency have caused many adverse effects such as shaft voltage, bearing current, leakage current and electromagnetic interference (EMI). The major objective of this paper is to investigate and suppress of the adverse effects of a PWM inverter feeding AC motor in EV and HEV. A technique to simultaneously reduce the leakage current and the switching losses is presented in this paper. Based on a discontinuous space vector pulse width modulation (DSVPWM) and a modular switches gate resistance, inverter losses and leakage current are reduced. Algorithms are presented and implemented on a DSP controller and experimental results are presented.

  15. An MHD Rotating Machine: A New Type of a.c. Magnetohydrodynamic Power Generator and Turbine

    A new type of MHD machine is proposed in this paper. The conceptual structure of the machine is very similar to that of the conventional three-phase rotating synchronous machine, which consists of the rotor, for exciting the mechanically rotating d. c. magnetic field, and the stator with conventional three-phase a.c. windings. The only difference in concept is the existence of the MHD working fluid flowing in the duct space between the rotor- and the stator in the direction of rotation of the rotor. The paper presents the results of the preliminary theoretical analysis of the machine. It is shown that the machine may be operated as an a.c. MHD electrical power generator or as an electrically- controlled MHD turbine or as the combination of those. As an a.c. generator, the machine may be regarded as the combination of the synchronous and asynchronous generator, and can be operated under such conditions that the rotor is in the self-rotating condition at the synchronous speed, or in other words, that no external drive is required for the rotor. Thus all the energy of the MHD working fluid, except the Joule loss in the fluid itself, is converted into the a.c. electrical power. On the other hand, as an MHD turbine, the d.c. magnetic field of the rotor plays the role of the turbine blades, and in this case a small a.c. current in the stator windings can control the mechanical power output transferred from the working fluid to the turbine rotor. The very interesting results as an a.c. electrical power generator from the practical viewpoint are that (1) under the self- rotating condition the lagging power- factor operation (0.8∼1.0) is possible, cf. the MHD induction generator, and (2) the machine is practically feasible not only by using a liquid metal working fluid together with a relatively low d.c. exciting magnetic field, but also by using the gaseous plasma with a very high d.c. magnetic field excitation. (author)

  16. Loss of Heterozygosity

    sprotocols

    2014-01-01

    Author: Molecular Profiling Initiative, NCI *This method was successful in our lab using prostate tissue and for our specific objectives. Investigators must be aware that they will need to tailor the following protocol for their own research objectives and tissue under study*. This method is used to detect genomic DNA deletions in tumor cells. For a more detailed discussion of applying this approach to microdissected samples, see [Allelic Loss Studies](http://cgap-mf.nih.gov/ProstateE...

  17. Valuing Catastrophic Citrus Losses

    Adams, Damian C.; Kilmer, Richard L.; Moss, Charles B.; Schmitz, Andrew

    2004-01-01

    Courts are often required to estimate changes in welfare to agricultural operations from catastrophic events. For example, courts must assign damages in lawsuits, such as with pesticide drift cases, or determine "just compensation" when the government takes private land for public use, as with the removal of dairy farms from environmentally sensitive land or destruction of canker-contaminated citrus trees. In economics, the traditional method of quantifying producer losses is estimating chang...

  18. Decisions under unpredictable losses

    Ali Ahmed

    2007-10-01

    Full Text Available An experimental test of the descriptive adequacy of the extit{restated diversification principle} is presented. The principle postulates that risk-averse utility maximizers will pool risks for their mutual benefit, even if information is missing about the probabilities of losses. It is enough for people to assume that they face equal risks when they pool risks. The results of the experiment support the principle.

  19. Muscle Loss in Elderly

    Nikolić, Marina; Šoić Vranić, Tamara; Arbanas, Juraj; Cvijanović, Olga; Bajek, Snježana

    2010-01-01

    Aging is associated with loss of skeletal muscle mass, strength and endurance. The aim of this study was to determinate age related changes in human muscles with different function and location in the body (vastus lateralis muscle and intercostal internus muscle). Our results suggest that age related muscle atrophy affect both human skeletal muscles. Also, the results showed the increase in percentage of muscle fibers with high oxidative activity during aging.

  20. ADT fast losses MD

    Priebe, A; Dehning, B; Redaelli, S; Salvachua Ferrando, BM; Sapinski, M; Solfaroli Camillocci, M; Valuch, D

    2013-01-01

    The fast beam losses in the order of 1 ms are expected to be a potential major luminosity limitation for higher beam energies after the LHC long shutdown (LS1). Therefore a Quench Test is planned in the winter 2013 to estimate the quench limit in this timescale and revise the current models. This experiment was devoted to determination the LHC Transverse Damper (ADT) as a system for fast losses induction. A non-standard operation of the ADT was used to develop the beam oscillation instead of suppressing them. The sign flip method had allowed us to create the fast losses within several LHC turns at 450 GeV during the previous test (26th March 2012). Thus, the ADT could be potentially used for the studies of the UFO ("Unidentied Falling Object") impact on the cold magnets. Verification of the system capability and investigations of the disturbed beam properties were the main objectives of this MD. During the experiment, the pilot bunches of proton beam were excited independently in the horizontal and vertical ...

  1. Adapting AC Lines to DC Grids for Large-Scale Renewable Power Transmission

    D. Marene Larruskain

    2014-10-01

    Full Text Available All over the world, governments of different countries are nowadays promoting the use of clean energies in order to achieve sustainable energy systems. In this scenario, since the installed capacity is continuously increasing, renewable sources can play an important role. Notwithstanding that, some important problems may appear when connecting these sources to the grid, being the overload of distribution lines one of the most relevant. In fact, renewable generation is usually connected to the nearest AC grid, although this HV system may not have been designed considering distributed generation. In the particular case of large wind farms, the electrical grid has to transmit all the power generated by wind energy and, as a consequence, the AC system may get overloaded. It is therefore necessary to determine the impact of wind power transmission so that appropriate measures can be taken. Not only are these measures influenced by the amount of power transmitted, but also by the quality of the transmitted power, due to the output voltage fluctuation caused by the highly variable nature of wind. When designing a power grid, although AC systems are usually the most economical solution because of its highly proven technology, HVDC may arise in some cases (e.g. offshore wind farms as an interesting alternative, offering some added values such as lower losses and better controllability. This way, HVDC technology can solve most of the aforementioned problems and has a good potential for future use. Additionally, the fast development of power electronics based on new and powerful semiconductor devices allow the spread of innovative technologies, such as VSC-HVDC, which can be applied to create DC grids. This paper focuses on the main aspects involved in adapting the existing overhead AC lines to DC grids, with the objective of improving the transmission of distributed renewable energy to the centers of consumption.

  2. ACLY and ACC1 Regulate Hypoxia-Induced Apoptosis by Modulating ETV4 via α-ketoglutarate.

    Melissa M Keenan

    2015-10-01

    Full Text Available In order to propagate a solid tumor, cancer cells must adapt to and survive under various tumor microenvironment (TME stresses, such as hypoxia or lactic acidosis. To systematically identify genes that modulate cancer cell survival under stresses, we performed genome-wide shRNA screens under hypoxia or lactic acidosis. We discovered that genetic depletion of acetyl-CoA carboxylase (ACACA or ACC1 or ATP citrate lyase (ACLY protected cancer cells from hypoxia-induced apoptosis. Additionally, the loss of ACLY or ACC1 reduced levels and activities of the oncogenic transcription factor ETV4. Silencing ETV4 also protected cells from hypoxia-induced apoptosis and led to remarkably similar transcriptional responses as with silenced ACLY or ACC1, including an anti-apoptotic program. Metabolomic analysis found that while α-ketoglutarate levels decrease under hypoxia in control cells, α-ketoglutarate is paradoxically increased under hypoxia when ACC1 or ACLY are depleted. Supplementation with α-ketoglutarate rescued the hypoxia-induced apoptosis and recapitulated the decreased expression and activity of ETV4, likely via an epigenetic mechanism. Therefore, ACC1 and ACLY regulate the levels of ETV4 under hypoxia via increased α-ketoglutarate. These results reveal that the ACC1/ACLY-α-ketoglutarate-ETV4 axis is a novel means by which metabolic states regulate transcriptional output for life vs. death decisions under hypoxia. Since many lipogenic inhibitors are under investigation as cancer therapeutics, our findings suggest that the use of these inhibitors will need to be carefully considered with respect to oncogenic drivers, tumor hypoxia, progression and dormancy. More broadly, our screen provides a framework for studying additional tumor cell stress-adaption mechanisms in the future.

  3. Measuring the loss tangent of polymer materials with atomic force microscopy based methods

    Atomic force microscopy (AFM) quantitatively maps viscoelastic parameters of polymers on the nanoscale by several methods. The loss tangent, the ratio between dissipated and stored energy, was measured on a blend of thermoplastic polymer materials by a dynamic contact method, contact resonance, and by a recently developed loss tangent measurement by amplitude modulation AFM. Contact resonance measurements were performed both with dual AC resonance tracking and band excitation (BE), allowing for a reference-free measurement of the loss tangent. Amplitude modulation AFM was performed where a recent interpretation of the phase signal under certain operating conditions allows for the loss tangent to be calculated. The loss tangent measurements were compared with values expected from time–temperature superposed frequency-dependent dynamical mechanical curves of materials and reveal that the loss tangents determined from the BE contact resonance method provide the most accurate values. (paper)

  4. Correlation of coupling losses and time constants in superconducting Bi-2223 tapes

    Ac-loss and coupling current time constant measurements were performed with a large variety of Bi-2223 tape conductors at 4.2 and at 77 K. Single tapes in a perpendicular field as well as stacks of tapes in perpendicular and parallel fields were investigated. The frequency dependence of the coupling loss curve has a maximum which is set in correlation to the separately measured time constant. The theoretical treatment of the time constant and loss measurements using a slab model shows a very good agreement between the position of loss maxima and measured time constants. Eddy currents in the silver matrix, which are described by a second smaller time constant, contribute substantially to the losses in the higher frequency range and may lead to the appearance of a second maximum in the loss curve

  5. Emergency ac power systems operating experience at US nuclear power plants, 1976 through 1983

    Success and failure data of test and emergency starts of emergency ac power sources (diesel generators) at US nuclear power plants were collected and evaluated to estimate diesel generator reliability parameters. A regression analysis of the estimates of the probability of failure to start based on surveillance test data from 1976 through 1983 indicates that the probability of failure to start has been decreasing. However, the reliability of diesel generator performance during losses of off-site power for 1981 through 1983 was less than expected based on the test data estimates. The failures that occurred during losses of off-site power were reviewed to determine why the calculated failure to start was greater than expected, and possible explanations for this high value are presented. The subsystems involved in diesel generator subsystem failures were categorized to determine whether there were any dominant failure modes. The results indicate that further significant improvement in diesel generator reliability will require improvement of many subsystems

  6. The AC conduction in Ag - Al2O3 cermet sandwich structures

    We have prepared cermet thin ms of Ag - Al2O3 sandwiched between Al electrodes by evaporation of the elements onto glass substrates in vacuo of 10-6 torr. Conductance and loss factor were obtained in evaporated Al/Ag - Al2O3/Al sandwich structures for m thickness ∼ 100 to 200nm containing 5 to 20 wt % Ag in the Al2O3 matrix at room temperature. The ac conductivity of Ag-Al2O3 cermet thin ms can be presented by the form AωS. The losses are discussed on the basis of concept of Goswami and Goswami model and are found to be in conformity with this model. (author)

  7. Cooperative Frequency Control for Autonomous AC Microgrids

    Shafiee, Qobad; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.; Nasirian, Vahidreza; Davoudi, Ali

    2015-01-01

    Distributed secondary control strategies have been recently studied for frequency regulation in droop-based AC Microgrids. Unlike centralized secondary control, the distributed one might fail to provide frequency synchronization and proportional active power sharing simultaneously, due to having...... different control parameters. This paper introduces a cooperative algorithm that regulates the system frequency while maintaining the power sharing properties of droop control. Dynamic consensus protocol is used to estimate the average of normalized active powers in the entire MG. This estimation is then...... added to primary control, compensating the frequency drop caused by the droop mechanism. The proposed controller is fully distributed, meaning that each source exchange information with only its direct neighbors through a sparse communication network. This controller has a unique feature that it does...

