WorldWideScience

Sample records for ac electro-osmotic pumps

  1. Ultrafast High-pressure AC Electro-osmotic Pumps for Portable Biomedical Microfluidics

    Huang, Chien-Chih; Thorsen, Todd

    2009-01-01

    This paper details the development of an integrated AC electro-osmotic (ACEO) microfluidic pump for dilute electrolytes consisting of a long serpentine microchannel lined with three dimensional (3D) stepped electrode arrays. Using low AC voltage (1 Volt rms, 1 kHz), power (5 mW) and current (3.5 mA) in water, the pump is capable of generating a 1.4 kPa head pressure, a 100-fold increase over prior ACEO pumps, and a 1.37 mm/sec effective slip velocity over the electrodes without flow reversal. The integrated ACEO pump can utilize low ionic strength solutions such as distilled water as the working solution to pump physiological strength (100 mM) biological solutions in separate microfluidic devices, with potential applications in portable or implantable biomedical microfluidic devices. As a proof-of-concept experiment, the use of the ACEO pumps for DNA hybridization in a microfluidic microarray is demonstrated.

  2. Simulation of an ac electro-osmotic pump with step microelectrodes

    Kim, Byoung Jae; Lee, Seung-Hyun; Rezazadeh, Soghra; Sung, Hyung Jin

    2011-05-01

    Pumps with step microelectrodes subjected to an ac voltage are known to have faster pumping rates than those with planar asymmetric microelectrodes. The driving force for pumping in these systems is ac electro-osmosis. This paper aims to understand the flow behaviors of pumps with step microelectrodes by using a realistic model applicable to high external voltages. This model takes the steric effect due to the finite sizes of ions into account and copes with the exponential sensitivity of the counterion concentration to voltage. The effects on the pumping flow rate of varying the pump parameters were investigated. The geometrical parameters were optimized, and the effects of varying the ac frequency and amplitude were examined. The electrical potential of the fluid and the electrical charge at the electrode surface were solved simultaneously, and the Stokes equation was used to describe the fluid flow.

  3. Maximum efficiency of the electro-osmotic pump

    Xu, Zuli; Miao, Jianying; Wang, Ning; Wen, Weijia; Sheng, Ping

    2011-06-01

    Electro-osmotic effect in a porous medium arises from the electrically charged double layer at the fluid-solid interface, whereby an externally applied electric field can give rise to fluid flow. The electro-osmotic pump (EOP) is potentially useful for a variety of engineering and biorelated applications, but its generally low efficiency is a negative factor in this regard. A study to determine the optimal efficiency of the EOP and the condition(s) under which it can be realized is therefore of scientific interest and practical importance. We present the results of a theoretical and experimental study on the maximum efficiency optimization of the electrokinetic effect in artificially fabricated porous media with controlled pore diameters. It is shown that whereas the EOP efficiency increases with decreasing channel diameter, from 4.5 to 2.5 μm for samples fabricated on oxidized silicon wafers as expected for the interfacial nature of the electro-osmotic effect, the opposite trend was observed for samples with much smaller channel diameters fabricated on anodized aluminum oxide films, with the pore surface coated with silica. These results are in agreement with the theoretical prediction, based on the competition between interfacial area and the no-slip flow boundary condition, that an optimal efficiency of ˜1% is attained at a microchannel diameter that is five times the Debye length, with a zeta potential of ˜100 mV.

  4. Fabrication and study of AC electro-osmotic micropumps

    Guo, Xin

    In this thesis, microelectrode arrays of micropumps have been designed, fabricated and characterized for transporting microfluid by AC electro-osmosis (ACEO). In particular, the 3D stepped electrode design which shows superior performance to others in literature is adopted for making micropumps, and the performance of such devices has been studied and explored. A novel fabrication process has also been developed in the work, realizing 3D stepped electrodes on a flexible substrate, which is suitable for biomedical use, for example glaucoma implant. There are three major contributions to ACEO pumping in the work. First, a novel design of 3D "T-shaped" discrete electrode arrays was made using PolyMUMPsRTM process. The breakthrough of this work was discretizing the continuous 3D stepped electrodes which were commonly seen in the past research. The "T-shaped" electrodes did not only create ACEO flows on the top surfaces of electrodes but also along the side walls between separated electrodes. Secondly, four 3D stepped electrode arrays were designed, fabricated and tested. It was found from the experiment that PolyMUMPsRTM ACEO electrodes usually required a higher driving voltage than gold electrodes for operation. It was also noticed that a simulation based on the modified model taking into account the surface oxide of electrodes showed a better agreement with the experimental results. It thus demonstrated the possibility that the surface oxide of electrodes had impact on fluidic pumping. This methodology could also be applied to metal electrodes with a native oxide layer such as titanium and aluminum. Thirdly, a prototype of the ACEO pump with 3D stepped electrode arrays was first time realized on a flexible substrate using Kapton polyimide sheets and packaged with PDMS encapsulants. Comprehensive experimental testing was also conducted to evaluate the mechanical properties as well as the pumping performance. The experimental findings indicated that this fabrication

  5. Electro-osmotic pumping and ion-concentration polarization based on conical nanopores

    Yeh, Hung-Chun; Chang, Chih-Chang; Yang, Ruey-Jen

    2015-06-01

    A numerical investigation is performed into the characteristics of an electro-osmotic pump consisting of a negatively charged conical nanopore. It is shown that the dependence of the flow rectification effect on the bias direction is the reverse of that of the ion current rectification effect. Moreover, the nozzle mode (i.e., the bias is applied from the base side of the nanopore to the tip side) has a higher flow rate compared to the diffuser mode (i.e., the bias is applied from the tip side of the nanopore to the base side). The results showed that the ion-concentration polarization effect occurred inside the conical nanopore, resulting in surface conduction dominating in the ionic current. The ions inside the nanopore are depleted and enriched under the nozzle mode and the diffuser mode, respectively. As a result, the electro-osmotic pump yields a greater pumping pressure, flow rate, and energy conversion efficiency when operating in the nozzle mode. In addition, we also investigated the flow rate rectification behavior for the conical nanopore. The best flow rate rectification factor in this work is 2.06 for an electrolyte concentration of 10-3M .

  6. Heat-transfer enhancement in AC electro-osmotic micro-flows

    Liu, Z. P.; Speetjens, M. F. M.; Frijns, A. J. H.; van Steenhoven, A. A.

    2012-11-01

    Heat transfer in micro-flows is essential to emerging technologies as advanced microelectronics cooling systems and chemical processes in lab-on-a-chip applications. The present study explores the potential of AC electro-osmotic (ACEO) flow forcing, a promising technique for the actuation and manipulation of micro-flows, for heat-transfer enhancement. Subjects of investigation include the 3D flow structure due to ACEO forcing via an array of electrodes in a micro-channel by way of 3D velocity measurements. Presence and properties of vortical structures of the 3D flow are quantified in laboratory experiments. Typical outcomes of the experimental study result from a number of 3D particle trajectories obtained by using 3D micro-Particle-Tracking Velocimetry (3D μ-PTV). The steady nature of the flow enables combination of results from a series of measurements into one dense data set. This facilitates accurate evaluation of quantities relevant for heat transfer by data-processing methods. The primary circulation is given above one half of an electrode in terms of the spanwise component of vorticity. The outline of the vortex boundary is determined via the eigenvalues of the strain-rate tensor. To estimate convective heat transfer, wall shear rate above one half of an electrode is quantitatively analyzed as function of voltage amplitude and frequency. These results yield first insights into the characteristics of 3D ACEO flows and ways to exploit and manipulate them for heat-transfer enhancement.

  7. Particle and droplet dynamics and separation in AC electro-osmotic micropumps

    Typical tasks in life--sciences are the transport of small amounts of liquids as well as the segregation of suspended biological cells or particles in the microfluidic environment. In the last decade alternating-current electro-osmotic (ACEO) pumping has been found to be an effective means for transporting conductive fluids in microfluidic channels. The ACEO pumping channel is characterized by its configuration of periodic interdigitated electrode fingers on the channel bottom. If a harmonic voltage is applied, an electric double layer develops adjacent to the electrodes that electrically screens the applied potential. The motion of the charged surface layer due to the remaining electric field results in a net flow in the channel. This work proposes to use the ACEO pump not only for the transport of liquids but also for the systematic manipulation and separation of immersed particles. In order to achieve this an extensive study of the relevant forces and dynamics of particles and droplets in the resulting electro-kinetic channel flow is done. This work therefore analyzes the electric and the flow field by means of the finite element method and investigates the size and density dependent particle motion as a function of magnitude and frequency of the applied voltage. Furthermore, the deformation of droplets in the electrokinetic flow is investigated. Their motion is therefore analyzed by means of three-dimensional finite element computations of the respective two-phase flow, where surface tension forces and electrical stresses on the interface between droplet and carrier fluid are regarded. In the course of this work it is shown, that suspended particles and droplets are influenced by the interplay of viscous fluid drag, gravitation, surface tension and dielectrophoretic forces. Therein, the significant dependance of these forces on the particle properties allows for the separation with respect to mass--density and size. Based on this knowledge, channel designs are

  8. Ion fluxes and electro-osmotic fluid flow in electrolytes around a metallic nanowire tip under large applied ac voltage.

    Poetschke, M; Bobeth, M; Cuniberti, G

    2013-09-10

    Motivated by the analysis of electrochemical growth of metallic nanowires from solution, we studied ion fluxes near nanoelectrodes in a binary symmetric electrolyte on the basis of the modified Poisson-Nernst-Planck equations in the strongly nonlinear region at large applied ac voltage. For an approximate calculation of the electric field near the nanowire tip, concentric spherical blocking electrodes were considered with radius of the inner electrode being of typically a few ten nanometers. The spatiotemporal evolution of the ion concentrations within this spherical model was calculated numerically by using the finite element method. The potential drop at the electric double layer, the electric field enhancement at the electrode surface, and the field screening in the bulk solution were determined for different bulk concentrations, ac voltages, and frequencies. The appearance of ac electro-osmotic fluid flow at the tip of a growing metallic nanowire is discussed, based on an estimation of the body force in the liquid near the nanowire tip, which was modeled by a cylinder with hemispherical cap. Electric field components tangential to the electrode surface exist near the contact between cylinder and hemisphere. Our analysis suggests that ac electro-osmotic flow causes an additional convective transport of metal complexes to the tip of the growing metal nanowire and thus affects the nanowire growth velocity. PMID:23927385

  9. Electro-osmotic pumping and ionic conductance measurements in porous membranes

    Vajandar, Saumitra K.

    Electro-osmotic (EO) pumps directly convert electrical energy into fluids' kinetic energy, which have many advantages such as a simple and compact structure, no mechanical moving parts, and easy integration. In general, it is easy for EO pumps to generate enough pressure but it has been a challenge for EO pumps to produce a high flowrate. EO pumps have found applications in various micro-/nano-electro-mechanical systems (MEMS/NEMS) and have the potential to impact a variety of engineering fields including microelectronics cooling and bio-analytical systems. This dissertation focuses on the design, fabrication and characterization of EO pumps based on two novel porous membrane materials: SiO2-coated anodic porous alumina and SiNx-coated porous silicon. High quality porous alumina membranes of controllable pore diameters in the range of 30-100 nm and pore lengths of 60-100 mum were fabricated by electrochemical anodization. The pores are straight, uniform and hexagonally close-packed with a high porosity of up to 50%. The inner surface of the pore was coated with a thin layer (˜5 nm) of SiO2 conformally to achieve a high zeta potential. The EO pumping flowrate of the fabricated anodic alumina membranes, coated and uncoated, was experimentally measured. Results indicate that the high zeta potential of the SiO2 coating increases the pumping flowrate even though the coating reduces the porosity of the membrane. The nanostructured SiO2-coated porous anodic alumina membranes can provide a normalized flowrate of 0.125 ml/min/V/cm2 under a low effective applied voltage of 3 V, which sets a record high normalized flowrate under low applied voltage. To realize field effect control of EO pumping, we designed and fabricated SiNx-coated porous silicon membranes with the silicon core as the electrode to apply a transverse gate potential. The gate potential will modulate the zeta potential of the pore wall and thereby provide control over the EO flowrate. The membranes were

  10. Electro-osmotic flow of a second-grade fluid in a porous microchannel subject to an AC electric field

    MISRA J.C.; CHANDRA S.

    2013-01-01

    Studies on electro-osmotic flows of various types of fluids in microcharmel are of great importance owing to their multifold applications in the transport of liquids,particularly when the ionized liquid flows with respect to a charged surface in the presence of an external electric field.In the case of viscoelastic fluids,the volumetric flow rate differs significantly from that of Newtonian fluids,even when the flow takes place under the same pressure gradient and the same electric field.With this end in view,this paper is devoted to a study concerning the flow pattern of an electro-osmotic flow in a porous microchannel,which is under the action of an alternating electric field.The influence of various rheologieal and electro-osmotic parameters,e.g.,the Reynolds number,Debye-Huckel parameter,shape factor and fluid viscoelasticity on the kinematics of the fluid,has been investigated for a second-grade viscoelastic fluid.The problem is first treated by using analytical methods,but the quantitative estimates are obtained numerically with the help of the software MATHEMATICA.The results presented here are applicable to the cases where the channel height is much greater than the thickness of the electrical double layer comprising the Stern and diffuse layers.The study reveals that a larger value of the Debye-Huckel parameter creates sharper profile near the wall and also that the velocity of electro-osmotic flow increases as the permeability of the porous microchannel is enhanced.The study further shows that the electro-osmotic flow dominates at lower values of Reynolds number.The results presented here will be quite useful to validate the observations of experimental investigations on the characteristics of electro-osmotic flows and also the results of complex numerical models that are necessary to deal with more realistic situations,where electro-osmotic flows come into the picture,as in blood flow in the micro-circulatory system subject to an electric field.

  11. Multi-functional Lagrangian flow structures in three-dimensional ac electro-osmotic micro-flows

    Flow forcing by ac electro-osmosis (ACEO) is a promising technique for the actuation and manipulation of micro-flows. Utilization to date mainly concerns pumping and mixing. However, emerging micro-fluidic applications demand further functionalities. The present study explores the first ways to systematically realize this in three-dimensional (3D) micro-flows using ACEO. This exploits the fact that continuity 'organizes' Lagrangian fluid trajectories into coherent structures that geometrically determine the transport properties. Lagrangian flow structures typically comprise families of concentric tubular structures, acting both as transport barriers and as transport conduits, embedded in chaotic regions. Numerical simulations of representative case studies demonstrate that ACEO, possibly in combination with other forcing mechanisms, has the potential to tailor these features into multi-functional Lagrangian flow structures that can fulfill various transport purposes. This may greatly enhance the functionality and versatility of labs-on-a-chip.

  12. Equilibrium Electro-osmotic Instability

    Rubinstein, Isaak

    2014-01-01

    Since its prediction fifteen years ago, electro-osmotic instability has been attributed to non-equilibrium electro-osmosis related to the extended space charge which develops at the limiting current in the course of concentration polarization at a charge-selective interface. This attribution had a double basis. Firstly, it has been recognized that equilibrium electro-osmosis cannot yield instability for a perfectly charge-selective solid. Secondly, it has been shown that non-equilibrium electro-osmosis can. First theoretical studies in which electro-osmotic instability was predicted and analyzed employed the assumption of perfect charge-selectivity for the sake of simplicity and so did the subsequent numerical studies of various time-dependent and nonlinear features of electro-osmotic instability. In this letter, we show that relaxing the assumption of perfect charge-selectivity (tantamount to fixing the electrochemical potential in the solid) allows for equilibrium electro-osmotic instability. Moreover, we s...

  13. Ionic Origin of Electro-osmotic Flow Hysteresis

    Lim, Chun Yee; Lim, An Eng; Lam, Yee Cheong

    2016-02-01

    Electro-osmotic flow, the driving of fluid at nano- or micro- scales with electric field, has found numerous applications, ranging from pumping to chemical and biomedical analyses in micro-devices. Electro-osmotic flow exhibits a puzzling hysteretic behavior when two fluids with different concentrations displace one another. The flow rate is faster when a higher concentration solution displaces a lower concentration one as compared to the flow in the reverse direction. Although electro-osmotic flow is a surface phenomenon, rather counter intuitively we demonstrate that electro-osmotic flow hysteresis originates from the accumulation or depletion of pH-governing minority ions in the bulk of the fluid, due to the imbalance of electric-field-induced ion flux. The pH and flow velocity are changed, depending on the flow direction. The understanding of electro-osmotic flow hysteresis is critical for accurate fluid flow control in microfluidic devices, and maintaining of constant pH in chemical and biological systems under an electric field.

  14. Equilibrium Electro-osmotic Instability

    Rubinstein, Isaak; Zaltzman, Boris

    2014-01-01

    Since its prediction fifteen years ago, electro-osmotic instability has been attributed to non-equilibrium electro-osmosis related to the extended space charge which develops at the limiting current in the course of concentration polarization at a charge-selective interface. This attribution had a double basis. Firstly, it has been recognized that equilibrium electro-osmosis cannot yield instability for a perfectly charge-selective solid. Secondly, it has been shown that non-equilibrium elect...

  15. An analysis of electro-osmotic and magnetohydrodynamic heat pipes

    Mechanically simple methods of improving heat transport in heat pipes are investigated. These methods are electro-osmotic and magnetohydrodynamic augmentation. For the electro-osmotic case, a detailed electrokinetic model is used. The electrokinetic model used includes the effects of pore surface curvature and multiple ion diffusivities. The electrokinetic model is extended to approximate the effects of elevated temperature. When the electro-osmotic model is combined with a suitable heat-pipe model, it is found that the electro-osmotic pump should be a thin membrane. Arguments are provided that support the use of a volatile electrolyte. For the magnetohydrodynamic case, a brief investigation is provided. A quasi-one-dimensional hydromagnetic duct flow model is used. This hydromagnetic model is extended to approximate flow effects unique to heat pipes. When combined with a suitable heat pipe model, it is found that there is no performance gain for the case considered. In fact, there are serious pressure-distribution problems that have not been previously recognized. Potential solutions to these pressure-distribution problems are suggested

  16. Electro-osmotic flow enhancement in carbon nanotube membranes.

    Mattia, Davide; Leese, Hannah; Calabrò, Francesco

    2016-02-13

    In this work, experimental evidence of the presence of electro-osmotic flow (EOF) in carbon nanotube membranes with diameters close to or in the region of electrical double layer overlap is presented for two different electrolytes for the first time. No EOF in this region should be present according to the simplified theoretical framework commonly used for EOF in micrometre-sized channels. The simplifying assumptions concern primarily the electrolyte charge density structure, based on the Poisson-Boltzmann (P-B) equation. Here, a numerical analysis of the solutions for the simplified case and for the nonlinear and the linearized P-B equations is compared with experimental data. Results show that the simplified solution produces a significant deviation from experimental data, whereas the linearized solution of the P-B equation can be adopted with little error compared with the full P-B case. This work opens the way to using electro-osmotic pumping in a wide range of applications, from membrane-based ultrafiltration and nanofiltration (as a more efficient alternative to mechanical pumping at the nanoscale) to further miniaturization of lab-on-a-chip devices at the nanoscale for in vivo implantation. PMID:26712647

  17. Electro-osmotic flows inside triangular microchannels

    This work presents a numerical investigation of both pure electro-osmotic and combined electro-osmotic/pressure-driven flows inside triangular microchannels. A finite element analysis has been adopted to solve the governing equations for the electric potential and the velocity field, accounting for a finite thickness of the electric double layer. The influence of non-dimensional parameters such as the aspect ratio of the cross-section, the electrokinetic diameter and the ratio of the pressure force to the electric force on the flow behavior has been investigated. Numerical results point out that the velocity field is significantly influenced by the aspect ratio of the cross section and the electrokinetic diameter. More specifically, the aspect ratio plays an important role in determining the maximum volumetric flow rate, while the electrokinetic diameter is crucial to establishing the range of pressures that may be sustained by the electro-osmotic flow. Numerical results are also compared with two correlations available in the literature which enable to assess the volumetric flow rate and the pressure head for microchannels featuring a rectangular, a trapezoidal or an elliptical cross-section.

  18. Anisotropic electro-osmotic flow over super-hydrophobic surfaces

    Bahga, Supreet S.; Vinogradova, Olga I.; Bazant, Martin Z.

    2009-01-01

    Patterned surfaces with large effective slip lengths, such as super-hydrophobic surfaces containing trapped gas bubbles, have the potential to greatly enhance electrokinetic phenomena. Existing theories assume either homogeneous flat surfaces or patterned surfaces with thin double layers (compared to the texture correlation length) and thus predict simple surface-averaged, isotropic flows (independent of orientation). By analyzing electro-osmotic flows over striped slip-stick surfaces with ar...

  19. Augmentation of peristaltic microflows through electro-osmotic mechanisms

    The present work aims to theoretically establish that the employment of an axial electric field can substantially augment the rate of microfluidic transport occurring in peristaltic microtubes. For theoretical analysis, shape evolution of the tube is taken to be arbitrary, except for the fact that the characteristic wavelength is assumed to be significantly greater than the average radius of cross section. First, expressions for the velocity profile within the tube are derived and are subsequently utilized to obtain variations in the net flow rate across the same, as a function of the pertinent system parameters. Subsequently, the modes of interaction between the electro-osmotic and peristaltic mechanisms are established through the variations in the time-averaged flow rates for zero pressure rise and the pressure rise for zero time-averaged flow rates, as expressed in terms of the occlusion number, characteristic electro-osmotic velocity and the peristaltic wave speed. From the simulation predictions, it is suggested that a judicious combination of peristalsis and an axial electrokinetic body force can drastically enhance the time-averaged flow rate, provided that the occlusion number is relatively small

  20. Applications of Electro-Osmotic Transport in the Processing of Textiles

    Cooper, J.F.; Krueger, R.; Hopper, R.; Cherepy, N.

    1999-11-29

    We report development of a pilot process for the industrial rinsing of fabrics. This process combines hydraulic (pressure-driven) transport with electro-osmotic transport. It reduces the total amount of water required in certain rinsing operations by a factor of about five. Cotton exhibits an electro-osmotic transport coefficient of about 6 x 10{sup -9} m{sup 2}/s-V resulting from a partial ionization of hydroxyl groups on the cellulose polymer substrate. This process applies a field transverse to the fabric to effect the movement of water in the spaces between the 10 {micro}m cotton fibers which constitute the yam. The field strength is adjusted so that the induced electro-osmotic flux is comparable to a pressure-driven flux, which moves preferentially in the more open channels between the yams. For a fixed current density, solution conductivity and electro-osmotic transport vary inversely. The process is most practical for removal of liquids of relatively low conductivity (<500 {micro}S/cm). For removal of solutions of conductivity greater than 1200 {micro}S/cm, the rate of electro-osmotic flow may be too low to benefit the rinsing process if current densities are restricted to practical levels of about 30 mA/cm{sup 2}. Electra-osmotic transport may have important applications in wet processing of extremely fine textiles, such as micro fiber fabrics. In addition to rinsing, electro-osmotic transport may also be used to speed the penetration of chemicals and dyestuffs that are applied to the surface of wet textiles.

  1. Low-frequency oscillations of the impedance of electrolyte moving in an electro-osmotic regime

    Kompan, M. E.; Malyshkin, V. G.; Goffman, V. G.

    2014-07-01

    The impedance of a liquid electrolyte has been studied under the conditions of electro-osmotic flow. It is found that the impedance exhibits oscillations in the region of subhertz frequencies, which are related to resonant mechanical oscillations arising in the flow. Assumptions concerning the type of these resonant oscillations are formulated based on the observed spectrum of impedance oscillations.

  2. Experimental Verification of Overlimiting Current by Surface Conduction and Electro-osmotic Flow in Microchannels

    Nam, Sungmin; Heo, Joonseong; Lim, Geunbae; Bazant, Martin Z; Sung, Gunyong; Kim, Sung Jae

    2014-01-01

    Possible mechanisms of overlimiting current in unsupported electrolytes, exceeding diffusion limitation, have been intensely studied for their fundamental significance and applications to desalination, separations, sensing, and energy storage. In bulk membrane systems, the primary physical mechanism is electro-convection, driven by electro-osmotic instability on the membrane surface. It has recently been predicted that confinement by charged surfaces in microchannels or porous media favors two new mechanisms, electro-osmotic flow (EOF) and surface conduction (SC), driven by large electric fields in the depleted region acting on the electric double layers on the sidewalls. Here, we provide the first direct evidence for the transition from SC to EOF above a critical channel height, using in situ particle tracking and current-voltage measurements in a micro/nanofluidic device. The dependence of the over-limiting conductance on channel depth (d) is consistent with theoretical predictions, scaling as d^-1 for SC a...

  3. Effect of Electro-Osmotic Flow on Energy Conversion on Superhydrophobic Surfaces

    Seshadri, Gowrishankar

    2013-01-01

    It has been suggested that superhydrophobic surfaces, due to the presence of a no-shear zone, can greatly enhance transport of surface charges, leading to a considerable increase in the streaming potential. This could find potential use in micro-energy harvesting devices. In this paper, we show using analytical and numerical methods, that when a streaming potential is generated in such superhydrophobic geometries, the reverse electro-osmotic flow and hence current generated by this, is significant. A decrease in streaming potential compared to what was earlier predicted is expected. We also show that, due to the electro-osmotic streaming-current, a saturation in both the power extracted and efficiency of energy conversion is achieved in such systems for large values of the free surface charge densities. Nevertheless, under realistic conditions, such microstructured devices with superhydrophobic surfaces have the potential to even reach energy conversion efficiencies only achieved in nanostructured devices so ...

  4. Effects of Micromachining Processes on Electro-Osmotic Flow Mobility of Glass Surfaces

    Norihisa Miki; Koichi Hishida; Reiko Kuriyama; Yohei Sato; Yosuke Koga

    2013-01-01

    Silica glass is frequently used as a device material for micro/nano fluidic devices due to its excellent properties, such as transparency and chemical resistance. Wet etching by hydrofluoric acid and dry etching by neutral loop discharge (NLD) plasma etching are currently used to micromachine glass to form micro/nano fluidic channels. Electro-osmotic flow (EOF) is one of the most effective methods to drive liquids into the channels. EOF mobility is affected by a property of the micromachined ...

  5. Analysis of electro-osmotic flow in a microchannel with undulated surfaces

    Yoshida, Hiroaki; Washizu, Hitoshi

    2016-01-01

    The electro-osmotic flow through a channel between two undulated surfaces induced by an external electric field is investigated. The gap of the channel is very small and comparable to the thickness of the electrical double layers. A lattice Boltzmann simulation is carried out on the model consisting of the Poisson equation for electrical potential, the Nernst--Planck equation for ion concentration, and the Navier--Stokes {\\color{black}equations} for flows of the electrolyte solution. An analytical model that predicts the flow rate is also derived under the assumption that the channel width is very small compared with the characteristic length of the variation along the channel. The analytical results are compared with the numerical results obtained by using the lattice Boltzmann method. In the case of a constant surface charge density along the channel, the variation of the channel width reduces the electro-osmotic flow, and the flow rate is smaller than that of a straight channel. In the case of a surface ch...

  6. Electro-osmotic fluxes in multi-well electro-remediation processes.

    López-Vizcaíno, Rubén; Sáez, Cristina; Mena, Esperanza; Villaseñor, Jose; Cañizares, Pablo; Rodrigo, Manuel A

    2011-01-01

    In recent years, electrokinetic techniques on a laboratory scale have been studied but few applications have been assessed at full-scale. In this work, a mock-up plant with two rows of three electrodes positioned in semipermeable electrolyte wells has been used to study the electro-osmotic flux distribution. Water accumulated in the cathodic wells when an electric voltage gradient was applied between the two electrode-well rows. Likewise, slight differences in the water flux were observed depending on the position and number of electrodes used and on the voltage gradient applied. Results show that the electro-osmotic flow did not increase proportionally with the number of electrodes used. During the start-up of the study, there was an abrupt change in the current density, pH and conductivity of the soil portions closest to electrodic wells due to electrokinetic processes. These differences can be explained in terms of the complex current distributions from anode and cathode rows. PMID:22029697

  7. Suppression of nano-channel ion conductance by electro-osmotic flow

    Liu, Yang; Zhu, Xin; Ran, Qiushi; Dutton, Robert

    2016-01-01

    This theoretical study concerns a basic understanding of ion transport in nano-channels that have weakly overlapping electric double layers. Numerical simulations reveal that the electro-osmotic flow (EOF) interplays with the concentration-polarization process and drives the ion depletion zone into the channels, thus significantly suppressing the channel conductance. The conductance may be restored at high electrical biases in the presence of recirculating vortices within the channels. Further analysis are conducted based on a 1-D, long channel model, and analytic expressions derived to quantitatively account for the EOF-driven ion depletion process. A limiting-conductance behavior is revealed as intrinsically different from the classical limiting-current behavior.

  8. Non-steady electro-osmotic flow of a micropolar fluid in a microchannel

    We formulated the initial-boundary-value problem of non-steady electro-osmotic flow of a micropolar fluid in a rectangular microchannel of height much larger than the Debye length and length much larger the height. Solving the governing differential equations numerically when a spatially uniform electric field is applied as an impulse of finite magnitude, we found that the effect is instantaneous on the flow, just as for simple Newtonian fluids. The decay times of the fluid velocity and the microrotation, however, are smaller in micropolar fluids than in simple Newtonian fluids. The maximum magnitude of microrotation decreases as the micropolarity increases. The effect of microrotation on the stress tensor is more dominant than that of the fluid speed, and a threshold effect with respect to the magnitude of the zeta potential is evident in the spatial profile of the couple stress tensor. We expect similar trends even when the applied electric field varies over some finite interval of time.

  9. Topology and shape optimization of induced-charge electro-osmotic micropumps

    Gregersen, Misha Marie; Okkels, Fridolin; Bazant, M. Z.; Bruus, Henrik

    2009-01-01

    For a dielectric solid surrounded by an electrolyte and positioned inside an externally biased parallel-plate capacitor, we study numerically how the resulting induced-charge electro-osmotic (ICEO) flow depends on the topology and shape of the dielectric solid. In particular, we extend existing...... conventional electrokinetic models with an artificial design field to describe the transition from the liquid electrolyte to the solid dielectric. Using this design field, we have succeeded in applying the method of topology optimization to find system geometries with non-trivial topologies that maximize the...... design field. Our results show the importance of the topology and shape of the dielectric solid in ICEO systems and point to new designs of ICEO micropumps with significantly improved performance....

  10. Experimental and theoretical investigations of non-Newtonian electro-osmotic driven flow in rectangular microchannels.

    Huang, Yi; Chen, Juzheng; Wong, TeckNeng; Liow, Jong-Leng

    2016-07-20

    With the development of microfluidics, electro-osmotic (EO) driven flow has gained intense research interest as a result of its unique flow profile and the corresponding benefits in its application in the transportation of sensitive samples. Sensitive samples, such as DNA, are incapable of enduring strong flow shear induced by conventional hydrodynamic driven methods. EO driven flow is thus a niche area. However, even though there are a few research studies focusing on bio-fluidic samples related to EO driven flow, the majority of them are merely theoretical modeling without solid evidence from experiments due to the inherent complex rheological behavior of the bio-fluids. Challenges occur when the EO driven mechanism meets with complex rheology; vital questions such as can the zeta potential still be assumed to be constant when dealing with fluids with complex rheology? and "Does the shear thinning effect enhance electro-osmotic driven flow?" need to be answered. We conducted experiments using current monitoring and microscopy fluorescence methods, and developed a theoretical model by coupling a generalized Smoluchowski approach with the power-law constitutive model. We calculated the zeta potential and compared the experimental results with modeling to answer the questions. The results show a reduction of zeta potential in the presence of PEO aqueous solutions. A constant zeta potential is also indicated by varying the PEO concentration and the electric field strength.The shear thinning effect is also addressed via experimental data and theoretical calculations. The results show a promising enhancement of the EO driven velocity due to the shear thinning effect. PMID:27381295

  11. A novel microfluidic valve controlledby induced charge electro-osmotic flow

    Wang, Chengfa; Song, Yongxin; Pan, Xinxiang; Li, Dongqing

    2016-07-01

    In this paper, a novel microfluidic valve by utilizing induced charge electro-osmotic flow (ICEOF) is proposed and analyzed. The key part of the microfluidic valve is a Y-shaped microchannel. A small metal plate is placed at each corner of the junction of the Y-shaped microchannel. When a DC electrical field is applied through the channels, electro-osmotic flows occur in the channels, and two vortices will be formed near each of the metal plates due to the ICEOF. The two vortices behave like virtual ‘blocking columns’ to restrain and direct the flow in the Y-channel. In this paper, effects of the length of the metal plates, the applied voltages, the width of the microchannel, the zeta potential of the non-metal microchannel wall, and the orientation of the branch channels on the flow switching between two outlet channels are numerically investigated. The results show that the flow switching between the two outlet channels can be flexibly achieved by adjusting the applied DC voltages. The critical switching voltage (CSV), under which one outlet channel is closed, decreases with the increase in the metal plate length and the orientation angle of the outlet channels. The CSV, however, increases with the increase in the inlet voltage, the width of the microchannel, and the absolute value of the zeta potential of the non-metal microchannel wall. Compared with other types of micro-valves, the proposed micro-valve is simple in structure without any moving parts. Only a DC power source is needed for its actuation, thus it can operate automatically by controlling the applied voltages.