  8. Mapa Acústico del Gran Madrid

    Santiago Páez, José Salvador; Perera, P

    2006-01-01

    El desarrollo urbanístico de Madrid desde los años 1980 a finales de la década de los 90 hizo que su Ayuntamiento, que ya había promovido la realización entre 1985 y 1991 de un Mapa Acústico parcial de la ciudad, pensase en extender el ámbito de éste a todo el término municipal. Siguiendo el mismo criterio anterior, se superpuso una cuadrícula sobre el plano de Madrid, y se llevaron a cabo registros sonoros de 5 minutos en cada vértice de la misma, en los puntos de medición fuera del área ant...

  9. Josephson arrays for dc and ac metrology

    Large series arrays of underdamped SIS tunnel junctions are the basic element of the primary dc voltage standards used at present. The development of versatile quantum voltmeters for dc and ac metrology requires the preparation of large and perfect series arrays of overdamped Josephson junctions. Overdamped junctions can be realized by externally shunted SIS junctions or by internally shunted SNS or SINIS junctions. Arrays of up to 8000 SINIS junctions or 30000 SNS junctions were successfully operated at the 1 V dc level. In addition to being used in large arrays for voltage metrology and oscillators, the described junction types may become very useful for the preparation of highly integrated single-flux-quantum digital devices. (author)

  10. An ac bridge readout for bolometric detectors

    Rieke, F. M.; Lange, A. E.; Beeman, J. W.; Haller, E. E.

    1989-01-01

    The authors have developed a bolometer readout circuit which greatly improves the low-frequency stability of bolometric detectors. The circuit uses an ac bias voltage and two matched bolometers and allows stable dc bolometer operation for integration times greater than 10 s. In astronomical applications the readout allows for qualitatively different observation modes (e.g. staring or slow-drift scanning) which are particularly well suited for space observations and for the use of arrays. In many applications the readout can increase sensitivity. The authors present noise spectra for 4He temperature bolometers with no excess noise at frequencies greater than 0.1 Hz. The measured optical responsivity of a bolometer operated with the present readout is the same as that of a bolometer operated with a conventional readout.

  11. Composite Based EHV AC Overhead Transmission Lines

    Sørensen, Thomas Kjærsgaard

    Overhead lines at transmission level are the backbone of any national power grid today. New overhead line projects however are at the same time subject to ever greater public resistance due to the lines environmental impact. As full undergrounding of transmission lines at extra high voltage (EHV......) levels are still not seen as possibility, the future expansion of transmission grids are dependent on new solutions with lessened environment impact, especially with regard to the visual impact. In the present Thesis, composite materials and composite based overhead line components are presented and...... analysed with regard to the possibilities, limitations and risks widespread application of composite materials on EHV AC overhead transmission lines may present. To form the basis for evaluation of the useability of composite materials, dierent overhead line projects aimed at reducing the environmental...

  12. Effective ac response in weakly nonlinear composites

    Wei Enbo [Institute of Oceanology, Chinese Academy of Sciences, Qingdao 266071 (China); Yang Zidong [College of Power Engineering, University of Shanghai Science and Technology, Shanghai 200093 (China); Gu Guoqing [Information College of Science and Technology, East China Normal University, Shanghai 200062 (China)

    2004-01-07

    The perturbation method is developed to deal with the problem of determining the effective nonlinear conductivity of Kerr-like nonlinear media under an external ac electric field. As an example, we have considered the cylindrical inclusion embedded in a host under the sinusoidal external field E{sub 1} sin (<{omega}t) + E{sub 3} sin (3<{omega}t) with frequencies{omega} and 3{omega}. The potentials of composites at higher harmonics are derived in both local inclusion particle and host regions. The effective responses of bulk nonlinear composites at basic frequency and harmonics are given for cylindrical composites in the dilute limit. Moreover, the relationships between the nonlinear effective responses at the basic frequency and the third harmonics are derived.

  13. Modeling of long High Voltage AC Underground

    Gudmundsdottir, Unnur Stella; Bak, Claus Leth; Wiechowski, W. T.

    2010-01-01

    This paper presents the work and findings of a PhD project focused on accurate high frequency modelling of long High Voltage AC Underground cables. The project is cooperation between Aalborg University and Energinet.dk. The objective of the project is to investigate the accuracy of most up to date...... cable models, perform highly accurate field measurements for validating the model and identifying possible disadvantages of the cable model. Furthermore the project suggests and implements improvements and validates them against several field measurements. It is shown in this paper how a new method for...... calculating the frequency dependent cables impedance greatly improves the modeling procedure and gives a highly accurate result for high frequency simulations....

  14. Nonlinear ac conductivity of interacting 1d electron systems

    Rosenow, Bernd; Nattermann, Thomas

    2004-01-01

    We consider low energy charge transport in one-dimensional (1d) electron systems with short range interactions under the influence of a random potential. Combining RG and instanton methods, we calculate the nonlinear ac conductivity and discuss the crossover between the nonanalytic field dependence of the electric current at zero frequency and the linear ac conductivity at small electric fields and finite frequency.

  15. Flexible AC transmission systems: the state of the art

    Edris, Abdel-Aty [Electric Power Research Inst., Palo Alto, CA (United States). Electric Systems Division

    1994-12-31

    Flexible AC transmission systems (FACTS) is a concept promoting the use of power electronic controllers to enhance the controllability and usable capacity of AC transmission. This paper presents the state of the art of FACTS and the status of the current projects for the application of the FACTS controllers in transmission systems. (author) 8 refs., 8 figs.

  16. 78 FR 39345 - ACS Wireless, Inc.; Notice of Application

    2013-07-01

    ... will transfer to AWN all remaining tangible and intangible assets owned, leased or held by ACS Wireless.... \\6\\ ACS Group will cause certain of its other subsidiaries to transfer wireless spectrum licenses and...'' as the power to exercise a controlling influence over the management or policies of a company,...

  17. Operation of AC Adapters Visualized Using Light-Emitting Diodes

    Regester, Jeffrey

    2016-01-01

    A bridge rectifier is a diamond-shaped configuration of diodes that serves to convert alternating current(AC) into direct current (DC). In our world of AC outlets and DC electronics, they are ubiquitous. Of course, most bridge rectifiers are built with regular diodes, not the light-emitting variety, because LEDs have a number of disadvantages. For…

  18. Search for β-delayed fission of 228Ac

    Radium was radiochemically separated from natural thorium. Thin 228Ra→β-228Ac sources were prepared and exposed to mica fission track detectors, and measured by an HPGe γ-ray detector. The β-delayed fission events of 228Ac were observed and its β-delayed fission probability was found to be (5±2)x10-12

  19. Adalimumab Treatment in Biologically Naïve Crohn’s Disease: Relationship with Ectopic MUC5AC Expression and Endoscopic Improvement

    Tsutomu Mizoshita

    2014-01-01

    Full Text Available Background. Adalimumab (ADA is effective for patients with Crohn’s disease (CD. However, there have been few reports on ADA therapy with respect to its relationship with pathologic findings and drug efficacy in biologically naïve CD cases. Methods. Fifteen patients with active biologically naïve CD were treated with ADA. We examined them clinically and pathologically with ectopic MUC5AC expression in the lesions before and after 12 and 52 weeks of ADA therapy, retrospectively. Results. Both mean CD activity index scores and serum C-reactive protein values were significantly lower after ADA therapy (P<0.001. In the MUC5AC negative group, all cases exhibited clinical remission (CR and endoscopic improvement at 52 weeks. In MUC5AC positive groups, loss of MUC5AC expression was detected in cases having CR and endoscopic improvement at 52 weeks, while remnant ectopic MUC5AC expression was observed in those exhibiting no endoscopic improvement and flare up after 52 weeks. Conclusions. ADA leads to CR and endoscopic improvement in biologically naïve CD cases. In addition, ectopic MUC5AC expression may be a predictive marker of flare up and endoscopic improvement in the intestines of CD patients.

  20. Improved Design Methods for Robust Single- and Three-Phase ac-dc-ac Power Converters

    Qin, Zian

    proposed new active power decoupling method, the ripple power in the converter can be compensated in a more efficient and more compact way. Then, Chapter 5 changes the scope of the thesis to three-phase converters, and the nine-switch converter, as a reduced switch version of two three-phase full......-bridges connected back-to-back, is studied. Application criteria of the nine-switch converter are investigated for reducing the relatively high stress introduced by the less number of switches. In Chapter 6 a rotating speed controller design method is proposed for improving the thermal loading of the three...... to users. Their performances including cost, efficiency, reliability, and so on, therefore are more important concerns than they were. The objective of this thesis is to study and propose advanced design methods for robust ac-dc-ac converters, which are widely used interfaces in energy conversion...

  1. 40 CFR 86.162-00 - Approval of alternative air conditioning test simulations and descriptions of AC1 and AC2.

    2010-07-01

    ... Procedures § 86.162-00 Approval of alternative air conditioning test simulations and descriptions of AC1 and AC2. The alternative air conditioning test procedures AC1 and AC2 are approved by the Administrator... requirements of paragraph (a) of this section and meet the requirements of § 86.163-00. Air conditioning...

  2. Determination for β-delayed fission probability of 230Ac

    袁双贵; 杨维凡; 徐岩冰; 肖永厚; 罗亦孝

    2002-01-01

    The 230Ra has been produced via 232Th-2p reaction induced by 60 MeV/u 18O ion irradia-tion of natural thorium. The radium was radiochemically separated from the mixture of thorium andreaction products. Thin Ra sources in which 230Ac was got through 230Ra β- → 230Ac were pre-pared for observing fission fragments from β-delayed fission of 230Ac. The sources were exposedto the mica fission track detectors and measured by the HPGe γ detector. The precursor 230Ac wasidentified by means of observed two fission events as well as γ spectra, and the β-delayed fissionprobability of 230Ac was obtained to be (1.19±0.85) × 10-8.

  3. Importance of Attenuation Correction (AC) for Small Animal PET Imaging

    El Ali, Henrik H.; Bodholdt, Rasmus Poul; Jørgensen, Jesper Tranekjær;

    2012-01-01

    performed. Methods: Ten NMRI nude mice with subcutaneous implantation of human breast cancer cells (MCF-7) were scanned consecutively in small animal PET and CT scanners (MicroPETTM Focus 120 and ImTek’s MicroCATTM II). CT-based AC, PET-based AC and uniform AC methods were compared. Results: The activity...... bladder 18 ± 3% (15–21%). The FBP reconstructed images showed almost the same attenuation levels as the MAP reconstructed images for all organs. Conclusions: The annihilation photons are suffering attenuation even in small subjects. Both PET-based and CT-based are adequate as AC methods. The amplitude of...... the AC recovery could be overestimated using the uniform map. Therefore, application of a global attenuation factor on PET data might not be accurate for attenuation correction....

  4. Ac response of a coupled double quantum dot

    Xu Jie; W.Z. Shangguan; Zhan Shi-Chang

    2005-01-01

    The effect of phase-breaking process on the ac response of a coupled double quantum dot is studied in this paper based on the nonequilibrium Green function formalism. A general expression is derived for the ac current in the presence of electron-phonon interaction. The ac conductance is numerically computed and the results are compared with those in [Anatram M P and Datts S 1995 Phys. Rev. B 51 7632]. Our results reveal that the inter-dot electron tunnelling interplays with that between dots and electron reservoirs, and contributes prominently to the ac current when inter-dot tunnelling coupling is much larger than the tunnelling coupling between dots and electron reservoirs. In addition, the phase-breaking process is found to have a significant effect on the ac transport through the coupled double dot.

  5. A Simple Load Power Estimator For Quasi-Direct AC-AC Converter System

    Marian GAICEANU

    2003-12-01

    Full Text Available In this paper a simple load power estimator for the three-phase quasi-direct acac converter system is reported. Since the ac-ac converter control by means of pulsewidth modulation (PWM is based on the power balance concept, its load power should be known. Two control boards, based on the dSMC (digital Smart Motion Controller 30 MIPS 32-bit fixed-point digital signal processor (DSP, were involved in the ac-ac system driving. By using the power balance control, the DC link voltage variation at the load changes can be reduced. In this way a small DC link capacitor is required to handle the dc voltage error control. The feed-forward (Sul and Lipo, 1990 current component provides fast correction of the reference control to load power variation. In order to obtain the feed-forward current component, the load power must to be known. In this paper the load power is estimated from the dc link, indirectly, through a dc load current estimator. In this way the author overcomes the use of the serial communication between control boards (Gaiceanu, 2004 in order to deliver the load power information from the inverter side. The load current estimator is based on the DC link voltage and on the load current of the supply converter. This method presents certain advantages instead of using measured method, which requires a low pass filter: no time delay, the feed-forward current component has no ripple, no additional hardware, and more fast control response. Through simulation and experimental results the performances of the proposed load current estimator scheme are demonstrated.

  6. Artificial pinning centre Nb-Ti superconducting wire for AC applications

    The present work presents the steps for the manufacture of an Nb-Ti artificial pinning centre (APC) multifilament wire for AC applications. The wire production starts from a Ti bar inserted in a Nb tube. The superconductor Nb-Ti alloy was obtained using heat treatments during the wire production steps through the growth of the diffusion layer between the pure Nb and Ti regions. The final wire is composed of many filaments dispersed in a Cu-Ni matrix. The transport critical current density was measured in samples for different conditions of heat treatment, followed by wire diameter reduction. Magnetization hysteresis loops were measured to extract the hysteretic losses in wires with filament diameters of 76 and 92 μm and compared to the results in commercial wires with comparable filament diameters. We obtained an Nb-Ti APC wire with hysteretic losses of the same order of magnitude as the commercial wires. However, critical current densities Jc are higher for fields lower than 2 T, where AC applications are most important. The Jc results confirmed a previous result that the decrease of normal region sizes is a less important pinning source in this material than the pinning from variations in the composition of the diffusion layer

  7. Hair loss in women.

    Camacho-Martínez, Francisco M

    2009-03-01

    Female pattern hair loss (FPHL) is a clinical problem that is becoming more common in women. Female alopecia with androgen increase is called female androgenetic alopecia (FAGA) and without androgen increase is called female pattern hair loss. The clinical picture of typical FAGA begins with a specific "diffuse loss of hair from the parietal or frontovertical areas with an intact frontal hairline." Ludwig called this process "rarefaction." In Ludwig's classification of hair loss in women, progressive type of FAGA, 3 patterns were described: grade I or minimal, grade II or moderate, and grade III or severe. Ludwig also described female androgenetic alopecia with male pattern (FAGA.M) that should be subclassified according to Ebling's or Hamilton-Norwood's classification. FAGA.M may be present in 4 conditions: persistent adrenarche syndrome, alopecia caused by an adrenal or an ovarian tumor, posthysterectomy, and as an involutive alopecia. A more recent classification (Olsen's classification of FPHL) proposes 2 types: early- and late-onset with or without excess of androgens in each. The diagnosis of FPHL is made by clinical history, clinical examination, wash test, dermoscopy, trichoscan, trichograms and laboratory test, especially androgenic determinations. Topical treatment of FPHL is with minoxidil, 2-5% twice daily. When FPHL is associated with high levels of androgens, systemic antiandrogenic therapy is needed. Persistent adrenarche syndrome (adrenal SAHA) and alopecia of adrenal hyperandrogenism is treated with adrenal suppression and antiandrogens. Adrenal suppression is achieved with glucocorticosteroids. Antiandrogens therapy includes cyproterone acetate, drospirenone, spironolactone, flutamide, and finasteride. Excess release of ovarian androgens (ovarian SAHA) and alopecia of ovarian hyperandrogenism is treated with ovarian suppression and antiandrogens. Ovarian suppression includes the use of contraceptives containing an estrogen, ethinylestradiol, and a

  8. Female pattern hair loss

    Archana Singal

    2013-01-01

    Full Text Available Female pattern hair loss (FPHL is a common cause of hair loss in women characterized by diffuse reduction in hair density over the crown and frontal scalp with retention of the frontal hairline. Its prevalence increases with advancing age and is associated with significant psychological morbidity. The pathophysiology of FPHL is still not completely understood and seems to be multifactorial. Although androgens have been implicated, the involvement of androgen-independent mechanisms is evident from frequent lack of clinical or biochemical markers of hyperandrogenism in affected women. The role of genetic polymorphisms involving the androgen and estrogen receptors is being increasingly recognized in its causation and predicting treatment response to anti-androgens. There are different clinical patterns and classifications of FPHL, knowledge of which facilitates patient management and research. Chronic telogen effluvium remains as the most important differential diagnosis. Thorough history, clinical examination, and evaluation are essential to confirm diagnosis. Patients with clinical signs of androgen excess require assessment of biochemical parameters and imaging studies. It is prudent to screen the patients for metabolic syndrome and cardiovascular risk factors. The treatment comprises medical and/or surgical modalities. Medical treatment should be initiated early as it effectively arrests hair loss progression rather than stimulating regrowth. Minoxidil continues to be the first line therapy whereas anti-androgens form the second line of treatment. The progressive nature of FPHL mandates long-term treatment for sustained effect. Medical therapy may be supplemented with cosmetic concealment in those desirous of greater hair density. Surgery may be worthwhile in some carefully selected patients.

  9. HVDC-AC system interaction from AC harmonics. Volume 1. Harmonic impedance calculations. Final report

    Breuer, G D; Chow, J H; Lindh, C B; Miller, N W; Numrich, F H; Price, W W; Turner, A E; Whitney, R R

    1982-09-01

    Improved methods are needed to characterize ac system harmonic behavior for ac filter design for HVDC systems. The purpose of this General Electric Company RP1138 research is to evaluate the present filter design practice and to investigate methods for calculating system harmonic impedances. An overview of ac filter design for HVDC systems and a survey of literature related to filter design have been performed. Two methods for calculating system harmonic impedances have been investigated. In the measurement method, an instrumentation system for measuring system voltage and current has been assembled. Different schemes of using the measurements to calculate system harmonic impedances have been studied. In the analytical method, a procedure to include various operating conditions has been proposed. Computer programs for both methods have been prepared, and the results of the measurement and analytical methods analyzed. A conclusion of the project is that the measurement and analytical methods both provided reasonable results. There are correlations between the measured and analytical results for most harmonics, although there are discrepancies between the assumptions used in the two methods. A sensitivity approach has been proposed to further correlate the results. From the results of the analysis, it is recommended that both methods should be tested further. For the measurement method, more testing should be done to cover different system operating conditions. In the analytical method, more detailed models for representing system components should be studied. In addition, alternative statistical and sensitivity approaches should be attempted.

  10. Sustainable AC/AC hybrid electrochemical capacitors in aqueous electrolyte approaching the performance of organic systems

    Abbas, Qamar; Babuchowska, Paulina; Frąckowiak, Elżbieta; Béguin, François

    2016-09-01

    A high energy hybrid AC/AC electrochemical capacitor has been realized in aqueous Li2SO4+KI electrolyte mixture. Owing to the redox processes associated with the 2I-/I2 system, the positive electrode operates in narrow potential range and displays high capacity. During prolonged potentiostatic floating at 1.6 V, the hybrid cell demonstrates remarkably stable capacitance and resistance. Analyses by temperature programmed desorption after floating at 1.6 V proved that oxidation of the positive AC electrode is prevented by the use of Li2SO4+KI, which enables the maximum potential of this electrode to be shifted below the water oxidation potential. When charged at 0.2 A g-1 up to U = 1.6 V, the hybrid cell displays a high capacitance of 75 F g-1 (300 F g-1 per mass of one electrode) compared to 47 F g-1 (188 F g-1 per mass of one electrode) for a symmetric cell in Li2SO4. At 0.2 A g-1 up to 1.6 V, the hybrid capacitor in Li2SO4+KI displays an energy density of 26 Wh kg-1 which approaches the energy density of 30.9 Wh kg-1 measured when the same carbon is implemented in a capacitor using TEABF4/ACN electrolyte and charged up to 2.5 V.

  11. Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach it is not...

  12. La acústica submarina y su desarrollo desde la creación del Instituto de Acústica

    Ranz Guerra, Carlos; Cobo, Pedro; Carbó, Rafael; Santiago Páez, José Salvador; Soler, A. M.; Briones, J. M.; Jimeno, I.; Muñoz, N; Camarasa, M.; Recuero López, Manuel

    2000-01-01

    PACS: 43.30.Xm; 43.30.Yj; 43.30.Vh; 43.30.Nb; 43.30.Ma.-- Publicado en el Vol. XXXI, núm. 3-4, tercer y cuarto trimestre 2000 de la Revista de Acústica: Número especial dedicado al XXV Aniversario del Instituto de Acústica del C.S.I.C.