  12. Oscillatory electro-osmotic flow through a slit channel with slipping stripes on walls

    A theoretical model is presented in this paper for time-oscillating electro-osmotic flow through a plane channel bounded by two parallel plates, which are patterned with periodic stripes of distinct hydrodynamic slippage and wall potential. The flow is driven by oscillatory pressure gradient and electric field of the same frequency in the axial direction. Flows that are longitudinal or transverse to the stripes are investigated. Based on the Debye–Hückel approximation, and assuming Stokes flow, the electric potential and the velocity fields are found by the methods of eigenfunction expansion and point collocation. The phenomenological coefficients of the Onsager relations for the fluid and current fluxes are deduced as functions of the channel height, the area fraction of wall with slippage, the intrinsic slip length, the Debye parameter, the zeta potentials and the oscillation parameter. Considering several kinds of wall patterns, we extend the theoretical limits in the steady-flow regime to the oscillatory-flow regime. For a uniformly charged wall, the effective slip length obtained from the hydrodynamic problem can still be used directly in the electro-osmotic flow as if the wall were uniformly slipping. When the slipping stripes are perfectly slipping but uncharged, the presence of such stripes will always have a decreasing effect on the streaming conductance, unlike the steady case in which it gives no net effect on the flow in the limit of a very thin double layer. Furthermore, we confirm the presence of a threshold frequency, beyond which the flow will diminish significantly. The slipping fraction of the wall will always introduce a phase lag to the response and lower the threshold frequency. Increasing the wall potential in the presence of slippage can appreciably increase the streaming conductance and the phase lag. (paper)

  13. Modified Bernoulli Equation for Use with Combined Electro-Osmotic and Pressure-Driven Microflows

    Adams, Thomas M

    2012-01-01

    In this paper we present electro-osmotic (EO) flow within a more traditional fluid mechanics framework. Specifically, the modified Bernoulli equation (viz. the energy equation, the mechanical energy equation, the pipe flow equation, etc.) is shown to be applicable to EO flows if an electrical potential energy term is also included. The form of the loss term in the modified Bernoulli equation is unaffected by the presence of an electric field; i.e., the loss term still represents the effect of wall shear stress, which can be represented via a friction factor. We show that that the friction factor for pure EO flow (no applied pressure gradient) varies inversely with the Reynolds number based on the Debeye length of the electric double layer. Expressions for friction factor for combined laminar pressure-driven and EO flow are also given. These are shown to be functions of Reynolds number and geometry, as well as the relative strength of the applied electric field to the applied pressure gradient.

  14. Flow patterning in Hele-Shaw configurations using non-uniform electro-osmotic slip

    Boyko, Evgeniy; Rubin, Shimon; Gat, Amir D.; Bercovici, Moran

    2015-10-01

    We present an analytical study of electro-osmotic flow in a Hele-Shaw configuration with non-uniform zeta potential distribution. Applying the lubrication approximation and assuming thin electric double layer, we obtain a pair of uncoupled Poisson equations for the pressure and depth-averaged stream function, and show that the inhomogeneous parts in these equations are governed by gradients in zeta potential parallel and perpendicular to the applied electric field, respectively. We obtain a solution for the case of a disk-shaped region with uniform zeta potential and show that the flow field created is an exact dipole, even in the immediate vicinity of the disk. In addition, we study the inverse problem where the desired flow field is known and solve for the zeta potential distribution required in order to establish it. Finally, we demonstrate that such inverse problem solutions can be used to create directional flows confined within narrow regions, without physical walls. Such solutions are equivalent to flow within channels and we show that these can be assembled to create complex microfluidic networks, composed of intersecting channels and turns, which are basic building blocks in microfluidic devices.

  15. Electro-osmotically driven MHD flow and heat transfer in micro-channel

    Shit, G. C.; Mondal, A.; Sinha, A.; Kundu, P. K.

    2016-05-01

    A theoretical analysis is presented for electro-osmotic flow (EOF) of blood in a hydrophobic micro-channel with externally applied magnetic field. The lumen of micro-channels is assumed to be porous medium in addition to the consideration of permeability of the channel walls. The effects of slip velocity and thermal-slip are taken into consideration. The governing equations in the electrical double layer (EDL) together with the Poisson-Boltzmann equation and the body force exerted by the applied potential are furthermore considered. The flow is governed by the non-Newtonian viscoelastic fluid model. These equations along with the thermal energy equation are approximated by assuming that the channel height is much greater than the thickness of electrical double layer consisting the stern and diffusive layers. The problem is solved analytically and the computed results have presented graphically for various values of the dimensionless parameters. The results presented here have significant impact on the therapeutic treatment in hyperthermia as well as in controlling blood flow and heat transfer in micro-channels.

  16. Effects of Micromachining Processes on Electro-Osmotic Flow Mobility of Glass Surfaces

    Norihisa Miki

    2013-03-01

    Full Text Available Silica glass is frequently used as a device material for micro/nano fluidic devices due to its excellent properties, such as transparency and chemical resistance. Wet etching by hydrofluoric acid and dry etching by neutral loop discharge (NLD plasma etching are currently used to micromachine glass to form micro/nano fluidic channels. Electro-osmotic flow (EOF is one of the most effective methods to drive liquids into the channels. EOF mobility is affected by a property of the micromachined glass surfaces, which includes surface roughness that is determined by the manufacturing processes. In this paper, we investigate the effect of micromaching processes on the glass surface topography and the EOF mobility. We prepared glass surfaces by either wet etching or by NLD plasma etching, investigated the surface topography using atomic force microscopy, and attempted to correlate it with EOF generated in the micro-channels of the machined glass. Experiments revealed that the EOF mobility strongly depends on the surface roughness, and therefore upon the fabrication process used. A particularly strong dependency was observed when the surface roughness was on the order of the electric double layer thickness or below. We believe that the correlation described in this paper can be of great help in the design of micro/nano fluidic devices.

  17. Non-isothermal electro-osmotic flow in a microchannel with charge-modulated surfaces

    Bautista, Oscar; Sanchez, Salvador; Mendez, Federico

    2015-11-01

    In this work, we present an theoretical analysis of a nonisothermal electro-osmotic flow of a Newtonian fluid over charge-modulated surfaces in a microchannel. Here, the heating in the microchannel is due to the Joule effect caused by the imposition of an external electric field. The study is conducted through the use of perturbation techniques and is validated by means of numerical simulations. We consider that both, viscosity and electrical conductivity of the fluid are temperature-dependent; therefore, in order to determine the heat transfer process and the corresponding effects on the flow field, the governing equations of continuity, momentum, energy and electric potential have to be solved in a coupled manner. The principal obtained results evidence that the flow patterns are perturbed in a noticeable manner in comparison with the isothernal case. Our results may be used for increasing microfluidics mixing by conjugating thermal effects with the use of charge-modulated surfaces. This work has been supported by the research grants no. 220900 of Consejo Nacional de Ciencia y Tecnología (CONACYT) and 20150919 of SIP-IPN at Mexico. F. Méndez acknowledges also the economical support of PAPIIT-UNAM under contract number IN112215.

  18. Field-Effect Modulated Electro-Osmotic Pumps for High Precision Colloid Thrusters Project

    National Aeronautics and Space Administration — The ability to precisely control the position of satellites is a critical enabling technology for space missions involving interferometric arrays. One proposed...

  19. Numerical characterization of silicon DC electro-osmotic pumps: the role of the micro channel geometry

    Geri, M; Lorenzini, M.; Morini, GL; 3rd Micro and Nano Flows Conference (MNF2011)

    2011-01-01

    This paper was presented at the 3rd Micro and Nano Flows Conference (MNF2011), which was held at the Makedonia Palace Hotel, Thessaloniki in Greece. The conference was organised by Brunel University and supported by the Italian Union of Thermofluiddynamics, Aristotle University of Thessaloniki, University of Thessaly, IPEM, the Process Intensification Network, the Institution of Mechanical Engineers, the Heat Transfer Society, HEXAG - the Heat Exchange Action Group, and the Energy Institute. ...

  20. EFFECT OF AQUEOUS PHASE PROPERTIES ON CLAY PARTICLE ZETA POTENTIAL AND ELECTRO-OSMOTIC PERMEABILITY: IMPLICATIONS FOR ELECTRO-KINETIC SOIL REMEDIATION PROCESSES

    The influence of aqueous phase properties (pH, ionic strength and divalent metal ion concentration) on clay particle zeta potential and packed-bed electro-osmotic permeability was quantified. Although pH strongly altered the zeta potential of a Georgia kaolinite, it did not signi...

  1. Theory and design method for electro-osmotic consolidation%电渗排水固结的设计理论和方法

    庄艳峰

    2016-01-01

    探讨了电渗法处理大面积深厚软土地基的若干问题,包括:电极材料、能耗、电源功率、设计理论和方法。EKG材料的出现解决了电极腐蚀和电渗能耗过高的问题,现在电渗法在大面积应用中面临的是电源功率要求过高的问题,该问题可以通过轮询通电的方法解决。依据电渗能级梯度理论提出了电渗排水固结的设计方法。时间因子和流量系数是电渗设计方法中的两个关键参数,其中流量系数具有较明显的模型尺寸效应,设计时需要进行修正。%The problems of electro-osmotic consolidation for large scale deep soft ground, including electrode, energy consumption, electric power, theory and design method, are discussed. Innovation of EKG materials has solved the problems of electrode corrosion and high energy consumption in electro-osmotic consolidation. High electric power demand is currently a new challenge for large scale application of electro-osmotic consolidation, and the solution will be the roll polling program embedded in novel designed electric power source. The design method based on the energy level gradient theory of electro-osmotic consolidation is proposed. The time factor and flow coefficient are the key parameters of the design method. The flow coefficient has distinct scale effect, and it needs to be corrected before applied in the design.

  2. Dispersion in oscillatory electro-osmotic flow through a parallel-plate channel with kinetic sorptive exchange at walls

    吴朝安

    2014-01-01

    Dispersion in time-oscillatory electro-osmotic flows in a slit micro-channel under the effect of kinetic sorptive exchange at walls is theoretically investigated using the homogenization method. The two walls of the channel are considered to be made up of different materials, and therefore have different zeta potentials and sorption coefficients. A general expression for the Taylor disper-sion coefficient under different zeta potentials as well as various sorption conditions at the walls is derived analytically. The disper-sion coefficient is found to be dependent on the oscillation frequency, the Debye parameter, the species partition coefficient, the rea-ction kinetics and the ratio of the wall potentials. The results demonstrate that the presence of wall sorption tends to enhance the dispersion when the oscillation frequency is low, but the effect is negligible in high-frequency oscillatory flows. Moreover, it is found that the dispersion coefficient could be significantly changed by adjusting the relative wall potentials for low-frequency flows.

  3. Electrical Potential, Mass Transport and Velocity Distribution of Electro-osmotic Flow in a Nanochannel by Incorporating the Variation of Dielectric Constant of Aqueous Electrolyte Solution

    Padidhapu, Rajendra; Brahmajirao, V

    2016-01-01

    We consider a coupled system of Navier Stokes, Maxwell Stefan and Poisson Boltzmann equations by incorporating the variation of dielectric constant, which governs the electro osmotic flow in nano channel, describing the evolution of the velocity, concentration and potential fields of dissolved constituents in an aqueous electrolyte solution. We apply the finite difference technique to solve one and two dimensional systems of these equations. The solutions give an extremely accurate prediction of the dielectric constant for a variety of salts and a wide range of concentrations.

  4. A CMOS AC/DC charge pump for a wireless sensor network

    An AC/DC charge pump implemented with MOS FETs has been presented for wireless sensor network applications. The proposed AC/DC charge pump can generate a stable output with low power dissipation and high pumping efficiency, which has been implemented in 0.13 μm CMOS technology. The proposed charge pump employs MOSFET diodes with low thresholds, and improves the conversion efficiency. The analytical model of the voltage multiplier, the simulation results, and the chip testing results are presented.

  5. Contactless microfluidic pumping using microchannel-integrated carbon black composite membranes.

    Fu, Xiaotong; Gagnon, Zachary

    2015-09-01

    The ability to pump and manipulate fluid at the micron-scale is a basic requirement for microfluidic platforms. Many current manipulation methods, however, require expensive and bulky external supporting equipment, which are not typically compatible for portable applications. We have developed a contactless metal electro-osmotic micropump capable of pumping conductive buffers. The pump operates using two pairs of gallium metal electrodes, which are activated using an external voltage source and separated from a main flow channel by a thin micron-scale polydimethylsiloxane (PDMS) membrane. The thin contactless membrane allows for field penetration and electro-osmotic flow within the microchannel, but eliminates electrode damage and sample contamination commonly associated with traditional DC electro-osmotic pumps that utilize electrodes in direct contact with the working fluid. Our previous work has demonstrated the effectiveness of this method in pumping deionized water. However, due to the high resistivity of PDMS, this method proved difficult to apply towards manipulating conductive buffers. To overcome this limitation, we fabricated conductive carbon black (CB) powder directly into the contactless PDMS membranes. The increased electrical conductivity of the contactless PDMS membrane significantly increased micropump performance. Using a microfluidic T-channel device and an electro-osmotic flow model, we determined the influence that CB has on pump pressure for CB weight percents varying between 0 and 20. The results demonstrate that the CB increases pump pressure by two orders of magnitude and enables effective operations with conductive buffers. PMID:26543514

  6. A new working principle for ac electro-hydrodynamic on-chip micro-pumps

    Our new type of on-chip micro-pump exploits the ac electro-kinetic forces acting in the volume of a fluid in the presence of a temperature gradient. No mechanically movable parts are used. The velocity of the pump flow observed depends on the frequency and strength of the driving ac field and on the temperature gradient across the pump channel. An integrated heating element allows the temperature gradient to be adjusted. Both ac field electrodes and heating element are platinum structures processed on a glass chip. The pump-channel walls and cover are made from polymer and thin-glass, respectively. In this paper, we present measurements of the fluid velocity as functions of the medium conductivity (0.1-1.3 S m-1) and field frequency (300 kHz-52 MHz), voltage across the field-electrode voltage (0-35 Vrms) and the heating element (1.1-3.6 V). Velocities of up to 120 μm s-1 were observed in the pump channel. The advantage of our new design is an evenly shaped cross-section of the pump channel, which reduces the risk of the channel becoming clogged by debris. Ac-electro-osmosis is not a predominant effect in our structures. Pumping could only be observed when the heating current and ac-pump field were applied simultaneously. The effects observed were simulated with the COMSOL Multiphysics program

  7. Hybrid pressure control concept for a speed variable AC motor pump in aerospace application

    Engelhardt, Joerg; Greissner, Carsten

    2002-01-01

    This paper describes a new pressure control strategy for AC motor driven pumps in aircraft application. Both, swash plate position and pump speed are used for controlling system pressure in a hybrid approach. The requirements for the pressure control loop and the design methods for the hybrid control circuits with a load observer are introduced. The new control concept has been implemented into an experimental set-up. The validation and evaluation of simulation results on the test rig are d...

  8. A scattering matrix approach to quantum pumping: beyond the small-AC-driving-amplitude limit

    In the adiabatic and weak-modulation quantum pump, net electron flow is driven from one reservoir to another by absorbing or emitting an energy quantum ħω from or to the reservoirs. This paper considers high-order dependence of the scattering matrix on the time. Non-sinusoidal behaviour of strong pumping is revealed. The relation between the pumped current and the ac driving amplitude varies from power of 2, 1 to 1/2 when stronger modulation is exerted. Open experimental observation can be interpreted by multi-energy-quantum-related processes. (condensed matter: electronic structure, electrical, magnetic, and optical properties)

  9. Flow reversal at low voltage and low frequency in a microfabricated ac electrokinetic pump

    Gregersen, Misha Marie; Olesen, Laurits Højgaard; Brask, Anders;

    2007-01-01

    Microfluidic chips have been fabricated in Pyrex glass to study electrokinetic pumping generated by a low-voltage ac bias applied to an in-channel asymmetric metallic electrode array. A measurement procedure has been established and followed carefully resulting in a high degree of reproducibility...... of the measurements over several days. A large coverage fraction of the electrode array in the microfluidic channels has led to an increased sensitivity allowing for pumping measurements at low bias voltages. Depending on the ionic concentration a hitherto unobserved reversal of the pumping direction...

  10. Micro pumping methods based on AC electrokinetics and Electrorheologically actuated PDMS valves

    Soni, Gaurav; Squires, Todd; Meinhart, Carl

    2006-11-01

    We have developed 2 different micropumping methods for transporting ionic fluids through microchannels. The first method is based on Induced Charge Electroosmosis (ICEO) and AC flow field-effect. We used an AC electric field to produce a symmetric ICEO flow on a planar electrode, called `gate'. In order to break the symmetry of ICEO, we applied an additional AC voltage to the gate electrode. Such modulation of the gate potential is called field effect and produces a unidirectional pumping over the gate surface. We used micro PIV to measure pumping velocities for a range of ionic concentration, AC frequency and gate voltage. We have also conducted numerical simulations to understand the deteriorating effect of lateral conduction of surface charge on the pumping velocities. The second method is based on vibration of a flexible PDMS diaphragm actuated by an electrorheological (ER) fluid. ER fluid is a colloidal suspension exhibiting a reversible liquid-to-solid transition under an electric field. This liquid-to-solid transition can yield very high shear stress and can be used to open and close a PDMS valve. Three such valves were fabricated and actuated in a peristaltic fashion in order to achieve positive displacement pumping of fluids.

  11. Analysis of metal ions migration to determine electro-osmotic flow for the in-situ cleanup of a tar-contaminated site

    Lima, Ana T.

    2012-03-01

    An electro-osmosis experiment was set up on a former asphalt factory site, which is currently contaminated by tar, in Olst, the Netherlands. The main goal of this experiment was to remove polycyclic aromatic hydrocarbons (PAHs) from a contaminated clay layer by applying an electric gradient. But before calculating PAH removal, the direction and intensity of electro-osmosis have to be estimated. In field situations, tracers are used to get information about the water flow. In the present study, the inorganic elements concentration oscillations during electro-osmosis application are used as tracers. The experiment was set up in a clay layer, with the configuration 1m×1m×0.3m, at a depth of 4m below soil surface. Al, Ca, Cl, Cr, Cu, Fe, K, Mg, Mn, Na, Ni, P, S, Si, Ti and Zn concentrations were determined in 28 measurements and were performed during the experimental period of 159days. Then they were used in a first evaluation where auto and cross-correlations were analyzed to aid in the geochemical interpretation and select the most conservative elements. The second part of this study is devoted to estimate the migration of water based on the concentrations development of Cl - at the anode and Na + at the cathode. Electro-osmotic flow was estimated to be intense (2.9 -10 -9-2.18 -10 -8m -s -1) during the first 10 to 50days of experiment and to cease after this period. © 2012.

  12. 电极间距和排水方式对电渗固结效果试验%Influence of electrode spacing and drainage mode on electro-osmotic consolidation

    曾宏

    2015-01-01

    为了探讨淤泥电渗固结的最佳方式,开展了不同电极间距和排水方式的电渗对比试验,试验中对渗水量、土体沉降、电能消耗、含水率等指标进行了监测,得出了适合工程应用的电极间距为1.2 m,排水孔钻孔深度7.5 m,排水方式采用塑料排水板套砂袋组合体排水.工程应用实例表明:采用该电极间距和排水方式取得了良好的电渗固结效果.%In order to study the best mode of mud electro-osmotic consolidation,electro-osmotic tests were con-ducted with different electrode spacing and drainage modes. The observed indexes during tests include seepage wa-ter volume,soil mass settlement,electric energy consumption,water-content coefficient etc. According to the re-sults of tests,some indexes applicable for engineering were concluded,including a electrode spacing of 1.2m, drainage bore depth of 7.5m,composite drainage mode of plastic drainage plate in sand bag. Application of above conclusions in completed project has demonstrated good electro-osmotic consolidation effects.

  13. Spin backflow and ac voltage generation by spin pumping and the inverse spin Hall effect.

    Jiao, HuJun; Bauer, Gerrit E W

    2013-05-24

    The spin current pumped by a precessing ferromagnet into an adjacent normal metal has a constant polarization component parallel to the precession axis and a rotating one normal to the magnetization. The former is now routinely detected as a dc voltage induced by the inverse spin Hall effect (ISHE). Here we compute ac ISHE voltages much larger than the dc signals for various material combinations and discuss optimal conditions to observe the effect. The backflow of spin is shown to be essential to distill parameters from measured ISHE voltages for both dc and ac configurations. PMID:23745937

  14. Direct Detection of Pure ac Spin Current by X-Ray Pump-Probe Measurements

    Li, J.; Shelford, L. R.; Shafer, P.; Tan, A.; Deng, J. X.; Keatley, P. S.; Hwang, C.; Arenholz, E.; van der Laan, G.; Hicken, R. J.; Qiu, Z. Q.

    2016-08-01

    Despite recent progress in spin-current research, the detection of spin current has mostly remained indirect. By synchronizing a microwave waveform with synchrotron x-ray pulses, we use the ferromagnetic resonance of the Py (Ni81Fe19 ) layer in a Py /Cu /Cu75Mn25/Cu /Co multilayer to pump a pure ac spin current into the Cu75Mn25 and Co layers, and then directly probe the spin current within the Cu75Mn25 layer and the spin dynamics of the Co layer by x-ray magnetic circular dichroism. This element-resolved pump-probe measurement unambiguously identifies the ac spin current in the Cu75Mn25 layer.

  15. Microfluidic pumping, routing and metering by contactless metal-based electro-osmosis.

    Fu, Xiaotong; Mavrogiannis, Nicholas; Doria, Steven; Gagnon, Zachary

    2015-09-01

    Over the past decade, many microfluidic platforms for fluid processing have been developed in order to perform on-chip fluidic manipulations. Many of these methods, however, require expensive and bulky external supporting equipment, which are not typically applicable for microsystems requiring portability. We have developed a new type of portable contactless metal electro-osmotic micropump capable of on-chip fluid pumping, routing and metering. The pump operates using two pairs of gallium metal electrodes, which are activated using an external voltage source, and separated from a main flow channel by a thin micron-scale PDMS membrane. The thin contactless membrane allows for field penetration and electro-osmotic (EO) flow within the microchannel, but eliminates electrode damage and sample contamination commonly associated with traditional DC electro-osmotic pumps that utilize electrodes in direct contact with the working fluid. The maximum flow rates and pressures generated by the pump using DI water as a working buffer are 10 nL min(-1) and 30 Pa, respectively. With our current design, the maximum operational conductivity where fluid flow is observed is 0.1 mS cm(-1). Due to the small size and simple fabrication procedure, multiple micropump units can be integrated into a single microfluidic device for automated on-chip routing and sample metering applications. We experimentally demonstrated the ability to quantify micropump electro-osmotic flowrate and pressure as a function of applied voltage, and developed a mathematical model capable of predicting the performance of a contactless micropump for a given external load and internal hydrodynamic microchannel resistance. Finally, we showed that by activating specific pumps within a microchannel network, our micropumps are capable of routing microchannel fluid flow and generating plugs of solute. PMID:26053965

  16. Pumping and mixing in a microchannel using AC asymmetric electrode arrays

    A numerical study of electroosmotic microchannel flow driven by arrays of AC (alternating current) asymmetric electrodes was carried out. By installing asymmetric electrode arrays on the top and bottom walls of the microchannel, pumping and mixing flow modes can be generated. The 'pumping mode' (P) is generated when the sequences of asymmetric electrode pairs (narrow to wide) on the top and bottom walls are in phase, whereas the 'mixing mode' (M) is generated by switching the sequence of electrode pairs of the top wall (e.g., wide to narrow). By combining mixing and pumping modes, enhanced mixing performance can be achieved without significantly reducing the flow rate. Among various combinations of P and M modes, the alternating PM mode showed the best mixing performance due to the iterative convergent and divergent flow motions. The effects of Peclet number and channel height on the mixing efficiency were analyzed in detail

  17. Reversed flow at low frequencies in a microfabricated AC electrokinetic pump

    Gregersen, Misha Marie; Brask, Anders; Hansen, Mikkel Fougt; Bruus, Henrik

    2007-01-01

    Microfluidic chips have been fabricated to study electrokinetic pumping generated by a low voltage AC signal applied to an asymmetric electrode array. A measurement procedure has been established and followed carefully resulting in a high degree of reproducibility of the measurements. Depending on the ionic concentration as well as the amplitude of the applied voltage, the observed direction of the DC flow component is either forward or reverse. The impedance spectrum has been thoroughly measured and analyzed in terms of an equivalent circuit diagram. Our observations agree qualitatively, but not quantitatively, with theoretical models published in the literature.

  18. A short tutorial contribution to impedance and AC-electrokinetic characterization and manipulation of cells and media: Are electric methods more versatile than acoustic and laser methods?

    Jan Gimsa

    2014-11-01

    Full Text Available Lab-on-chip systems (LOCs can be used as in vitro systems for cell culture or manipulation in order to analyze or monitor physiological cell parameters. LOCs may combine microfluidic structures with integrated elements such as piezo-transducers, optical tweezers or electrodes for AC-electrokinetic cell and media manipulations. The wide frequency band (<1 kHz to >1 GHz usable for AC-electrokinetic manipulation and characterization permits avoiding electrochemical electrode processes, undesired cell damage, and provides a choice between different polarization effects that permit a high electric contrast between the cells and the external medium as well as the differentiation between cellular subpopulations according to a variety of parameters. It has been shown that structural polarization effects do not only determine the impedance of cell suspensions and the force effects in AC-electrokinetics but can also be used for the manipulation of media with inhomogeneous temperature distributions. This manuscript considers the interrelations of the impedance of suspensions of cells and AC-electrokinetic single cell effects, such as electroorientation, electrodeformation, dielectrophoresis, electrorotation, and travelling wave (TW dielectrophoresis. Unified models have allowed us to derive new characteristic equations for the impedance of a suspension of spherical cells, TW dielectrophoresis, and TW pumping. A critical review of the working principles of electro-osmotic, TW and electrothermal micropumps shows the superiority of the electrothermal pumps. Finally, examples are shown for LOC elements that can be produced as metallic structures on glass chips, which may form the bottom plate for self-sealing microfluidic systems. The structures can be used for cell characterization and manipulation but also to realize micropumps or sensors for pH, metabolites, cell-adhesion, etc.

  19. Nonlinear Dynamics of Magnons observed by AC Spin Pumping in Magnetic Hybrid Structures

    Vilela-Leao, L. H.; Cunha, R. O.; Azevedo, A.; Rodriguez-Suarez, R. L.; Rezende, S. M.

    2015-03-01

    The electron spin degree of freedom constitutes the basic means to carry and store information in the field of spintronics. In the spin pumping process, the microwave driven magnetization dynamics in a ferromagnetic film generates a spin current in an attached metallic layer that can be converted into a charge current by means of the inverse spin Hall effect and detected by a voltage signal. While the time independent component (DC) of the spin current has been widely investigated in a variety of material structures, recently it has been recognized that the alternating current (AC) component is much larger, though more difficult to detect, and has many attractive features. We report experiments with microwave driven DC and AC spin pumping in bilayers made of the insulating ferrimagnet yttrium iron garnet (YIG) and platinum that reveal the nonlinear dynamics involving the driven mode and a pair of magnon modes with half frequency. This process occurs when the frequency is lowered below a critical value so that a three-magnon splitting process with energy conservation is made possible. The results are explained by a model with coupled nonlinear equations describing the time evolution of the magnon modes.

  20. 异性纳米通道中NaCl水溶液电渗输运特性%MD Simulation of Electro-Osmotic Characteristics of NaC1 Solution in Different Nano-Tubes

    蒋洁; 陈永平; 郝英立

    2011-01-01

    The flow characteristics of NaCl solution in different nanotubes were investigated. The tubes differ in charge. One has no charge and the other has negative charge. The distribution of velocity, density, viscosity and thermal conductivity were got. It is found the Na+ is absorbed by charged wall, Cl- is expelled to the center of the tube. Na+ and water travel towards the cathode and Cl-travels towards the anode. Ions travel as electro-osmotic flow and water travels as a mixture of electro-osmotic flow and dragged flow. The order of particles in NaCl solution and diffusion are strengthened by charged wall. The thermal conductivity near the wall is larger than in the center area.%采用分子动力学方法模拟了电场驱动下纳米通道中NaCl水溶液的电渗输运特性,壁面为无电荷和带有负电荷两种情况,统计了速度、密度、黏度和热传导系数的分布规律.在壁面电荷作用下,Na+被壁面吸附,Cl-聚集在通道中央;Na+与水分子朝电场负方向、Cl-朝电场正方向运动;Na+、Cl-呈电渗流动,水分子则较为复杂,呈电渗流和被离子拖拽混杂流动;在壁面作用下,水分子和Na+/Cl-的有序度、系统的自扩散系数增大;热传导系数分布呈靠近壁面处大,主流区小的特点.

  1. Strongly nonlinear dynamics of electrolytes in large ac voltages

    Olesen, Laurits Højgaard; Bazant, Martin Z.; Bruus, Henrik

    2010-01-01

    , ignoring any transverse instability or fluid flow. We analyze the resulting one-dimensional problem by matched asymptotic expansions in the limit of thin double layers and extend previous work into the strongly nonlinear regime, which is characterized by two features—significant salt depletion in the...... suppress the strongly nonlinear regime in the limit of concentrated electrolytes, ionic liquids, and molten salts. Beyond the model problem, our reduced equations for thin double layers, based on uniformly valid matched asymptotic expansions, provide a useful mathematical framework to describe additional...... nonlinear responses to large ac voltages, such as Faradaic reactions, electro-osmotic instabilities, and induced-charge electrokinetic phenomena....

  2. AC Stark shift and temperature shift in laser pumped rubidium frequency standards

    Full text: We report our study on the light-shift (AC-Stark effect) and buffer-gas induced effects (e.g. temperature effect) on the ground-state ('clock') transition of rubidium atoms contained in cm-scale glass cells. Rb atoms are optically pumped by radiation from a DFB laser diode (at 780 nm). Microwave radiation resonant with the clock transition frequency is applied via a resonator cavity, and the clock transition is detected in the light transmission. Narrow double resonance linewidths are obtained by adding buffer gases (Dicke narrowing). Control of the buffer-gas mixture allows reducing the temperature coefficient. By adjusting the total buffer-gas pressure, we are able to adjust the pump optical frequency to the point of the zero lightshift. We have successfully produced cells that simultaneously show a low intensity light-shift (δf/f ∼ 1 x 10-12 cm /uW) as well as a small temperature coefficient (δf/f -12 /K), and pave the way for improved Rb atomic frequency standards. (author)

  3. Experimental research on effect of electrode spacing on electro-osmotic dewatering under same voltage gradient%等电势梯度下电极间距对电渗影响的试验研究

    李瑛; 龚晓南

    2012-01-01

    通过室内1:5的模型试验进行了等电势梯度下2m×1 m和1 m×0.5 m两种工程常见矩形布置电极间距下的软黏土电渗性状的研究.利用监测排水量、排水速率、电流、电势、含水率和pH值等指标,对不同电极间距试样的电渗处理效果、能量效率和电极腐蚀等方面进行了分析.结果表明:保持电势梯度不变而减半电极间距能够加快电渗排水,降低土体含水率,减小能量消耗和电极界面电阻,但也会导致土体pH值变化和阳极腐蚀量的增大.此外,采用较小的电极间距可使损失在电极和土接触面上的电势降减小,但损失的电势降占电源电压的比例增大.%A 1:5 scaled model test is conducted in order to find a simple and feasible technical means to improve electro-osmotic efficiency in soft clay foundation. The test program involves two different electrode spacings which are 2m×1m and lm×0.5m. By monitoring drainage, current intensity, voltage, water content and soil pH values, two tests are compared in terms of treatment effect, energy efficiency and electrodes corrosion. The results show that: halving the electrode spacing and keeping the voltage gradient could improve electro-osmotic treatment efficiency effectively including faster drainage rate, more reduction in water content, less energy consumption and less interface resistivity while it would also lead more changes in pH values of soil and more anodes corrosion; moreover, in the condition of halved spacing, smaller voltage drop took place at the soil-electrode interface; but the proportion of the voltage drop to supply voltage is higher.

  4. Spin Backflow and ac Voltage Generation by Spin Pumping and the Inverse Spin Hall Effect

    Jiao, H.; Bauer, G.E.W.

    2013-01-01

    The spin current pumped by a precessing ferromagnet into an adjacent normal metal has a constant polarization component parallel to the precession axis and a rotating one normal to the magnetization. The former is now routinely detected as a dc voltage induced by the inverse spin Hall effect (ISHE).

  5. Combined loss of primary and secondary coolant AC pump power design-basis event for the K-reactor safety analysis report

    The combined loss of alternating-current (ac) power to the primary coolant and secondary coolant system pumps has been included as a design-basis event in Chap. 15 of the safety analysis report for the K reactor at the U.S. Department of Energy's Savannah River site (SRS) nuclear materials production complex near Aiken, South Carolina. This event can arise from a disruption of the entire 115-kV SRS power grid or a lesser disturbance affecting the K-reactor area, combined with a failure of the standby emergency power sources. The first scenario is referred to as a open-quotes station blackout,close quotes and the second scenario is designated as a open-quotes mini-blackout.close quotes This is a condition-11 event (incident of moderate frequency) per the criterion (frequency of occurrence ≥ 1 x 10-6 per year) for credible eventualities in the design-basis envelope. The event causes the primary coolant flow to drop and stabilize at ∼27% of its full level (5.83 + 05 ell/min). Likewise, the secondary coolant flow drops and settles also at ∼27% of its full level (6.36 x 105 ell/min). The final primary coolant flow is maintained by the reduced pumping provided by diesel powered direct-current motors. The final secondary coolant flow is driven by gravity from the height differential between the supply and discharge basins. Both flows coast down gradually due to the action of flywheels in all of the six primary coolant pumps and in two of the ten secondary coolant pumps

  6. Electro-Osmotic Flow of Semidilute Polyelectrolyte Solutions

    Uematsu, Yuki; Araki, Takeaki

    2013-01-01

    We investigate electro-osmosis in aqueous solutions of polyelectrolytes using mean-field equations. A solution of positively charged polyelectrolytes is confined between two negatively charged planar surfaces, and an electric field is applied parallel to the surfaces. When electrostatic attraction between the polymer and the surface is strong, the polymers adhere to the surface, forming a highly viscous adsorption layer that greatly suppresses the electro-osmosis. Conversely, electro-osmosis ...

  7. Silicon-Based Chemical Motors: An Efficient Pump for Triggering and Guiding Fluid Motion Using Visible Light.

    Esplandiu, Maria J; Farniya, Ali Afshar; Bachtold, Adrian

    2015-11-24

    We report a simple yet highly efficient chemical motor that can be controlled with visible light. The motor made from a noble metal and doped silicon acts as a pump, which is driven through a light-activated catalytic reaction process. We show that the actuation is based on electro-osmosis with the electric field generated by chemical reactions at the metal and silicon surfaces, whereas the contribution of diffusio-osmosis to the actuation is negligible. Surprisingly, the pump can be operated using water as fuel. This is possible because of the large ζ-potential of silicon, which makes the electro-osmotic fluid motion sizable even though the electric field generated by the reaction is weak. The electro-hydrodynamic process is greatly amplified with the addition of reactive species, such as hydrogen peroxide, which generates higher electric fields. Another remarkable finding is the tunability of silicon-based pumps. That is, it is possible to control the speed of the fluid with light. We take advantage of this property to manipulate the spatial distribution of colloidal microparticles in the liquid and to pattern colloidal microparticle structures at specific locations on a wafer surface. Silicon-based pumps hold great promise for controlled mass transport in fluids. PMID:26349036

  8. Detección de cavitación en una bomba centrífuga usando emisiones acústicas Cavitation detection in a centrifugal pump using acoustic emissions

    Jabid Quiroga M.