  13. [Progressive hearing loss].

    Reiss, M; Reiss, G

    2000-01-01

    Progressive sensorineural hearing loss (SNHL) is defined as hearing loss of unknown etiology with fairly high-speed progression. Its diagnostic criteria consist of the following: that it is 1) progressive, 2) with bilateral involvement, and 3) of unknown etiology. Due to recent advances in diagnostics, imaging and management, SNHL has gained much interest from otologists in the last few years. They provide new insight into the physiology and pathophysiology of hearing. SNHL which is sudden in onset, fluctuating, and/or progressive complicates medical management, hearing aid selection, and individualized educational planning for a hearing-impaired patient. Existing hypotheses on the etiology of SNHL are judged on experimental, clinical, laboratory and radiological evidence. Cardiovascular and rheologic diseases, hereditary disorders, immunological phenomena, infections, environmental causes like noise, ototoxic drugs and industrial substances and systemic maladies must be included in the diagnostic reflections. Potential concepts of treatment include rheologic medications and corticosteroids. Hearing aids and timely cochlear implant operation are further possible forms of treatment. PMID:10893764

  14. Tragic loss at CERN

    CERN Ski Club

    2015-01-01

    Tragic loss at CERN The CERN community is mourning the tragic loss of two members of the CERN Ski Club. On Sunday, April 12, an avalanche buried four out of five skiers, taking part in a ski touring in the region of the Becs de Bosson in Valais (CH). The fifth skier, who had not been buried in the snow,  courageously managed to save two of the skiers, but Hervé Milcent, 49 years, federal ski instructor, and Mattieu Cattin, 33 years, were buried under two to three meters of snow, far down the avalanche slope, and did not survive, despite the fast arrival of the mountain rescue. In its 40 years of existence, the CERN Ski Club, one of the biggest in the Geneva area, has never been confronted with such a tragedy. The passing of Hervé and Matthieu has deeply shocked and saddened all volunteers of the Club as well as the entire alpine community. The ski touring section of the club would like to honour its friend Hervé, who joined the club in 1998. In 2003 he became res...

  15. Production Of Multi-magnetron Plasma By Using Polyphase Ac Glow Discharge In An Improved Multi-pole Magnetic Field

    Matsumoto, Kazunori; Motoki, Kentaro; Miyamoto, Masahiro; Uetani, Yasuhiro

    1998-10-01

    Effects of an improved multi-pole magnetic field on a plasma production generated by a polyphase ac glow discharge with multiple electrodes have been investigated. Conventional configuration of the multi-pole magnetic filed has been modified to suppress plasma losses at both ends of the chamber due to ExB drift motion. The modified multi-pole magnetic field has enabled us to produce a multiple magnetron-plasma at a considerably low pressure less than mTorr. The low temperature plasma has been widely used as the fine processing technology of a dry etching and as the thin film formation technology of a sputtering coating. Large-scale plasmas which can be generated at a low gas-pressure have been desired for more wider dry etching and greater sputter coating. The purpose of this study is to develop a large-scale and low-cost plasma generator by using a polyphase ac power source with the low frequency. In this session, we will present the experimental result as to a multiple magnetron-plasma generated in the modified twenty-four poles magnetic field by using the twenty-four-phase ac power source with the commercial electric power frequency of 60Hz. The ac power is supplied to twenty-four electrodes which are fixed to the water-cooled chamber-wall through sheet insulators so that the electrodes can be cooled indirectly.

  16. AC Dielectric Properties and Positron Annihilation Study on Co and Ti Substitution Effect on Ca-Sr M-Hexaferrites

    Mahmoud, K. R.; Eraky, M. R.

    2016-06-01

    The dependence of AC conductivity σ AC, dielectric constant έ, and dielectric loss tangent tan δ on frequency and composition have been investigated at room temperature for polycrystalline Ca0.5Sr0.5Co x Ti x Fe12 - 2 x O19 (where 0.0 ≤ x ≤ 0.8) hexaferrites. It was found that the parameters σ AC, ɛ ', and tan δ have maximum values at x = 0.4 of the Co and Ti substitution. The behavior of σ AC, ɛ ', and tan δ with frequency and composition was explained on the basis of the hopping conduction mechanism and the Koops model. Positron annihilation lifetime spectroscopy (PALS) was used to investigate the defects and changes in electron density for hexaferrite samples. The PAL parameters ( τ 1, I 1, τ 2, I 2, and mean lifetime) show that altering the doping percentage of the Co and Ti ions affects the size and concentration of defects. The results reveal that there are some large voids in the studied samples. The obtained results indicate the high sensitivity of the PALS technique to the enhanced structure changes with changing composition of the investigated samples and correlate the results with the measured electrical parameters.

  17. Muc5ac gastric mucin glycosylation is shaped by FUT2 activity and functionally impacts Helicobacter pylori binding.

    Magalhães, Ana; Rossez, Yannick; Robbe-Masselot, Catherine; Maes, Emmanuel; Gomes, Joana; Shevtsova, Anna; Bugaytsova, Jeanna; Borén, Thomas; Reis, Celso A

    2016-01-01

    The gastrointestinal tract is lined by a thick and complex layer of mucus that protects the mucosal epithelium from biochemical and mechanical aggressions. This mucus barrier confers protection against pathogens but also serves as a binding site that supports a sheltered niche of microbial adherence. The carcinogenic bacteria Helicobacter pylori colonize the stomach through binding to host glycans present in the glycocalyx of epithelial cells and extracellular mucus. The secreted MUC5AC mucin is the main component of the gastric mucus layer, and BabA-mediated binding of H. pylori to MUC5AC confers increased risk for overt disease. In this study we unraveled the O-glycosylation profile of Muc5ac from glycoengineered mice models lacking the FUT2 enzyme and therefore mimicking a non-secretor human phenotype. Our results demonstrated that the FUT2 determines the O-glycosylation pattern of Muc5ac, with Fut2 knock-out leading to a marked decrease in α1,2-fucosylated structures and increased expression of the terminal type 1 glycan structure Lewis-a. Importantly, for the first time, we structurally validated the expression of Lewis-a in murine gastric mucosa. Finally, we demonstrated that loss of mucin FUT2-mediated fucosylation impairs gastric mucosal binding of H. pylori BabA adhesin, which is a recognized feature of pathogenicity. PMID:27161092

  18. Pricing Excess-of-loss Reinsurance Contracts Against Catastrophic Loss

    J. David Cummins; Lewis, Christopher M.; Phillips, Richard D.

    1998-01-01

    This paper develops a pricing methodology and pricing estimates for the proposed Federal excess-of- loss (XOL) catastrophe reinsurance contracts. The contracts, proposed by the Clinton Administration, would provide per-occurrence excess-of-loss reinsurance coverage to private insurers and reinsurers, where both the coverage layer and the fixed payout of the contract are based on insurance industry losses, not company losses. In financial terms, the Federal government would be selling earthqua...

  19. UHV A.C. transmission: Technology and prospects

    At the beginning of the 70's, UHV transmission was regarded as imminent in many countries in view of the expected concentration of generating units (possibly of the nuclear type and grouped together in a few large plants, each of several GW), and research projects were therefore launched in the U.S.A., Canada, Italy, Japan, USSR, etc. Nowadays, the expected introduction of UHV transmission seems remote due to the slowdown in electricity growth and to the tendency towards distributed generation. Nevertheless, there are exceptions: the 1,200 kV 2,400 km-long transmission system in operation in Siberia-Kazahkstan-Urals, and the 1,100 kV 200 km double-circuit line under construction in Japan (which will, however, be operated at 500 kV up to the end of the century). In addition, in Italy, the research programme of a 1000 kV project has now been completed and a 1,050 kV pilot plant is under construction in Tuscany, consisting of a short 1,050kV line and a 420/1,050 kV 1,200 MVA substation. The technology of UHV AC transmission has therefore been proved effective and may represent an available option for the power systems of the next century. From the power system planning point-of-view, UHV's favourable characteristics lie in the possibility of transmitting large amount of power, of the order of 5 GW per circuit, with lower costs, reduced losses, and less land occupation than in the case of EHV lines

  20. Ripple current loss measurement with DC bias condition for high temperature superconducting power cable using calorimetry method

    Kim, D.W.; Kim, J.G.; Kim, A.R. [Changwon National University, 9 sarim-dong, Changwon 641-773 (Korea, Republic of); Park, M., E-mail: paku@changwon.ac.k [Changwon National University, 9 sarim-dong, Changwon 641-773 (Korea, Republic of); Yu, I.K. [Changwon National University, 9 sarim-dong, Changwon 641-773 (Korea, Republic of); Sim, K.D.; Kim, S.H.; Lee, S.J.; Cho, J.W. [Superconducting Device and Cryogenics Group, Korea Electrotechnology Research Institute, Changwon, 641-120 (Korea, Republic of); Won, Y.J. [Korea Electric Power Corporation, 411, youngdong-dearo, Gangnam-gu, Seoul (Korea, Republic of)

    2010-11-01

    The authors calculated the loss of the High Temperature Superconducting (HTS) model cable using Norris ellipse formula, and measured the loss of the model cable experimentally. Two kinds of measuring method are used. One is the electrical method, and the other is the calorimetric method. The electrical method can be used only in AC condition. But the calorimetric method can be used in both AC and DC bias conditions. In order to propose an effective measuring approach for Ripple Dependent Loss (RDL) under DC bias condition using the calorimetric method, Bismuth Strontium Calcium Copper Oxide (BSCCO) wires were used for the HTS model cable, and the SUS tapes were used as a heating tape to make the same pattern of the temperature profiles as in the electrical method without the transport current. The temperature-loss relations were obtained by the electrical method, and then applied to the calorimetric method by which the RDL under DC bias condition was well estimated.

  1. Ripple current loss measurement with DC bias condition for high temperature superconducting power cable using calorimetry method

    The authors calculated the loss of the High Temperature Superconducting (HTS) model cable using Norris ellipse formula, and measured the loss of the model cable experimentally. Two kinds of measuring method are used. One is the electrical method, and the other is the calorimetric method. The electrical method can be used only in AC condition. But the calorimetric method can be used in both AC and DC bias conditions. In order to propose an effective measuring approach for Ripple Dependent Loss (RDL) under DC bias condition using the calorimetric method, Bismuth Strontium Calcium Copper Oxide (BSCCO) wires were used for the HTS model cable, and the SUS tapes were used as a heating tape to make the same pattern of the temperature profiles as in the electrical method without the transport current. The temperature-loss relations were obtained by the electrical method, and then applied to the calorimetric method by which the RDL under DC bias condition was well estimated.

  2. Importance of Attenuation Correction (AC for Small Animal PET Imaging

    Henrik H. El Ali

    2012-10-01

    Full Text Available The purpose of this study was to investigate whether a correction for annihilation photon attenuation in small objects such as mice is necessary. The attenuation recovery for specific organs and subcutaneous tumors was investigated. A comparison between different attenuation correction methods was performed. Methods: Ten NMRI nude mice with subcutaneous implantation of human breast cancer cells (MCF-7 were scanned consecutively in small animal PET and CT scanners (MicroPETTM Focus 120 and ImTek’s MicroCATTM II. CT-based AC, PET-based AC and uniform AC methods were compared. Results: The activity concentration in the same organ with and without AC revealed an overall attenuation recovery of 9–21% for MAP reconstructed images, i.e., SUV without AC could underestimate the true activity at this level. For subcutaneous tumors, the attenuation was 13 ± 4% (9–17%, for kidneys 20 ± 1% (19–21%, and for bladder 18 ± 3% (15–21%. The FBP reconstructed images showed almost the same attenuation levels as the MAP reconstructed images for all organs. Conclusions: The annihilation photons are suffering attenuation even in small subjects. Both PET-based and CT-based are adequate as AC methods. The amplitude of the AC recovery could be overestimated using the uniform map. Therefore, application of a global attenuation factor on PET data might not be accurate for attenuation correction.

  3. Noise and Hearing Loss Prevention

    ... Follow us on Twitter Noise Manufacturing Construction SafeInSound Noise and Hearing Loss on the NIOSH Science Blog ... Topics Publications and Products Programs Contact NIOSH NIOSH NOISE AND HEARING LOSS PREVENTION Recommend on Facebook Tweet ...

  4. Noise-Induced Hearing Loss

    ... Home » Health Info » Hearing, Ear Infections, and Deafness Noise-Induced Hearing Loss On this page: What is ... I find additional information about NIHL? What is noise-induced hearing loss? Every day, we experience sound ...

  5. Hypothyroidism and pregnancy loss

    Andersen, Stine Linding; Olsen, Jørn; Laurberg, Peter

    2016-01-01

    BACKGROUND: Hypothyroidism is a common endocrine disease. The frequency of pregnancy loss in women with known hypothyroidism as opposed to women with a later diagnosis of hypothyroidism has not been evaluated and compared with other common endocrine diseases. DESIGN: Population-based cohort study...... using Danish nationwide registers. PARTICIPANTS: All pregnancies in Denmark, 1997-2008, resulting in live birth (n=732,533), spontaneous abortion (n=112,487) or stillbirth (n=2,937) were identified together with information on maternal hypothyroidism, hyperthyroidism and diabetes. METHODS: Cox model was...... used to estimate adjusted hazard ratio (aHR) with 95% confidence interval (95%CI) for spontaneous abortion and stillbirth, reference: no hypo- or hyperthyroidism or diabetes (n=824,310). RESULTS: We identified 4,951 pregnancies where maternal hypothyroidism was diagnosed before the pregnancy (group 1...

  6. Change, Gain and Loss

    Fu Mengzi

    2006-01-01

    @@ Five years have passed since the September 11 terrorist attacks occurred. America's counter-terrorism campaign is still on the way.Besides the momentary monumental significance of the fifth anniversary, five years is still too short in regard to the long-term counter-terrorism campaign. Yet, America's president's tenure is eight years at best; most of Bush's presidency time has passed. Five years ago, the U. S. encountered the most serious terrorist attack; the whole nation formed a consensus that counter-terrorism is its utmost priority. President Bush once enjoyed a support rate as high as 90% for over 16 months. But five years later, the trend changes. People can not help but ask: what are the gains and losses of the Republican Party in dealing with national security affairs?

  7. Methodology for Evaluating Water Losses

    Mindaugas Rimeika; Anželika Jurkienė

    2013-01-01

    A reduction in water losses is significant for improving the efficiency of water supply systems and sustainable water use. The major part of water supply companies does not have enough experience in reducing water losses; therefore, a lack of information about practically applied measures for reducing water losses can be noticed. The article presents a method for determining water losses implemented under real conditions. The conducted research defines minimum night-time water consumption for...

  8. Relative Information Loss - An Introduction

    Geiger, Bernhard C

    2012-01-01

    We introduce a relative variant of information loss to characterize the behavior of deterministic input-output systems. We show that the relative loss is closely related to Renyi's information dimension. We provide an upper bound for continuous input random variables and an exact result for a class of functions (comprising quantizers) with infinite absolute information loss. A connection between relative information loss and reconstruction error is investigated.

  9. Breast Cancer and Bone Loss

    ... Balance › Breast Cancer and Bone Loss Fact Sheet Breast Cancer and Bone Loss July, 2010 Download PDFs English ... JoAnn Pinkerton, MD What is the link between breast cancer and bone loss? Certain treatments for breast cancer ...

  10. Loss Aversion and Individual Characteristics

    Hjorth, Katrine; Fosgerau, Mogens

    2011-01-01

    Many studies have shown that loss aversion affects the valuation of non-market goods. Using stated choice data, this paper presents an empirical investigation of how individual-level loss aversion varies with observable personal characteristics and with the choice context. We investigate loss...

  11. Losses compensation; Compensation des pertes

    NONE

    2001-07-01

    One mission of RTE (Electric Power Transportation), is to watch over the losses compensation resulting from the power transport on the electric power network. Since january 2001, RTE makes good the electric losses by the purchase of energy. To choose the marketers, a consultation has been realized by RTE. This document presents the rules concerning these losses compensation. (A.L.B.)

  12. Optimum voltage control for loss minimization in HVDC multi-terminal transmission systems for large offshore wind farms

    Aragüés Peñalba, Mònica; Egea Àlvarez, Agustí; Gomis Bellmunt, Oriol; Sumper, Andreas

    2012-01-01

    An optimal power flow based control scheme is proposed in order to minimize the losses in multi-terminal HVDC systems for large offshore wind power plants. The scheme optimizes system power flows while delivering the generated wind power to the terrestrial AC grid (or grids). The proposed scheme is compared to droop control schemes in two case studies in order to illustrate the power loss reduction achieved. Dynamic simulations have been provided in order to show the dynamic behavior of both ...

  13. Operation of AC Adapters Visualized Using Light-Emitting Diodes

    Regester, Jeffrey

    2016-01-01

    A bridge rectifier is a diamond-shaped configuration of diodes that serves to convert alternating current (AC) into direct current (DC). In our world of AC outlets and DC electronics, they are ubiquitous. Of course, most bridge rectifiers are built with regular diodes, not the light-emitting variety, because LEDs have a number of disadvantages. For educational purposes, however, an LED-based rectifier is ideal because it allows students to literally see the rectifier operating. Here I'll discuss the practical aspects of building a full AC adapter incorporating an LED-based rectifier and ideas on how to use it in class.

  14. Advanced DC/AC inverters applications in renewable energy

    Luo, Fang Lin

    2013-01-01

    DC/AC inversion technology is of vital importance for industrial applications, including electrical vehicles and renewable energy systems, which require a large number of inverters. In recent years, inversion technology has developed rapidly, with new topologies improving the power factor and increasing power efficiency. Proposing many novel approaches, Advanced DC/AC Inverters: Applications in Renewable Energy describes advanced DC/AC inverters that can be used for renewable energy systems. The book introduces more than 100 topologies of advanced inverters originally developed by the authors,

  15. Analysis of Input and Output Ripples of PWM AC Choppers

    Pekik Argo Dahono

    2008-11-01

    Full Text Available This paper presents an analysis of input and output ripples of PWM AC choppers. Expressions of input and output current and voltage ripples of single-phase PWM AC choppers are first derived. The derived expressions are then extended to three-phase PWM AC choppers. As input current and output voltage ripples specification alone cannot be used to determine the unique values of inductance and capacitance of the LC filters, an additional criterion based on the minimum reactive power is proposed. Experimental results are included in this paper to show the validity of the proposed analysis method.

  16. An Improved AC-BM Algorithm for Monitoring Watch List

    Mo Yiwen

    2013-07-01

    Full Text Available With the expanding of database of the watch list of anti-money laundering, improving the speed in matching between the watch list and the database of account holders and clients’ transaction is especially important. This paper proposes an improved AC-BM Algorithm, a matching algorithm of subsection, to improve the speed of matching. Experiment results show the time performance of the improved algorithm is better than traditional BM algorithm, AC algorithm and the AC-BM algorithm. It can improve the efficiency of on-line monitoring of anti-money laundering.  

  17. DC and AC biasing of a transition edge sensor microcalorimeter

    We are developing AC-biased transition edge sensor (TES) microcalorimeters for use in large arrays with frequency-domain multiplexing. Using DC bias, we have achieved a resolution of 17 eV FWHM at 2.6 keV with a decay time of 90 μs and an effective detector diameter of 300 μm. We have successfully measured thermal pulses with a TES microcalorimeter operated with an AC bias. We present here preliminary results from a single pixel detector operated under DC and AC bias conditions

  18. Study on radioimmunoassay of Bt Cry1Ac protein

    Bt Cry1Ac protein was extracted from incubation of Bacillus thuringiensis HD-73, and cutting into more specific protein segment with high insect-resistance. High-affinity multi-colonial antibodies of Bt Cry1 Ac protein were obtained after injected it into New Zealand rabbits. By 125I labeling of Bt Cry1 Ac protein, a RIA kit was established. In this method, centrifuge for separation was not necessary due to the use of magnetic micro-particle and the specifications of the kit were found equal to those of imported ELISA. (authors)

  19. Stochastic Dynamics of DC and AC Driven Dislocation Kinks

    Vardanyan, A.; Kteyan, A.

    2013-02-01

    Dynamics of a pinned dislocation kink controlled by the acting DC and AC forces is studied analytically. The motion of the kink, described by sine-Gordon (sG) equation, is explored within the framework of McLaughlin-Scott perturbation theory. Assuming weakness of the acting AC force, the equation of motion of the dislocation kink in the pinning potential is linearized. Based on the equations derived, we study stochastic behavior of the kink, and determine the probability of its depinning. The dependencies of the depinning probability on DC and AC forces are analyzed in detail.

  20. Observation of β-delayed fission from 230Ac

    β-delayed fission for 230Ac was searched. 230Ra was produced via multinucleon transfer reaction by 60 MeV/u 18O ion irradiation of 232Th target. Thin 230Ra→230Ac sources of 108 atoms were acquired through radiochemical separations. The mica track detectors were used to record the fission events. The β-delayed fission nucleus 230Ac was identified via the observed two fission events and the measured γ-ray spectra. Its β-delayed fission probability was obtained to be (1.19 +- 0.85) x 10-8

  1. Risk of fetal loss associated with invasive testing following combined first-trimester screening for Down syndrome

    Wulff, C B; Gerds, T A; Rode, L;

    2016-01-01

    OBJECTIVE: To assess prospectively the risk of fetal loss associated with chorionic villus sampling (CVS) and amniocentesis (AC) following combined first-trimester screening (cFTS) for Down syndrome. METHODS: This was a nationwide population-based study (Danish Fetal Medicine Database, 2008...