    2012-12-01

    Full Text Available En el presente artículo se propone el uso de las emisiones acústicas para el monitoreo de la cavitación en una bomba centrífuga. Este monitoreo se ejecuta a través del seguimiento a unos indicadores de falla obtenidos a partir del valor RMS de la señal de emisiones acústicas en dominio tiempo y el valor RMS de los coeficientes de la Transformada Discreta Wavelet (TDW usando la onda madre db6 de la misma señal acústica. La experimentación se realiza en un banco dedicado que permite cavitar a una bomba de ½ hp en distintos niveles de severidad y bajo diferentes condiciones de bombeo. Resultados experimentales mostraron que los indicadores propuestos permiten detectar y evaluar cualitativamente los niveles de severidad de la cavitación en una bomba centrífuga.In this paper an acoustic emission based cavitation fault detection system is proposed for a centrifugal pump. The monitoring is performed tracking a fault indicator obtained using the RMS value of the acoustic emission signal in time domain and the RMS value of the coefficients obtained by applying discrete wavelet transform on the acoustic signal using db6 mother wavelet. Experiments in different cavitation levels and under different operation conditions are carried out in a ½ hp centrifugal pump dedicated test bed. Results showed that the proposed fault indicators are suitable for detecting and evaluating cavitation severities in a centrifugal pump.

  9. AC power supply systems

    An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)

  10. Topological spin and valley pumping in silicene.

    Luo, Wei; Sheng, L; Wang, B G; Xing, D Y

    2016-01-01

    We propose to realize adiabatic topological spin and valley pumping by using silicene, subject to the modulation of an in-plane ac electric field with amplitude Ey and a vertical electric field consisting of an electrostatic component and an ac component with amplitudes and . By tuning and , topological valley pumping or spin-valley pumping can be achieved. The low-noise valley and spin currents generated can be useful in valleytronic and spintronic applications. Our work also demonstrates that bulk topological spin or valley pumping is a general characteristic effect of two-dimensional topological insulators, irrelevant to the edge state physics. PMID:27507592

  11. Power source device for reactor recycling pump

    The device of the present invention prevents occurrence of an accident of a reactor forecast upon spontaneous power stoppage, loss of power source or trip of the reactor. Namely, a AC/DC converter and a DC/AC connector having an AC voltage frequency controller are connected in series between an AC (bus) in the plant and reactor recycling pumps. A DC voltage controller, a superconductive energy storing device and an excitation power source are connected to the input of the DC/AC converter. The control device receives signals of the spontaneous power stoppage, loss of power source or trip of the reactor to maintain the output voltage of the superconductive energy storing device to a predetermined value. Further, the ratio of AC power voltage and the frequency of AC voltage to be supplied to the reactor recycling pumps is constantly varied to control the flow rate of the pump to a predetermined value. With such procedures, a power source device for the reactor recycling pumps compact in size, easy for maintenance and having high reliability can be realized by adopting a static-type superconductive energy storing device as an auxiliary power source for the reactor recycling pumps. (I.S.)

  12. Centrifugal pumps

    Anderson, HH

    1981-01-01

    Centrifugal Pumps describes the whole range of the centrifugal pump (mixed flow and axial flow pumps are dealt with more briefly), with emphasis on the development of the boiler feed pump. Organized into 46 chapters, this book discusses the general hydrodynamic principles, performance, dimensions, type number, flow, and efficiency of centrifugal pumps. This text also explains the pumps performance; entry conditions and cavitation; speed and dimensions for a given duty; and losses. Some chapters further describe centrifugal pump mechanical design, installation, monitoring, and maintenance. The

  13. An economic evaluation comparison of solar water pumping system with engine pumping system for rice cultivation

    Treephak, Kasem; Thongpron, Jutturit; Somsak, Dhirasak; Saelao, Jeerawan; Patcharaprakiti, Nopporn

    2015-08-01

    In this paper we propose the design and economic evaluation of the water pumping systems for rice cultivation using solar energy, gasoline fuel and compare both systems. The design of the water and gasoline engine pumping system were evaluated. The gasoline fuel cost used in rice cultivation in an area of 1.6 acres. Under same conditions of water pumping system is replaced by the photovoltaic system which is composed of a solar panel, a converter and an electric motor pump which is compose of a direct current (DC) motor or an alternating current (AC) motor with an inverter. In addition, the battery is installed to increase the efficiency and productivity of rice cultivation. In order to verify, the simulation and economic evaluation of the storage energy battery system with batteries and without batteries are carried out. Finally the cost of four solar pumping systems was evaluated and compared with that of the gasoline pump. The results showed that the solar pumping system can be used to replace the gasoline water pumping system and DC solar pump has a payback less than 10 years. The systems that can payback the fastest is the DC solar pumping system without batteries storage system. The system the can payback the slowest is AC solar pumping system with batteries storage system. However, VAC motor pump of 220 V can be more easily maintained than the motor pump of 24 VDC and batteries back up system can supply a more stable power to the pump system.

  14. Surface micromachined electrostatically actuated micro peristaltic pump

    Xie, Jun; Shih, Jason; Lin, Qiao; Yang, Bozhi; Tai, Yu-Chong

    2004-01-01

    An electrostatically actuated micro peristaltic pump is reported. The micro pump is entirely surface micromachined using a multilayer parylene technology. Taking advantage of the multilayer technology, the micro pump design enables the pumped fluid to be isolated from the electric field. Electrostatic actuation of the parylene membrane using both DC and AC voltages was demonstrated and applied to fluid pumping based on a 3-phase peristaltic sequence. A maximum flow rate of 1.7 nL min^–1 and a...

  15. In situ electro-osmotic cleanup of tar contaminated soil—Removal of polycyclic aromatic hydrocarbons

    Lima, Ana T.

    2012-12-01

    An in situ electro-osmosis experiment was set up in a tar contaminated clay soil in Olst, the Netherlands, at the site of a former asphalt factory. The main goal of this experiment was to remove polycyclic aromatic hydrocarbons (PAHs) from the contaminated clay layer by applying an electric gradient of 12 V m-1 across the soil over an electrode distance of 1 m. With the movement of water by electro-osmosis and the addition of a non-ionic surfactant (Tween 80), the non-polar PAHs were dragged along by convection and removed from the fine soil fraction. Soil samples were taken at the start and after 159 days at the end of the experiment. Water at the electrode wells was sampled regularly during the course of the experiment. The results reflect the heterogeneity of the soil characteristics and show the PAH concentrations within the experimental set up. After first having been released into the anolyte solution due to extraction by Tween 80 and subsequent diffusion, PAH concentrations increased significantly in the electrode reservoirs at the cathode side after 90 days of experiment. Although more detailed statistical analysis is necessary to quantify the efficiency of the remediation, it can be concluded that the use of electro-osmosis together with a non-ionic surfactant is a feasible technique to mobilize non-polar organic contaminants in clayey soils. Crown Copyright © 2011 Published by Elsevier Ltd. All rights reserved.

  16. 21 CFR 878.4780 - Powered suction pump.

    2010-04-01

    ...) MEDICAL DEVICES GENERAL AND PLASTIC SURGERY DEVICES Surgical Devices § 878.4780 Powered suction pump. (a) Identification. A powered suction pump is a portable, AC-powered or compressed air-powered device intended to be... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Powered suction pump. 878.4780 Section...

  17. Heat pumps

    Macmichael, DBA

    1988-01-01

    A fully revised and extended account of the design, manufacture and use of heat pumps in both industrial and domestic applications. Topics covered include a detailed description of the various heat pump cycles, the components of a heat pump system - drive, compressor, heat exchangers etc., and the more practical considerations to be taken into account in their selection.

  18. Heat pumps

    Brodowicz, Kazimierz; Wyszynski, M L; Wyszynski

    2013-01-01

    Heat pumps and related technology are in widespread use in industrial processes and installations. This book presents a unified, comprehensive and systematic treatment of the design and operation of both compression and sorption heat pumps. Heat pump thermodynamics, the choice of working fluid and the characteristics of low temperature heat sources and their application to heat pumps are covered in detail.Economic aspects are discussed and the extensive use of the exergy concept in evaluating performance of heat pumps is a unique feature of the book. The thermodynamic and chemical properties o

  19. Nonadiabatic pure spin pumping in zigzag graphene nanoribbons with proximity induced ferromagnetism

    Cheraghchi, Hosein

    2015-01-01

    By combining Floquet theory with Green's function formalism, we present non-adiabatic quantum spin and charge pumping through a zigzag ferromagnetic graphene nanoribbon including a double-barriers structure driven weakly by two local $ac$ gate voltages operating with a phase-lag. Over a wide range of Fermi energies, interesting quantum pumping such as i) pure spin pumping with zero net charge pumping, ii) pure charge pumping and iii) fully spin polarized pumping can be achieved by tuning and ...

  20. Pumping life

    Sitsel, Oleg; Dach, Ingrid; Hoffmann, Robert Daniel

    2012-01-01

    The name PUMPKIN may suggest a research centre focused on American Halloween traditions or the investigation of the growth of vegetables – however this would be misleading. Researchers at PUMPKIN, short for Centre for Membrane Pumps in Cells and Disease, are in fact interested in a large family of...... membrane proteins: P-type ATPase pumps. This article takes the reader on a tour from Aarhus to Copenhagen, from bacteria to plants and humans, and from ions over protein structures to diseases caused by malfunctioning pump proteins. The magazine Nature once titled work published from PUMPKIN ‘Pumping ions......’. Here we illustrate that the pumping of ions means nothing less than the pumping of life....

  1. Centrifugal pumps

    Gülich, Johann Friedrich

    2014-01-01

    This book gives an unparalleled, up-to-date, in-depth treatment of all kinds of flow phenomena encountered in centrifugal pumps including the complex interactions of fluid flow with vibrations and wear of materials. The scope includes all aspects of hydraulic design, 3D-flow phenomena and partload operation, cavitation, numerical flow calculations, hydraulic forces, pressure pulsations, noise, pump vibrations (notably bearing housing vibration diagnostics and remedies), pipe vibrations, pump characteristics and pump operation, design of intake structures, the effects of highly viscous flows, pumping of gas-liquid mixtures, hydraulic transport of solids, fatigue damage to impellers or diffusers, material selection under the aspects of fatigue, corrosion, erosion-corrosion or hydro-abrasive wear, pump selection, and hydraulic quality criteria. As a novelty, the 3rd ed. brings a fully analytical design method for radial impellers, which eliminates the arbitrary choices inherent to former design procedures. The d...

  2. Jet Pump

    Wærp, Nils Petter

    2010-01-01

    The aim of this project is to investigate how an artificial lift method in the oil industry works,and to compare its performance with other pump systems. Jet pumps are initially used in the oil industry for artificial lift and thus in order to do so one needs a good understanding of themechanics to predict the jet pumps’ performance. The project will begin with a review of how the jet pump operates, aiming to give the reader an insight and overview into the field of an artificial lift method....

  3. Electromagnetic pump

    The present invention provides an electromagnetic pump suitable to a recycling pump for liquid sodium as coolants of an FBR type reactor. Namely, a stator module of the electromagnetic pump of the present invention comprises a plurality of outer laminate iron core units and outer stator modules stacked alternately in the axial direction. With such a constitution, even a long electromagnetic pump having a large number of outer stator coils can be manufactured without damaging electric insulation of the outer stator coils. In addition, the inner circumferential surface of the outer laminate iron cores is urged and brought into contact with the outer circumferential surface of the outer duct by an elastic material. With such a constitution, Joule loss heat generated in the outer stator coils and internal heat generated in the outer laminate iron cores can be released to an electroconductive fluid flowing the inner circumference of the outer duct by way of the outer duct. (I.S.)

  4. Pump impeller

    A mixed-flow pump impeller, which may be used, for example, as a primary pump for circulating sodium as the primary coolant in a fast nuclear reactor, is described which comprises an impeller with evenly-spaced blades. Some of the blades, which are symmetrically disposed around the axis of rotation of the impeller, extend beyond the ends of the other blades towards the suction side of the pump to form an inducer. The channels defined between the extensions of the extended blades follow helical paths parallel to the axis of rotation. The leading edges of the unextended blades are interposed between the extended blades in the region of divergence of flow from the axis of rotation. The provision of the inducer reduces the risk of cavitation in the pump, which could cause rapid wear of the impeller. A shroud may be provided for the unextended blades. (author)

  5. Electrokinetic pump

    Patel, Kamlesh D. (Dublin, CA)

    2007-11-20

    A method for altering the surface properties of a particle bed. In application, the method pertains particularly to an electrokinetic pump configuration where nanoparticles are bonded to the surface of the stationary phase to alter the surface properties of the stationary phase including the surface area and/or the zeta potential and thus improve the efficiency and operating range of these pumps. By functionalizing the nanoparticles to change the zeta potential the electrokinetic pump is rendered capable of operating with working fluids having pH values that can range from 2-10 generally and acidic working fluids in particular. For applications in which the pump is intended to handle highly acidic solutions latex nanoparticles that are quaternary amine functionalized can be used.

  6. Experiment of brushless fully superconducting generator with magnetic flux pump

    Since the first success in the development of magnetic flux-pumped brushless excitation system for superconducting AC generators in 1983, the authors have been building a testing machine to generate actual electric power. The paper presents experimental machine system, and test results about performances of the flux pump and output characteristics when operated as fully superconducting brushless generator

  7. Single electron pump fabricated with ultrasmall normal tunnel junctions

    We have designed and operated a device through which single electrons can be 'pumped' reversibly. It consists of a linear array of three tunnel junctions voltage biased below the Coulomb gap. Phase shifted ac voltages applied to two gates pump one electron per cycle. (orig.)

  8. Developing a Magnetocaloric Domestic Heat Pump

    Bahl, Christian R.H.

    2014-01-01

    beverage coolers, A/Cs for cars and electronics cooling. Devices for heating have not been extensively demonstrated. Here we consider a promising application of magnetocaloric heat pumps for domestic heating. The task of designing and building such a device is a multidisciplinary one encompassing materials...

  9. 76 FR 34192 - Commercial and Industrial Pumps

    2011-06-13

    ..., oil and gas extraction, water and wastewater, or mineral mining. Standard Industrial Codes (SICs) from... Part 431 RIN 1904-AC54 Commercial and Industrial Pumps AGENCY: Office of Energy Efficiency and... certain commercial and industrial equipment, and requires the Department of Energy (DOE) to administer...

  10. Insulin pumps.

    Pickup, J

    2011-02-01

    The last year has seen a continued uptake of insulin pump therapy in most countries. The USA is still a leader in pump use, with probably some 40% of type 1 diabetic patients on continuous subcutaneous insulin infusion (CSII), but the large variation in usage within Europe remains, with relatively high use (> 15%) in, for example, Norway, Austria, Germany and Sweden and low use (companies or funding from national health services, the availability of sufficient diabetes nurse educators and dietitians trained in pump procedures, and clear referral pathways for the pump candidate from general practitioner or general hospital to specialist pump centre. There are now several comprehensive national guidelines on CSII use (see ATTD Yearbook 2009) but more work needs to be done in unifying uptake and ensuring all those who can benefit do so. Technology developments recently include increasing use of pumps with continuous glucose monitoring (CGM) connectivity (see elsewhere in this volume) and the emergence of numerous manufacturers developing so-called 'patch pumps', often for the type 2 diabetes market. Interestingly, the evidence base for CSII in this group is not well established, and for this reason the selected papers on CSII in this section include several in this area. The use of CSII in diabetic pregnancy is a long-established practice, in spite of the lack of evidence that it is superior to multiple daily injections (MDI), and few randomised controlled trials have been done in recent years. Several papers in this field this year continue the debate about the usefulness of CSII in diabetic pregnancy and are reviewed here. It is pleasing to see more research on the psychosocial aspects of CSII during the year, both from the point of view of how psychological beliefs influence outcomes on CSII (is there a type of patient who does particularly well or poorly on CSII?) and how CSII affects psychological factors like mood, behaviour and quality of life. Quality of

  11. DIFFUSION PUMP

    Levenson, L.

    1963-09-01

    A high-vacuum diffusion pump is described, featuring a novel housing geometry for enhancing pumping speed. An upright, cylindrical lower housing portion is surmounted by a concentric, upright, cylindrical upper housing portion of substantially larger diameter; an uppermost nozzle, disposed concentrically within the upper portion, is adapted to eject downwardly a conical sheet of liquid outwardly to impinge upon the uppermost extremity of the interior wall of the lower portion. Preferably this nozzle is mounted upon a pedestal rising coaxially from within the lower portion and projecting up into said upper portion. (AEC)

  12. ACAC Converters for UPS

    Rusalin Lucian R. Păun

    2008-05-01

    Full Text Available This paper propose a new control technique forsingle – phase ACAC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.

  13. Whole blood pumping with a microthrottle pump

    Davies, M J; Johnston, I. D.; Tan, C. K. L.; Tracey, M. C.

    2010-01-01

    We have previously reported that microthrottle pumps (MTPs) display the capacity to pump solid phase suspensions such as polystyrene beads which prove challenging to most microfluidic pumps. In this paper we report employing a linear microthrottle pump (LMTP) to pump whole, undiluted, anticoagulated, human venous blood at 200 μl min−1 with minimal erythrocyte lysis and no observed pump blockage. LMTPs are particularly well suited to particle suspension transport by virtue of their relatively ...

  14. Using a Breast Pump

    ... you can relax and not be disturbed while pumping. If you have an electric pump, find an ... otherwise irritating your nipple or breast tissue. Begin Pumping If your pump is electric or battery-powered, ...

  15. Ion pumping in nanochannels using an asymmetric electrode array

    Sparreboom, W.; Cucu, C.F.; Eijkel, J.C.T.; Berg, van den, T.J.T.P.; Locascio, L.E.; Gaitan, M.; Paegel, B.M.; Ross, D J; Vreeland, W. N.

    2008-01-01

    We demonstrate an ion pump, consisting of a nanochannel with an AC driven asymmetric electrode array. Our system enables us to actively pump ions using a low driving voltage. In all experiments the electrical double layers are overlapping. Via viscous coupling ion pumping is accompanied by liquid pumping. Actuation below 500 mV at 10 Hz results in a liquid velocity of ~10 μm/s, corresponding to an electrical ion current of ~400 fA. Finite element simulations support the experimental data.

  16. Pump characteristics and applications

    Volk, Michael

    2013-01-01

    Providing a wealth of information on pumps and pump systems, Pump Characteristics and Applications, Third Edition details how pump equipment is selected, sized, operated, maintained, and repaired. The book identifies the key components of pumps and pump accessories, introduces the basics of pump and system hydraulics as well as more advanced hydraulic topics, and details various pump types, as well as special materials on seals, motors, variable frequency drives, and other pump-related subjects. It uses example problems throughout the text, reinforcing the practical application of the formulae

  17. AcEST: DK950971 [AcEST

    Full Text Available optera acutorost... 37 0.66 tr|B1ACS6|B1ACS6_BALBN DMP1 (Fragment) OS=Balaenoptera ...bonaerens... 37 0.66 tr|B1ACS5|B1ACS5_BALED DMP1 (Fragment) OS=Balaenoptera edeni... GN=... 37 0.66 tr|B1ACS4|B1ACS4_BALBO DMP1 (Fragment) OS=Balaenoptera borealis ... 37 0.66 tr|B1ACS3|B1ACS3..._BALMU DMP1 (Fragment) OS=Balaenoptera musculus ... 37 0.86 tr|B1ACS1|B1ACS1_MEGNO DMP1 (Fragment) OS=Megapt...1ACS2_BALPH DMP1 (Fragment) OS=Balaenoptera physalus ... 37 1.1 tr|B1ACT6|B1ACT6_MESPE DMP1 (Fragment) OS=Me

  18. Spin exchange collision mixing of the K and Rb ac Stark shifts

    Chen, Yao; Fang, Jiancheng

    2016-01-01

    In a hybrid pumping alkali vapor cell that both K and Rb are filled, K atom spins are optically pumped by laser and Rb atom spins are polarized by the K spins through spin exchange. We find that the AC Stark shift of the Rb atoms is composed of not only the AC Stark shift of the Rb atoms caused by the far off resonant pumping laser which is tuned to the K absorption lines, but also the AC Stark shift of the K atom spins. The mixing of the light shifts through fast spin exchange between K and Rb atoms are studied in this paper and we demonstrate a K-Rb-21Ne co-magnetometer in which the AC Stark shift of the Rb atoms are reduced by the collision mixing.

  19. AC1 Wing

    Adrian DOBRE

    2010-03-01

    Full Text Available The AC1 wing replaces the old wing of the wind tunnel model AEROTAXI, which has been made at scale 1:9. The new wing is part of CESAR program and improves the aerodynamic characteristics of the old one. The geometry of the whole wing was given by FOI Sweden and position of AC1 wing must coincide with the structure of the AEROTAXI model.

  20. AC1 Wing

    Adrian DOBRE

    2010-01-01

    The AC1 wing replaces the old wing of the wind tunnel model AEROTAXI, which has been made at scale 1:9. The new wing is part of CESAR program and improves the aerodynamic characteristics of the old one. The geometry of the whole wing was given by FOI Sweden and position of AC1 wing must coincide with the structure of the AEROTAXI model.

  1. Heat pump technology

    Von Cube, Hans Ludwig; Goodall, E G A

    2013-01-01

    Heat Pump Technology discusses the history, underlying concepts, usage, and advancements in the use of heat pumps. The book covers topics such as the applications and types of heat pumps; thermodynamic principles involved in heat pumps such as internal energy, enthalpy, and exergy; and natural heat sources and energy storage. Also discussed are topics such as the importance of the heat pump in the energy industry; heat pump designs and systems; the development of heat pumps over time; and examples of practical everyday uses of heat pumps. The text is recommended for those who would like to kno

  2. AC Test Chambers

    Federal Laboratory Consortium — The Psychrometric Test Chamber’s primary purpose is to evaluate the performance of split type central air conditioners and heat pumps in the cooling capacity range...

  3. Multiple pump housing

    Donoho, II, Michael R.; Elliott; Christopher M.

    2010-03-23

    A fluid delivery system includes a first pump having a first drive assembly, a second pump having a second drive assembly, and a pump housing. At least a portion of each of the first and second pumps are located in the housing.

  4. Types of Breast Pumps

    ... breast-shield. Some experts discourage the use of bicycle horn pumps because they may be difficult to clean and dry. Battery-Powered and Electric Pumps A powered breast pump uses batteries or a cord plugged into an electrical outlet to power a small motorized pump that ...

  5. Theory and simulations of water flow through carbon nanotubes: prospects and pitfalls

    We study water flow through carbon nanotubes using continuum theory and molecular dynamics simulations. The large slip length in carbon nanotubes greatly enhances the pumping and electrokinetic energy conversion efficiency. In the absence of mobile charges, however, the electro-osmotic flow vanishes. Uncharged nanotubes filled with pure water can therefore not be used as electric field-driven pumps, contrary to some recently ventured ideas. This is in agreement with results from a generalized hydrodynamic theory that includes the angular momentum of rotating dipolar molecules. The electro-osmotic flow observed in simulations of such carbon nanotubes is caused by an imprudent implementation of the Lennard-Jones cutoff. We also discuss the influence of other simulation parameters on the spurious electro-osmotic flow.

  6. ac bidirectional motor controller

    Schreiner, K.

    1988-01-01

    Test data are presented and the design of a high-efficiency motor/generator controller at NASA-Lewis for use with the Space Station power system testbed is described. The bidirectional motor driver is a 20 kHz to variable frequency three-phase ac converter that operates from the high-frequency ac bus being designed for the Space Station. A zero-voltage-switching pulse-density-modulation technique is used in the converter to shape the low-frequency output waveform.

  7. 78 FR 11996 - Energy Efficiency Program for Commercial and Industrial Equipment: Commercial and Industrial Pumps

    2013-02-21

    ... efficiency of commercial and industrial pumps. (76 FR 34192, June 13, 2011). DOE subsequently published a...; ] DEPARTMENT OF ENERGY 10 CFR Part 431 RIN 1904-AC54 Energy Efficiency Program for Commercial and Industrial Equipment: Commercial and Industrial Pumps AGENCY: Office of Energy Efficiency and Renewable...

  8. Pump element for a tube pump

    2011-01-01

    The invention relates to a tube pump comprising a tube and a pump element inserted in the tube, where the pump element comprises a rod element and a first and a second non-return valve member positioned a distance apart on the rod element. The valve members are oriented in the same direction...... portion acts to alternately close and open the valve members thereby generating a fluid flow through the tube. The invention further relates to a pump element comprising at least two non-return valve members connected by a rod element, and for insertion in an at least partly flexible tube in such tube...... pump as mentioned above, thereby acting to generate a fluid flow through the tube upon repeated deformation of the tube between the two valve members. The pump element may comprise a connecting part for coupling to another tube and may comprise a sealing part establishing a fluid tight connection to a...

  9. Gastrostomy feeding tube - pump - child

    Feeding - gastrostomy tube - pump; G-tube - pump; Gastrostomy button - pump; Bard Button - pump; MIC-KEY - pump ... Gather supplies: Feeding pump (electronic or battery powered) Feeding set that matches the feeding pump (includes a feeding bag, drip chamber, roller clamp, ...

  10. AC/RF Superconductivity

    Ciovati, Gianluigi [JLAB

    2015-02-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  11. AC/RF Superconductivity

    Ciovati, G.

    2015-01-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  12. Tritium gas transfer pump development

    Non-lubricated, hermetically sealed pumps for tritium service have been selected to replace Sprengel pumps in the existing Tritium Facility. These pumps will be the primary gas-transfer pumps in the planned Replacement Tritium Facility. The selected pumps are Metal Bellows Corporation's bellows pumps and Normetex scroll pumps. Pumping range for a Normetex/Metal Bellows system is from 0.01 torr suction to 2300 torr discharge. Performance characteristics of both pumps are presented. 10 figs

  13. Large electromagnetic pumps. [LMFBR

    Kilman, G.B.

    1976-01-01

    The development of large electromagnetic pumps for the liquid metal heat transfer systems of fission reactors has progressed for a number of years. Such pumps are now planned for fusion reactors and solar plants as well. The Einstein-Szilard (annular) pump has been selected as the preferred configuration. Some of the reasons that electromagnetic pumps may be preferred over mechanical pumps and why the annular configuration was selected are discussed. A detailed electromagnetic analysis of the annular pump, based on slug flow, is presented. The analysis is then used to explore the implications of large size and power on considerations of electromagnetic skin effect, geometric skin effect and the cylindrical geometry.

  14. Air-clad fibers: pump absorption assisted by chaotic wave dynamics?

    Mortensen, Niels Asger

    2007-01-01

    Wave chaos is a concept which has already proved its practical usefulness in design of double-clad fibers for cladding-pumped fiber lasers and fiber amplifiers. In general, classically chaotic geometries will favor strong pump absorption and we address the extent of chaotic wave dynamics in typical...... air-clad structures may thus suppress the pump-absorption efficiency η below the ergodic scaling law η∞ Ac/Acl, where Ac and Acl are the areas of the rare-earth doped core and the cladding, respectively....

  15. An Alternating Current Electroosmotic Pump Based on Conical Nanopore Membranes.

    Wu, Xiaojian; Ramiah Rajasekaran, Pradeep; Martin, Charles R

    2016-04-26

    Electroosmotic flow (EOF) is used to pump solutions through microfluidic devices and capillary electrophoresis columns. We describe here an EOF pump based on membrane EOF rectification, an electrokinetic phenomenon we recently described. EOF rectification requires membranes with asymmetrically shaped pores, and conical pores in a polymeric membrane were used here. We show here that solution flow through the membrane can be achieved by applying a symmetrical sinusoidal voltage waveform across the membrane. This is possible because the alternating current (AC) carried by ions through the pore is rectified, and we previously showed that rectified currents yield EOF rectification. We have investigated the effect of both the magnitude and frequency of the voltage waveform on flow rate through the membrane, and we have measured the maximum operating pressure. Finally, we show that operating in AC mode offers potential advantages relative to conventional DC-mode EOF pumps. PMID:27046145

  16. Neural network based PWM AC chopper fed induction motor drive

    Venkatesan Jamuna

    2009-01-01

    Full Text Available In this paper, a new Simulink model for a neural network controlled PWM AC chopper fed single phase induction motor is proposed. Closed loop speed control is achieved using a neural network controller. To maintain a constant fluid flow with a variation in pressure head, drives like fan and pump are operated with closed loop speed control. The need to improve the quality and reliability of the drive circuit has increased because of the growing demand for improving the performance of motor drives. With the increased availability of MOSFET's and IGBT's, PWM converters can be used efficiently in low and medium power applications. From the simulation studies, it is seen that the PWM AC chopper has a better harmonic spectrum and lesser copper loss than the Phase controlled AC chopper. It is observed that the drive system with the proposed model produces better dynamic performance, reduced overshoot and fast transient response. .

  17. Insulin pump (image)

    The catheter at the end of the insulin pump is inserted through a needle into the abdominal ... with diabetes. Dosage instructions are entered into the pump's small computer and the appropriate amount of insulin ...

  18. Proton pump inhibitors

    Proton pump inhibitors (PPIs) are medicines that work by reducing the amount of stomach acid made by glands in ... Proton pump inhibitors are used to: Relieve symptoms of acid reflux, or gastroesophageal reflux disease (GERD). This is a ...

  19. Proton pump inhibitors

    Proton pump inhibitors (PPIs) are medicines that work by reducing the amount of stomach acid made by ... Proton pump inhibitors are used to: Relieve symptoms of acid reflux, or gastroesophageal reflux disease (GERD). This ...

  20. Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition

    The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity

  1. Photovoltaic pump systems

    Klockgether, J.; Kiessling, K. P.

    1983-09-01

    Solar pump systems for the irrigation of fields and for water supply in regions with much sunshine are discussed. For surface water and sources with a hoisting depth of 12 m, a system with immersion pumps is used. For deep sources with larger hoisting depths, an underwater motor pump was developed. Both types of pump system meet the requirements of simple installation and manipulation, safe operation, maintenance free, and high efficiency reducing the number of solar cells needed.

  2. Hermetisk AC-Krets

    Hirsch, Carl; Smirnoff, Alexander

    2007-01-01

    Under sex månader våren 2007 har ett samarbete mellan Volvo Lastvagnar och två studenter från KTH, inriktning Integrerad produktutveckling vid institutionen för maskinkonstruktion, pågått i form av ett examensarbete på 20 poäng. Dagens AC-system i Volvos lastbilar avger 20-40 g/år av köldmediet R134a som är en kraftfull växthusgas. Detta sker främst genom diffusion via slangar och tätningsmaterial. Syftet med detta examensarbete är att ta fram förslag på tekniska lösningar på ett nytt AC-syst...

  3. Breast milk - pumping and storing

    ... a comfortable chair, sink, and electric pump. If pumping at work is going to be hard, build ... up your milk supply. Wash your hands before pumping. Collect breast milk when pumping. You can use: ...

  4. The considerations to use soft start AC controllers in nuclear application

    Motors larger than 200 HP shall be fed from 4.16 kV or 2.4 kV fused starters. In CANDU reactors all large pumps motors are supplied directly from the 13.8 kV, 6.3 kV or 4.16 kV AC system. In the MAPLE reactors, the Primary Coolant System pumps are supplied directly from the 2.4 kV AC system. Starting and stopping a pump may be easy, but the consequences may not always be ones we wanted. It can result in high start current that require large cables and fuses, or hydraulic shocks known as 'water hammer' can cause stress and damage to pipes, valves, gaskets and seals. If the nuclear plant installs soft starters, the result will be pump protection, which provides start and stop control, preventing both water hammer and expensive high start currents. (author)

  5. Internal pump monitoring device

    In the present invention, a thermometer is disposed at the upper end of an internal pump casing of a coolant recycling system in a BWR type reactor to detect leakage of reactor water thereby ensuring the improvement of reliability of the internal pump. Namely, a thermometer is disposed, which can detect temperature elevation occurred when water in the internal pump leaked from a reactor pressure vessel passes through the gap between a stretch tube and an upper end of the pump casing. Signals from the thermometer are transmitted to a signal processing device by an instrumentation cable. The signal processing device generates an alarm when the temperature signal exceeds a predetermined value and announces that leakage of reactor water occurs in the internal pump. Since the present invention can detect the leakage of the reactor water in the pump casing in an early stage, it can contribute to the improvement of the safety and reliability of the internal pump. (I.S.)

  6. High performance AC drives

    Ahmad, Mukhtar

    2010-01-01

    This book presents a comprehensive view of high performance ac drives. It may be considered as both a text book for graduate students and as an up-to-date monograph. It may also be used by R & D professionals involved in the improvement of performance of drives in the industries. The book will also be beneficial to the researchers pursuing work on multiphase drives as well as sensorless and direct torque control of electric drives since up-to date references in these topics are provided. It will also provide few examples of modeling, analysis and control of electric drives using MATLAB/SIMULIN

  7. Superconducting ac cable

    The components of a superconducting 110 kV ac cable for power ratings >= 2000 MVA have been developed. The cable design especially considered was of the semiflexible type, with a rigid cryogenic envelope and flexible hollow coaxial cable cores pulled into the former. The cable core consists of spirally wound Nb-Al composite wires and a HDPE-tape wrapped electrical insulation. A 35 m long single phase test cable with full load terminations for 110 kV and 10 kA was constructed and successfully tested. The results obtained prove the technical feasibility and capability of our cable design. (orig.)