  2. Neurinoma central do nervo acústico

    Paulo Pinto Pupo

    1950-03-01

    Full Text Available O autor apresenta o caso de uma paciente com 45 anos, com hipertensão arterial, queixando-se de tonturas e surdez progressiva à esquerda que, ao exame neurológico, apresentava síndrome protuberancial, com hemi-anestesia táctil e dolorosa à direita respeitando a face, hemiparesia direita, ataxia de tipo sensitivo nos membros da direita, paralisia facial de tipo periférico, hipoacusia, paresia de motor ocular externo à esquerda, síndrome vertiginosa e nistagmo horizontal ao olhar para a direita. À necrópsia foi encontrado um tumor na hemicalota protuberancial esquerda e foco malácico adjacente, secundário a distúrbio circulatório. O tumor, intimamente dependente das raízes intraprotuberanciais do nervo acústico, se apresentava com as características histológicas dos neurinomas. Além dessas particularidades, a lesão do feixe central da calota e conseqüente degeneração "hipertrófica" da oliva bulbar constituem outro aspecto de grande interêsse dêste caso.

  3. AC Impedance Behaviour of Black Diamond Films

    Haitao YE; Olivier GAUDIN; Richard B.JACKMAN

    2005-01-01

    The first measurement of impedance on free-standing diamond films from 0.1 Hz to 10 MHz up to 300℃ were reported. A wide range of chemical vapour deposition (CVD) materials were investigated, but here we concentrate are well fitted to a RC parallel circuit model and the equivalent resistance and capacitance for the diamond films have been estimated using the Zview curve fitting. The results show only one single semicircle response at each temperature measured. It was found that the resistance decreases from 62 MΩ at room temperature to 4 kΩ at300℃, with an activation energy around 0.51 eV. The equivalent capacitance is maintained at the level of 100 pF up to 300℃ suggesting that the diamond grain boundaries are dominating the conduction. At 400℃, the impedance at low frequencies shows a linear tail, which can be explained that the AC polarization of diamond/Au interface occurs.

  4. Dicty_cDB: FCL-AC22 [Dicty_cDB

    Full Text Available FCL (Link to library) FCL-AC22 (Link to dictyBase) - G03266 DDB0186811 Contig-U14995-1 FCL-...AC22P (Link to Original site) FCL-AC22F 430 FCL-AC22Z 521 FCL-AC22P 951 - - Show FCL-AC22 Library FC...L (Link to library) Clone ID FCL-AC22 (Link to dictyBase) Atlas ID - NBRP ID G03266 dictyBase ID DDB0186811 ...Link to Contig Contig-U14995-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-...AC22Q.Seq.d/ Representative seq. ID FCL-AC22P (Link to Original site) Representative DNA sequence >FCL-

  5. Dicty_cDB: FCL-AC23 [Dicty_cDB

    Full Text Available FCL (Link to library) FCL-AC23 (Link to dictyBase) - G01760 DDB0186002 Contig-U16043-1 FCL-...AC23P (Link to Original site) FCL-AC23F 132 FCL-AC23Z 582 FCL-AC23P 714 - - Show FCL-AC23 Library FC...L (Link to library) Clone ID FCL-AC23 (Link to dictyBase) Atlas ID - NBRP ID G01760 dictyBase ID DDB0186002 ...Link to Contig Contig-U16043-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-...AC23Q.Seq.d/ Representative seq. ID FCL-AC23P (Link to Original site) Representative DNA sequence >FCL-

  6. Absorption and Attenuation Coefficients Using the WET Labs ac-s in the Mid-Atlantic Bight: Field Measurements and Data Analysis

    Ohi, Nobuaki; Makinen, Carla P.; Mitchell, Richard; Moisan, Tiffany A.

    2008-01-01

    Ocean color algorithms are based on the parameterization of apparent optical properties as a function of inherent optical properties. WET Labs underwater absorption and attenuation meters (ac-9 and ac-s) measure both the spectral beam attenuation [c (lambda)] and absorption coefficient [a (lambda)]. The ac-s reports in a continuous range of 390-750 nm with a band pass of 4 nm, totaling approximately 83 distinct wavelengths, while the ac-9 reports at 9 wavelengths. We performed the ac-s field measurements at nine stations in the Mid-Atlantic Bight from water calibrations to data analysis. Onboard the ship, the ac-s was calibrated daily using Milli Q-water. Corrections for the in situ temperature and salinity effects on optical properties of water were applied. Corrections for incomplete recovery of the scattered light in the ac-s absorption tube were performed. The fine scale of spectral and vertical distributions of c (lambda) and a (lambda) were described from the ac-s. The significant relationships between a (674) and that of spectrophotometric analysis and chlorophyll a concentration of discrete water samples were observed.

  7. Loss measurement programs at TRIUMF

    During the KAON Factory Project Definition Study year we plan to directly measure magnet losses at sinusoidal excitation and at the proposed dual frequency excitation of the booster and driver rings. The losses due to transverse fields in the conductors will be measured using the NINA magnets and core losses will be measured on steel samples using an Epstein Bridge method which allows dc bias levels to be applied. The proposed tests are described and some preliminary findings are presented. The aim of these tests is to allow us to understand the loss processes and to allow us to calculate these losses with greater accuracy and confidence

  8. Tailored vacuum chambers for ac magnets

    The proposed LAMPF-II accelerator has a 60-Hz booster synchrotron and a 3-Hz main ring. To provide a vacuum enclosure inside the magnets with low eddy-current losses and minimal field distortion, yet capable of carrying rf image currents and providing beam stabilization, we propose an innovative combination pipe. Structurally, the enclosure is high-purity alumina ceramic, which is strong, radiation resistant, and has good vacuum properties. Applied to the chamber are thin, spaced, silver conductors using adapted thick-film technology. The conductor design can be tailored to the stabilization requirements, for example, longitudinal conductors for image currents, circumferential for transverse stabilization. The inside of the chamber has a thin, resistive coating to avoid charge build-up. The overall 60-Hz power loss is less than 100 W/m

  9. Composite Cu/Fe/MgB2 superconducting wires and MgB2/YSZ/Hastelloy coated conductors for ac and dc applications

    We discuss the results of a study of MgB2 multifilamentary conductors and coated conductors from the point of view of their future dc and ac applications. The correlation between the slope of the irreversibility line induced by neutron irradiation defects and in situ structural imperfections and the critical temperature and critical current density is discussed with respect to the conductor performance and applicability. We debate the possible origin of the observed anomalous decrease of ac susceptibility at 50 K in copper clad in situ powder-in-tube MgB2 wires. Different conductor preparation methods and conductor architectures, and attainable critical current densities are presented. Some numerical results on critical currents, thermal stability and ac losses of future MgB2 multifilamentary and coated conductors with magnetic cladding of their filaments are also discussed

  10. Autoimmunity in visual loss.

    Petzold, Axel; Wong, Sui; Plant, Gordon T

    2016-01-01

    There are a number of autoimmune disorders which can affect visual function. There are a very large number of mechanisms in the visual pathway which could potentially be the targets of autoimmune attack. In practice it is the retina and the anterior visual pathway (optic nerve and chiasm) that are recognised as being affected in autoimmune disorders. Multiple Sclerosis is one of the commonest causes of visual loss in young adults because of the frequency of attacks of optic neuritis in that condition, however the basis of the inflammation in Multiple Sclerosis and the confirmation of autoimmunity is lacking. The immune process is known to be highly unusual in that it is not systemic and confined to the CNS compartment. Previously an enigmatic partner to Multiple Sclerosis, Neuromyelitis Optica is now established to be autoimmune and two antibodies - to Aquaporin4 and to Myelin Oligodendrocyte Glycoprotein - have been implicated in the pathogenesis. The term Chronic Relapsing Inflammatory Optic Neuropathy is applied to those cases of optic neuritis which require long term immunosuppression and hence are presumed to be autoimmune but where no autoimmune pathogenesis has been confirmed. Optic neuritis occurring post-infection and post vaccination and conditions such as Systemic Lupus Erythematosus and various vasculitides may cause direct autoimmune attack to visual structures or indirect damage through occlusive vasculopathy. Chronic granulomatous disorders such as Sarcoidosis affect vision commonly by a variety of mechanisms, whether and how these are placed in the autoimmune panoply is unknown. As far as the retina is concerned Cancer Associated Retinopathy and Melanoma Associated Retinopathy are well characterised clinically but a candidate autoantibody (recoverin) is only described in the former disorder. Other, usually monophasic, focal retinal inflammatory disorders (Idiopathic Big Blind Spot Syndrome, Acute Zonal Occult Outer Retinopathy and Acute Macular

  11. Calculation of the ac to dc resistance ratio of conductive nonmagnetic straight conductors by applying FEM simulations

    Riba, Jordi-Roger

    2015-09-01

    This paper analyzes the skin and proximity effects in different conductive nonmagnetic straight conductor configurations subjected to applied alternating currents and voltages. These effects have important consequences, including a rise of the ac resistance, which in turn increases power loss, thus limiting the rating for the conductor. Alternating current (ac) resistance is important in power conductors and bus bars for line frequency applications, as well as in smaller conductors for high frequency applications. Despite the importance of this topic, it is not usually analyzed in detail in undergraduate and even in graduate studies. To address this, this paper compares the results provided by available exact formulas for simple geometries with those obtained by means of two-dimensional finite element method (FEM) simulations and experimental results. The paper also shows that FEM results are very accurate and more general than those provided by the formulas, since FEM models can be applied in a wide range of electrical frequencies and configurations.

  12. Structural and frequency dependencies of a.c. and dielectric characterizations of epitaxial InSb-based heterojunctions

    A ASHERY; A H ZAKI; M HUSSIEN MOURAD; A M AZAB; A A M FARAG

    2016-08-01

    In this work, heterojunction of InSb/InP was grown by liquid phase epitaxy (LPE). Surface morphology and crystalline structure of the heterojunction were characterized by scanning electron microscopy (SEM) and X-ray diffraction (XRD). The frequency and temperature dependences of a.c. conductivity and dielectric properties of the heterojunctions were investigated in the ranges of 100 kHz–5 MHz and 298–628 K, respectively. The a.c. conductivity and its frequency exponents were interpreted in terms of correlated barrier hopping model (CBH), as the dominant conduction mechanism for charge carrier transport. The calculated activation energy, from the Arrhenius plot, was found to decrease with increasing frequency. Experimental results of both dielectric constant $\\epsilon_1$ and dielectric loss $\\epsilon_2$ showed a remarkable dependence of both frequency and temperature.

  13. Analysis on heat loss characteristics of a 10 kV HTS power substation

    Teng, Yuping; Dai, Shaotao; Song, Naihao; Zhang, Jingye; Gao, Zhiyuan; Zhu, Zhiqin; Zhou, Weiwei; Wei, Zhourong; Lin, Liangzhen; Xiao, Liye

    2014-09-01

    A 10 kV High Temperature Superconducting power substation (10 kV HTS substation), supported by Chinese State 863 projects, was developed and has been running to supply power for several factories for more than two years at an industrial park of Baiyin, Gansu province in Northwest China. The system of the 10 kV HTS substation compositions, including a HTS cable, a HTS transformer, a SFCL, and a SMES, are introduced. The SMES works at liquid helium temperature and the other three apparatus operates under liquid nitrogen condition. There are mainly four types of heat losses existing in each HTS apparatus of the 10 kV HTS substation, including AC loss, Joule heat loss, conductive heat, and leak-in heat from cryostat. A small quantity of AC loss still exists due to the harmonic component of the current when it carries DC for HTS apparatus. The principle and basis for analysis of the heat losses are introduced and the total heat loss of each apparatus are calculated or estimated, which agree well with the test result. The analysis and result presented are of importance for the design of the refrigeration system.