  8. Behaviour analysis of AC-600 passive safety systems

    Southwest Center of Reactor Engineering Research and Design has finished the first step conceptual design of 600 mwe advanced PWR (AC-600). The main research emphases of AC-600 conceptual design include the advanced reactor core, the passive safety systems and the simplification. The passive safety systems of AC-600 consist of two reactor make up water tanks, two accumulators, two emergency feedwater tanks, two emergency natural draft air condensers, a containment water jacket and an enhanced primary cycle natural circulation flow system. 25% of the rated reactor power can be removed by the natural circulation cooling. The full pressure reactor make up water tanks are able to provide enough borated water which would be injected into the reactor coolant system during small LOCA. The coolant natural circulations can be established in the primary system and the passive secondary emergency feedwater system, removing residual heat from the reactor core to the atmosphere when station blackout occurs. It is indicated from analysis that the containment diameter of AC-600 is about 35 m. The large tanks and the large vertical distances between the tanks and reactor core are the main reason of using the big containment. It is also indicated from analysis that the low head safety injection pumps are required in AC-600 design to assure the recirculation system operation when large LOCA occurs. The reliability of AC-600 engineered safety systems is increased because the function of the passive safety systems is conducted through the immutable natural laws. The paper discusses the natural circulation ability and safety behavior of the passive safety systems during LOCA or station blackout for AC-600. The passive limits to excess reactivity and thermal hydraulic transients are also preliminarily discussed. Figs and tabs

  9. Heat Pumps With Direct Expansion Solar Collectors

    Ito, Sadasuke

    In this paper, the studies of heat pump systems using solar collectors as the evaporators, which have been done so far by reserchers, are reviwed. Usually, a solar collector without any cover is preferable to one with ac over because of the necessity of absorbing heat from the ambient air when the intensity of the solar energy on the collector is not enough. The performance of the collector depends on its area and the intensity of the convective heat transfer on the surface. Fins are fixed on the backside of the collector-surface or on the tube in which the refrigerant flows in order to increase the convective heat transfer. For the purpose of using a heat pump efficiently throughout year, a compressor with variable capacity is applied. The solar assisted heat pump can be used for air conditioning at night during the summer. Only a few groups of people have studied cooling by using solar assisted heat pump systems. In Japan, a kind of system for hot water supply has been produced commercially in a company and a kind of system for air conditioning has been installed in buildings commercially by another company.

  10. Geothermal energy. Ground source heat pumps

    Geothermal energy can be harnessed in 2 different ways: electricity or heat generation. The combined net electrical geothermal power of the European Union countries reached 719.3 MWe in 2008 (4.8 MW up on 2007) for 868.1 MWe of installed capacity. Gross electrical production contracted slightly in 2008 (down 1% on the 2007 level) and stood at 5809.5 GWh in 2008. Italy has a overwhelming position with a production of 5520.3 GWh. Geothermal heat production concerning aquifers whose temperature is 30-150 C. degrees generally at a depth of 1-3 km is called low- and medium-enthalpy energy. 18 of the 27 EU members use low- and medium-enthalpy energy totaling 2560.0 MWth of installed capacity that yielded 689.2 ktoe in 2008 and 3 countries Hungary, Italy and France totaling 480.3 ktoe. Very low-enthalpy energy concerns the exploitation of shallow geothermal resources using geothermal heat pumps. In 2008, 114452 ground heat pumps were sold in Europe. At the end of 2008, the installed capacity was 8955.4 MWth (16.5% up on 2007 level, it represented 785206 pumps. Over one million ground heat pumps are expected to be operating in 2010 in Europe. (A.C.)

  11. HEAT ACCUMULATION IN HELIUM GROUND SYSTEMS IN HEAT PUMP SUPPLY

    A. I. Kolosov

    2012-04-01

    Full Text Available Problem statement. The paper discusses the problem of estimation of prospects of heat accumulation in the combined systems of heat supply with the use of low potential energy of renewable sources (sun and ground and heat pumps for increase of their potential.Results and conclusions. The use of heat accumulators in combined heating systems that utilize low-potential solar and ground energy as primary energy sources and heat pumps to boost the po-tential of the latter was discussed. A method of calculating ground heat exchangers that use the heat pump cycle to increase a thermal potential of renewable energy sources was set forth. An at-tempt was made at addressing the problem of heat and mass transfer in ground when ground ac-cumulators like “a Field’s tube” are used: a geothermal circulation system comprises two wells (pumping and operational.

  12. Research on the noise induced by cavitation under the asymmetric cavitation condition in a centrifugal pump

    Lu, J. X.; Yuan, S. Q.; Yuan, J. P.; Ren, X. D.; Pei, J.; Si, Q. R.

    2015-12-01

    An experimental investigation has been carried out to research the noise induced by cavitation under the asymmetric cavitation (AC) condition in a centrifugal pump. The acoustic pressure signals at the pump inlet and outlet were measured respectively during the development of cavitation in a closed hydraulic test rig. It could be found that both the pump inlet and outlet acoustic pressures changed obviously with the development of cavitation. The time domain and the power spectrum density of the pump inlet and outlet acoustic pressure pulsations were analyzed. The broadband pulses of the acoustic pressure pulsations were found and the reasons for the phenomenon were given.

  13. Pump application and maintenance

    Nuclear maintenance programs are typically organized by overall application, function, cost impact, and failure histories. Each maintenance program is uniquely tailored for each plant's specific goals and objectives. Most maintenance programs include pump maintenance within an application and/or a function. NMAC provides guidance on maintenance, troubleshooting, and applications of Deep Draft Vertical Centrifugal Pumps, Main Coolant Pump Seals, Feedwater Pumps, and Charging Pumps. Each maintenance guide includes a technical discussion of the design and operating issues which influence pump and component performance, reliability, and availability. The guides also discuss comprehensive inspection and corresponding repair Advisory groups consisting of utility, manufacturer, and regulatory representatives oversee the development of the NMAC guides, and review by utility personnel further augments the development process

  14. Electrokinetic pumps and actuators

    Flow and ionic transport in porous media are central to electrokinetic pumping as well as to a host of other microfluidic devices. Electrokinetic pumping provides the ability to create high pressures (to over 10,000 psi) and high flow rates (over 1 mL/min) with a device having no moving parts and all liquid seals. The electrokinetic pump (EKP) is ideally suited for applications ranging from a high pressure integrated pump for chip-scale HPLC to a high flow rate integrated pump for forced liquid convection cooling of high-power electronics. Relations for flow rate and current fluxes in porous media are derived that provide a basis for analysis of complex microfluidic systems as well as for optimization of electrokinetic pumps

  15. Fakir fuel pump

    1922-01-01

    In designing the Fakir fuel pump, the fundamental idea was to obtain a simple and reliable method of conveying the fuel from a low tank to the carburetor, with the avoidance of the faults of all former methods and the simultaneous warming of the fuel by means of the heat of compression generated. The principle of the Fakir fuel pump rests on the well-known principle of the diaphragm pump, which must be suitably adapted to the present purpose.

  16. Detection of pump degradation

    Greene, R.H.; Casada, D.A.; Ayers, C.W. [and others

    1995-08-01

    This Phase II Nuclear Plant Aging Research study examines the methods of detecting pump degradation that are currently employed in domestic and overseas nuclear facilities. This report evaluates the criteria mandated by required pump testing at U.S. nuclear power plants and compares them to those features characteristic of state-of-the-art diagnostic programs and practices currently implemented by other major industries. Since the working condition of the pump driver is crucial to pump operability, a brief review of new applications of motor diagnostics is provided that highlights recent developments in this technology. The routine collection and analysis of spectral data is superior to all other technologies in its ability to accurately detect numerous types and causes of pump degradation. Existing ASME Code testing criteria do not require the evaluation of pump vibration spectra but instead overall vibration amplitude. The mechanical information discernible from vibration amplitude analysis is limited, and several cases of pump failure were not detected in their early stages by vibration monitoring. Since spectral analysis can provide a wealth of pertinent information concerning the mechanical condition of rotating machinery, its incorporation into ASME testing criteria could merit a relaxation in the monthly-to-quarterly testing schedules that seek to verify and assure pump operability. Pump drivers are not included in the current battery of testing. Operational problems thought to be caused by pump degradation were found to be the result of motor degradation. Recent advances in nonintrusive monitoring techniques have made motor diagnostics a viable technology for assessing motor operability. Motor current/power analysis can detect rotor bar degradation and ascertain ranges of hydraulically unstable operation for a particular pump and motor set. The concept of using motor current or power fluctuations as an indicator of pump hydraulic load stability is presented.

  17. Detection of pump degradation

    This Phase II Nuclear Plant Aging Research study examines the methods of detecting pump degradation that are currently employed in domestic and overseas nuclear facilities. This report evaluates the criteria mandated by required pump testing at U.S. nuclear power plants and compares them to those features characteristic of state-of-the-art diagnostic programs and practices currently implemented by other major industries. Since the working condition of the pump driver is crucial to pump operability, a brief review of new applications of motor diagnostics is provided that highlights recent developments in this technology. The routine collection and analysis of spectral data is superior to all other technologies in its ability to accurately detect numerous types and causes of pump degradation. Existing ASME Code testing criteria do not require the evaluation of pump vibration spectra but instead overall vibration amplitude. The mechanical information discernible from vibration amplitude analysis is limited, and several cases of pump failure were not detected in their early stages by vibration monitoring. Since spectral analysis can provide a wealth of pertinent information concerning the mechanical condition of rotating machinery, its incorporation into ASME testing criteria could merit a relaxation in the monthly-to-quarterly testing schedules that seek to verify and assure pump operability. Pump drivers are not included in the current battery of testing. Operational problems thought to be caused by pump degradation were found to be the result of motor degradation. Recent advances in nonintrusive monitoring techniques have made motor diagnostics a viable technology for assessing motor operability. Motor current/power analysis can detect rotor bar degradation and ascertain ranges of hydraulically unstable operation for a particular pump and motor set. The concept of using motor current or power fluctuations as an indicator of pump hydraulic load stability is presented

  18. The Insulin Pump

    Toews, C. J.

    1985-01-01

    Subcutaneous continuous insulin infusion systems deliver insulin at a basal rate designed to keep blood glucose levels normal in the non-fed state. Additional insulin is delivered at meal time. Pumps can provide near optimal control of blood glucose concentrations in selected, highly motivated patients. The pump provides better diabetic control than once daily insulin injections, although several daily injections can provide comparable control. Optimal control with the pump causes some short-...

  19. ac electrokinetic micropumps: The effect of geometrical confinement, Faradaic current injection, and nonlinear surface capacitance

    Olesen, Laurits Højgaard; Bruus, Henrik; Ajdari, A.

    2006-01-01

    Recent experiments have demonstrated that ac electrokinetic micropumps permit integrable, local, and fast pumping (velocities similar to mm/s) with low driving voltage of a few volts only. However, they also displayed many quantitative and qualitative discrepancies with existing theories. We...... therefore extend the latter theories to account for three experimentally relevant effects: (i) vertical confinement of the pumping channel, (ii) Faradaic currents from electrochemical reactions at the electrodes, and (iii) nonlinear surface capacitance of the Debye layer. We report here that these effects...... indeed affect the pump performance in a way that we can rationalize by physical arguments....

  20. Optically pumped atoms

    Happer, William; Walker, Thad

    2010-01-01

    Covering the most important knowledge on optical pumping of atoms, this ready reference is backed by numerous examples of modelling computation for optical pumped systems. The authors show for the first time that modern scientific computing software makes it practical to analyze the full, multilevel system of optically pumped atoms. To make the discussion less abstract, the authors have illustrated key points with sections of MATLAB codes. To make most effective use of contemporary mathematical software, it is especially useful to analyze optical pumping situations in the Liouville spa

  1. Detection of pump degradation

    Casada, D. [Oak Ridge National Lab., TN (United States)

    1995-04-01

    There are a variety of stressors that can affect the operation of centrifugal pumps. Although these general stressors are active in essentially all centrifugal pumps, the stressor level and the extent of wear and degradation can vary greatly. Parameters that affect the extent of stressor activity are manifold. In order to assure the long-term operational readiness of a pump, it is important to both understand the nature and magnitude of the specific degradation mechanisms and to monitor the performance of the pump. The most commonly applied method of monitoring the condition of not only pumps, but rotating machinery in general, is vibration analysis. Periodic or continuous special vibration analysis is a cornerstone of most pump monitoring programs. In the nuclear industry, non-spectral vibration monitoring of safety-related pumps is performed in accordance with the ASME code. Pump head and flow rate are also monitored, per code requirements. Although vibration analysis has dominated the condition monitoring field for many years, there are other measures that have been historically used to help understand pump condition; advances in historically applied technologies and developing technologies offer improved monitoring capabilities. The capabilities of several technologies (including vibration analysis, dynamic pressure analysis, and motor power analysis) to detect the presence and magnitude of both stressors and resultant degradation are discussed.

  2. Ground Source Heat Pumps

    Lale Valizade

    2013-01-01

    A heat pump is a device that is able to transfer heat from one fluid at a lower temperature to another at a higher temperature. Ground source heat pumps are generally classified by the type of ground loop. The coefficient of performance (COP) is used to define the heating performance of heat pumps. Both the COP and EER values are valid only at the specific test conditions used in the rating. A ground source pump could reach 450%, compared with an efficient gas boiler of 90% obviously this is ...

  3. Photonic crystal resonator integrated in a microfluidic system

    Rodrigues de Sousa Nunes, Pedro André; Mortensen, Niels Asger; Kutter, Jörg Peter;

    2008-01-01

    -free refractive index detection. The resonator was fabricated in a silicon oxynitride platform, to support electro-osmotic flow, and operated at =1.55 m. Different aqueous solutions of ethanol with refractive indices ranging from n1.3330 to 1.3616 were pumped into the column/resonator, and the transmission...

  4. Characterization of flowreversal in anodically bonded glass-based AC electrokinetic micropumps

    Gregersen, Misha Marie; Olesen, Laurits Højgaard; Brask, Anders;

    2007-01-01

    Microfluidic chips have been fabricated to study electrokinetic pumping generated by a low voltage AC signal applied to an asymmetric electrode array. A measurement procedure has been established and followed carefully resulting in a high degree of reproducibility of the measurements. Depending on...

  5. Liquid pump for astronaut cooling

    Carson, M. A.

    1972-01-01

    The Apollo portable life support system water-recirculation pump used for astronaut cooling is described. The problems associated with an early centrifugal pump and how these problems were overcome by the use of a new diaphragm pump are discussed. Performance comparisons of the two pump designs are given. Developmental problems and flight results with the diaphragm pump are discussed.

  6. Ac Hybrid Charge Controller

    Shalini S. Durgam

    2015-03-01

    Full Text Available One of the primary needs for socio-economic development in any nation in the world is the provision of reliable electricity supply systems with lower carbon footprint levels. The purpose of this work is the development of a hybrid Power system that harnesses the renewable energy in sun and electricity to generate electricity. The working model can able to run on dual mode- solar and electricity. It can also be driven independently either by solar or electricity. The battery can be charge from solar panel (40W or by power supply. The household single phase A.C. power supply of 230V is converted into 12V D.C. using step down transformer and rectifying circuit. The working model can achieve energy saving, low carbon emission, environmental protection for the upcoming future of human life.

  7. Water Treatment Technology - Pumps.

    Ross-Harrington, Melinda; Kincaid, G. David

    One of twelve water treatment technology units, this student manual on pumps provides instructional materials for three competencies. (The twelve units are designed for a continuing education training course for public water supply operators.) The competencies focus on the following areas: types of pumps in plant and distribution systems, pump…

  8. Detection of pump degradation

    There are a variety of stressors that can affect the operation of centrifugal pumps. Although these general stressors are active in essentially all centrifugal pumps, the stressor level and the extent of wear and degradation can vary greatly. Parameters that affect the extent of stressor activity are manifold. In order to assure the long-term operational readiness of a pump, it is important to both understand the nature and magnitude of the specific degradation mechanisms and to monitor the performance of the pump. The most commonly applied method of monitoring the condition of not only pumps, but rotating machinery in general, is vibration analysis. Periodic or continuous spectral vibration analysis is a cornerstone of most pump monitoring programs. In the nuclear industry, non-spectral vibration monitoring of safety-related pumps is performed in accordance with the ASME code. Although vibration analysis has dominated the condition monitoring field for many years, there are other measures that have been historically used to help understand pump condition: advances in historically applied technologies and developing technologies offer improved monitoring capabilities. The capabilities of several technologies (including vibration analysis, dynamic pressure analysis, and motor power analysis) to detect the presence and magnitude of both stressors and resultant degradation are discussed

  9. Normetex Pump Alternatives Study

    Clark, Elliot A.

    2013-04-25

    A mainstay pump for tritium systems, the Normetex scroll pump, is currently unavailable because the Normetex company went out of business. This pump was an all-metal scroll pump that served tritium processing facilities very well. Current tritium system operators are evaluating replacement pumps for the Normetex pump and for general used in tritium service. An all-metal equivalent alternative to the Normetex pump has not yet been identified. 1. The ideal replacement tritium pump would be hermetically sealed and contain no polymer components or oils. Polymers and oils degrade over time when they contact ionizing radiation. 2. Halogenated polymers (containing fluorine, chlorine, or both) and oils are commonly found in pumps. These materials have many properties that surpass those of hydrocarbon-based polymers and oils, including thermal stability (higher operating temperature) and better chemical resistance. Unfortunately, they are less resistant to degradation from ionizing radiation than hydrocarbon-based materials (in general). 3. Polymers and oils can form gaseous, condensable (HF, TF), liquid, and solid species when exposed to ionizing radiation. For example, halogenated polymers form HF and HCl, which are extremely corrosive upon reaction with water. If a pump containing polymers or oils must be used in a tritium system, the system must be designed to be able to process the unwanted by-products. Design features to mitigate degradation products include filters and chemical or physical traps (eg. cold traps, oil traps). 4. Polymer components can work in tritium systems, but must be replaced regularly. Polymer components performance should be monitored or be regularly tested, and regular replacement of components should be viewed as an expected normal event. A radioactive waste stream must be established to dispose of used polymer components and oil with an approved disposal plan developed based on the facility location and its regulators. Polymers have varying

  10. EXPERIMENTAL STUDY ON ALTERNATING MAGNETIC FIELD MAGNETOHYDRODYNAMIC PUMP

    PENG Yan; ZHAO Ling-zhi; SONG Shu-jun; SHA Ci-wen; LI Ran; XU Yu-yu

    2008-01-01

    An experimental apparatus to investigate AC MHD pump was established, which mainly consists of a rotary permanent magnet with 4 poles an annular channel, a motor, a shaft and a platform. The magnet generates a field similar to sinusoid with the maximum of 0.9 T in the channel when it is rotated up by the motor to simulate an AC magnetic field. This moving magnetic field acts on the conductive fluid in the channel, and produces an electromagnetic force to move the fluid in the same direction as that of the magnet rotating. Experiments were carried out to investigate the performance of the pump. Flow velocity in the annular channel was measured for different conductivities and rotating speeds of the magnet. The results show that the flow rate and pressure increase as the magnetic field strength, fluid conductivity and frequency of the magnetic field increase.

  11. AcEST: BP920072 [AcEST

    Full Text Available YMU001_000132_F11 525 Adiantum capillus-veneris mRNA. clone: YMU001_000132_F11. BP920072 - Show ... YGMYGEGEKALETFADMEKSGIVPDSVVFIAII 617 Query: 139 NACSR SCLFHECHSYFEAMSTHHGIVPCLEHHSCVV 32 ACS S L E + FE M ... KLMTRDVVSWNTLIAGYAQVGQNEGLFCTFSDMLGQRVKPDLITFVIVLNACSR ... 125 VF+ + +D VSWN++I+GY Q G F M+ + D IT++++++ +R S ... YGVHGYGKKAIQIFEEMLANGASP 384 Query: 166 DLITFVIVLNACSR SCLFHECHSYFEAMSTHHGIVPCLEHHSCVV 32 +TFV VL ACS L E ... KLMTRDVVSWNTLIAGYAQVGQNEGLFCTFSDMLGQRVKPDLITFVIVLNACSR S 122 +VFDK R + WN L G E + + M V+ D T+ VL AC S Sbjc ...

  12. Apparatus for Pumping a Fluid

    Boeyen, Robert Van; Reeh, Jonathan

    2013-01-01

    A fluid pump has been developed for mechanically pumped fluid loops for spacecraft thermal control. Lynntech's technology utilizes a proprietary electrochemically driven pumping mechanism. Conventional rotodynamic and displacement pumps typically do not meet the stringent power and operational reliability requirements of space applications. Lynntech's developmental pump is a highly efficient solid-state pump with essentially no rotating or moving components (apart from metal bellows).

  13. Pump effect of a capillary discharge in electrically conductive liquids

    De Baerdemaeker, F.; Šimek, Milan; Leys, C.; Verstraete, W.

    2007-01-01

    Roč. 27, č. 4 (2007), s. 473-485. ISSN 0272-4324 R&D Projects: GA AV ČR IAA1043403 Institutional research plan: CEZ:AV0Z20430508 Keywords : water * conductive * capillary * AC discharge * pump Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 1.747, year: 2007 http://www.springerlink.com/content/w802073563282272/fulltext.pdf

  14. Pumping machinery theory and practice

    Badr, Hassan M

    2014-01-01

    Pumping Machinery Theory and Practice comprehensively covers the theoretical foundation and applications of pumping machinery. Key features: Covers characteristics of centrifugal pumps, axial flow pumps and displacement pumpsConsiders pumping machinery performance and operational-type problemsCovers advanced topics in pumping machinery including multiphase flow principles, and two and three-phase flow pumping systemsCovers different methods of flow rate control and relevance to machine efficiency and energy consumptionCovers different methods of flow rate control and relevance to machine effi

  15. AcEST: BP918490 [AcEST

    Full Text Available 1|SRPC_PSEPU Solvent efflux pump outer membrane protein ... 69 1e-11 sp|Q93PU3|TTGI_PSEPU Toluene efflux pump outer membrane prote...in ... 66 1e-10 sp|Q9ZHD2|SILC_SALTY Probable outer membrane lipoprotein silC OS... 63... 9e-10 sp|Q51397|OPRJ_PSEAE Outer membrane protein oprJ OS=Pseudomonas ... 61 3e-09 sp|Q9WWZ8|TTGC_PSEPU Toluene efflux pump outer... membrane protein ... 55 2e-07 sp|Q88N32|TTGC_PSEPK Probable efflux pump outer... membrane protein... 55 2e-07 sp|P0C071|MEPC_PSEPU Multidrug/solvent efflux pump outer me

  16. Microfluidic reflow pumps.

    Haslam, Bryan; Tsai, Long-Fang; Anderson, Ryan R; Kim, Seunghyun; Hu, Weisheng; Nordin, Gregory P

    2015-07-01

    A new microfluidic pump, termed a reflow pump, is designed to operate with a sub-μl sample volume and transport it back and forth between two pneumatically actuated reservoirs through a flow channel typically containing one or more sensor surfaces. The ultimate motivation is to efficiently use the small sample volume in conjunction with convection to maximize analyte flux to the sensor surface(s) in order to minimize sensor response time. In this paper, we focus on the operational properties of the pumps themselves (rather than the sensor surfaces), and demonstrate both two-layer and three-layer polydimethylsiloxane reflow pumps. For the three-layer pump, we examine the effects of reservoir actuation pressure and actuation period, and demonstrate average volumetric flow rates as high as 500 μl/min. We also show that the two-layer design can pump up to 93% of the sample volume during each half period and demonstrate integration of a reflow pump with a single-chip microcantilever array to measure maximum flow rate. PMID:26221199

  17. Pressure charged airlift pump

    Campbell, Gene K.

    1983-01-01

    A pumping system is described for pumping fluids, such as water with entrained mud and small rocks, out of underground cavities such as drilled wells, which can effectively remove fluids down to a level very close to the bottom of the cavity and which can operate solely by compressed air pumped down through the cavity. The system utilizes a subassembly having a pair of parallel conduit sections (44, 46) adapted to be connected onto the bottom of a drill string utilized for drilling the cavity, the drill string also having a pair of coaxially extending conduits. The subassembly includes an upper portion which has means for connection onto the drill string and terminates the first conduit of the drill string in a plenum (55). A compressed air-driven pump (62) is suspended from the upper portion. The pump sucks fluids from the bottom of the cavity and discharges them into the second conduit. Compressed air pumped down through the first conduit (46) to the plenum powers the compressed air-driven pump and aerates the fluid in the second conduit to lift it to the earth's surface.

  18. Induction Motor Control through AC/DC/AC Converters

    Elfadili, Abderrahim; Giri, Fouad; Ouadi, Hamid; El Magri, Abdelmounime; Dugard, Luc; Abouloifa, Abdelmajid

    2010-01-01

    We consider the problem of controlling inductions motors driven through AC/DC rectifiers and DC/AC inverters. The control objectives are threefold: (i) forcing the motor speed to track a reference signal, (ii) regulating the DC Link voltage, (iii) assuring a satisfactory power factor correction (PFC) with respect to the power supply net. First, a nonlinear model of the whole controlled system is developed in the Park-coordinates. Then, a nonlinear multi-loop controller is synthesized using th...

  19. AcEST: BP920905 [AcEST

    Full Text Available EM + + D ++S L AC Sbjct: 374 NSAYKLFERMPKKNVVAWNAIISGYSQHGHPHEALALFIEMQAQGIKPDSFAIVSVLPAC 433 Query: 71 SHSSTLNDGKLIHFYILMNNFE...EM++ ++ + V + S L +C Sbjct: 255 SSERIFEKIAKKNAVSWTAMISSYNRGEFSEKALRSFSEMIKSGIEPNLVTLYSVLSSCG 314 Query: 68 HSSTLNDGKLIHFYILMNNFE...VVVMSCLKACS 69 ++ +F RRD VTW A+I GYA HG E A+ LF+ M+ EN+ + V +S L+AC+ Sbjct: 656 DSRLMFEKSLRRDFVTWNAMICGYAHHGKGEEAIQLFERMILEN...ELEKMHNKRLQEMCVSWNSIISGYVMKEQSEDAQMLFTRMME 596 Query: 122 ENVDTDGVVVMSCLKACSHSSTLNDGKLIHFYILMNNFE ...FCEADT-NVITWNAMIASYVHCEQSEKAIALFDRMVSENFKPSSITLVTLLMAC 543 Query: 71 SHSSTLNDGKLIHFYILMNNFEL 3 ++ +L G++

  20. AcEST: DK950147 [AcEST

    Full Text Available TST38A01NGRL0007_O05 706 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0007_O05. 5' end seq ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... OS=Medicago truncatula GN=MtrDRAFT_AC149576g3v2 PE ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... (Fragment) OS=Medicago truncatula GN=MtrDRAFT_AC14 ...

  1. AcEST: DK959344 [AcEST

    Full Text Available TST39A01NGRL0004_G23 714 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0004_G23. 5' end seq ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... OS=Medicago truncatula GN=MtrDRAFT_AC149576g3v2 PE ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... (Fragment) OS=Medicago truncatula GN=MtrDRAFT_AC14 ...

  2. AcEST: DK949716 [AcEST

    Full Text Available TST38A01NGRL0006_L20 613 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0006_L20. 5' end seq ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... OS=Medicago truncatula GN=MtrDRAFT_AC149576g3v2 PE ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... (Fragment) OS=Medicago truncatula GN=MtrDRAFT_AC14 ...

  3. AC drives for industrial plants. Plant kudoyo AC drive sochi

    Miyazaki, M.; Shibata, M.; Yamada, S. (Toshiba Corp., Tokyo (Japan))

    1992-08-01

    Features and product series of AC drives for industrial plants were outlined. Configurations and features of various types of AC drives were briefly discussed which are put into market to meet various requirements for industrial plants and wide ranges of output voltage and capacity. The following product series were outlined; the power bipolar transistor inverter for 3.5-600 kVA in output capacity, IGBT inverter for AC 400 V in output voltage and 1,000 kVA or less, GTO inverter for AC 600 V and 700-2,000 kVA, and cycloconverter for AC 1,000-3,000 V and 1,000 kW-20 MW. The following subjects were outlined as current technical trends of AC drives for industrial plants; increasing in capacity of voltage-source PWM inverters, downsizing of converters through highly efficient cooling and highly dense mounting, spreading of sensorless vector controls, and development of high-voltage large-capacity PWM inverters. 6 figs., 2 tabs.

  4. Electromagnetically-Actuated Reciprocating Pump for High-Flow-Rate Microfluidic Applications

    Chia-Yen Lee; Jian-Hao Zhong; Ming-Tsun Ke

    2012-01-01

    This study presents an electromagnetically-actuated reciprocating pump for high-flow-rate microfluidic applications. The pump comprises four major components, namely a lower glass plate containing a copper microcoil, a middle PMMA plate incorporating a PDMS diaphragm with a surface-mounted magnet, upper PMMA channel plates, and a ball-type check valve located at the channel inlet. When an AC current is passed through the microcoil, an alternating electromagnetic force is established between t...

  5. Time-reversal symmetry breaking by ac field: Effect of commensurability in the frequency domain

    V E Kravtsov

    2002-02-01

    It is shown that the variance of the linear dc conductance fluctuations in an open quantum dot under high-frequency ac pumping depends significantly on the spectral content of the ac field. For a sufficiently strong ac field the dc conductance fluctuations are much stronger for the periodic pumping than in the case of the noise ac field of the same intensity. The reduction factor in a static magnetic field takes the universal value of 2 only for the white-noise pumping. In general may deviate from 2 thus signalling on the time-reversal breaking by the ac field. For the bi-harmonic ac field of the form () = 0 [cos(1 ) + cos(2 )] we predict the enchancement of effects of -symmetry breaking at commensurate frequencies 2/1 = /. In the high-temperature limit there is also the parity effect: the enchancement is only present if either or is even.

  6. Pumping and Breastmilk Storage

    ... refrigerate or freeze your breastmilk also qualify as tax-deductible breastfeeding gear. After each pumping Label the ... cause some of the milk's valuable parts to break down. Refrigerate or chill milk right after it ...

  7. Keeping Hearts Pumping

    2002-01-01

    A collaboration between NASA, Dr. Michael DeBakey, Dr. George Noon, and MicroMed Technology, Inc., resulted in a life-saving heart pump for patients awaiting heart transplants. The MicroMed DeBakey VAD functions as a "bridge to heart transplant" by pumping blood throughout the body to keep critically ill patients alive until a donor heart is available. Weighing less than 4 ounces and measuring 1 inch by 3 inches, the pump is approximately one-tenth the size of other currently marketed pulsatile VADs. This makes it less invasive and ideal for smaller adults and children. Because of the pump's small size, less than 5 percent of the patients implanted developed device-related infections. It can operate up to 8 hours on batteries, giving patients the mobility to do normal, everyday activities.The MicroMed DeBakey VAD is a registered trademark of MicroMed Technology, Inc.

  8. Nuclear-pumped lasers

    Prelas, Mark

    2016-01-01

    This book focuses on Nuclear-Pumped Laser (NPL) technology and provides the reader with a fundamental understanding of NPLs, a review of research in the field, and exploration of large scale NPL system design and applications. Early chapters look at the fundamental properties of lasers, nuclear-pumping and nuclear reactions that may be used as drivers for nuclear-pumped lasers. The book goes on to explore the efficient transport of energy from the ionizing radiation to the laser medium and then the operational characteristics of existing nuclear-pumped lasers. Models based on Mathematica, explanations and a tutorial all assist the reader’s understanding of this technology. Later chapters consider the integration of the various systems involved in NPLs and the ways in which they can be used, including beyond the military agenda. As readers will discover, there are significant humanitarian applications for high energy/power lasers, such as deflecting asteroids, space propulsion, power transmission and mining....

  9. High Voltage Charge Pump

    Emira, Ahmed A.

    2014-10-09

    Various embodiments of a high voltage charge pump are described. One embodiment is a charge pump circuit that comprises a plurality of switching stages each including a clock input, a clock input inverse, a clock output, and a clock output inverse. The circuit further comprises a plurality of pumping capacitors, wherein one or more pumping capacitors are coupled to a corresponding switching stage. The circuit also comprises a maximum selection circuit coupled to a last switching stage among the plurality of switching stages, the maximum selection circuit configured to filter noise on the output clock and the output clock inverse of the last switching stage, the maximum selection circuit further configured to generate a DC output voltage based on the output clock and the output clock inverse of the last switching stage.

  10. Advanced heat pump

    Ashley, Joseph L.; Matthews, John D.

    1989-09-01

    This patent application discloses a heat pump which includes a first packed bed of liquid desiccant for removing moisture from outside air in the heating mode of operation, and a pump for transferring the moisture laden desiccant to a second packed bed which humidifies condenser heated inside air by adding water vapor to the air. The first packed bed, by removing moisture from the outside air before it passes through the heat pump's evaporator coils, prevents frost from forming on the coils. In the cooling mode of operation the second packed bed of liquid desiccant removes water vapor from the air inside of the building. The moisture laden desiccant is then transferred to the first packed bed by a second pump where condenser heat transfers the moisture from the desiccant to outside air.

  11. Lunar Base Heat Pump

    Walker, D.; Fischbach, D.; Tetreault, R.

    1996-01-01

    The objective of this project was to investigate the feasibility of constructing a heat pump suitable for use as a heat rejection device in applications such as a lunar base. In this situation, direct heat rejection through the use of radiators is not possible at a temperature suitable for lde support systems. Initial analysis of a heat pump of this type called for a temperature lift of approximately 378 deg. K, which is considerably higher than is commonly called for in HVAC and refrigeration applications where heat pumps are most often employed. Also because of the variation of the rejection temperature (from 100 to 381 deg. K), extreme flexibility in the configuration and operation of the heat pump is required. A three-stage compression cycle using a refrigerant such as CFC-11 or HCFC-123 was formulated with operation possible with one, two or three stages of compression. Also, to meet the redundancy requirements, compression was divided up over multiple compressors in each stage. A control scheme was devised that allowed these multiple compressors to be operated as required so that the heat pump could perform with variable heat loads and rejection conditions. A prototype heat pump was designed and constructed to investigate the key elements of the high-lift heat pump concept. Control software was written and implemented in the prototype to allow fully automatic operation. The heat pump was capable of operation over a wide range of rejection temperatures and cooling loads, while maintaining cooling water temperature well within the required specification of 40 deg. C +/- 1.7 deg. C. This performance was verified through testing.

  12. Tokamak pump limiters

    Recent experiments with a scoop limiter without active internal pumping have been carried out in the PDX tokamak with up to 6MW of auxiliary neutral beam heating. Experiments have also been done with a rotating head pump limiter in the PLT tokamak in conjunction with RF plasma heating. Extensive experiments have been done in the ISX-B tokamak and first experiments have been completed with the ALT-I limiter in TEXTOR. The pump limiter modules in these latter two machines have internal getter pumping. Experiments in ISX-B are with ohmic and auxiliary neutral beam heating. The results in ISX-B and TEXTOR show that active density control and particle removal is achieved with pump limiters. In ISX-B, the boundary layer (or scape-off layer) plasma partially screens the core plasma from gas injection. In both ISX-B and TEXTOR, the pressure internal to the module scales linearly with plasma density but in ISX-B, with neutral beam injection, a nonlinear increase is observed at the highest densities studied. Plasma plugging is the suspected cause. Results from PDX suggest that a region may exist in which core plasma energy confinement improves using a pump limiter during neutral beam injection. Asymmetric radial profiles and an increased edge electron temperature are observed in discharges with improved confinement. The injection of small amounts of neon into ISX-B has more clearly shown an improved electron core energy confinement during neutral beam injection. While carried out with a regular limiter, this Z-mode of operation is ideal for use with pump limiters and should be a way to achieve energy confinement times similar to values for H-mode tokamak plasmas. The implication of all these results for the design of a reactor pump limiter is described

  13. Portable photovoltaic irrigation pumps

    Furber, J.D.