  14. Sensorineural hearing loss in children.

    Wormald, R

    2010-02-01

    The objective of the study was to examine the aetiology of sensorineural hearing loss (SNHL) in a paediatric population presenting to the National Centre of Medical Genetics. A retrospective chart review from 1998 to 2006. One hundred and twenty nine children were investigated for SNHL. The average age of diagnosis of hearing loss was 36 months. The degree of hearing loss was mild in 8 children, moderate in 33 children, severe in 31 children and profound in 57 children. Eighty-five children (66%) were diagnosed with a hereditary hearing loss, 11 (8%) children had an acquired hearing loss and no cause found in 33 (26%) children. This is the first report of the causes of hearing loss in Irish children. The mean age of diagnosis in our cohort is high and emphasises the need for a neonatal screening programme. There remains a number of children for whom the cause of hearing loss remains unknown.

  15. A precursor of β-delayed fission:230Ac

    2002-01-01

    The 230Ra has been produced via multinucleon transfer and dissipativefragmentation of heavy target in the 60 MeV/u 18O ion reaction with natural thorium.The radium was radiochemically separated from irradiated thorium targets. 230Acwas obtained by 230Ra β-→ 230Ac. Thin Ra sources were prepared for observing fissionfragments from β-delayed fission of 230Ac. The sources were exposed to the micafission track detectors and measured by a HPGe γ detector. The two fission eventswere obtained and could been assigned to theβ-delayed fission of 230Ac. The β-delayedfission probability of 230Ac was determined to be (1.19+0.85) × 10-8.

  16. AC susceptibility of polycrystalline (Bi-Pb 2223 superconductors

    H. Salamati

    2004-06-01

    Full Text Available   The temperature dependence of ac susceptibility of (Bi-Pb2223 polycrystalline samples was measured as a function of frequency and ac field amplitude. Analysis of the temperature dependence of the AC susceptibility near the transition temperature (Tc has been done employing Bean’s critical state model. The observed variation of intergranular critical current densities (Jc with temperature indicates that the weak links are superconductor- normal metal-superconductor (SNS type for this sample. The frequency effect on AC susceptibility was also measured. As the frequency increases, (TP shifts to higher temperatures. This effect can be interpreted in terms of flux creep. The temperature T, and field, , dependence of activation energy obtained from the Arrhenius plot for the frequency ( f and ( TP , can be described as: U(Hac,T=U0(1-T/TCHac-0.18

  17. Performance of an x-ray microcalorimeter under ac biasing

    Frequency domain multiplexing (FDM) is an attractive option for the readout of imaging arrays of microcalorimeters. Implementation of FDM requires ac biasing of the individual microcalorimeters. In this letter we present a small signal model for the behavior of a microcalorimeter under ac bias. Moreover, we have measured the behavior of the same microcalorimeter under ac (at 46 kHz) and dc bias. These experiments show that the performance of the device is very similar in terms of energy resolution, pulse shapes, and current-voltage characteristics. The measured energy resolution at 5.89 keV is 6.9 eV for ac bias and 5.5 eV for dc bias. The effective time constant in both cases is 100 μs

  18. Dc to ac converter operates efficiently at low input voltages

    1965-01-01

    Self-oscillating dc to ac converter with transistor switching to produce a square wave output is used for low and high voltage power sources. The converter has a high efficiency throughout a wide range of loads.

  19. Ferromagnetic resonance driven by an ac current: a brief review

    Excitation of ferromagnetic resonance (FMR) by an ac current has been observed in macroscopic ferromagnetic films for decades and typically relies on the ac Oersted field of the current to drive magnetic moments into precession and classical rectification of ac signals to detect the resonance. Recently, current-driven ferromagnetic resonances have attracted renewed attention with the discovery of the spin-transfer torque (STT) effect due to its potential applications in magnetic memory and microwave technologies. Here STT associated with the ac current is used to drive magnetodynamics on the nanoscale that enables FMR studies in sample volumes smaller by a factor of 1000 compared to conventional resonance techniques. In this paper, we briefly review the basics of STT-FMR technique and the results of various STT-FMR experiments.

  20. c-axis ac susceptibility in high-Tc superconductors

    We have investigated the angle and magnetic field dependence of the ac susceptibility in Bi2Sr2CaCu2O8 and YBa2Cu3O7 single crystals at low external fields. The ac field was applied perpendicular to the CuO2 planes. The first and third harmonics of the ac susceptibility exhibit remarkably sharp features when the dc field component perpendicular to the CuO2 planes passes a threshold field Hth. Hth is strongly temperature dependent, but is independent of the parallel field component. We propose a simple model which excellently explains the data. Within this model the peak structures are related to the irreversibility line. We discuss the implications of the model for the interpretation of the ac susceptibility. copyright 1996 The American Physical Society

  1. Fabrication of alumina films with laminated structures by ac anodization

    Anodization techniques by alternating current (ac) are introduced in this review. By using ac anodization, laminated alumina films are fabricated. Different types of alumina films consisting of 50–200 nm layers were obtained by varying both the ac power supply and the electrolyte. The total film thickness increased with an increase in the total charge transferred. The thickness of the individual layers increased with the ac voltage; however, the anodization time had little effect on the film thickness. The laminated alumina films resembled the nacre structure of shells, and the different morphologies exhibited by bivalves and spiral shells could be replicated by controlling the rate of increase of the applied potentials. (paper)

  2. American Community Survey (ACS) 5-Year Estimates for Coastal Geographies

    National Oceanic and Atmospheric Administration, Department of Commerce — The American Community Survey (ACS) is an ongoing statistical survey that samples a small percentage of the population every year. These data have been apportioned...

  3. Vertigo and hearing loss.

    Newman-Toker, David E; Della Santina, Charles C; Blitz, Ari M

    2016-01-01

    Symptoms referable to disorders affecting the inner ear and vestibulocochlear nerve (eighth cranial nerve) include dizziness, vertigo, tinnitus, and hearing loss, in various combinations. Similar symptoms may occur with involvement of the central nervous system, principally the brainstem and cerebellum, to which the vestibular and auditory systems are connected. Imaging choices should be tailored to patient symptoms and the clinical context. Computed tomography (CT) should be used primarily to assess bony structures. Magnetic resonance imaging (MRI) should be used primarily to assess soft-tissue structures. Vascular imaging by angiography or venography should be obtained when vascular lesions are suspected. No imaging should be obtained in patients with typical presentations of common peripheral vestibular or auditory disorders. In current clinical practice, neuroimaging is often overused, especially CT in the assessment of acute dizziness and vertigo in the emergency department. Despite low sensitivity for ischemic strokes, CT is often used to rule out neurologic causes. When ischemic stroke is the principal concern in acute vestibular presentations, imaging should almost always be by MRI with diffusion-weighted images, rather than CT. In this chapter, we describe recommended strategies for audiovestibular imaging based on patient symptoms and signs. PMID:27430449

  4. Magnetization Losses of Roebel Cable Samples with 2G YBCO Coated Conductor Strands

    Yang, Y.; Falorio, I.; Young, E.A.; Kario, A.; Goldacker, W.; Dhallé, M. M. J.; van Nugteren, J.; Kirby, G.; Bottura, L.; Ballarino, A.; 10.1109/TASC.2016.2525926

    2016-01-01

    Roebel cable with 2G YBCO strands is one of the promising HTS solutions of fully transposed high current conductors for high field accelerator magnets. Following the considerable research effort on the manufacturing of Roebel cables in recent years, sample conductors are now available in useful lengths with reproducible performances to allow detailed characterizations beyond the standard critical current measurements. The ac loss and strands coupling are of significant interest for the field quality of the accelerator magnets. We report a set of systematic ac loss measurements on two different Roebel cable samples prepared for the EuCARD2 collaboration. The measurements were performed over a wide range of temperature between 5 K and 90 K and the results were analyzed in the context of strands architecture and coupling. The results show that the transposed bundles are partially decoupled and the strands in transposition sections behave as an isolated single tape if the strands are insulated.

  5. dc and ac magnetic properties of thin-walled Nb cylinders with and without a row of antidots

    Tsindlekht, M. I.; Genkin, V. M.; Felner, I.; Zeides, F.; Katz, N.; Gazi, Š.; Chromik, Š.; Dobrovolskiy, O. V.; Sachser, R.; Huth, M.

    2016-06-01

    dc and ac magnetic properties of two thin-walled superconducting Nb cylinders with a rectangular cross-section are reported. Magnetization curves and the ac response were studied on as-prepared and patterned samples in magnetic fields parallel to the cylinder axis. A row of micron-sized antidots (holes) was made in the film along the cylinder axis. Avalanche-like jumps of the magnetization are observed for both samples at low temperatures for magnetic fields not only above H c1, but in fields lower than H c1 in the vortex-free region. The positions of the jumps are not reproducible and they change from one experiment to another, resembling vortex lattice instabilities usually observed for magnetic fields larger than H c1. At temperatures above 0.66{{T}\\text{c}} and 0.78{{T}\\text{c}} the magnetization curves become smooth for the patterned and the as-prepared samples, respectively. The magnetization curve of a reference planar Nb film in the parallel field geometry does not exhibit jumps in the entire range of accessible temperatures. The ac response was measured in constant and swept dc magnetic field modes. Experiment shows that ac losses at low magnetic fields in a swept field mode are smaller for the patterned sample. For both samples the shapes of the field dependences of losses and the amplitude of the third harmonic are the same in constant and swept field near H c3. This similarity does not exist at low fields in a swept mode.

  6. Muc5ac mucin expression during rat skin development

    V. Ferretti; Á. Segal-Eiras; Barbeito, C.G.; Croce, M. V.

    2015-01-01

    Some mucin genes have been detected during human embryonic and fetal organ development; however, little is known about mucin expression in epidermal development, neither in humans nor in other species. The present research was developed to explore Muc5ac skin expression during prenatal and postnatal rat development. Immunohistochemistry (IHC), Western blotting (WB) and RT-PCR were employed. By IHC, Muc5ac protein was found early in embryonic epidermis from day 13 of gestation until seven days...

  7. Dynamics of a nanowire superlattice in an ac electric field

    Zhang, Aizhen; Voon, L. C. Lew Yan; M. Willatzen

    2005-01-01

    With a one-band envelope function theory, we investigate the dynamics of a finite nanowire superlattice driven by an ac electric field by solving numerically the time-dependent Schroedinger equation. We find that for an ac electric field resonant with two energy levels located in two different minibands, the coherent dynamics in nanowire superlattices is much more complex as compared to the standard two-level description. Depending on the energy levels involved in the transitions, the coheren...