    1980-07-01

    Experiences in developing a solar-powered irrigation pump to meet the needs of poor farmers in developing nations are summarized. The design which evolved is small and portable, employing a high-efficiency electric pump, powered by photovoltaic panels. Particular emphasis is placed on how the system works, and on early field problems experienced with the first prototypes. The resolution of these problems and the performance of actual systems in various countries is presented and user responses are noted.

  14. Rotary blood pump

    Benkowski, Robert J. (Inventor); Kiris, Cetin (Inventor); Kwak, Dochan (Inventor); Rosenbaum, Bernard J. (Inventor); Bacak, James W. (Inventor); DeBakey, Michael E. (Inventor)

    1999-01-01

    A blood pump that comprises a pump housing having a blood flow path therethrough, a blood inlet, and a blood outlet; a stator mounted to the pump housing, the stator having a stator field winding for producing a stator magnetic field; a flow straightener located within the pump housing, and comprising a flow straightener hub and at least one flow straightener blade attached to the flow straightener hub; a rotor mounted within the pump housing for rotation in response to the stator magnetic field, the rotor comprising an inducer and an impeller; the inducer being located downstream of the flow straightener, and comprising an inducer hub and at least one inducer blade attached to the inducer hub; the impeller being located downstream of the inducer, and comprising an impeller hub and at least one impeller blade attached to the impeller hub; and preferably also comprising a diffuser downstream of the impeller, the diffuser comprising a diffuser hub and at least one diffuser blade. Blood flow stagnation and clot formation within the pump are minimized by, among other things, providing the inducer hub with a diameter greater than the diameter of the flow straightener hub; by optimizing the axial spacing between the flow straightener hub and the inducer hub, and between the impeller hub and the diffuser hub; by optimizing the inlet angle of the diffuser blades; and by providing fillets or curved transitions between the upstream end of the inducer hub and the shaft mounted therein, and between the impeller hub and the shaft mounted therein.

  15. BIOMATERIALS FOR ROTARY BLOOD PUMPS

    VANOEVEREN, W

    1995-01-01

    Rotary blood pumps are used for cardiac assist and cardiopulmonary support since mechanical blood damage is less than with conventional roller pumps. The high shear rate in the rotary pump and the reduced anticoagulation of the patient during prolonged pumping enforces high demands on the biocompati

  16. Pump trials for charged liquids

    The pumps intended for the circulation of charged and radioactive liquids have particular qualities. The choice of such a pump has called for endurance tests with various types of equipment: a Goodyear volumetric screw pumps, and RICHIER, Klein and SCHABAVER centrifugal pumps. The latter, fitted with a special oakum, gave the best results. (authors)

  17. A DC brushless PM motor driven photovoltaic water pumping system

    Yu, Shijie; Xie, Lei; He, Huiruo; Zhang, Hualin; Zhou, Longhua; Liu, Wen [Sun Yat-sen Univ., Zhuhai (China). Inst. of Power Electronics and Control Technology

    2008-07-01

    Along with the worldwide more attention to environment and rapid development of photovoltaic industry, the PV water pumping system has rapidly developed, the economic advantage of which brings it into prominence. It was estimated, up to now the operating PV water pumping systems in the world may exceed hundreds thousand sets and with a driving increasing tendency. In many cases the distributed stations gain the advantages over PV feed-in grid-connected pump. The majority of the PV pumping systems are driven by an ac asynchronous motor, which are generally of lower efficiency, especially for small-scale systems. A dc permanent magnetic, brushless, sensorless and casting resin motor are developed and used in PV water pumping systems, the experiments and operations of 19 demonstrative stations in Guangdong show that the results on economics and reliability are excited. It can save even 15% {proportional_to} 20% PV modules in comparison with an asynchronous motor driven under same sunshine, water head and flow. An example of comparison between systems with batteries and without batteries is also given in this paper. Finally the commercialization, marketing and subsidy policies of PV water pumping system in China are discussed. (orig.)

  18. Thermally Actuated Hydraulic Pumps

    Jones, Jack; Ross, Ronald; Chao, Yi

    2008-01-01

    Thermally actuated hydraulic pumps have been proposed for diverse applications in which direct electrical or mechanical actuation is undesirable and the relative slowness of thermal actuation can be tolerated. The proposed pumps would not contain any sliding (wearing) parts in their compressors and, hence, could have long operational lifetimes. The basic principle of a pump according to the proposal is to utilize the thermal expansion and contraction of a wax or other phase-change material in contact with a hydraulic fluid in a rigid chamber. Heating the chamber and its contents from below to above the melting temperature of the phase-change material would cause the material to expand significantly, thus causing a substantial increase in hydraulic pressure and/or a substantial displacement of hydraulic fluid out of the chamber. Similarly, cooling the chamber and its contents from above to below the melting temperature of the phase-change material would cause the material to contract significantly, thus causing a substantial decrease in hydraulic pressure and/or a substantial displacement of hydraulic fluid into the chamber. The displacement of the hydraulic fluid could be used to drive a piston. The figure illustrates a simple example of a hydraulic jack driven by a thermally actuated hydraulic pump. The pump chamber would be a cylinder containing encapsulated wax pellets and containing radial fins to facilitate transfer of heat to and from the wax. The plastic encapsulation would serve as an oil/wax barrier and the remaining interior space could be filled with hydraulic oil. A filter would retain the encapsulated wax particles in the pump chamber while allowing the hydraulic oil to flow into and out of the chamber. In one important class of potential applications, thermally actuated hydraulic pumps, exploiting vertical ocean temperature gradients for heating and cooling as needed, would be used to vary hydraulic pressures to control buoyancy in undersea research

  19. Dynamic modelling of a PV pumping system with special consideration on water demand

    Highlights: ► Evaluation of water demand and solar energy is essential for PV pumping system. ► The design for a PV water pumping system has been optimized based on dynamic simulations. ► It is important to conduct dynamic simulations to check the matching between water demand and water supply. ► AC pump driven by the fixed PV array is the most cost-effective solution. - Abstract: The exploitation of solar energy in remote areas through photovoltaic (PV) systems is an attractive solution for water pumping for irrigation systems. The design of a photovoltaic water pumping system (PVWPS) strictly depends on the estimation of the crop water requirements and land use since the water demand varies during the watering season and the solar irradiation changes time by time. It is of significance to conduct dynamic simulations in order to achieve the successful and optimal design. The aim of this paper is to develop a dynamic modelling tool for the design of a of photovoltaic water pumping system by combining the models of the water demand, the solar PV power and the pumping system, which can be used to validate the design procedure in terms of matching between water demand and water supply. Both alternate current (AC) and direct current (DC) pumps and both fixed and two-axis tracking PV array were analyzed. The tool has been applied in a case study. Results show that it has the ability to do rapid design and optimization of PV water pumping system by reducing the power peak and selecting the proper devices from both technical and economic viewpoints. Among the different alternatives considered in this study, the AC fixed system represented the best cost effective solution

  20. AcEST: BP916855 [AcEST

    Full Text Available YMU001_000092_F07 488 Adiantum capillus-veneris mRNA. clone: YMU001_000092_F07. BP916855 CL436Co ... H Putative pyrophosphate-energized membrane proton pump ... 3 OS=Arabidopsis thaliana Align length 162 Score ( ... p|Q8RCX1|HPPA_THETN Pyrophosphate-energized proton pump ... OS=Ther... 178 1e-44 sp|Q8TJA8|HPPA2_METAC Pyropho ...

  1. AcEST: BP921672 [AcEST

    Full Text Available YMU001_000152_G09 441 Adiantum capillus-veneris mRNA. clone: YMU001_000152_G09. BP921672 CL436Co ... AVP2_ARATH Pyrophosphate-energized membrane proton pump ... 2 OS=Arabidopsis thaliana Align length 146 Score ( ... p|Q8RCX1|HPPA_THETN Pyrophosphate-energized proton pump ... OS=Ther... 120 2e-27 sp|Q8PYZ8|HPPA1_METMA Pyropho ...

  2. AcEST: DK957906 [AcEST

    Full Text Available TST39A01NGRL0029_J16 650 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0029_J16. 5' end seq ... H Pyrophosphate-energized vacuolar membrane proton pump ... 1 OS=Arabidopsis thaliana Align length 160 Score ( ... p|Q8F641|HPPA_LEPIN Pyrophosphate-energized proton pump ... OS=Lept... 45 4e-04 sp|Q72Q29|HPPA_LEPIC Pyrophosp ...

  3. AcEST: BP916377 [AcEST

    Full Text Available YMU001_000087_A08 472 Adiantum capillus-veneris mRNA. clone: YMU001_000087_A08. BP916377 CL436Co ... AVP2_ARATH Pyrophosphate-energized membrane proton pump ... 2 OS=Arabidopsis thaliana Align length 157 Score ( ... p|Q8RCX1|HPPA_THETN Pyrophosphate-energized proton pump ... OS=Ther... 132 1e-30 sp|Q8TJA8|HPPA2_METAC Pyropho ...

  4. AcEST: DK954135 [AcEST

    Full Text Available TST39A01NGRL0019_K04 622 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0019_K04. 5' end seq ... AVP2_ARATH Pyrophosphate-energized membrane proton pump ... 2 OS=Arabidopsis thaliana Align length 207 Score ( ... p|Q8RCX1|HPPA_THETN Pyrophosphate-energized proton pump ... OS=Ther... 151 2e-36 sp|Q89K83|HPPA_BRAJA Pyrophos ...

  5. AcEST: DK961553 [AcEST

    Full Text Available TST39A01NGRL0010_H02 670 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0010_H02. 5' end seq ... U Pyrophosphate-energized vacuolar membrane proton pump ... OS=Phaseolus aureus Align length 198 Score (bit) 2 ... p|Q8F641|HPPA_LEPIN Pyrophosphate-energized proton pump ... OS=Lept... 72 3e-12 sp|Q72Q29|HPPA_LEPIC Pyrophosp ...

  6. AcEST: DK943760 [AcEST

    Full Text Available YMU02A01NGRL0003_N16 480 Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0003_N16. 5' end seq ... H Pyrophosphate-energized vacuolar membrane proton pump ... 1 OS=Arabidopsis thaliana Align length 160 Score ( ... p|Q8F641|HPPA_LEPIN Pyrophosphate-energized proton pump ... OS=Lept... 149 5e-36 sp|Q72Q29|HPPA_LEPIC Pyrophos ...

  7. AcEST: BP912221 [AcEST

    Full Text Available YMU001_000016_E09 556 Adiantum capillus-veneris mRNA. clone: YMU001_000016_E09. BP912221 CL436Co ... AVP2_ARATH Pyrophosphate-energized membrane proton pump ... 2 OS=Arabidopsis thaliana Align length 183 Score ( ... p|Q8RCX1|HPPA_THETN Pyrophosphate-energized proton pump ... OS=Ther... 159 9e-39 sp|Q82TF3|HPPA_NITEU Pyrophos ...

  8. AcEST: DK954545 [AcEST

    Full Text Available TST39A01NGRL0020_L14 562 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0020_L14. 5' end seq ... H Putative pyrophosphate-energized membrane proton pump ... 3 OS=Arabidopsis thaliana Align length 167 Score ( ... p|Q8RCX1|HPPA_THETN Pyrophosphate-energized proton pump ... OS=Ther... 197 2e-50 sp|Q898Q9|HPPA_CLOTE Pyrophos ...

  9. AcEST: DK951275 [AcEST

    Full Text Available TST38A01NGRL0010_P14 650 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0010_P14. 5' end seq ... U Pyrophosphate-energized vacuolar membrane proton pump ... OS=Phaseolus aureus Align length 69 Score (bit) 13 ... p|Q8F641|HPPA_LEPIN Pyrophosphate-energized proton pump ... OS=Lept... 94 4e-19 sp|Q72Q29|HPPA_LEPIC Pyrophosp ...

  10. Electronic Unit Pump Test Bench Development and Pump Properties Research

    LIU Bo-lan; HUANG Ying; ZHANG Fu-jun; ZHAO Chang-lu

    2006-01-01

    A unit pump test bench is developed on an in-line pump test platform. The bench is composed of pump adapting assembly, fuel supply subsystem, lubricating subsystem and a control unit. A crank angle domain injection control method is given out and the control accuracy can be 0.1° crank degree. The bench can test bot h mechanical unit pump and electronic unit pump. A test model-PLD12 electronic unit pump is tested. Full pump delivery map and some influence factors test is d one. Experimental results show that the injection quantity is linear with the de livery angle. The quantity change rate is 15% when fuel temperature increases 30℃. The delivery quantity per cycle increases 30mg at 28V drive voltage. T he average delivery difference for two same type pumps is 5%. Test results show that the bench can be used for unit pump verification.

  11. Underground pumped hydroelectric storage

    Allen, R.D.; Doherty, T.J.; Kannberg, L.D.

    1984-07-01

    Underground pumped hydroelectric energy storage was conceived as a modification of surface pumped storage to eliminate dependence upon fortuitous topography, provide higher hydraulic heads, and reduce environmental concerns. A UPHS plant offers substantial savings in investment cost over coal-fired cycling plants and savings in system production costs over gas turbines. Potential location near load centers lowers transmission costs and line losses. Environmental impact is less than that for a coal-fired cycling plant. The inherent benefits include those of all pumped storage (i.e., rapid load response, emergency capacity, improvement in efficiency as pumps improve, and capacity for voltage regulation). A UPHS plant would be powered by either a coal-fired or nuclear baseload plant. The economic capacity of a UPHS plant would be in the range of 1000 to 3000 MW. This storage level is compatible with the load-leveling requirements of a greater metropolitan area with population of 1 million or more. The technical feasibility of UPHS depends upon excavation of a subterranean powerhouse cavern and reservoir caverns within a competent, impervious rock formation, and upon selection of reliable and efficient turbomachinery - pump-turbines and motor-generators - all remotely operable.

  12. AcEST: DK955197 [AcEST

    Full Text Available TST39A01NGRL0022_H07 532 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0022_H07. 5' end seq ... KDEVTALPLLK 192 Query: 194 RFAFGIACELLMSRYEKEEQEMLEEPF TTMMKGILQLPIKLPGTRFSKAIVAANMLRARF 373 R+ F +AC+L S ... KDEVMALPLLK 192 Query: 194 RFAFGIACELLMSRYEKEEQEMLEEPF TTMMKGILQLPIKLPGTRFSKAIVAANMLRARF 373 R+ F +AC+L S ... KDEVKVLP 189 Query: 185 LMKRFAFGIACELLMSRYEKEEQEMLEEPF TTMMKGILQLPIKLPGTRFSKAIVAANMLR 364 L++ F IA L + +Q+ ... KDEATVLP 177 Query: 185 LMKRFAFGIACELLMSRYEKEEQEMLEEPF TTMMKGILQLPIKLPGTRFSKAIVAANMLR 364 L+K F +A L E+ QE ...

  13. AcEST: BP915640 [AcEST

    Full Text Available YMU001_000074_A01 462 Adiantum capillus-veneris mRNA. clone: YMU001_000074_A01. BP915640 CL3685C ... y: 462 GPLILRACLVYMQGAPVGSLAEDGIVSAATGKDMEQSTVGFRLMLAKI IHRLIAAFKEVG 283 G IL+AC YM+G +GSL +D V ++VGF+LMLAK ... : 1032 GYYILKACDAYMKGYLIGSLTKDASVIDERSS-ANSTSVGFKLMLAKI APKLFSALSEVG 1090 Query: 282 AYCDAYE 262 A C+ ++ Sb ... uery: 453 ILRACLVYMQGAPVGSLAEDGIVSAATGKDMEQSTVGFRLMLAKI IHRLIAAFKEVGAYC 274 +L AC YM+G PVGS A G ST GF++ML+K ... ame = -1 Query: 423 GAPVGSLAEDGIVSAATGKDMEQSTVGFRLMLAKI I----HRLIAAFKEVGAYCD 271 G P+ L D +S GK + S RL + L+ ...

  14. Pump tank divider plate for sump suction sodium pumps

    A circular plate extends across the diameter of a sump suction pump, with a close clearance between the edge of the plate and the wall of the pump tank. The plate is located above the pump impeller, inlet and outlet flow nozzles but below the sodium free surface and effectively divides the pump tank into two separate chambers. On change of pump speed, the close fitting flow restriction plate limits the rate of flow into or out of the upper chamber, thereby minimizing the rate of level change in the tank and permitting time for the pump cover gas pressure to be varied to maintain an essentially constant level. 4 claims, 3 figures

  15. Speed Control of DC Motor using AC/AC/DC Converter Based on Intelligent Techniques

    Rakan Kh Antar

    2013-05-01

    Full Text Available    This paper describes the application of ac/ac/dc and ac/dc converters to control the speed of a separately excited DC motor. Artificial neural network and PI controller are trained to select the desired values of firing angles for triggering thyristors of the ac/ac/dc and ac/dc bridge converters in order to control the speed of the dc motor at a desired value with constant and different load torques in order to obtain the best speed response. Simulation results show that the rising time for ac/dc and ac/ac/dc converters at 250rpm are reduced about 79% and 89% respectively, while delay time it reduced about 69% and 64% respectively. Therefore, speed response of the dc motor is more efficient for closed loop system compared with open loop also the response of ac/ac/dc converter is better than ac/dc converter.

  16. Fluid pumping apparatus

    West, Phillip B.

    2006-01-17

    A method and apparatus suitable for coupling seismic or other downhole sensors to a borehole wall in high temperature and pressure environments. In one embodiment, one or more metal bellows mounted to a sensor module are inflated to clamp the sensor module within the borehole and couple an associated seismic sensor to a borehole wall. Once the sensing operation is complete, the bellows are deflated and the sensor module is unclamped by deflation of the metal bellows. In a further embodiment, a magnetic drive pump in a pump module is used to supply fluid pressure for inflating the metal bellows using borehole fluid or fluid from a reservoir. The pump includes a magnetic drive motor configured with a rotor assembly to be exposed to borehole fluid pressure including a rotatable armature for driving an impeller and an associated coil under control of electronics isolated from borehole pressure.

  17. Miniature Lightweight Ion Pump

    Sinha, Mahadeva P.

    2010-01-01

    This design offers a larger surface area for pumping of active gases and reduces the mass of the pump by eliminating the additional vacuum enclosure. There are three main components to this ion pump: the cathode and anode pumping elements assembly, the vacuum enclosure (made completely of titanium and used as the cathode and maintained at ground potential) containing the assembly, and the external magnet. These components are generally put in a noble diode (or differential) configuration of the ion pump technology. In the present state of the art, there are two cathodes, one made of titanium and the other of tantalum. The anodes are made up of an array of stainless steel cylinders positioned between the two cathodes. All the elements of the pump are in a vacuum enclosure. After the reduction of pressure in this enclosure to a few microns, a voltage is applied between the cathode and the anode elements. Electrons generated by the ionization are accelerated toward the anodes that are confined in the anode space by the axial magnetic field. For the generation of the axial field along the anode elements, the magnet is designed in a C-configuration and is fabricated from rare earth magnetic materials (Nd-B-Fe or Sm-Co) possessing high energy product values, and the yoke is fabricated from the high permeability material (Hiperco-50A composed of Fe-Co-V). The electrons in this region collide with the gas molecules and generate their positive ions. These ions are accelerated into the cathode and eject cathode material (Ti). The neutral atoms deposit on the anode surfaces. Because of the chemical activity of Ti, the atoms combine with chemically active gas molecules (e.g. N2, O2, etc.) and remove them. New layers of Ti are continually deposited, and the pumping of active gases is thus accomplished. Pumping of the inert gases is accomplished by their burial several atomic layers deep into the cathode. However, they tend to re-emit if the entrapping lattice atoms are

  18. Reactor coolant pump flywheel

    Finegan, John Raymond; Kreke, Francis Joseph; Casamassa, John Joseph

    2013-11-26

    A flywheel for a pump, and in particular a flywheel having a number of high density segments for use in a nuclear reactor coolant pump. The flywheel includes an inner member and an outer member. A number of high density segments are provided between the inner and outer members. The high density segments may be formed from a tungsten based alloy. A preselected gap is provided between each of the number of high density segments. The gap accommodates thermal expansion of each of the number of segments and resists the hoop stress effect/keystoning of the segments.

  19. Heat pump planning handbook

    Bonin, Jürgen

    2015-01-01

    The Heat Pump Planning Handbook contains practical information and guidance on the design, planning and selection of heat pump systems, allowing engineers, designers, architects and construction specialists to compare a number of different systems and options. Including detailed descriptions of components and their functions and reflecting the current state of technology this guide contains sample tasks and solutions as well as new model calculations and planning evaluations. Also economic factors and alternative energy sources are covered, which are essential at a time of rising heat costs. T

  20. Noise through Quantum Pumps

    Polianski, M. L.; Vavilov, M. G.; Brouwer, P.W.

    2002-01-01

    We study the current noise through an unbiased quantum electron pump and its mesoscopic fluctuations for arbitrary temperatures and beyond the bilinear response. In the bilinear regime, we find the full distributions of the noise power and the current-to-noise ratio for a chaotic quantum dots with single-channel and many-channel ballistic point contacts. For a dot with many-channel point contacts we also calculate the ensemble-averaged noise at arbitrary temperature and pumping strength. In t...

  1. Air-Operated Sump Pump

    Nolt, Gary D.

    1988-01-01

    Pump removes liquid seepage from small, restricted area and against large pressure head. Developed for moving small amounts of water and oil from sump pit 85 ft (25.91 m) deep. Fits in space only 6 1/2 in. (16.5 cm) in diameter and 18 in. (45.7 cm) long. In discharge part of pumping cycle, air forces liquid out of pump chamber through pipe. During filling part of pumping cycle, water enters pump chamber from sump pit. Float in chamber next to pump chamber controls pressurization through timer and solenoid valve.

  2. Commercialization of PV-powered pumping systems for use in utility PV service programs. Final report

    NONE

    1997-03-01

    The project described in this report was a commercialization effort focused on cost-effective remote water pumping systems for use in utility-based photovoltaic (PV) service programs. The project combined a commercialization strategy tailored specifically for electric utilities with the development of a PV-powered pumping system that operates conventional ac pumps rather than relying on the more expensive and less reliable PV pumps on the market. By combining these two attributes, a project goal was established of creating sustained utility purchases of 250 PV-powered water pumping systems per year. The results of each of these tasks are presented in two parts contained in this Final Summary Report. The first part summarizes the results of the Photovoltaic Services Network (PSN) as a new business venture, while the second part summarizes the results of the Golden Photon system installations. Specifically, results and photographs from each of the system installations are presented in this latter part.

  3. Nuclear structure of $^{231}$Ac

    Boutami, R; Mach, H; Kurcewicz, W; Fraile, L M; Gulda, K; Aas, A J; García-Raffi, L M; Løvhøiden, G; Martínez, T; Rubio, B; Taín, J L; Tengblad, O

    2008-01-01

    The low-energy structure of 231Ac has been investigated by means of gamma ray spectroscopy following the beta-decay of 231Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a mini-orange electron spectrometer. The decay scheme of 231Ra --> 231Ac has been constructed for the first time. The Advanced Time Delayed beta-gamma-gamma(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

  4. AcEST: BP920800 [AcEST

    Full Text Available DLNLALQVHSRMVRFGFNAEVEACGALINMYGKCGKVLYAQRVFDDT 298 Query: 206 RQQDVISWNDIISACAQRGHGTEALENFSQMLHEGIVPNSMTFTSVMQA---CNSIEGG...G L +A S F ++ +D+ISW +I +Q EA+ F Sbjct: 217 SEKNEATSNCLINGYMGLGNLEQAESLFNQMPVKDIISWTTMIKGYSQNKRYREAIAVFY 276 Query: 119 QMLHEG...EKAWRIFDGVSCKNLPSWNAIITGCVQGGLLEEAIDLYRHMK 281 Query: 110 HEGIVPNSMTFTSVMQAC---NSIEGGR 36 + + PN +T +V+ AC +...N IIS AQ G +EA+E ++ M Sbjct: 383 DITIGNAVVVMYAKLGLVDSARAVFNWLPNTDVISWNTIISGYAQNGFASEAIEMYNIME 442 Query: 110 HEG...EIDLGEQIHSLSVKTGFESDMYVSGVLIDMYSKYGWLEKARRVLEML 406 Query: 206 RQQDVISWNDIISACAQRGHGTEALENFSQMLHEGIVPNSMTFTSVMQACNSIEGG

  5. AcEST: DK945549 [AcEST

    Full Text Available AGGCGATTTCATCTTTTCTGAGAACCCTGATTTTGTGATTGTGTAATTACA ACTGTGGAACAGAAGGATGAGAAGTCTACTGACACAACAAGATATCTCTGGAGAGGAGA...A AATTGAGAAGGTTTGAGTTCTCAACAATGGGCTATGAGGCAATAATGGGAAGGCACCGAT TGTGGGCTTGTATAGGTTTTGAC...LCTG 239 L++R+LRR + + ++ G AC+ DP +P PLC+G Sbjct: 108 LQQRELRRKLLADSGALNTNSVNGPRNWKACVQQDPSSRPGTPLCSG 154 >sp|A6UUY8|RNZ_META3...49 Tissue type young leaves Developmental stage sporophyte Contig ID CL454Contig1 Sequence GATGAGCGA...CCACCTGTGCAACCGTCAGCGCCTTTGTGCACTGGTG CAATGTCCTGTGGTTACCTTGTTTGGAATCTTAATTGTTCTCATGTAT

  6. AcEST: BP917632 [AcEST

    Full Text Available YMU001_000103_D10 554 Adiantum capillus-veneris mRNA. clone: YMU001_000103_D10. BP917632 - Show ... YSKCKIHQKALELLVLML 154 Query: 466 KDSLEPDEVTYLNVLKACARE EDLKV 543 +D++ P+ TY +VL++C D+++ Sbjct: 155 RDNVRPN ... 185 Query: 415 GHSDSS--KEALKLLTQMRKDSLEPDEVTYLNVLKACARE EDLK 540 + EA KL +M+ ++ PDE+ N++ AC R +++ Sbjct: 18 ...

  7. AcEST: DK961189 [AcEST

    Full Text Available OS=A... 127 7e-29 sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS... 125 2e-28 sp|P00785|AC...IRNSWGLNWGDSGYVKLQRNIDDPFGKCGIAMMPSYP 347 >sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS=

  8. AcEST: DK946687 [AcEST

    Full Text Available YMU02A01NGRL0013_G11 544 Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0013_G11. 5' end seq ... + G P+ TY+ + AC+ E Sbjct: 97 YSFNYMIRGLTNTWN-------DHEA ---ALSLYRRMKFSGLKPDKFTYNFVFIACAKLE 146 Query: 214 A ... Sbjct: 71 LIPKAVELGDFNYSSFLFSVTEEPNHYSFNYMIRGLTNTWNDHEA ALSLYRRMKFSGLKP 130 Query: 469 DGATFSCVLRACGNVGALDV ...

  9. AcEST: DK949372 [AcEST

    Full Text Available TST38A01NGRL0005_N02 627 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0005_N02. 5' end seq ... 363 DQLREKTC-GVDKFDDIVMACXXXXXXXXXXXXXXXXXXKARVHAYGVCD DPEYFYDYVQ 539 Q++EK G+ FDDIV+AC KA+VHA+ VCD DP+YFYD ... 264 QQVQEKKVPGITFFDDIVVACGSGGSIAGLSLGSYLSNLKAKVHAFAVCD DPDYFYDYTQ 323 Query: 540 GLLDGMNANIASRDIVNVIDAKGLG ...

  10. Fault Tolerant Three-Phase AC Motor Drive Topologies:A Comparison of Features, Cost, and Limitations

    2005-01-01

    THE RELIABILITY of adjustables peed ac motor drives is an area of great interest for all members of the drives community and marketplace. This is particularly the case for the military, aerospace and automotive industries that are increasingly adopting variable speed drives in order to improve overall system efficiency and performance. There are certain safety critical applications such as steering, fuel pumps,

  11. Aquaflo pump vs FMS 4 pump for shoulder arthroscopic surgery.

    Ampat, G.; Bruguera, J.; Copeland, S A

    1997-01-01

    A prospective controlled trial was carried out to compare two different fluid delivery systems used for shoulder arthroscopy. One an advanced pump system that controls both pressure and flow of fluid delivered, the other an air-driven diaphragm pump that only controls fluid pressure. Blood loss, presence of bleeding vessels and visual clarity were parameters used to assess the pump systems. There was no difference between the pumps in straightforward shoulder procedures. However, complicated ...

  12. Piston for rod pumping

    Pastushenko, G.I.

    1965-06-22

    A piston, or plunger, for rod pumping, is made up of a cylindrical housing with labryinthal seals, a nose piece, and a scraper. In order to remove paraffin from the inside surface of the production pipe, the housing is made in telescopic form. The scraper consists of an arrangement of springs installed on the outer surface of the housing.

  13. Pump Flow Analysis

    1981-01-01

    Ingersoll-Rand Research, Inc.'s use of COSMIC's computer program MERIDL permits designers to evaluate performance and efficiency characteristics to be expected from the pump's impeller. It also provides information that enables a trained hydraulic engineer to make design improvements. Company was able to avoid the cost of developing new software and to improve some product design features.

  14. AcEST: BP919906 [AcEST

    Full Text Available YMU001_000130_E09 448 Adiantum capillus-veneris mRNA. clone: YMU001_000130_E09. BP919906 - Show ... uperf... 35 2.4 tr|B8NNJ3|B8NNJ3_ASPFL Efflux pump antibiotic ... resistance protein... 35 2.4 tr|Q5WZ39|Q5WZ39_LEGP ... 1 WRVKTSLL 108 >tr|B8NNJ3|B8NNJ3_ASPFL Efflux pump antibiotic ... resistance protein, putative OS=Aspergillus flavus ...

  15. AcEST: BP920454 [AcEST

    Full Text Available YMU001_000137_C07 517 Adiantum capillus-veneris mRNA. clone: YMU001_000137_C07. BP920454 - Show ... idore... 33 7.4 tr|B8M583|B8M583_9EURO Efflux pump antibiotic ... resistance protein... 33 9.7 >tr|B6ENL6|B6ENL6_ALI ... SILAGFPFKE 530 >tr|B8M583|B8M583_9EURO Efflux pump antibiotic ... resistance protein, putative OS=Talaromyces stipit ...

  16. Electrothermal pumping with interdigitated electrodes and resistive heaters.

    Williams, Stuart J; Green, Nicolas G

    2015-08-01

    Interdigitated electrodes are used in electrokinetic lab-on-a-chip devices for dielectrophoretic trapping and characterization of suspended particles, as well as the production of field-induced fluid flow via AC electroosomosis and electrothermal mechanisms. However, the optimum design for dielectrophoresis, that if symmetrical electrodes, cannot induce bulk electrohydrodynamic pumping. In addition, the mechanism of intrinsic electrothermal pumping is affected by the properties of the fluid, with thermal fields being generated by Joule Heating. This work demonstrates the incorporation of an underlying thin film heater, electrically isolated from the interdigitated electrodes by an insulator layer, to enhance bulk electrothermal pumping. The use of integrated heaters allows the thermal field generation to be controlled independently of the electric field. Numerical simulations are performed to demonstrate the importance of geometrical arrangement of the heater with respect to the interdigitated electrodes, as well as electrode size, spacing, and arrangement. The optimization of such a system is a careful balance between electrokinetics, heat transfer, and fluid dynamics. The heater location and electrode spacing influence the rate of electrothermal pumping significantly more than electrode width and insulator layer thickness. This demonstration will aid in the development of microfluidic electrokinetic systems that want to utilize the advantages associated with electrothermal pumping while simultaneously applying other lab-on-a-chip electrokinetics like dielectrophoresis. PMID:26010255

  17. Air-clad fibers: pump absorption assisted by chaotic wave dynamics?

    Mortensen, Niels Asger

    2007-01-01

    Wave chaos is a concept which has already proved its practical usefulness in design of double-clad fibers for cladding-pumped fiber lasers and fiber amplifiers. In general, classically chaotic geometries will favor strong pump absorption and we address the extent of chaotic wave dynamics in typical air-clad geometries. While air-clad structures supporting sup-wavelength convex air-glass interfaces (viewed from the high-index side) will promote chaotic dynamics we find guidance of regular whispering-gallery modes in air-clad structures resembling an overall cylindrical symmetry. Highly symmetric air-clad structures may thus suppress the pump-absorption efficiency eta below the ergodic scaling law eta proportional to Ac/Acl, where Ac and Acl are the areas of the rare-earth doped core and the cladding, respectively.

  18. Fuel Pumping System And Method

    Shafer, Scott F.; Wang, Lifeng

    2005-12-13

    A fuel pumping system that includes a pump drive is provided. A first pumping element is operatively connected to the pump drive and is operable to generate a first flow of pressurized fuel. A second pumping element is operatively connected to the pump drive and is operable to generate a second flow of pressurized fuel. A first solenoid is operatively connected to the first pumping element and is operable to vary at least one of a fuel pressure and a fuel flow rate of the first flow of pressurized fuel. A second solenoid is operatively connected to the second pumping element and is operable to vary at least one of a fuel pressure and a fuel flow rate of the second flow of pressurized fuel.

  19. Optimization of compound gear pump

    栾振辉

    2002-01-01

    This paper introduces the performances of compound gear pump. Based on the target of having the smallest mass per unit volume, the paper established a mathematical model of optimization, and obtained the results of optimization of the pump.

  20. Orbital Liquid Oxygen Pump Project

    National Aeronautics and Space Administration — This proposed work will develop a pump, which is based on two novel and unique design features. The first feature is a lobed pumping mechanism which operates with...

  1. Energy saving in ac generators

    Nola, F. J.

    1980-01-01

    Circuit cuts no-load losses, without sacrificing full-load power. Phase-contro circuit includes gate-controlled semiconductor switch that cuts off applied voltage for most of ac cycle if generator idling. Switch "on" time increases when generator is in operation.

  2. Apuntes de Acústica

    Martín Domingo, Agustín

    2014-01-01

    Esta publicacion contiene unos apuntes para la parte de Acústica de las asignaturas de la ETSAM, junto con cierta cantidad de material adicional que excede el ámbito del curso. Aunque está lejos de ser completa y de estar libre de errores, el autor espera sea útil.

  3. SSTI Clark ACS Technology Demonstrations

    Freesland, Douglas

    1997-01-01

    SSTI Clark, one of two spacecraft built under NASA's Small Satellite Technology Initiative, includes seven ACS technology demonstrations. The technologies redefine the performance cost envelope, providing improved sensor and actuator performance at reduced costs. Six sensing technologies are being flown consisting of both hardware and algorithmic demonstrations: autonomous star tracker, hemispherical resonating gyro, GPS attitude determination, miniature horizon sensors, low cost course sun s...

  4. Blood Pump Bearing System

    Aber, Gregory S. (Inventor)

    2000-01-01

    An apparatus is provided for a blood pump bearing system within a pump housing to support long-term highspeed rotation of a rotor with an impeller blade having a plurality of individual magnets disposed thereon to provide a small radial air gap between the magnets and a stator of less than 0.025 inches. The bearing system may be mounted within a flow straightener, diffuser, or other pump element to support the shaft of a pump rotor. The bearing system includes a zirconia shaft having a radiused end. The radiused end has a first radius selected to be about three times greater than the radius of the zirconia shaft. The radiused end of the zirconia shaft engages a flat sapphire endstone. Due to the relative hardness of these materials a flat is quickly produced during break-in on the zirconia radiused end of precisely the size necessary to support thrust loads whereupon wear substantially ceases. Due to the selection of the first radius, the change in shaft end-play during pump break-in is limited to a total desired end-play of less than about 0.010 inches. Radial loads are supported by an olive hole ring jewel that makes near line contact around the circumference of the Ir shaft to support big speed rotation with little friction. The width of olive hole ring jewel is small to allow heat to conduct through to thereby prevent heat build-up in the bearing. A void defined by the bearing elements may fill with blood that then coagulates within the void. The coagulated blood is then conformed to the shape of the bearing surfaces.

  5. Absorption heat pumps

    Huhtinen, M.; Heikkilae, M.; Andersson, R.

    1987-03-01

    The aim of the study was to analyze the technical and economic feasibility of absorption heat pumps in Finland. The work was done as a case study: the technical and economic analyses have been carried out for six different cases, where in each the suitable size and type of the heat pump plant and the auxiliary components and connections were specified. The study also detailed the costs concerning the procurement, installation and test runs of the machinery, as well as the savings in energy costs incurred by the introduction of the plant. Conclusions were drawn of the economic viability of the applications studied. The following cases were analyzed: heat recovery from flue gases and productin of district heat in plants using peat, natural gas, and municipal wastes as a fuel. Heat recovery in the pulp and paper industry for the upgrading of pressure of secondary steam and for the heating of white liquor and combustion and drying the air. Heat recovery in a peat-fulled heat and power plant from flue gases that have been used for the drying of peat. According to the study, the absorption heat pump suits best to the production of district heat, when the heat source is the primary energy is steam produced by the boiler. Included in the flue as condensing is the purification of flue gases. Accordingly, benefit is gained on two levels in thick applications. In heat and power plants the use of absorption heat pumps is less economical, due to the fact that the steam used by the pump reduces the production of electricity, which is rated clearly higher than heat.

  6. Sludge pumping in water treatment

    In water treatment processes is frequent to separate residual solids, with sludge shape, and minimize its volume in a later management. the technologies to applicate include pumping across pipelines, even to long distance. In wastewater treatment plants (WWTP), the management of these sludges is very important because their characteristics affect load losses calculation. Pumping sludge can modify its behavior and pumping frequency can concern treatment process. This paper explains advantages and disadvantages of different pumps to realize transportation sludge operations. (Author) 11 refs.

  7. Optimization of Pumping System in Solar Pumped Laser.

    Peng, Xu; Suhui, Yang; Changming, Zhao; Haiyang, Zhang; Yanlei, Qian; Jiayin, Hao; Tao, He; Wang, Huaxin

    2013-01-01

    The coupling between solar light radiation and laser rod medium in a solar pumped laser affects the efficiency of the laser. To optimize the pumping system, simulation of the two-stage pumping system with a Fresnel lens and conic pumping cavity is carried out with Tracepro software. According to the power density distribution along the axis at focal place of the Fresnel lens, the diameter and position of the pumping cavity window and the distance of the window from the Fresnel lens are optimi...

  8. Getting Pumped About Heart Failure

    Mann, Douglas L.

    2014-01-01

    Heart failure is a clinical syndrome caused by dysregulated calcium handling and abnormal cardiac pumping capacity. Whalquist et al. (2014) show that upregulation of micro-RNA25 impairs calcium handling leading to pump dysfunction, and that targeting micro-RNA25 using antisense oligonucleotides reverses pump dysfunction and improves survival in mice with heart failure.

  9. VIRTUAL FUEL-PUMP DESIGN

    2002-01-01

    Some concepts of virtual product are discussed. The key technologies of virtual fuel-pump development are in detail analysed, which include virtual fuel-pump product modeling, intelligent simulation, distributed design environment, and virtual assembly. The virtual fuel-pump development prototype system considers requirement analysis, concept design, injection preferment analysis, detailed design, and assembly analysis.

  10. AcEST: DK951716 [AcEST

    Full Text Available TST38A01NGRL0012_C08 588 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0012_C08. 5' end seq ... Pseudomonas aerugin... 30 9.0 sp|Q9KJC2|ARPB_PSEPU Antibiotic ... efflux pump membrane transporter... 30 9.0 >sp|Q94 ...

  11. Small Scroll Pump for Cryogenic Liquids Project

    National Aeronautics and Space Administration — The innovation is a compact, reliable, light weight, electrically driven pump capable of pumping cryogenic liquids, based on scroll pump technology. This pump will...

  12. Pumping characteristics of roots blower pumps for light element gases

    The pumping speed and compression ratio of the two-stage roots blower pumping system were measured for light element gases (H2, D2 and He) and for N2, in order to assess validity of the ITER torus roughing system as an ITER R and D task (T234). The pumping system of an Edwards EH1200 (nominal pumping speed of 1200 m3/s), two EH250s (ibid. 250 m3/s) and a backing pump (ibid. 100 m3/s) in series connection was tested under PNEUROP standards. The maximum pumping speeds of the two-stage system for D2 and N2 were 1200 and 1300 m3/h, respectively at 60 Hz, which satisfied the nominal pumping speed. These experimental data support the design validity of the ITER torus roughing system. (author)

  13. AcEST: DK950895 [AcEST

    Full Text Available |A7SFA3|A7SFA3_NEMVE Predicted protein OS=Nematostella vectens... 210 5e-53 tr|Q0CVA9|Q0CVA9_ASPTN ATP-citrate synthase subunit...stX Result : Swiss-Prot sp_hit_id Q54YA0 Definition sp|Q54YA0|ACLY_DICDI Probable ATP-citrate synthase OS=Dictyos...PIDYSWAQELGLIRKPAAFISTI 404 >sp|Q8X097|ACL1_NEUCR Probable ATP-citrate synthase subunit 1 OS=Neurospora cras...IRKPASFMTSI 844 >sp|Q9P7W3|ACL1_SCHPO Probable ATP-citrate synthase subunit 1 OS=Schizosaccharomyces pombe G....done Score E Sequences producing significant alignments: (bits) Value sp|Q54YA0|ACLY_DICDI Probable ATP-citrate synthase OS=Dictyos

  14. AcEST: BP914304 [AcEST

    Full Text Available IDEHTFVFTLRAC 4 V+ NA++ Y G+ E A++ + +M+ E++ + TF+ LRAC Sbjct: 670 VTWNAMICGYAHHGKGEEAIQLFERMILENIKPNHVTFISI...KSLRRDFVTWNAMICGYAHHGKGEEAIQLFERMILENIKPN 703 Query: 339 NLTYVSLFKACGNVLDFGQG-RTIHGEARANGFSSDRFICTTLI...TFVFTLRAC 4 +F + + V+ N ++ +YV A +++M + D TL+AC Sbjct: 484 QIFERMCDRDNVTWNTIIGSYVQDENESEAFDLFKRMNLCGIVSDGACL...K + A+Q+ + R + +W++MI++ +A + ++ M Sbjct: 93 LGNSLINFYSKFEDVASAEQVFRRMTLRDVVTWSSMIAAYAGNNHPAKAFDTFERMTDAN 152... + R + +W++MI++ +A + ++ M Sbjct: 93 LGNSLINFYSKFEDVASAEQVFRRMTLRDVVTWSSMIAAYAGNNHPAKAFDTFERM

  15. AcEST: BP911793 [AcEST

    Full Text Available + +VSWN +++ Y QHG + ++L+ M+AE T N + + A Sbjct: 58 EAKFVFERIQNKDVVSWNCIINGYSQHGPSGSSHVMELFQRMRAENTAPNAHTFAGVF... N + + A Sbjct: 58 EAKFVFERIQNKDVVSWNCIINGYSQHGPSGSSHVMELFQRMRAENTAPNAHTFAGVFTA 117 Query: 359 CIQTGNLELCKQM...D VT S+LSACSH G + +G YF Sbjct: 602 IIGGSAQHGRGQDALQLFERMKMEGVKPDIVTFVSLLSACSHAGLLEEGRRYF 654 Score = 115 bit...53 QTGNLELCKQMHFNIVSAGNELNPSLASSLIRTYGNCGSMLDAHAVFDSLPLPDIVSWNV 174 Q +E+ K++ F+++ N S +++I Y CG + +A +FD +P D VSW Sbjct: 324 QGERME... L+ M +E + I+LV +L AC+ TG+LE + +H Sbjct: 498 VITWNAMIASYVHCEQSEKAIALFDRMVSENFKPSSITLVTLLMACVNTGSLER

  16. AcEST: BP921649 [AcEST

    Full Text Available 40 + ++LV YAK L + ++ +P R W+ +I+ + + ++E AL+ + M+ G Sbjct: 144 VASSLVGMYAKFNLFENSLQVFDEMPERDVASWNTVISCFYQSGEAEKALELFGRME...LDCYKEM 52 ++L +GNALVD YAKCG L A ++ +R+ R V W+ +I Y + E A D +K M Sbjct: 461 KNLFVGNALVDMYAKCGALEDARQIFERMCDRDNVTWNTIIGSYVQDEN...RD+ WNA+I Sbjct: 237 LEQGKQIHCYAIRSG-IESDVLVVNGLVNMYAKCGNVNTAHKLFERMPIRDVASWNAIIG 295 Query: 411 GYVNHGRAEVALDCFGKME...SNDVV-GNALVNMYAKCGNVNSAYKLFERMPKKNVVAWNAIIS 396 Query: 411 GYVNHGRAEVALDCFGKME... HGR + AL F +M+ EG PD +TF +L AC G + + + + Sbjct: 603 IGGSAQHGRGQDALQLFERMKMEGVKPDIVTFVSLLSACSHAGLLEEGRRYFCSM

  17. AcEST: BP919669 [AcEST

    Full Text Available D + RDV SW ++S + + G+ ++F M G +P+ Sbjct: 148 LVGMYAKFNLFENSLQVFDEMPERDVASWNTVISCFYQSGEAEKALELFGRMESSGFEPN 20...+ +++AC L + +G+E+H + K+G EL V Sbjct: 190 EKALELFGRMESSGFEPNSVSLTVAISACSRLLWLERGKE...F Sbjct: 468 IY---VVNSLIDSYGKCSHVEDAERIFEECTIGDLVSFTSMITAYAQYGQGEEALKLFLE 524 Query: 226 MVGEGTKPDSISLLVVLRA-YNF...+ IR DV W +LMSGY+K D ++F ++ Sbjct: 44 SLINVYFTCKDHCSARHVFENFDIRSDVYIWNSLMSGYSKNSMFHDTLEVFKRLLNCSIC 103 Query: 208 KPDSISLLVVLRAYNF...KPD Sbjct: 261 VDMYAKCGCIETAVEVFEKLTRRNVFSWAALIGGYAAYGYAKKATTCLDRIEREDGIKPD 320 Query: 199 SISLLVVLRAYNFLGFP

  18. AcEST: DK957916 [AcEST

    Full Text Available PQKQPVPAVSHSPQKSSTPPTPAATKPKEEPSVPKEVPKLQQGKLEKT 967 Query: 577 --TTEASQGIPVEEG...G E+ P+ P Sbjct: 1974 QEQGRAPSQDQEAPSPEALPSPGQEPAAGASPRRGELRRGSSAESALPRAGP 2025 >sp|Q05175|BASP_RAT Brain ac... +P AP P Sbjct: 388 ERETAASAGPQG----AFPEPRPAQPSAGPEPRPAQPSAGPEPRPAQPSAAPEPRP---- 439 Query: 571 GQTTE... L ++ +A+ +E AP Sbjct: 406 IVTTPEPEGSGEEDVPKPDEIPEKEVTEEELIKVSTAAPAKASPEEEVVKATTLAPSEED 465 Query: 550 VSPYIASGQTTE... Query: 424 KGQAYEAIPDPHVDPAAGVHERLAQLQLGDEPEATKPKEAPG-VSPYI--ASGQTTEASQ 594 K A E P + + G E + E EA P A G +P

  19. AcEST: DK956923 [AcEST

    Full Text Available CCATAGTCTCAA CAGCGATAAGCAGGAAATGCATGCAGTGACCATGGGTAAGAAAAGGGTCATGGTGGGCGC CATTAACACGATACTTATCCTA...CTCCTCTTGCAGTTTATGAAGCAATGTTCTTCCTCTTC TAGTCATGATGATGATGGCGATGCCTTTGCGGATGACACTCTAAGCAGACGCAACGAT...AC GGTCGAGTCTGCTCCTCGACATTGGCCAAGGCGAATGCTGGGCAGCCAAGAACCTGCCTC CAACAAGACTTCATATGGTATTCCTGAT...H At1g73965 (CLE13 / CLAVATA3/ESR-Related 13) (CLE13) OS=Arabidopsis thaliana Align length 25 Sco...icant alignments: (bits) Value tr|Q6NMF0|Q6NMF0_ARATH At1g73965 (CLE13 / CLAVATA3/ESR-Related 1... 49 3e-04

  20. AcEST: BP921492 [AcEST

    Full Text Available + AL +G+ +H Sbjct: 286 DVASWNAIIGGYSLNSQHHEALAFFNRMQVRGIKPNSITMVSVLPACAHLFAL... ++ L +GK +H Sbjct: 178 NLVSWTAMVSGYAQGGFADEALRMFYEMQGEDVKANYVTVASVLPACAQLSDLQQGKEIH 237 Query: 153 AC...FDRMPEK 171 Query: 333 DVVSWSAMIAMYGQQGCGKEAFQLFQEMACEGGMPNRVTYVSILDACASVAALPEGKLVH 154 +V+W+++++ + Q G EA Q+F +M G P+ T+VS+L ACA...333 DVVSWSAMIAMYGQQGCGKEAFQLFQEMACE-GGMPNRVTYVSILDACASVAALPEGKLV 157 +V +W+AMI+ YG G G++A +LF +M + G +PN VT+V++L ACA...SKL 85 Query: 288 GCGKEAFQLFQEMACEGGMPNRVTYVSILDACASVAALPEGKLVHACFMESELELDVVVG 109 ++ M P+ T+ S++ +CA ++AL G

  1. SHINE Vacuum Pump Test Verification

    Morgan, Gregg A; Peters, Brent

    2013-09-30

    Normetex pumps used world-wide for tritium service are no longer available. DOE and other researchers worldwide have spent significant funds characterizing this pump. Identification of alternate pumps is required for performance and compatibility with tritium gas. Many of the pumps that could be used to meet the functional performance requirements (e.g. pressure and flow conditions) of the Normetex pump have features that include the use of polymers or oils and greases that are not directly compatible with tritium service. This study assembles a test system to determine the flow characteristics for candidate alternate pumps. These tests are critical to the movement of tritium through the SHINE Tritium Purification System (TPS). The purpose of the pump testing is two-fold: (1) obtain baseline vacuum pump characteristics for an alternate (i.e. ''Normetex replacement'') pump intended for use in tritium service; and (2) verify that low pressure hydrogen gas can be transported over distances up to 300 feet by the candidate pumps. Flow rates and nominal system pressures have been identified for the SHINE Mo-99 production process Tritium Purification System (TPS). To minimize the line sizes for the transfer of low pressure tritium from the Neutron Driver Accelerator System (NDAS) to the primary processing systems in the TPS, a ''booster'' pump has been located near the accelerator in the design. A series of pump tests were performed at various configurations using hydrogen gas (no tritium) to ensure that this concept is practical and maintains adequate flow rates and required pressures. This report summarizes the results of the tests that have been performed using various pump configurations. The current design of the Tritium Purification System requires the ''booster'' pump to discharge to or to be backed by another vacuum pump. Since Normetex pumps are no longer manufactured, a commercially available Edwards

  2. SHINE Vacuum Pump Test Verification

    Normetex pumps used world-wide for tritium service are no longer available. DOE and other researchers worldwide have spent significant funds characterizing this pump. Identification of alternate pumps is required for performance and compatibility with tritium gas. Many of the pumps that could be used to meet the functional performance requirements (e.g. pressure and flow conditions) of the Normetex pump have features that include the use of polymers or oils and greases that are not directly compatible with tritium service. This study assembles a test system to determine the flow characteristics for candidate alternate pumps. These tests are critical to the movement of tritium through the SHINE Tritium Purification System (TPS). The purpose of the pump testing is two-fold: (1) obtain baseline vacuum pump characteristics for an alternate (i.e. ''Normetex replacement'') pump intended for use in tritium service; and (2) verify that low pressure hydrogen gas can be transported over distances up to 300 feet by the candidate pumps. Flow rates and nominal system pressures have been identified for the SHINE Mo-99 production process Tritium Purification System (TPS). To minimize the line sizes for the transfer of low pressure tritium from the Neutron Driver Accelerator System (NDAS) to the primary processing systems in the TPS, a ''booster'' pump has been located near the accelerator in the design. A series of pump tests were performed at various configurations using hydrogen gas (no tritium) to ensure that this concept is practical and maintains adequate flow rates and required pressures. This report summarizes the results of the tests that have been performed using various pump configurations. The current design of the Tritium Purification System requires the ''booster'' pump to discharge to or to be backed by another vacuum pump. Since Normetex pumps are no longer manufactured, a commercially available Edwards scroll pump will be used to back the booster pump. In this

  3. Legal issues concerning heat pumps

    Gersemann, D.

    Heat pumps are considered suitable to contribute to an improvement of the total energy balance. As a rule, they are divided into the following categories of utilizable auxiliary energies: ground water, surface waters, soil, absorbers, air. They are also distinguished according to driving systems: electric, gas, or Diesel heat pumps. Considering forecasts concerning the utilization potential of heat pumps it seems easy to see that the legal assessment of heat pumps shall obtain considerable practical importance for the authorities as well as for private managers. The article gives a survey of the most important legal issues concerning heat pumps.

  4. VIBRATION ANALYSIS IN OVERHUNG PUMP

    Neelendra Pratap Singh*, Prateek Gupta, Siddharth Agnihotri

    2016-01-01

    In the present scenario, Energy demand is increasing day by day. To meet that demand, the production or extraction of crude oil, natural gas and other energy resources is done with the help of various pumps. Pumps are the second largest used machinery in world and plays a vital role. In this paper, we have done analysis on centrifugal pump categorised as overhung pump (OH2). It is commonly known that vibration problems on centrifugal pumps can result from multitude of possible parameters whic...

  5. 21 CFR 880.5725 - Infusion pump.

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Infusion pump. 880.5725 Section 880.5725 Food and... Infusion pump. (a) Identification. An infusion pump is a device used in a health care facility to pump fluids into a patient in a controlled manner. The device may use a piston pump, a roller pump, or...

  6. Sucker rod pump

    Brewer, J.R.

    1992-04-14

    This patent describes a subsurface well pump, it comprises: a working barrel; a plunger which reciprocates along the vertical axis within the working barrel between an upper and lower position; a rod connected to the plunger and extending to a means for providing reciprocating force; a well string extending from the top of the working barrel to the surface; an outlet check valve which permits flow to exit the working barrel into the well string and does not permit flow to exit the well string into the working barrel; and an inlet check valve which permits flow into the working barrel from outside of the subsurface pump, the inlet check valve being above the top position of the plunger, the inlet check valve having a cross sectional flow area about equal to or greater than the horizontal cross sectional area of the working barrel, and the inlet check valve being a hinged flapper valve.

  7. Pocket pumped image analysis

    Kotov, I.V., E-mail: kotov@bnl.gov [Brookhaven National Laboratory, Upton, NY 11973 (United States); O' Connor, P. [Brookhaven National Laboratory, Upton, NY 11973 (United States); Murray, N. [Centre for Electronic Imaging, Open University, Milton Keynes, MK7 6AA (United Kingdom)

    2015-07-01

    The pocket pumping technique is used to detect small electron trap sites. These traps, if present, degrade CCD charge transfer efficiency. To reveal traps in the active area, a CCD is illuminated with a flat field and, before image is read out, accumulated charges are moved back and forth number of times in parallel direction. As charges are moved over a trap, an electron is removed from the original pocket and re-emitted in the following pocket. As process repeats one pocket gets depleted and the neighboring pocket gets excess of charges. As a result a “dipole” signal appears on the otherwise flat background level. The amplitude of the dipole signal depends on the trap pumping efficiency. This paper is focused on trap identification technique and particularly on new methods developed for this purpose. The sensor with bad segments was deliberately chosen for algorithms development and to demonstrate sensitivity and power of new methods in uncovering sensor defects.

  8. Solar-powered pump

    Kirsten, C. C. (Inventor)

    1976-01-01

    A solar powered pump particularly suited for intermittently delivering a stream of water is reported. The pump is characterized by a housing adapted to be seated in a source of water having a water discharge port disposed above the water line of the source, a sump including a valved inlet port through which water is introduced to the sump, disposed beneath the water line, a displacer supported for vertical reciprocation in said housing, an air passageway extended between the vertically spaced faces of the displacer, and a tipple disposed adjacent to the water discharge port adapted to be filled in response to a discharge of water from the housing. Air above a displacer is expanded in response to solar energy impinging on the housing and transferred into pressurizing relation with the sump for forcing water from the sump.

  9. Small size ion pumps

    This paper describes some designs of the two versions ion pumps and their range operation for various magnetic fields. The first version is made with different cell size in the anode element and titanium cathode operating in magnetic field from 600 to 650 Gs and the second version with the same anode element but differential Ti/Ta cathode working in magnetic field above 1200 Gs

  10. Adiabatic pumping through quantum dots

    A finite charge can be pumped through a mesoscopic system in the absence of an applied bias voltage by changing periodically in time some parameters of the system. If these parameters change slowly with respect to all internal time scales of the system, pumping is adiabatic. The scope of this work is to investigate adiabatic pumping through a quantum dot, in particular the influence of Coulomb interaction between electrons in the dot on the pumped charge. On one hand we develop a formalism based on Green's functions, in order to calculate the pumped charge from the weak-tunnel-coupling regime down to the Kondo regime. We extend our calculations to a system with a superconducting contact. On the other hand we use a systematic perturbation expansion for the calculation of the pumped charge, giving us the possibility to analyze processes which contribute to charge pumping and to highlight the important role of interaction-induced level renormalization. (orig.)

  11. Performance of AC/graphite capacitors at high weight ratios of AC/graphite

    Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)

    2008-03-01

    The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)

  12. Versatile roles of V-ATPases accessory subunit Ac45 in osteoclast formation and function.

    An Qin

    Full Text Available Vacuolar-type H(+-ATPases (V-ATPases are macromolecular proton pumps that acidify intracellular cargos and deliver protons across the plasma membrane of a variety of specialized cells, including bone-resorbing osteoclasts. Extracellular acidification is crucial for osteoclastic bone resorption, a process that initiates the dissolution of mineralized bone matrix. While the importance of V-ATPases in osteoclastic resorptive function is well-defined, whether V-ATPases facilitate additional aspects of osteoclast function and/or formation remains largely obscure. Here we report that the V-ATPase accessory subunit Ac45 participates in both osteoclast formation and function. Using a siRNA-based approach, we show that targeted suppression of Ac45 impairs intracellular acidification and endocytosis, both are prerequisite for osteoclastic bone resorptive function in vitro. Interestingly, we find that knockdown of Ac45 also attenuates osteoclastogenesis owing to a reduced fusion capacity of osteoclastic precursor cells. Finally, in an effort to gain more detailed insights into the functional role of Ac45 in osteoclasts, we attempted to generate osteoclast-specific Ac45 conditional knockout mice using a Cathepsin K-Cre-LoxP system. Surprisingly, however, insertion of the neomycin cassette in the Ac45-Flox(Neo mice resulted in marked disturbances in CNS development and ensuing embryonic lethality thus precluding functional assessment of Ac45 in osteoclasts and peripheral bone tissues. Based on these unexpected findings we propose that, in addition to its canonical function in V-ATPase-mediated acidification, Ac45 plays versatile roles during osteoclast formation and function.

  13. Pumping potential wells

    Hershkowitz, N.; Forest, C.; Wang, E. Y.; Intrator, T.

    1987-01-01

    Nonmonotonic plasma potential structures are a common feature of many double layers and sheaths. Steady state plasma potential wells separating regions having different plasma potentials are often found in laboratory experiments. In order to exist, such structures all must find a solution to a common problem. Ions created by charge exchange or ionization in the region of the potential well are electrostatically confined and tend to accumulate and fill up the potential well. The increase in positive charge should eliminate the well. Nevertheless, steady state structures are found in which the wells do not fill up. This means that it is important to take into account processes which 'pump' ions from the well. As examples of ion pumping of plasma wells, potential dips in front of a positively biased electro collecting anode in a relatively cold, low density multidipole plasma is considered. Pumping is provided by ion leaks from the edges of the potential dip or by oscillating the applied potential. In the former case the two dimensional character of the problem is shown to be important.

  14. Electrocentrifugal pumping; Bombeo electrocentrifugo

    Rodriguez Perez, Guillermo; Medellin Otero, Hector [Instituto Mexicano del Peroleo (Mexico)

    1996-07-01

    The exploitation of isolated oil deposits, in losing their own energy, enter a phase of secondary recovery. One of the technologies of new development in Mexico is the one of electrocentrifugal pumping , which consists of introducing the motor-pump as an integral part of the production pipe down to the well bottom and pumping directly up to central complexes, from where it is sent inland. In the present paper is intended to explain what this type of secondary recovery consists of. [Spanish] La explotacion de yacimientos aislados de petroleo, al perder su energia propia, entran en una fase de recuperacion secundaria. Una de las tecnologias de nuevo desarrollo en Mexico es la de bombeo electrocentrifugo, la cual consiste en introducir la motobomba como parte integral de la tuberia de produccion hasta el fondo del pozo y bombearlo directamente hasta los complejos centrales, de donde se envia a tierra. En el presente trabajo se pretende explicar en que consiste este tipo de recuperacion secundaria.

  15. Stirling Engine Heat Pump

    Kagawa, Noboru

    Recent advances in the feasibility studies related to the Stirling engines and Stirling engine heat pumps which have been considered attractive due to their promising role in helping to solve the global environmental and energy problems,are reviewed. This article begins to describe the brief history of the Stirling engines and theoretical thermodynamic analysis of the Stirling cycle in order to understand several advantages on the Stirling engine. Furthermore,they could throw light on our question why the dream engines had not been promoted to practical applications during two hundred years. The present review shows that the Stirling engines with several unique advantages including 30 to 40% thermal efficiency and preferable exhaust characteristics,had been designed and constructed by recent tackling for the development of the advanced automobile and other applications using them. Based on the current state of art,it is being provided to push the Stirling engines combined with heat pumps based on the reversed Rankine cycle to the market. At present,however, many problems, especially for the durability, cost, and delicate engine parts must be enforced to solve. In addition,there are some possibilities which can increase the attractiveness of the Stirling engines and heat pumps. The review closes with suggestions for further research.

  16. Simultaneous distribution of AC and DC power

    Polese, Luigi Gentile

    2015-09-15

    A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.

  17. A Magnetically Coupled Cryogenic Pump

    Hatfield, Walter; Jumper, Kevin

    2011-01-01

    Historically, cryogenic pumps used for propellant loading at Kennedy Space Center (KSC) and other NASA Centers have a bellows mechanical seal and oil bath ball bearings, both of which can be problematic and require high maintenance. Because of the extremely low temperatures, the mechanical seals are made of special materials and design, have wearing surfaces, are subject to improper installation, and commonly are a potential leak path. The ball bearings are non-precision bearings [ABEC-1 (Annular Bearing Engineering Council)] and are lubricated using LOX compatible oil. This oil is compatible with the propellant to prevent explosions, but does not have good lubricating properties. Due to the poor lubricity, it has been a goal of the KSC cryogenics community for the last 15 years to develop a magnetically coupled pump, which would eliminate these two potential issues. A number of projects have been attempted, but none of the pumps was a success. An off-the-shelf magnetically coupled pump (typically used with corrosive fluids) was procured that has been used for hypergolic service at KSC. The KSC Cryogenics Test Lab (CTL) operated the pump in cryogenic LN2 as received to determine a baseline for modifications required. The pump bushing, bearings, and thrust rings failed, and the pump would not flow liquid (this is a typical failure mode that was experienced in the previous attempts). Using the knowledge gained over the years designing and building cryogenic pumps, the CTL determined alternative materials that would be suitable for use under the pump design conditions. The CTL procured alternative materials for the bearings (bronze, aluminum bronze, and glass filled PTFE) and machined new bearing bushings, sleeves, and thrust rings. The designed clearances among the bushings, sleeves, thrust rings, case, and case cover were altered once again using experience gained from previous cryogenic pump rebuilds and designs. The alternative material parts were assembled into

  18. Reactor coolant pump shaft seal stability during station blackout

    Results are presented from an investigation into the behavior of Reactor Coolant Pump shaft seals during a potential station blackout (loss of all ac power) at a nuclear power plant. The investigation assumes loss of cooling to the seals and focuses on the effect of high temperature on polymer seals located in the shaft seal assemblies, and the identification of parameters having the most influence on overall hydraulic seal performance. Predicted seal failure thresholds are presented for a range of station blackout conditions and shaft seal geometries

  19. Operational research on a high-T c rectifier-type superconducting flux pump

    Geng, Jianzhao; Matsuda, K.; Fu, Lin; Shen, Boyang; Zhang, Xiuchang; Coombs, T. A.

    2016-03-01

    High-T c superconducting (HTS) flux pumps are capable of injecting flux into a superconducting circuit, which can achieve persistent current operation for HTS magnets. In this paper, we studied the operation of a rectifier-type HTS flux pump. The flux pump employs a transformer to generate high alternating current in its secondary winding, which is connected to an HTS load shorted by an HTS bridge. A high frequency ac field is intermittently applied perpendicular to the bridge, thus, generating flux flow. The dynamic resistance caused by the flux flow ‘rectifies’ the secondary current, resulting in a direct current in the load. We have found that the final load current can easily be controlled by changing the phase difference between the secondary current and the bridge field. The bridge field of frequency ranging from 10 to 40 Hz and magnitude ranging from 0 to 0.66 T was tested. Flux pumping was observed for field magnitudes of 50 mT or above. We have found that both higher field magnitude and higher field frequency result in a faster pumping speed and a higher final load current. This can be attributed to the influence of dynamic resistance. The dynamic resistance measured in the flux pump is comparable with the theoretical calculation. The experimental results fully support a first order circuit model. The flux pump is much more controllable than the traveling wave flux pumps based on permanent magnets, which makes it promising for practical use.

  20. PUMPED LASER SYSTEM USING FEEDBACK TO PUMP MEANS

    2008-01-01

    A laser system according to the invention comprises pump generating means (xO2, xO3) for generating at least a first and a second, preferably focused, pump beam, and lasing means (xO6, xO7) for emitting radiation by being appropriately pumped. The lasing means (xO6, xO7) is disposed in a first...... resonator so as to receive the first pump beam in order to generate a first beam (x21) having a first frequency, and the lasing means (xO6, xO7) is disposed in a second resonator so as to receive the second pump beam in order to generate a second beam (x22) having a second frequency. At least one Q...... fed back to a regulation system (x14), said regulation system (x14) controlling said pump generating means (xO2, xO3)....

  1. Supercritical waste oxidation pump investigation

    Thurston, G.; Garcia, K.

    1993-02-01

    This report investigates the pumping techniques and pumping equipment that would be appropriate for a 5,000 gallon per day supercritical water oxidation waste disposal facility. The pumps must boost water, waste, and additives from atmospheric pressure to approximately 27.6 MPa (4,000 psia). The required flow ranges from 10 gpm to less than 0.1 gpm. For the higher flows, many commercial piston pumps are available. These pumps have packing and check-valves that will require periodic maintenance; probably at 2 to 6 month intervals. Several commercial diaphragm pumps were also discovered that could pump the higher flow rates. Diaphragm pumps have the advantage of not requiring dynamic seals. For the lower flows associated with the waste and additive materials, commercial diaphragm pumps. are available. Difficult to pump materials that are sticky, radioactive, or contain solids, could be injected with an accumulator using an inert gas as the driving mechanism. The information presented in this report serves as a spring board for trade studies and the development of equipment specifications.

  2. Supercritical waste oxidation pump investigation

    This report investigates the pumping techniques and pumping equipment that would be appropriate for a 5,000 gallon per day supercritical water oxidation waste disposal facility. The pumps must boost water, waste, and additives from atmospheric pressure to approximately 27.6 MPa (4,000 psia). The required flow ranges from 10 gpm to less than 0.1 gpm. For the higher flows, many commercial piston pumps are available. These pumps have packing and check-valves that will require periodic maintenance; probably at 2 to 6 month intervals. Several commercial diaphragm pumps were also discovered that could pump the higher flow rates. Diaphragm pumps have the advantage of not requiring dynamic seals. For the lower flows associated with the waste and additive materials, commercial diaphragm pumps. are available. Difficult to pump materials that are sticky, radioactive, or contain solids, could be injected with an accumulator using an inert gas as the driving mechanism. The information presented in this report serves as a spring board for trade studies and the development of equipment specifications

  3. Experimental Study on Series Operation of Sliding Vane Pump and Centrifugal Pump

    Tao Li; Weiming Zhang; Ming Jiang; Zhengyang Li

    2013-01-01

    A platform for sliding vane pump and centrifugal pump tests is installed to study the series operation of them under different characteristics of pipeline. Firstly, the sliding vane pump and the centrifugal pump work independently, and the performance is recorded. Then, the two types of pumps are combined together, with the sliding vane pump acting as the feeding pump. Comparison is made between the performance of the independently working pump and the performance of series operation pump. Re...