  8. Fractal AC circuits and propagating waves on fractals

    Akkermans, Eric; Dunne, Gerald; Rogers, Luke G; Teplyaev, Alexander

    2015-01-01

    We extend Feynman's analysis of the infinite ladder AC circuit to fractal AC circuits. We show that the characteristic impedances can have positive real part even though all the individual impedances inside the circuit are purely imaginary. This provides a physical setting for analyzing wave propagation of signals on fractals, by analogy with the Telegrapher's Equation, and generalizes the real resistance metric on a fractal, which provides a measure of distance on a fractal, to complex impedances.

  9. Autonomous Operation of Hybrid Microgrid With AC and DC Subgrids

    Chiang Loh, Poh; Li, Ding; Kang Chai, Yi;

    2013-01-01

    This paper investigates on power-sharing issues of an autonomous hybrid microgrid. Unlike existing microgrids which are purely ac, the hybrid microgrid studied here comprises dc and ac subgrids interconnected by power electronic interfaces. The main challenge here is to manage power flows among all...... converters. Suitable control and normalization schemes are now developed for controlling them with the overall hybrid microgrid performance already verified in simulation and experiment....

  10. AC resistivity of d-wave ceramic superconductors

    Li, Mai Suan; Dominguez, Daniel

    2000-01-01

    We model d-wave ceramic superconductors with a three-dimensional lattice of randomly distributed $\\pi$ Josephson junctions with finite self-inductance. The linear and nonlinear ac resistivity of the d-wave ceramic superconductors is obtained as function of temperature by solving the corresponding Langevin dynamical equations. We find that the linear ac resistivity remains finite at the temperature $T_p$ where the third harmonics of resistivity has a peak. The current amplitude dependence of t...

  11. Scaling and universality of ac conduction in disordered solids

    Schrøder, Thomas; Dyre, Jeppe

    2000-01-01

    Recent scaling results for the ac conductivity of ionic glasses by Roling et al. [Phys. Rev. Lett. 78, 2160 (1997)] and Sidebottom [Phys. Rev. Lett. 82, 3653 (1999)] are discussed. We prove that Sidebottom's version of scaling is completely general. A new approximation to the universal ac conduct...... conductivity arising in the extreme disorder limit of the symmetric hopping model, the "diffusion cluster approximation," is presented and compared to computer simulations and experiments....

  12. Dipole relaxation losses in DNA

    Briman, M.; N. P. Armitage; Helgren, E.; Gruner, G.

    2003-01-01

    The electrodynamic response of DNA in the millimeter wave range is investigated. By performing measurements under a wide range of humidity conditions and comparing the response of single strand DNA and double strand DNA, we show that the appreciable AC conductivity of DNA is not due to photon activated hopping between localized states, but instead due to dissipation from dipole motion in the surrounding water helix. Such a result, where the conductivity is due to the constrained motion of ove...

  13. ISTTOK upgrade towards AC and remote operation

    ISTTOK has performed one of the earliest experiments of AC tokamak operation showing that long discharges could be produced merely with inductive current drive. However, due to the design of the machine, the data acquisition system and the power supplies, a limit of 250 ms (six times the nominal forward shot duration) is currently imposed.In this paper the relevant constrains to attain current operation up to the limit of the stable toroidal magnetic field (3s) are discussed and the work being carried out to achieve this goal is presented.The conditions that shall be accomplished are: (i) removing the power deposited on the limiters; (ii) density control through gas puffing and monitoring the recycling from the walls; (iii) assessment of the free magnetic flux available on the iron core (Wmax=0.2 Vs); (iv) reformulation of the data acquisition system towards an event driven philosophy maintaining the actual distributed architecture but allowing a real-time control; (v) active control of the equilibrium magnetic fields implementing a digital plasma position estimator and actuator through new power supplies for the poloidal magnetic fields. As a new high level software was needed to implement all this features, the ISTTOK data acquisition system and control has been totally redesigned in JAVA/SQL database technology and time stamps events were adopted to catalogue the data. This software has been design keeping in mind the needs for remote participation and operation of the machine. Therefore, a cooperative environment has been implemented where several persons can be connected together to the platform, programming their own devices and exchanging knowledge or opinions through an embedded chat

  14. ISTTOK upgrade towards AC and remote operation

    Fernandes, H.; Silva, C.; Carvalho, B.; Sousa, J.; Valcárcel, D.; Neto, A.; Fortunato, J.; Carvalho, I.; Varandas, C. A. F.

    2006-12-01

    ISTTOK has performed one of the earliest experiments of AC tokamak operation showing that long discharges could be produced merely with inductive current drive. However, due to the design of the machine, the data acquisition system and the power supplies, a limit of 250 ms (six times the nominal forward shot duration) is currently imposed. In this paper the relevant constrains to attain current operation up to the limit of the stable toroidal magnetic field (3s) are discussed and the work being carried out to achieve this goal is presented. The conditions that shall be accomplished are: (i) removing the power deposited on the limiters; (ii) density control through gas puffing and monitoring the recycling from the walls; (iii) assessment of the free magnetic flux available on the iron core (Wmax=0.2 Vs); (iv) reformulation of the data acquisition system towards an event driven philosophy maintaining the actual distributed architecture but allowing a real-time control; (v) active control of the equilibrium magnetic fields implementing a digital plasma position estimator and actuator through new power supplies for the poloidal magnetic fields. As a new high level software was needed to implement all this features, the ISTTOK data acquisition system and control has been totally redesigned in JAVA/SQL database technology and time stamps events were adopted to catalogue the data. This software has been design keeping in mind the needs for remote participation and operation of the machine. Therefore, a cooperative environment has been implemented where several persons can be connected together to the platform, programming their own devices and exchanging knowledge or opinions through an embedded chat.

  15. Simulation of the Relaxation Potential Profile of an ac-dc-ac Test

    Kerry N. Allahar

    2014-01-01

    Full Text Available The relaxation period of the accelerated ac-dc-ac test for coatings is associated with the transient electrochemistry that occurs when the immersed coated system is allowed to return to a stable open-circuit condition after being subjected to a cathodic potential. A mathematical model of the transient electrochemistry that occurs during this relaxation period is presented for coated aluminum. Expressions for the corrosion potential and corrosion current as functions of the local pH at the metal-coating interface were developed using reported experimental results. These expressions enabled the simulation of the transient electrochemistry under the constraint of balanced anodic and cathodic current densities. Regression of the transient relaxation potential profiles to exponential decay functions provided time-constant characterization of the profiles. Simulated results are presented that demonstrate the influences of the coating's porosity and thickness, the applied dc potential and the metal-coating interface condition on the time-constants associated with the relaxation profile. Interpretation of experimentally reported relaxation potential profiles supported the analysis of the simulated results.

  16. Diagnostics of the Fermilab Tevatron using an AC dipole

    Miyamoto, Ryoichi; /Texas U.

    2008-08-01

    The Fermilab Tevatron is currently the world's highest energy colliding beam facility. Its counter-rotating proton and antiproton beams collide at 2 TeV center-of-mass. Delivery of such intense beam fluxes to experiments has required improved knowledge of the Tevatron's beam optical lattice. An oscillating dipole magnet, referred to as an AC dipole, is one of such a tool to non-destructively assess the optical properties of the synchrotron. We discusses development of an AC dipole system for the Tevatron, a fast-oscillating (f {approx} 20 kHz) dipole magnet which can be adiabatically turned on and off to establish sustained coherent oscillations of the beam particles without affecting the transverse emittance. By utilizing an existing magnet and a higher power audio amplifier, the cost of the Tevatron AC dipole system became relatively inexpensive. We discuss corrections which must be applied to the driven oscillation measurements to obtain the proper interpretation of beam optical parameters from AC dipole studies. After successful operations of the Tevatron AC dipole system, AC dipole systems, similar to that in the Tevatron, will be build for the CERN LHC. We present several measurements of linear optical parameters (beta function and phase advance) for the Tevatron, as well as studies of non-linear perturbations from sextupole and octupole elements.

  17. [Steroid-responsive sensorineural hearing loss with low tone loss].

    Toriya, R; Yamashita, H; Hisashi, K; Komune, S; Komiyama, S

    1995-11-01

    Five cases of sensorineural hearing loss of sudden onset were reviewed. They were not responsive to administration of ATP and Vit. B12, but very responsive to steroid administration. All the patients were male and showed hearing loss in low frequencies in pure tone audiogram. Administration of steroid recovered hearing impairment immediately. However, cessation of steroid aggravated the recovered hearing. Serological and immunological examinations did not show any abnormal findings on all the patients. It was considered that these five patients had characteristics of both steroid-sensitive and low tone-loss type sensorineural hearing losses. PMID:8566929

  18. Plasma Heating and Losses in Toroidal Multipole Fields

    The heating and loss of plasmas have been studied in three pulsed, toroidal multipole devices: a large levitated octupole, a small supported octupole and a very small supported quadrupole. Plasmas are produced by gun injection and heated by electron and ion cyclotron resonance heating and ohmic heating. Electron cyclotron heating rates have been measured over a wide range of parameters, and the results are in quantitative agreement with stochastic heating theory. Electron cyclotron resonance heating produces ions with energies larger than predicted by theory. With the addition of a toroidal field, ohmic heating gives densities as high as 1013cm-3 in the toroidal quadrupole and 1012cm-3 in the small octupole. Plasma losses for n=5 x 109cm-3 plasmas are inferred from Langmuir probe and Fabry-Perot interferometer measurements, and measured with special striped collectors on the wall and rings. The loss to a levitated ring is measured using a modulated light beam telemeter. The confinement is better than Bohm but considerably worse than classical. Low frequency convective cells which are fixed in space are observed. These cells around the ring are diminished when a weak toroidal field is added, and loss collectors show a vastly reduced flux to the rings. Analysis of the spatial density profile shows features of B-independent diffusion. The confinement is sensitive to some kinds of dc field errors, but surprisingly insensitive to perturbations of the ac confining field

  19. Matrix Converter Bi-directional Switch Power Loss and Cooling Condition Estimation for Integrated Drives

    Sokolovs, A; Galkins, I

    2010-01-01

    In this paper power loss estimation of bi-directional switch of matrix converter is done by means of calculation and experiments. For safe operation of power devices an efficient cooling system of specific device must be designed. This work is part of a greater project of integrated matrix converter AC drives and the cooling problem here is viewed in context of this task. It is necessary to develop a compact power board and cooling system to extract excessive heat from power devices.

  20. Controlo de um conversor AC-DC-AC para turbinas eólicas baseadas no PMSG

    Bulhosa, João Paulo Rodrigues

    2009-01-01

    A dissertação teve como objectivo o estudo e implementação do controlo de um conversor AC-DC-AC, constituído por um conversor DC/DC elevador e um inversor de tensão monofásico, para efectuar a ligação à rede de turbinas eólicas baseadas no gerador síncrono de ímanes permanentes. O controlo global do conversor AC-DC-AC seguiu uma estratégia na qual o controlo do conversor elevador e do inversor de tensão monofásico é implementado de modo independente. O primeiro visa maximizar a potência ex...