  4. RP-200: Design of PD pump for pumping of molasses

    Skåtun, Kim

    2008-01-01

    Abstract Motivation There is, at the present time, no submerged molasses pump on the market that is designed specifically for cargo tankers. Due to this I, find it interesting to look into the possibilities of installing a molasses pump in cargo tankers to transport molasses instead of transporting molasses in containers as it is done today. It is challenging to come up with a new product, and the motivation of actual be able to release a pump for the international marked is indescribable...

  5. AcEST: DK948526 [AcEST

    Full Text Available TST38A01NGRL0003_I19 675 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0003_I19. 5' end seq ... IAMVRTTTPVYV 214 Query: 542 ALALFNQARVSSLPIIDDNGSLIDIY ARSDITALARDDTY 661 AL +F Q RVS+LP++D+ G ++DIY ++ D+ ... LA + TY Sbjct: 215 ALGIFVQHRVSALPVVDEKGRVVDIY SKFDVINLAAEKTY 254 >sp|Q09138|AAKG1_PIG 5'-AMP-acti ... IAMVRTTTPVYV 215 Query: 542 ALALFNQARVSSLPIIDDNGSLIDIY ARSDITALARDDTY 661 AL +F Q RVS+LP++D+ G ++DIY ++ D+ ... LA + TY Sbjct: 216 ALGIFVQHRVSALPVVDEKGRVVDIY SKFDVINLAAEKTY 255 >sp|O54950|AAKG1_MOUSE 5'-AMP-ac ...

  6. AcEST: DK962916 [AcEST

    Full Text Available TST39A01NGRL0015_C06 596 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0015_C06. 5' end seq ... NA. clone: TST39A01NGRL0015_C06. 5' end sequence. Acce ssion DK962916 Tissue type prothallia with plantlet ... 2 Query: 317 MPKSKEPCSQEACDIQTCLVKNNFITERCFPVIEALQACCE K 442 MP+ K+PC ++AC+IQ CL NN++ +C VI+ L+ CC + Sbjct ... me = +2 Query: 335 PCSQEACDIQTCLVKNNFITERCFPVIEALQACCE K 442 PC +EAC IQ CL+ + + +C VI+ L CC K Sbjct: 4 PCQ ... = +2 Query: 326 SKEPCSQEACDIQTCLVKNNFITERCFPVIEALQACCE KCNSK 454 + E C+ CD +TC +K F +C AL CCE KC K Sbjct: 4 ...

  7. AcEST: DK955705 [AcEST

    Full Text Available TST39A01NGRL0023_N02 635 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0023_N02. 5' end seq ... NA. clone: TST39A01NGRL0023_N02. 5' end sequence. Acce ssion DK955705 Tissue type prothallia with plantlet ... 2 Query: 296 MPKSKEPCSQEACDIQTCLVKNNFITERCFPVIEALQACCE K 421 MP+ K+PC ++AC+IQ CL NN++ +C VI+ L+ CC + Sbjct ... me = +2 Query: 314 PCSQEACDIQTCLVKNNFITERCFPVIEALQACCE K 421 PC +EAC IQ CL+ + + +C VI+ L CC K Sbjct: 4 PCQ ... = +2 Query: 305 SKEPCSQEACDIQTCLVKNNFITERCFPVIEALQACCE KCNSK 433 + E C+ CD +TC +K F +C AL CCE KC K Sbjct: 4 ...

  8. AcEST: DK961330 [AcEST

    Full Text Available FWVPCMHTPIKQEKHTHA 405 +AR P W +++PI+ ++C++ P + AK+ PL DVTH+F+V + +QE Sbjct: 61 VARRTRP-SWHEDNPINYVQCDISDPDD...+IL +D PGGPWKVYG Sbjct: 4 WWAGAIGAAKKKLEEDDAPPKHS---SVALIVGVTGIIGNSLAEILPLADTPGGP...AWHEDNPINYIQCDISDPDDSLAKLSPLTDVTHVFYVTCANR--STEPENCE 117 Query: 406 MATHMFENIIGVLLTHAPNLQHVCMQTSDKHY-... : Swiss-Prot sp_hit_id Q7MXT7 Definition sp|Q7MXT7|LPXD_PORGI UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac...lue sp|Q7MXT7|LPXD_PORGI UDP-3-O-[3-hydroxymyristoyl] glucosamine N-... 34 0.62 sp|P60369|KR103_HUMAN Kerati

  9. AcEST: BP913772 [AcEST

    Full Text Available N VT V L C+ G G+ H Sbjct: 350 NVVTWSAVIAGYAQRGLGFEALDVFRQMRLCGSEPNVVTLVSLLSGCALAGTLLHGKETH 409 Query: 376 IEIER--RGLLEVDP-...VFNKLSVQDIVSW 236 + + A ++G+++H I RRGL + PV+ + LV MY R G L Q VF+++ +D+VSW Sbjct: 296 ASLAALEQGKLIHGYILRRGLDSILPVI-S... TF M+ +PN+VT V VL+AC+ + Q + Sbjct: 250 SWSAMIACYAKNGKAFEALRTFREMMRETKDSSPNSVTMVSVLQACASLA...MIEGGVAPNAVTFVVVLRACSQTGSYSQSQTFFEAMSKNF 50 + G A G + F+ M + GV PNAVTFV VLR CS G + Q F++M F Sbjct: 312 ALNGLAMNGFGEKCLELFSL...L YA G + + +F++ D+ +TA + + Sbjct: 48 IHAAILRHNLLLHPRYPVLNLKLHRAYASHGKIRHSLALFHQTIDP

  10. AcEST: DK952954 [AcEST

    Full Text Available TST38A01NGRL0015_H21 616 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0015_H21. 5' end seq ... LIHAHIVCSCNDVDNFVRSTLVNLYSKCGSIEDAHNVFAKLATRRSVDWSMMIS ... 541 ++ Q K +HA I + D + V + L+++Y+KCGSI DA F +++T+ ... LIHAHIVCSCNDVDNFVRSTLVNLYSKCGSIEDAHNVFAKLATRRSVDWSMMIS GS 547 + + IHA S D ++ LV LYS+CG IE+++ F + ++ W+ ++S ... LIHAHIVCSCNDVDNFVRSTLVNLYSKCGSIEDAHNVFAKLATRRSVDWSMMIS ... 541 DL + IH+ I+ + ++ +V S L+++Y+K G ++ A ++ + A + ... EA+ LF +M G+ P + + L AC Sbjct: 243 RVFDGLRLKDHSSWVAMIS GLSKNECEAEAIRLFCDMYVLGIMPTPYAFSSVLSACKKIE 302 Query ...

  11. AcEST: BP912540 [AcEST

    Full Text Available YMU001_000020_B03 501 Adiantum capillus-veneris mRNA. clone: YMU001_000020_B03. BP912540 - Show ... 2 EELTVHHTASVGDVEALKALLAEGADKDEKDSEGRTALHFACGYGEVMCAE VLLEAGVAV 181 EE VH TAS+GDVE LKA LA G +KDE+DSEGRTAL ... ry: 14 VHHTASVGDVEALKALLAEGADKDEKDSEGRTALHFACGYGEVMCAE VLLEAGVAVDAVD 193 +H A V ++ LL GAD KD G LH AC YG AE ... uery: 26 ASVGDVEALKALLAEGADKDEKDSEGR--TALHFACGYGEVMCAE VLLEAGVAVDAVDKN 199 + GD+E +K L + + + +D EGR T LHFA ... ry: 14 VHHTASVGDVEALKALLAEGADKDEKDSEGRTALHFACGYGEVMCAE VLLEAGVAVDAVD 193 +H A ++E + LL GAD + +D G LH A YG ...

  12. Accuracy of a New Patch Pump Based on a Microelectromechanical System (MEMS) Compared to Other Commercially Available Insulin Pumps: Results of the First In Vitro and In Vivo Studies

    Borot, Sophie; Franc, Sylvia; Cristante, Justine; Penfornis, Alfred; Benhamou, Pierre-Yves; Guerci, Bruno; Hanaire, Hélène; Renard, Eric; Reznik, Yves; Simon, Chantal; Charpentier, Guillaume

    2014-01-01

    The JewelPUMP™ (JP) is a new patch pump based on a microelectromechanical system that operates without any plunger. The study aimed to evaluate the infusion accuracy of the JP in vitro and in vivo. For the in vitro studies, commercially available pumps meeting the ISO standard were compared to the JP: the MiniMed® Paradigm® 712 (MP), Accu-Chek® Combo (AC), OmniPod® (OP), Animas® Vibe™ (AN). Pump accuracy was measured over 24 hours using a continuous microweighing method, at 0.1 and 1 IU/h bas...

  13. Proper Sizing of Circulation Pumps

    Tommerup, Henrik M.; Nørgaard, Jørgen

    2007-01-01

    The paper describes the preliminary results from field tests of replacing various types of old pumps used for circulating water in heating systems in single- and double-family houses with new types of pumps. The tests were carried out in Denmark for the Danish Electricity Savings Trust, but the...... results can be applied to Europe in general. Despite the small sample of houses involved in the test, 15 houses, some rather safe conclusions can be drawn from the results, which showed that newly developed pumps with power consumption around 5-8 W, can perform the task of circulating the water...... sufficiently to keep the houses satisfactorily warm during the heating season of the test. The old replaced pumps used 5-10 times more power. In Europe alone, a gradual replacement of the present vastly oversized pumps with such small but sufficient pumps can save the construction of 17 large power plants as...

  14. Speed Control of DC Motor using AC/AC/DC Converter Based on Intelligent Techniques

    Rakan Kh Antar

    2013-01-01

       This paper describes the application of ac/ac/dc and ac/dc converters to control the speed of a separately excited DC motor. Artificial neural network and PI controller are trained to select the desired values of firing angles for triggering thyristors of the ac/ac/dc and ac/dc bridge converters in order to control the speed of the dc motor at a desired value with constant and different load torques in order to obtain the best speed response. Simulation results show that the rising time fo...

  15. Smart Grid enabled heat pumps

    Carmo, Carolina; Detlefsen, Nina; Nielsen, Mads Pagh

    2014-01-01

    an empirical study in order to achieve a number of recommendations with respect to technology concepts and control strategies that would allow residential vapor-compression heat pumps to support large-scale integration of intermittent renewables. The analysis is based on data gathered over a period...... of up to 3 years for 283 residential heat pumps installed and operating in Denmark. The results are used to assess the flexibility of domestic heat pumps and their ability to follow production....

  16. Spin pumping through quantum dots

    Rojek, Stephan; Governale, Michele; König, Jürgen

    2013-01-01

    We propose schemes for generating spin currents into a semiconductor by adiabatic or non-adiabatic pumping of electrons through interacting quantum dots. The appeal of such schemes lies in the possibility to tune the pumping characteristics via gate voltages that control the properties of the quantum dot. The calculations are based on a systematic perturbation expansion in the tunnel-coupling strength and the pumping frequency, expressed within a diagrammatic real-time technique. Special focu...

  17. Research on synchronous gear pump

    LUAN Zhen-hui

    2010-01-01

    Based on a comprehensive analysis of the structure and existing problems of the gear pump, provided a structure principle of a synchronous gear pump. The discussions focused on the working principle, construction features and finite element analysis of the hydraulic gear. The research indicates that the new pump has such advantages as lower noise, better distributed flow and a high work pressure, and it can be widely used in hydraulic systems.

  18. Valve-Less Rectification Pumps

    Tesař, Václav

    New York : Springer, 2015 - (Li, D.), s. 3399-3415 ISBN 978-0-387-32468-5 R&D Projects: GA ČR GA13-23046S Institutional support: RVO:61388998 Keywords : no-moving-part pumps * fluidic pumps * maintenance-free pumps Subject RIV: BK - Fluid Dynamics http://link.springer.com/referencework/10.1007%2F978-0-387-48998-8

  19. Centrifugal pumps and allied machinery

    Anderson, HH

    1994-01-01

    This book will be of vital interest to all engineers and designers concerned with centrifugal pumps and turbines. Including statistical information derived from 20000 pumps and 700 turbines with capacities of 5gpm to 5000000gpm, this book offers the widest range and scope of information currently available. Statistical analyses suggest practical methods of increasing pump performance and provide valuable data for new design aspects.

  20. Pump cavitation and inducer design

    Details of past work on sodium pump development and cavitation studies executed mainly for SNR 300 were reported earlier. Among the requirements for large sodium pumps are long life (200000 hours up to 300000 hours) and small size of impeller and pump, fully meeting the process and design criteria. These criteria are the required 'Q, H, r characteristics' in combination with a low NPSH value and the avoidance of cavitation damage to the pump. The pump designer has to develop a sound hydraulic combination consisting of suction arrangement, impeller design and diffuser. On the other hand the designer is free to choose an optimal pump speed. The pump speed in its turn influences the rotor dynamic pump design and the pump drive. The introduction of the inducer as an integral part of the pump design is based on following advantages: no tip cavitation; (possible) cavitation bubbles move to the open centre due to centrifugal forces on the fluid; the head of the inducer improves the inlet conditions of the impeller. The aim of an inducer is the increase in the suction specific speed (SA value) of a pump whereby the inducer functions as a pressure source improving the impeller inlet conditions. With inducer-impeller combinations values up to SA=15000 are realistic. With the use of an inducer the overall pump sizes can be reduced with Ca. 30%. Pumps commonly available have SA values up to a maximum of ca. 10000. A development programme was executed for SNR 300 in order to reach an increase of the suction specific speed of the impeller from SA 8200 to SA 11000. Further studies to optimize pumps design for the follow up line introduced the 'inducer acting as a pre-impeller' development. This programme was executed in the period 1979-1981. At the FDO premises a scale 1 2.8 inducer impeller combination with a suction specific speed SA=15000 was developed, constructed and tested at the water test rig. This water test rig is equipped with a perspex pipe allowing also visualisation

  1. The terrestrial silica pump.

    Carey, Joanna C; Fulweiler, Robinson W

    2012-01-01

    Silicon (Si) cycling controls atmospheric CO(2) concentrations and thus, the global climate, through three well-recognized means: chemical weathering of mineral silicates, occlusion of carbon (C) to soil phytoliths, and the oceanic biological Si pump. In the latter, oceanic diatoms directly sequester 25.8 Gton C yr(-1), accounting for 43% of the total oceanic net primary production (NPP). However, another important link between C and Si cycling remains largely ignored, specifically the role of Si in terrestrial NPP. Here we show that 55% of terrestrial NPP (33 Gton C yr(-1)) is due to active Si-accumulating vegetation, on par with the amount of C sequestered annually via marine diatoms. Our results suggest that similar to oceanic diatoms, the biological Si cycle of land plants also controls atmospheric CO(2) levels. In addition, we provide the first estimates of Si fixed in terrestrial vegetation by major global biome type, highlighting the ecosystems of most dynamic Si fixation. Projected global land use change will convert forests to agricultural lands, increasing the fixation of Si by land plants, and the magnitude of the terrestrial Si pump. PMID:23300825

  2. The terrestrial silica pump.

    Joanna C Carey

    Full Text Available Silicon (Si cycling controls atmospheric CO(2 concentrations and thus, the global climate, through three well-recognized means: chemical weathering of mineral silicates, occlusion of carbon (C to soil phytoliths, and the oceanic biological Si pump. In the latter, oceanic diatoms directly sequester 25.8 Gton C yr(-1, accounting for 43% of the total oceanic net primary production (NPP. However, another important link between C and Si cycling remains largely ignored, specifically the role of Si in terrestrial NPP. Here we show that 55% of terrestrial NPP (33 Gton C yr(-1 is due to active Si-accumulating vegetation, on par with the amount of C sequestered annually via marine diatoms. Our results suggest that similar to oceanic diatoms, the biological Si cycle of land plants also controls atmospheric CO(2 levels. In addition, we provide the first estimates of Si fixed in terrestrial vegetation by major global biome type, highlighting the ecosystems of most dynamic Si fixation. Projected global land use change will convert forests to agricultural lands, increasing the fixation of Si by land plants, and the magnitude of the terrestrial Si pump.

  3. Resonant Tunneling Spin Pump

    Ting, David Z.

    2007-01-01

    The resonant tunneling spin pump is a proposed semiconductor device that would generate spin-polarized electron currents. The resonant tunneling spin pump would be a purely electrical device in the sense that it would not contain any magnetic material and would not rely on an applied magnetic field. Also, unlike prior sources of spin-polarized electron currents, the proposed device would not depend on a source of circularly polarized light. The proposed semiconductor electron-spin filters would exploit the Rashba effect, which can induce energy splitting in what would otherwise be degenerate quantum states, caused by a spin-orbit interaction in conjunction with a structural-inversion asymmetry in the presence of interfacial electric fields in a semiconductor heterostructure. The magnitude of the energy split is proportional to the electron wave number. Theoretical studies have suggested the possibility of devices in which electron energy states would be split by the Rashba effect and spin-polarized currents would be extracted by resonant quantum-mechanical tunneling.

  4. Lasers with nuclear pumping

    Melnikov, S P; Sizov, A N; Miley, George H

    2015-01-01

    This book covers the history of lasers with nuclear pumping (Nuclear Pumped Lasers, NPLs). This book showcases the most important results and stages of NPL development in The Russian Federal Nuclear Center (VNIIEF) as well as other Russian and international laboratories, including laboratories in the United States. The basic science and technology behind NPLs along with potential applications are covered throughout the book. As such, this book: ·         Contains a historical overview of the extensive information developed over the past 40 years of work on NPLs ·         Covers the most important results and stages of NPL development, not just in the Russian Federal Nuclear Center, VNIIEF, but also in other laboratories in Russia, the United States , and some other scattered international laboratories ·         Systematizes the fragmented information accumulated over these years of very active research and development As the first comprehensive discussion of NPLs, students, research...

  5. Universality of ac conduction in disordered solids

    Dyre, Jeppe; Schrøder, Thomas

    2000-01-01

    non-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally......The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual...

  6. Survey of pumps for tritium gas

    This report considers many different types of pumps for their possible use in pumping tritium gas in the low, intermediate and high vacuum ranges. No one type of pump is suitable for use over the wide range of pumping pressure required in a typical pumping system. The favoured components for such a system are: bellows pump (low vacuum); orbiting scroll pump (intermediate vacuum); magnetically suspended turbomolecular pump (high vacuum); cryopump (high vacuum). Other pumps which should be considered for possible future development are: mound modified vane pump; SRTI wobble pump; roots pump with canned motor. It is proposed that a study be made of a future tritium pumping system in a Canadian tritium facility, e.g. a tritium laboratory

  7. Work plan, AP-102 mixer pump removal and pump replacement

    The objective of this work plan is to plan the steps and estimate the costs required to remove the failed AP-102 mixer pump, and to plan and estimate the cost of the necessary design and specification work required to order a new, but modified, mixer pump including the pump and pump pit energy absorbing design. The main hardware required for the removal of the mixer is as follows: a flexible receiver and blast shield; a metal container for the pulled mixer pump; and a trailer and strongback to haul and manipulate the container. Additionally: a gamma scanning device will be needed to detect the radioactivity emanating from the mixer as it is pulled from the tank; a water spray system will be required to remove tank waste from the surface of the mixer as it is pulled from the AP-102 tank; and a lifting yoke to lift the mixer from the pump pit (the SY-101 Mixer Lifting Yoke will be used). A ''green house'' will have to be erected over the AP-102 pump pit and an experienced Hoisting and Rigging crew must be assembled and trained in mixer pump removal methods before the actual removal is undertaken

  8. About Variable Speed Heating and Cooling Pumps

    Cătălin Popovici; Jan Ignat

    2009-01-01

    The present work has the purpose of underlying the advantages of variable speed heating and cooling pumps use for the perspective of general and particular pumping costs and efficiency. The study approaches comparisons between constant flow pumps and variable flow pumps in different given situations and comparatively analyses the pumping costs.

  9. Design of Pumps for Water Hydraulic Systems

    Klit, Peder; Olsen, Stefan; Bech, Thomas Nørgaard

    1999-01-01

    This paper considers the development of two pumps for water hydraulic applications. The pumps are based on two different working principles: The Vane-type pump and the Gear-type pump. Emphasis is put on the considerations that should be made to account for water as the hydraulic fluid.......KEYWORDS: water, pump, design, vane, gear....

  10. Short term dynamic aperture with AC dipoles

    Mönig, Saskia; Persson, Tobias Hakan Bjorn; Coello De Portugal, Jaime; Langner, Andy; Tomas, Rogelio; CERN. Geneva. ATS Department

    2015-01-01

    The dynamic aperture of an accelerator is determined by its non-linear components and errors. Control of the dynamic aperture is important for a good understanding and operation of the accelerator. The AC dipole, installed in the LHC for the diagnostic of linear and non-linear optics, could serve as a tool for the determination of the dynamic aperture. However, since the AC dipole itself modifies the non-linear dynamics, the dynamic aperture with and without AC dipole are expected to differ. The effect of the AC dipole on the dynamic aperture is studied within this note.

  11. ac electroosmosis in rectangular microchannels.

    Campisi, Michele; Accoto, Dino; Dario, Paolo

    2005-11-22

    Motivated by the growing interest in ac electroosmosis as a reliable no moving parts strategy to control fluid motion in microfluidic devices for biomedical applications, such as lab-on-a-chip, we study transient and steady-state electrokinetic phenomena (electroosmosis and streaming currents) in infinitely extended rectangular charged microchannels. With the aid of Fourier series and Laplace transforms we provide a general formal solution of the problem, which is used to study the time-dependent response to sudden ac applied voltage differences in case of finite electric double layer. The Debye-Huckel approximation has been adopted to allow for an algebraic solution of the Poisson-Boltzmann problem in Fourier space. We obtain the expressions of flow velocity profiles, flow rates, streaming currents, as well as expressions of the complex hydraulic and electrokinetic conductances. We analyze in detail the dependence of the electrokinetic conductance on the extension of linear dimensions relative to the Debye length, with an eye on finite electric double layer effects. PMID:16351310

  12. DESARROLLO RURAL A.C.

    Alfredo Aguilar Valdés

    2015-01-01

    Full Text Available El objetivo de este trabajo fue analizar el diagnostico situacional de una Empresa de Servicios Profesionales en el caso de: Instituto de Promoción Para el Desarrollo Rural A.C., a través de la Metodología “UALAE” así como la oportunidad que como empresa presenta. Este estudio se realizó en el municipio de Saltillo, Coahuila, México. Adoptó esta Metodología UALAE y se difundió su opinión. El Instituto de Promoción Para el Desarrollo Rural A.C., está formado por profesionistas y productores cuya finalidad es la de contribuir al desarrollo del medio rural con proyectos de viabilidad técnica, económica y social, sobre la base de necesidades reales y al aprovechamiento sustentable del potencial de los recursos naturales. Su buen funcionamiento es indispensable e importante para el desarrollo de los productores agropecuarios principalmente, debido a que se ven muy beneficiados con todos los servicios que se les brinda, se han logrado buenos proyectos, buenas capacitaciones y un gran crecimiento de sus productos. Mediante el proceso de asistencia técnica a organizaciones de productores, se induce la formulación adecuada de proyectos viables desde el punto visto del mercado, la rentabilidad económica, las tecnologías disponibles y de la organización social.

  13. Pump rod forces due to hydrodynamic effects in piston pumps

    Verheij, F.

    1986-10-01

    A mathematical model has been set up to describe flow and pressure fluctuations in a pump system of a wind pump for single acting piston pumps. With this, hydrodynamic forces acting on the pump rod can be calculated. Hydrodynamic forces make an important contribution to the total pump rod force. Experiments have been performed on a laboratory version of the so-called Tanzania pump. Different air volumes of the delivery airchamber, different delivery heads and different rotational speeds were chosen to obtain enough information to check the validity of the model. For the measuring and the elaboration of the measurements, computer programs were developed using a new data acquisition system. This new system operates very satisfactorily. A new magneto-inductive flow meter has been installed. However there are still incertainties as to the reliability of this sensor. Simple analytical expressions using Fourier transform analysis methods were obtained for the pressure and flow fluctuations in the pump system, from which the forces acting on the pump rod can be calculated. Comparison between theoretical and experimental results suggest that the pressure fluctuations are predicted correctly by theory. This is yet not the case in comparing theory and experiment with regards to the flow fluctuations. Apart from the irreliability of the flow meter, this could also be due to the complex flow in and out of the airchamber that is not correctly modelled in theory. There is certainly need for further analysis of the measurements possibly supplemented by a new set of measurements. However, design rules already can be derived from the results obtained so far. A good sizing of the airchamber in relation to the stroke volume of the pump keeps the pressure fluctuations, and so the fluctuating hydrodynamic forces acting on the pump rod, within bounds. 13 refs.

  14. Ion-Pumping Microbial Rhodopsins

    Hideki eKandori

    2015-09-01

    Full Text Available Rhodopsins are light-sensing proteins used in optogenetics. The word rhodopsin originates from the Greek words rhodo and opsis, indicating rose and sight, respectively. Although the classical meaning of rhodopsin is the red-colored pigment in our eyes, the modern meaning of rhodopsin encompasses photoactive proteins containing a retinal chromophore in animals and microbes. Animal and microbial rhodopsins possess 11-cis and all-trans retinal, respectively, to capture light in seven transmembrane α-helices, and photoisomerizations into all-trans and 13-cis forms, respectively, initiate each function. Ion-transporting proteins can be found in microbial rhodopsins, such as light-gated channels and light-driven pumps, which are the main tools in optogenetics. Light-driven pumps, such as archaeal H+ pump bacteriorhodopsin (BR and Cl- pump halorhodopsin (HR, were discovered in the 1970s, and their mechanism has been extensively studied. On the other hand, different kinds of H+ and Cl- pumps have been found in marine bacteria, such as proteorhodopsin (PR and Fulvimarina pelagi rhodopsin (FR, respectively. In addition, a light-driven Na+ pump was found, Krokinobacter eikastus rhodopsin 2 (KR2. These light-driven ion-pumping microbial rhodopsins are classified as DTD, TSA, DTE, NTQ and NDQ rhodopsins for BR, HR, PR, FR and KR2, respectively. Recent understanding of ion-pumping microbial rhodopsins is reviewed in this paper.

  15. Threshold values of autoresonant pumping

    Kiselev, O. M.

    2013-01-01

    There exists stable growing solution of primary resonant equation for a autoresonant pumping with decreasing amplitude. The primary term of asymptotics is $O(\\sqrt{t})$ and does not depend on order of the force from some interval. We point to the interval for the amplitude of the pumping for which the growing stable solution exists.

  16. High Temperature Thermoacoustic Heat Pump

    Tijani, H.; Spoelstra, S. [ECN Biomass and Energy Efficiency, Petten (Netherlands)

    2012-07-15

    Thermoacoustic technology can provide new types of heat pumps that can be deployed in different applications. Thermoacoustic heat pumps can for example be applied in dwellings to generate cooling or heating. Typically, space and water heating makes up about 60% of domestic and office energy consumption. The application of heat pumps can contribute to achieve energy savings and environmental benefits by reducing CO2 and NOx emissions. This paper presents the study of a laboratory scale thermoacoustic-Stirling heat pump operating between 10C and 80C which can be applied in domestics and offices. The heat pump is driven by a thermoacoustic-Stirling engine. The experimental results show that the heat pump pumps 250 W of heat at 60C at a drive ratio of 3.6 % and 200 W at 80C at a drive ratio of 3.5 %. The performance for both cases is about 40% of the Carnot performance. The design, construction, and performance measurements of the heat pump will be presented and discussed.

  17. High temperature thermoacoustic heat pump

    Tijani, H.; Spoelstra, S. [Energy research Centre of the Netherlands, 1755 ZG Petten (Netherlands)

    2012-06-15

    Thermoacoustic technology can provide new types of heat pumps that can be deployed in different applications. A thermoacoustic heat pumps can for example be applied in dwellings to generate cooling or heating. Typically, space and water heating makes up about 60% of domestics and offices energy consumption. The application of heat pumps can contribute to achieve energy savings and environmental benefits by reducing CO2 and NOx emissions. This paper presents the study of a laboratory scale thermoacoustic-Stirling heat pump operating between 10C and 80C which can be applied in domestics and offices. The heat pump is driven by a thermoacoustic-Stirling engine. The experimental results show that the heat pump pumps 250 W of heat at 60C at a drive ratio of 3.6% and 200 W at 80C at a drive ratio of 3.5 %. The performance for both cases is about 40% of the Carnot performance. The design, construction, and performance measurements of the heat pump will be presented and discussed.

  18. Multi-path peristaltic pump

    Chandler, Joseph A. (Inventor)

    1986-01-01

    The instant invention is directed to a peristaltic pump for critical laboratory or hospital applications requiring precise flow rates over an extended period of time. Within the cylindrical barrel pump housing is a single-piece, molded, elastometric, cylindrical liner with a multiplicity of flattened helical channels created therein from one end of the liner to the other. Three cylindrical rollers rotate about the center axis of the pump around the inside surface of the liner selectively compressing the liner, and hence the helical channels between the rollers and the barrel housing, creating a pumping action by forcing trapped fluid in the helical channels axially from one end of the liner to the opposite end. The novelty of the invention appears to lie in the provision of the special liner with multiple helical channels as the pumping chamber, rather than the standard single elastomeric tubing which is squeezed repeatedly by rollers to move the liquid through a typical peristaltic pump. Large, repeated deflections on the standard tubing causes a permanent set in the tubing, thus either changing the flow rate, or requiring a new section of tubing to be positioned in the pump head. Further, this configuration minimizes the amount of outflow pulsation which is characteristic of a typical single tubing peristaltic pump.

  19. Centrifugal pumps for rocket engines

    Campbell, W. E.; Farquhar, J.

    1974-01-01

    The use of centrifugal pumps for rocket engines is described in terms of general requirements of operational and planned systems. Hydrodynamic and mechanical design considerations and techniques and test procedures are summarized. Some of the pump development experiences, in terms of both problems and solutions, are highlighted.

  20. AcEST: BP920845 [AcEST

    Full Text Available 45|Adiantum capillus-veneris mRNA, clone: YMU001_000142_D08. (514 letters) Database: uniprot_sprot.fasta 412,525 seq...P7 OS=Magnapor... 33 1.0 sp|Q7VF68|SYH_HELHP Histidyl-tRNA synthetase OS=Helicobacter hep... 31 3.8 sp|P1305...90 FTGFLVLHSEPRQQPQVDL 1608 >sp|A4QX49|DBP7_MAGGR ATP-dependent RNA helicase DBP7 OS=Magnaporthe grise...T PT VT+H + T+ AC+ A+TT+ H H Sbjct: 481 PPKETKPTK------PVTNHTESTVGKACYITSAANTTITLHKLH 519 >sp|Q7VF68|SYH_HELHP His...rot_trembl.fasta 7,341,751 sequences; 2,391,615,440 total letters Searching.................................

  1. AcEST: DK960083 [AcEST

    Full Text Available ome P450 71D7 OS=Solanum chacoense ... 96 1e-19 sp|Q9SAB6|C71AI_ARATH Cytochrome ...... 96 2e-19 sp|P93530|C71D6_SOLCH Cytochrome P450 71D6 OS=Solanum chacoense ... 94 5e-19 sp|Q9T0K2|C71AK_AR... paten... 176 1e-42 tr|Q9AXP9|Q9AXP9_POPJC Cinnamate 4-hydroxylase OS=Populus jackii... 176 2e-42 tr|Q40907|Q40907_POPKI Cinnamic ac...8 KVVQQSRGAWEDEALRVIQDLKA 160 >tr|Q9AXP9|Q9AXP9_POPJC Cinnamate 4-hydroxylase OS=Populus jackii GN=C4H PE=2 ...e-42 tr|A9PBZ7|A9PBZ7_POPTR Putative uncharacterized protein OS=Popul... 176 2e-4

  2. AcEST: DK955376 [AcEST

    Full Text Available TST39A01NGRL0022_O23 611 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0022_O23. 5' end seq ... LMDETRAAGIKL 210 Query: 602 AIC 610 A+C Sbjct: 211 AVC ... 213 >tr|A9SM81|A9SM81_PHYPA Predicted protein OS=P ... C 610 VLELMD A+ KGLKVA+C Sbjct: 196 VLELMDAAREKGLKVAVC ... 213 >tr|Q8L7U1|Q8L7U1_ARATH AT4g39970/T5J17_140 OS ... LKVAIC 610 LMDEA+A G K+A+C Sbjct: 182 RLMDEAKAAGKKLAVC ... 197 >tr|Q680K2|Q680K2_ARATH MRNA, complete cds, cl ... LKVAIC 610 LMDEA+A G K+A+C Sbjct: 182 RLMDEAKAAGKKLAVC ... 197 >tr|Q8LAS1|Q8LAS1_ARATH Putative uncharacteriz ...

  3. AcEST: BP913416 [AcEST

    Full Text Available GCATGTAGTTTGGA CAGAGATG ■■Homology search results ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swi...AC_BACFN Uronate isomerase OS=Bacteroides fragilis (... 30 4.5 sp|Q3ITT7|SYA_NATPD Alanyl-tRNA synthetase OS=Natronomonas phar...C++ N IP+ M C Sbjct: 417 LSYPRHEYFRRTLCNLLGCDVENGEIPLSEMERVC 451 >sp|Q3ITT7|SYA_NATPD Alanyl-tRNA synthetase OS=Natronomonas phar...ng, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database searc...148,809,765 total letters Searching..................................................done Score E Sequences

  4. AcEST: DK947388 [AcEST

    Full Text Available Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Ac...ids Res. 25:3389-3402. Query= DK947388|Adiantum capillus-veneris mRNA, clone: YMU02A01NGRL0015_L18, 5' (587 letters) Databa... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK947388|Adiantum c...apillus-veneris mRNA, clone: YMU02A01NGRL0015_L18, 5' (587 letters) Database: uniprot_trembl.fasta...-ribosylation factor 1 OS=Salix bakko GN... 268 1e-71 sp|P49076|ARF_MAIZE ADP-ribosylation factor OS=Zea may

  5. AcEST: BP916217 [AcEST

    Full Text Available inase kinase 7-interacting protein 3 OS=Mus musculus Align length 119 Score (bit) 35.0 E-value 0.16 Report B...visiae GN... 30 6.8 >sp|Q571K4|TAB3_MOUSE Mitogen-activated protein kinase kinase kinase 7-interacting protein 3 OS=Mus musculus...protein kinase kinase kinase 7 interacting protein 3 OS=Mus musculus GN=Map3k7ip3 PE=2 SV=1 Length = 716 Sco...(3)malignant brain tumor-like 2 prot... 31 2.3 sp|P33234|ADIY_ECOLI HTH-type transcriptional regulator adiY ...ZZC3_PSEU2 Membrane protein, putative OS=Pseudomonas... 35 2.5 tr|Q5U7D5|Q5U7D5_9BACI OpuAC OS=Halobacillus trueperi GN=opu

  6. AcEST: DK953324 [AcEST

    Full Text Available |LSRR_PHOLL Transcriptional regulator lsrR OS=Photorhab... 30 6.1 sp|A0JY64|ATPB_ARTS2 ATP synthase subunit beta OS=Arthroba...cter s... 30 6.1 sp|A1R7V3|ATPB_ARTAT ATP synthase subunit beta OS=Arthroba...ATP synthase subunit beta OS=Arthrobacter sp. (strain FB24) GN=atpD PE=3 SV=1 Len...KD 372 Query: 311 HLHFTHRGKQRL 346 H + R KQ L Sbjct: 373 HYNTAVRVKQIL 384 >sp|A1R7V3|ATPB_ARTAT ATP synthase subunit beta OS=Arthroba...T and PSI-BLAST: a new generation of protein database search programs, Nucleic Ac

  7. AcEST: DK945049 [AcEST

    Full Text Available R 148 >sp|Q9X5X3|ATCU_SINMW Copper-transporting P-type ATPase OS=Sinorhizobium medicae (strain WSM419) GN=ac...|Q4EPP8|Q4EPP8_LISMO Heavy metal-binding protein OS=Listeria m... 34 3.2 tr|A6AST1|A6AST1_VIBHA Copper-trans..... 31 2.7 sp|Q4X0S7|DPH1_ASPFU Diphthamide biosynthesis protein 1 OS=Asper... 30 4.5 sp|A2VDJ0|T131L_HUMAN Transmembran...P58342|ATCU2_RHIME Copper-transporting ATPase 2 OS=Rhizobium meliloti Align length 75 Score (bit) 34.7 E-val...sophila ... 30 7.8 >sp|P58342|ATCU2_RHIME Copper-transporting ATPase 2 OS=Rhizobium me

  8. Nanowire liquid pumps

    Huang, Jian Yu; Lo, Yu-Chieh; Niu, Jun Jie; Kushima, Akihiro; Qian, Xiaofeng; Zhong, Li; Mao, Scott X.; Li, Ju

    2013-04-01

    The ability to form tiny droplets of liquids and control their movements is important in printing or patterning, chemical reactions and biological assays. So far, such nanofluidic capabilities have principally used components such as channels, nozzles or tubes, where a solid encloses the transported liquid. Here, we show that liquids can flow along the outer surface of solid nanowires at a scale of attolitres per second and the process can be directly imaged with in situ transmission electron microscopy. Microscopy videos show that an ionic liquid can be pumped along tin dioxide, silicon or zinc oxide nanowires as a thin precursor film or as beads riding on the precursor film. Theoretical analysis suggests there is a critical film thickness of ~10 nm below which the liquid flows as a flat film and above which it flows as discrete beads. This critical thickness is the result of intermolecular forces between solid and liquid, which compete with liquid surface energy and Rayleigh-Plateau instability.

  9. Pump it up

    Maffli, Luc; O'Brien, Benjamin; Rosset, Samuel; Shea, Herbert

    2012-04-01

    We report on the use of zipping actuation applied to dielectric elastomer actuators to microfabricate mm-sized pumps. The zipping actuators presented here use electrostatic attraction to deform an elastomeric membrane by pulling it into contact with a rigid counter electrode. We present several actuation schemes using either conventional DEA actuation, zipping, or a combination of both in order to realize microfluidic devices. A zipping design in which the electric field is applied across the elastomer membrane was explored theoretically and experimentally. Single zipping chambers and a micropump body made of a three chambers connected by an embedded channel were wet-etched into a silicon wafer and subsequently covered by a gold-implanted silicone membrane. We measured static deflections of up to 300 μm on chambers with square openings of 1.8 and 2.6 mm side, in very good agreement with our model.

  10. SOLAR PUMPED LASER MICROTHRUSTER

    Rubenchik, A M; Beach, R; Dawson, J; Siders, C W

    2010-02-05

    The development of microsatellites requires the development of engines to modify their orbit. It is natural to use solar energy to drive such engines. For an unlimited energy source the optimal thruster must use a minimal amount of expendable material to minimize launch costs. This requires the ejected material to have the maximal velocity and, hence, the ejected atoms must be as light as possible and be ejected by as high an energy density source as possible. Such a propulsion can be induced by pulses from an ultra-short laser. The ultra-short laser provides the high-energy concentration and high-ejected velocity. We suggest a microthruster system comprised of an inflatable solar concentrator, a solar panel, and a diode-pumped fiber laser. We will describe the system design and give weight estimates.

  11. Stochastic thermodynamics of hidden pumps

    Esposito, Massimiliano; Parrondo, Juan M. R.

    2015-05-01

    We show that a reversible pumping mechanism operating between two states of a kinetic network can give rise to Poisson transitions between these two states. An external observer, for whom the pumping mechanism is not accessible, will observe a Markov chain satisfying local detailed balance with an emerging effective force induced by the hidden pump. Due to the reversibility of the pump, the actual entropy production turns out to be lower than the coarse-grained entropy production estimated from the flows and affinities of the resulting Markov chain. Moreover, in presence of a large time scale separation between the fast-pumping dynamics and the slow-network dynamics, a finite current with zero dissipation may be produced. We make use of these general results to build a synthetase-like kinetic scheme able to reversibly produce high free-energy molecules at a finite rate and a rotatory motor achieving 100% efficiency at finite speed.

  12. Quantum spin and charge pumping through double quantum dots with ferromagnetic leads

    The pumping of electrons through double quantum dots (DQDs) attached to ferromagnetic leads have been theoretically investigated by using the nonequilibrium Green's function method. It is found that an oscillating electric field applied to the quantum dot may give rise to the pumped charge and spin currents. In the case that both leads are ferromagnet, a pure spin current can be generated in the antiparallel magnetization configuration, where no net charge current exists. The possibility of manipulating the pumped spin current is explored by tuning the dot level and the ac field. By making use of various tunings, the magnitude and direction of the pumped spin current can be well controlled. For the case that only one lead is ferromagnetic, both of the charge and spin currents can be pumped and flow in opposite directions on the average. The control of the magnitude and direction of the pumped charge and spin currents is also discussed by means of the magnetic flux threading through the DQD ring. -- Highlights: → We theoretically investigate the pumping of electrons through double quantum dots attached to ferromagnetic leads. → An oscillating electric field applied to the quantum dot may give rise to the pumped charge and spin currents. → When both leads are ferromagnet, a pure spin current can be generated in the antiparallel magnetization configuration. → By making use of various tunings, the magnitude and direction of the pumped spin current can be well controlled. → When only one lead is ferromagnetic, both of the charge and spin currents can be pumped and flow in opposite directions.

  13. Automatic Control of Water Pumping Stations

    Muhannad Alrheeh; JIANG Zhengfeng

    2006-01-01

    Automatic Control of pumps is an interesting proposal to operate water pumping stations among many kinds of water pumping stations according to their functions.In this paper, our pumping station is being used for water supply system. This paper is to introduce the idea of pump controller and the important factors that must be considering when we want to design automatic control system of water pumping stations. Then the automatic control circuit with the function of all components will be introduced.

  14. Eigenvalues Analysis Applied to the Stability Study of a Variable Speed Pump Turbine Unit

    Han, Michel; Kawkabani, Basile; Simond, Jean-Jacques

    2012-01-01

    This paper presents an eigenvalues analysis method for an induction machine model based on phase variables a, b, c. This approach is validated by comparison with ad, q approach and applied to a variable speed pump-turbine unit using a simplified model of the converters. The proposed approach permits the study and analysis of the interaction between mechanical, electric and regulation parts of the system. Index Terms—control systems, numerical simulation, induction motors, AC-DC power converte...

  15. Correcting Working Postures in Water Pump AssemblyTasks using the OVAKO Work Analysis System (OWAS)

    Atiya Kadhim Al-Zuheri; Hussein S. Ketan

    2008-01-01

    Ovako Working Postures Analyzing System (OWAS) is a widely used method for studying awkward working postures in workplaces. This study with OWAS, analyzed working postures for manual material handling of laminations at stacking workstation for water pump assembly line in Electrical Industrial Company (EICO) / Baghdad. A computer program, WinOWAS, was used for the study. In real life workstation was found that more than 26% of the working postures observed were classified as either AC2 (slight...

  16. Pumping characteristics of sputter ion pump (SIP) and titanium sublimation pump (TSP) combination

    For achieving hydrocarbon free, clean ultra high vacuum, SIP-TSP combination is one of the ideal choice for pumping. For the SRS facility in Centre for Advanced Technology (CAT), we are utilising this combination, enmass. For this purpose, two modules of these combination set-ups are assembled, one with the TSP as an integral part of SIP and the other, with TSP as a separate pump mounted on the top of SIP. The pump bodies were vacuum degassed at 700 degC at 10-5 mbar for 3 hrs. An ultimate vacuum of 3 x 10-11 mbar was achieved, after a bake-out at 250 degC for 4 hrs, followed by continuous SIP pumping for 48 hrs, with two TSP flashing at approximately 10 hrs interval. The pump-down patterns as well as the pressure-rise patterns are studied. (author). 2 refs., 5 figs

  17. Antiplatelet drug interactions with proton pump inhibitors

    Scott, Stuart A; Obeng, Aniwaa Owusu; Hulot, Jean-Sébastien

    2014-01-01

    Introduction Non-aspirin antiplatelet agents (e.g., clopidogrel, prasugrel, ticagrelor) are commonly prescribed for the prevention of recurrent cardiovascular events among patients with acute coronary syndromes (ACS) and/or those undergoing percutaneous coronary intervention (PCI). In addition, combination therapy with proton pump inhibitors (PPIs) is often recommended to attenuate gastrointestinal bleeding risk, particularly during dual antiplatelet therapy (DAPT) with clopidogrel and aspirin. Importantly, a pharmacological interaction between clopidogrel and some PPIs has been proposed based on mutual CYP450-dependent metabolism, but available evidence is inconsistent. Areas covered This article provides an overview of the currently approved antiplatelet agents and PPIs, including their metabolic pathways. Additionally, the CYP450 isoenzyme at the center of the drug interaction, CYP2C19, is described in detail, and the available evidence on both the potential pharmacological interaction and influence on clinical outcomes are summarized and evaluated. Expert opinion Although concomitant DAPT and PPI use reduces clopidogrel active metabolite levels and ex vivo-measured platelet inhibition, the influence of the drug interaction on clinical outcomes has been conflicting and largely reported from non-randomized observational studies. Despite this inconsistency, a clinically important interaction cannot be definitively excluded, particularly among patient subgroups with higher overall cardiovascular risk and potentially among CYP2C19 loss-of-function allele carriers. PMID:24205916

  18. Heat pumps for the home

    Cantor, John

    2013-01-01

    In recent years, heat pumps have emerged as a promising new form of technology with a relatively low environmental impact. Moreover, they have presented householders with an opportunity to reduce their heating bills. Heat pumps can heat a building by 'pumping' heat from either the ground or the air outside: an intriguing process which utilizes principles that are somewhat analogous to those employed in the domestic refrigerator. Armed with the practical information contained in these pages, homeowners will have the necessary knowledge to take advantage of this potentially low-carbon t

  19. Novel Characteristics of Valveless Pumping

    Timmermann, Stine; Ottesen, Johnny T.

    2009-01-01

    This study investigates the occurrence of valveless pumping in a fluidfilled system consisting of two open tanks connected by an elastic tube. We show that directional flow can be achieved by introducing a periodic pinching applied at an asymmetrical location along the tube, and that the flow...... direction depends on the pumping frequency. We propose a relation between wave propagation velocity, tube length, and resonance frequencies associated with shifts in the pumping direction using numerical simulations. The eigenfrequencies of the system are estimated from the linearized system, and we show...

  20. Solar pumped solid state lasers

    Results are presented for direct solar pumping of a Nd:YAG rod laser. Stable CW output of more than 60 watts was obtained with slope efficiencies exceeding 2%. Results are consistent with predictions based on a simple solar laser model the authors have developed. Using this model, performance projections and design concepts for higher power and higher efficiency solar-pumped solid state lasers are presented. It is shown that existing laser materials with broadband absorption characteristics (e.g., alexandrite and Nd:Cr:GSGG) can have better than 10% overall conversion efficiencies when solar pumped. The utility of solar lasers for various laser applications in space is briefly discussed

  1. Chemically driven electron tunnelling pumps

    Goychuk, I

    2006-01-01

    The simplest mechanism for molecular electron pumps is discussed which is based on nonadiabatic electron tunnelling and nonequilibrium conformational fluctuations. Such fluctuations can be induced, e.g. by random binding of negatively charged ATP molecules to the electron-transferring molecular complex, their subsequent hydrolysis and the products dissociation. The pumping rate can be controlled by the ATP concentration in solution. Depending on the model parameters there may exist a critical ATP concentration for the pump to function. Alternatively, nonequilibrium fluctuations can be induced by externally applied stochastic electric fields. For realistically chosen parameters, the mechanism is shown to be robust and highly efficient.

  2. System analysis for sucker-rod pumping

    Schmidt, Z.; Doty, D.R.

    1989-05-01

    Pumping free gas in an oil well can significantly decrease the efficiency of a sucker-rod-pumping installation. Pump placement depth and use of a downhole gas/liquid separator (gas anchor) were found to be significant variables in improving the overall efficiency. A procedure is presented that shows when and to what degree the use of a gas anchor improves the efficiency of a sucker-rod pumping system. It was found that at lower pump intake pressures, the gas anchor usually improves efficiency, but at higher pump intake pressures, use of a gas anchor produces no positive effect. Also, elevating the pump to the highest position that still allows proper pump loading was found to reduce the operating costs of a sucker-rod-pumping installation significantly. Finally, a procedure is presented to calculate directly the pump volumetric efficiency and required volumetric pump displacement rate.

  3. Fluid Dynamics in Sucker Rod Pumps

    Cutler, R.P.; Mansure, A.J.

    1999-01-14

    Sucker rod pumps are installed in approximately 90% of all oil wells in the U.S. Although they have been widely used for decades, there are many issues regarding the fluid dynamics of the pump that have not been fully investigated. A project was conducted at Sandia National Laboratories to develop unimproved understanding of the fluid dynamics inside a sucker rod pump. A mathematical flow model was developed to predict pressures in any pump component or an entire pump under single-phase fluid and pumping conditions. Laboratory flow tests were conducted on instrumented individual pump components and on a complete pump to verify and refine the model. The mathematical model was then converted to a Visual Basic program to allow easy input of fluid, geometry and pump parameters and to generate output plots. Examples of issues affecting pump performance investigated with the model include the effects of viscosity, surface roughness, valve design details, plunger and valve pressure differentials, and pumping rate.

  4. SINGLE PHASE HIGH FREQUENCY AC CONVERTER FOR INDUCTION HEATING APPLICATION

    M.A INAYATHULLAAH,; Dr. R. Anita

    2010-01-01

    The proposed topology reduces the total harmonic distortion (THD) of a high frequency AC/AC Converter well below the acceptable limit. This paper deals with a novel single phase AC/DC/AC soft switching utility frequency AC to high frequency AC converter. In this paper a single phase full bridge inverter with Vienna rectifier as front end is used instead of conventional diode bridge rectifier to provide continuous sinusoidal input current with nearly unity power factor at the source side with ...

  5. Pump failure leads to alternative vertical pump condition monitoring technique

    Condition monitoring and detecting early signs of potential failure mechanisms present particular problems in vertical pumps. Most often, the majority of the pump assembly is not readily accessible for visual or audible inspection or conventional vibration monitoring techniques using accelerometers and/or proximity sensors. The root cause failure analysis of a 2-stage vertical centrifugal service-water pump at a nuclear power generating facility in the USA is presented, highlighting this long standing challenge in condition monitoring of vertical pumps. This paper will summarize the major findings of the root cause analysis (RCA), highlight the limitations of traditional monitoring techniques, and present an expanded application of motor current monitoring as a means to gain insight into the mechanical performance and condition of a pump. The 'real-world' example of failure, monitoring and correlation of the monitoring technique to a detailed pump disassembly inspection is also presented. This paper will explain some of the reasons behind well known design principles requiring natural frequency separation from known forcing frequencies, as well as explore an unexpected submerged brittle fracture failure mechanism, and how such issues may be avoided. (author)

  6. ENERGY STAR Certified Pool Pumps

    U.S. Environmental Protection Agency — Certified models meet all ENERGY STAR requirements as listed in the Version 1.0 ENERGY STAR Program Requirements for Pool Pumps that are effective as of February...

  7. Transverse pumped laser amplifier architecture

    Bayramian, Andrew James; Manes, Kenneth; Deri, Robert; Erlandson, Al; Caird, John; Spaeth, Mary

    2013-07-09

    An optical gain architecture includes a pump source and a pump aperture. The architecture also includes a gain region including a gain element operable to amplify light at a laser wavelength. The gain region is characterized by a first side intersecting an optical path, a second side opposing the first side, a third side adjacent the first and second sides, and a fourth side opposing the third side. The architecture further includes a dichroic section disposed between the pump aperture and the first side of the gain region. The dichroic section is characterized by low reflectance at a pump wavelength and high reflectance at the laser wavelength. The architecture additionally includes a first cladding section proximate to the third side of the gain region and a second cladding section proximate to the fourth side of the gain region.

  8. Heat pumps at the maltings

    1987-11-01

    Heat pumps have halved the energy costs of producing finished malt at two of the country's maltsters. The fuel-fired kilning processes described are now performed by heat pumps with considerable energy and production benefits at the maltings of J.P. Simpson and Co. (Alnwick) Ltd, in Tivetshall St Margaret, Norfolk, and of Munton and Fison Plc of Stowmarket, Suffolk. The heat pump system installed at the Station Malting of J.P. Simpson was devised by the Electricity Council Research Centre at Capenhurst near Chester. Energy cost benefits of Pound 6,000 a month are being realised at Simpsons, but there is the added benefit that the system has been designed to provide conditioned air to the germination cycle to ensure that the correct temperature is maintained throughout the year. At the Cedars factory of Munton and Fison, heat pumps were used on a trial basis for plant micropropagation and for a fish farming unit.

  9. High Performance Space Pump Project

    National Aeronautics and Space Administration — PDT is proposing a High Performance Space Pump based upon an innovative design using several technologies. The design will use a two-stage impeller, high...

  10. Pump for extremely dangerous liquids

    Tesař, Václav

    2011-01-01

    Roč. 89, č. 7A (2011), s. 940-956. ISSN 0263-8762 R&D Projects: GA ČR GA101/07/1499; GA AV ČR IAA200760705 Institutional research plan: CEZ:AV0Z20760514 Keywords : pump * jet pump * coanda effect Subject RIV: BK - Fluid Dynamics Impact factor: 1.968, year: 2011 http://www. science direct.com/ science /article/pii/S0263876210003631

  11. Operating pumps on minimum flow

    The Nuclear Regulatory Commission (NRC) regulations in Appendix A to 10 CFR 50 require that components important to safety be designed and tested to quality standards commensurate with the importance of the safety functions to be performed. The NRC regulations in 10 CFR 50.55a reference the American Society of Mechanical Engineers (ASME) Boiler and Pressure Vessel Code for criteria to conduct inservice testing of pumps. The ASME Code allows the performance of pump inservice testing using mini flow bypass loops. Operating experience and studies performed for the Nuclear Plant Aging Research Program (NUREG/ CR-4597, Vols. 1 and 2) showed that a leading cause of pump problems and failures is associated with hydraulic instability phenomena induced by low-flow operation. The NRC staff issued Information Notice (IN) 87-59 to alert all licensees to two miniflow design concerns identified by Westinghouse. The first potential problem discussed in this IN involves parallel pump operation. If the head/capacity curve of one of the parallel pumps is greater than the other, the weaker pump may be dead-headed when the pumps are operating at low-flow conditions. The other problem relates to potential pump damage as a result of hydraulic instability during low-flow operation. In NRC Bulletin 88-04, dated May 5, 1988, the staff requested all licensees to investigate and correct, as applicable, the two miniflow design concerns. The staff also developed a Temporary Instruction, TI 2515/105, dated January 29, 1990, to inspect for the adequacy of licensee response and follow-up actions to NRC Bulletin 88-04. Oak Ridge National Laboratory has reviewed utility responses to Bulletin 88-04 under the auspices of the NRC's Nuclear Plant Aging Research Program, and participated in several NRC inspections. Examples of actions that have been taken, an assessment of the overall industry response, and resultant conclusions and recommendations are presented

  12. Nanoampere pumping of Cooper pairs

    Vartiainen, Juha J.; Möttönen, Mikko; Pekola, Jukka P.; Kemppinen, Antti

    2007-01-01

    The authors have employed a tunable Cooper-pair transistor, the sluice, with radio frequency control to pump current over a resistive circuit. They find that the charge transferred per pumping cycle can be controlled with the resolution of a single Cooper pair up to hundreds of pairs. The achieved nanoampere current features more than an order of magnitude improvement over the previously reported results and it is close to the theoretical maximum value for the measured sample.

  13. Nanoampere pumping of Cooper pairs

    Vartiainen, Juha J.; Mottonen, Mikko; Pekola, Jukka; Kemppinen, Antti

    2006-01-01

    We have employed a tunable Cooper-pair transistor, the sluice, with radio frequency control to pump current over a resistive circuit. We find that the charge transferred per pumping cycle can be controlled with the resolution of a single Cooper-pair up to hundreds of pairs. The achieved nanoampere current features more than an order of magnitude improvement over the previously reported results and it is close to the theoretical maximum value for the measured sample.

  14. Electrohydrodynamic inductively pumped heat pipe

    Mitchell, A.S.

    1981-01-19

    The self-priming voltage controllable electrohydrodynamic inductively pumped heat pipe of the present invention greatly improves the maximum thermal throughout of heat pipes in low and medium temperature applications calling for the use of dielectric working fluids. An applied traveling potential wave induces a traveling wave of electrical charge in selected phase relation in the liquid phase of the dielectric working fluid providing an electrical traction which pumps the working fluid from the condensor to the evaporator.

  15. Towards visible CW pumped supercontinua

    Cumberland, B A; Popov, S V; Taylor, J R

    2008-01-01

    We report a 1 um continuous wave pumped supercontinuum which extends short of the pump wavelength to 0.65 um. This is achieved by using a 50 W Yb fibre laser in combination with a photonic crystal fibre with a carefully engineered zero dispersion wavelength. We show that the short wavelength generation is due to a combination of four-wave mixing and dispersive wave trapping by solitons. The evolution and limiting factors of the continuum are discussed.

  16. Characterization of AcMNPV with a deletion of ac69 gene

    Jianhao Ke

    2011-07-01

    Full Text Available ORF69 (Ac69 of Autographa californica multiple nucleopolyhedrovirus (AcMNPV is conserved in some baculovirus genomes. Although it has been shown that Ac69 has cap 0-dependent methyltransferase activity and is not required for budded virus production in Spodoptera frugiperda Sf-9 cells, its role in occlusion-derived virus synthesis and virus oral infectivity is not known. This paper describes generation of an ac69 knockout AcMNPV bacmid mutant and analyses of the influence of ac69 deletion on the viral infectivity in Sf-9 cells and Trichoplusia ni larvae so as to investigate the role of ac69 in the viral life cycle. Results indicated that ac69 deletion has little effect on the production rates and morphogenesis of budded virus and occlusion-derived virus in Sf-9 cells. In addition, animal experiment revealed that the deletion mutant did not affect AcMNPV infectivity for Trichoplusia ni larvae in LD50 and LT50 bioassay when administered orally. These results suggest that ac69 may be dispensable for viral infectivity both in vitro and in vivo.

  17. Bipropellant propulsion with reciprocating pumps

    Whitehead, John C.

    1993-06-01

    A pressure regulated gas generator rocket cycle with alternately pressurized pairs of reciprocating pumps offers thrust-on-demand operation with significantly lower inert mass than conventional spacecraft liquid propulsion systems. The operation of bipropellant feed systems with reciprocating pumps is explained, with consideration for both short and long term missions. There are several methods for startup and shutdown of this self-starting pump-fed system, with preference determined by thrust duty cycle and mission duration. Progress to date includes extensive development testing of components unique to this type of system, and several live tests with monopropellant hydrazine. Pneumatic pump control valves which render pistons and bellows automatically responsive to downstream liquid demand are significantly simpler than those described previously. A compact pumpset mounted to central liquid manifolds has a pair of oxidizer pumps pneumatically slaved to a pair of fuel pumps to reduce vibration. A warm gas pressure reducer for tank expulsion can eliminate any remaining need for inert gas storage.

  18. Noise reduction in AC-coupled amplifiers

    Serrano Finetti, Roberto Ernesto; Pallàs Areny, Ramon

    2014-01-01

    AC-coupled amplifiers are noisier than dc-coupled amplifiers because of the thermal noise of the resistor(s) in the ac-coupling network and the increased contribution of the amplifier input noise current i(n). Both contributions, however, diminish if the corner frequency f(c) of the high-pass filter observed by the signal is lowered, the cost being a longer transient response. At the same time, the presence of large resistors in the ac-coupling network suggests that the use of FET-input ampli...

  19. The abdominal circulatory pump.

    Andrea Aliverti

    Full Text Available Blood in the splanchnic vasculature can be transferred to the extremities. We quantified such blood shifts in normal subjects by measuring trunk volume by optoelectronic plethysmography, simultaneously with changes in body volume by whole body plethysmography during contractions of the diaphragm and abdominal muscles. Trunk volume changes with blood shifts, but body volume does not so that the blood volume shifted between trunk and extremities (Vbs is the difference between changes in trunk and body volume. This is so because both trunk and body volume change identically with breathing and gas expansion or compression. During tidal breathing Vbs was 50-75 ml with an ejection fraction of 4-6% and an output of 750-1500 ml/min. Step increases in abdominal pressure resulted in rapid emptying presumably from the liver with a time constant of 0.61+/-0.1SE sec. followed by slower flow from non-hepatic viscera. The filling time constant was 0.57+/-0.09SE sec. Splanchnic emptying shifted up to 650 ml blood. With emptying, the increased hepatic vein flow increases the blood pressure at its entry into the inferior vena cava (IVC and abolishes the pressure gradient producing flow between the femoral vein and the IVC inducing blood pooling in the legs. The findings are important for exercise because the larger the Vbs the greater the perfusion of locomotor muscles. During asystolic cardiac arrest we calculate that appropriate timing of abdominal compression could produce an output of 6 L/min. so that the abdominal circulatory pump might act as an auxiliary heart.

  20. Program optimizes sucker-rod pumping mode

    Direct energy costs for sucker-rod pumping can be optimized by selecting the right pump size, stroke length, and pumping speed for the required liquid production rate. Calculation procedures for a computer program are developed for optimizing the design of conventional pumping units

  1. Program optimizes sucker-rod pumping mode

    Takacs, G. (Technical Univ. of Miskolc, Miskolc (HU))

    1990-10-01

    Direct energy costs for sucker-rod pumping can be optimized by selecting the right pump size, stroke length, and pumping speed for the required liquid production rate. Calculation procedures for a computer program are developed for optimizing the design of conventional pumping units.

  2. 33 CFR 183.524 - Fuel pumps.

    2010-07-01

    ... diaphragm pump must not leak fuel from the pump if the primary diaphragm fails. (b) Each electrically operated fuel pump must not operate except when the engine is operating or when the engine is started. (c) If tested under § 183.590, each fuel pump, as installed in the boat, must not leak more than...

  3. 49 CFR 195.262 - Pumping equipment.

    2010-10-01

    ... 49 Transportation 3 2010-10-01 2010-10-01 false Pumping equipment. 195.262 Section 195.262... PIPELINE Construction § 195.262 Pumping equipment. (a) Adequate ventilation must be provided in pump... warn of the presence of hazardous vapors in the pumping station building. (b) The following must...

  4. Design of Pumps for Water Hydraulic Systems

    Klit, Peder; Olsen, Stefan; Bech, Thomas Nørgaard

    1999-01-01

    This paper considers the development of two pumps for water hydraulic applications. The pumps are based on two different working principles: The Vane-type pump and the Gear-type pump. Emphasis is put on the considerations that should be made to account for water as the hydraulic fluid...

  5. 33 CFR 157.126 - Pumps.

    2010-07-01

    ... Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) POLLUTION RULES FOR... Washing (COW) System on Tank Vessels Design, Equipment, and Installation § 157.126 Pumps. (a) Crude oil must be supplied to the COW machines by COW system pumps or cargo pumps. (b) The pumps under...

  6. 46 CFR 169.559 - Fire pumps.

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Fire pumps. 169.559 Section 169.559 Shipping COAST GUARD... Firefighting Equipment Firefighting Equipment § 169.559 Fire pumps. (a) Each sailing school vessel must be equipped with fire pumps as required in Table 169.559(a). Table 169.559(a)—Fire Pumps Length Exposed...

  7. Method for optimising the energy of pumps

    Skovmose Kallesøe, Carsten; De Persis, Claudio

    2011-01-01

    The method involves determining whether pumps (pu1, pu5) are directly assigned to loads (v1, v3) as pilot pumps (pu2, pu3) and hydraulically connected upstream of the pilot pumps. The upstream pumps are controlled with variable speed for energy optimization. Energy optimization circuits are selected

  8. Centrifugal slurry pump wear and hydraulic studies. Phase II report. Experimental studies

    Mistry, D.; Cooper, P.; Biswas, C.; Sloteman, D.; Onuschak, A.

    1983-01-01

    This report describes the work performed by Ingersoll-Rand Research, Inc., under Phase II, Experimental Studies for the contract entitled, Centrifugal Slurry Pump Wear and Hydraulic Studies. This work was carried out for the US Department of Energy under Contract No. DE-AC-82PC50035. The basic development approach pursued this phase is presented, followed by a discussion on wear relationships. The analysis, which resulted in the development of a mathematical wear model relating pump life to some of the key design and operating parameters, is presented. The results, observations, and conclusions of the experimental investigation on small scale pumps that led to the selected design features for the prototype pump are discussed. The material investigation was performed at IRRI, ORNL and Battelle. The rationale for selecting the materials for testing, the test methods and apparatus used, and the results obtained are presented followed by a discussion on materials for a prototype pump. In addition, the prototype pump test facility description, as well as the related design and equipment details, are presented. 20 references, 53 figures, 13 tables.

  9. Efficiency of pumping gasoline in service station

    This paper studies a gasoline pumping system and evaluates the efficiency of pumping gasoline in service station. The primary motivation of the study is to determine how to improve the efficiency of pumping gasoline in service station. An experimental test rig is setup. After evaluating the efficiency of the pump under different conditions, it was found that the performance is quite different when pumping different medium, which is not match with the pump manufacturer's catalog. And it provides us a guidance to choose the operational parameters of pumps. A phenomenon has been observed which result of the appearance of the BEP (best efficiency point) and the proof needs more works.

  10. Comparison of solar powered water pumping systems which use diaphragm pumps

    Four solar photovoltaic (PV) powered diaphragm pumps were tested at different simulated pumping depths at the USDA-ARS Conservation and Production Research Laboratory near Bushland, Texas. Two of the pumps were designed for intermediate pumping depths (30 to 70 meters), and the other two pumps were...

  11. Measure Guideline: Replacing Single-Speed Pool Pumps with Variable Speed Pumps for Energy Savings

    Hunt, A.; Easley, S.

    2012-05-01

    The report evaluates potential energy savings by replacing traditional single-speed pool pumps with variable speed pool pumps, and provide a basic cost comparison between continued uses of traditional pumps verses new pumps. A simple step-by-step process for inspecting the pool area and installing a new pool pump follows.

  12. Measure Guideline. Replacing Single-Speed Pool Pumps with Variable Speed Pumps for Energy Savings

    Hunt, A. [Building Media and the Building America Retrofit Alliance (BARA), Wilmington, DE (United States); Easley, S. [Building Media and the Building America Retrofit Alliance (BARA), Wilmington, DE (United States)

    2012-05-01

    This measure guideline evaluates potential energy savings by replacing traditional single-speed pool pumps with variable speed pool pumps, and provides a basic cost comparison between continued uses of traditional pumps verses new pumps. A simple step-by-step process for inspecting the pool area and installing a new pool pump follows.

  13. The hydraulic design of pump turbine for Xianyou pumped storage power station

    This paper presents the hydraulic design of pump turbines for Xianyou pumped storage power station. The method of improving the hydraulic performance of pump turbine with CFD analysis is given. The results of model test indicate that the final hydraulic design of pump turbine for Xianyou pumped storage power station is of high efficiencies, good

  14. The hydraulic design of pump turbine for Xianyou pumped storage power station

    Zheng, J. S.; Liu, W. C.; Fu, Z. Y.; Shi, Q. H.

    2012-11-01

    This paper presents the hydraulic design of pump turbines for Xianyou pumped storage power station. The method of improving the hydraulic performance of pump turbine with CFD analysis is given. The results of model test indicate that the final hydraulic design of pump turbine for Xianyou pumped storage power station is of high efficiencies, good

  15. Experimental Realization of a Quantum Spin Pump

    Watson, Susan; Potok, R.; M. Marcus, C.;

    2003-01-01

    We demonstrate the operation of a quantum spin pump based on cyclic radio-frequency excitation of a GaAs quantum dot, including the ability to pump pure spin without pumping charge. The device takes advantage of bidirectional mesoscopic fluctuations of pumped current, made spin-dependent by the...... application of an in-plane Zeeman field. Spin currents are measured by placing the pump in a focusing geometry with a spin-selective collector....

  16. Design of Solar Steam Irrigation Pump

    Vishal Kumar Dhimmar, Jay Prajapti, Mital Patel, Dhruv Patel, Banti Mistry, Jignesh Parmar

    2014-01-01

    Solar irrigation pump is this type of device which uses solar energy for water pumping. Water pumping is an energy intensive activity and consumes a large amount man power, diesel and electricity. Smallholder farmers in low income countries can benefit from affordable irrigation pump systems as they enable cultivation of high value crops during dry season. Currently the majority of small irrigation pumps are manually operated which is time consuming and require...

  17. Remotely powered self-propelling particles and micropumps based on miniature diodes

    Chang, Suk Tai; Paunov, Vesselin N.; Petsev, Dimiter N.; Velev, Orlin D.

    2007-03-01

    Microsensors and micromachines that are capable of self-propulsion through fluids could revolutionize many aspects of technology. Few principles to propel such devices and supply them with energy are known. Here, we show that various types of miniature semiconductor diodes floating in water act as self-propelling particles when powered by an external alternating electric field. The millimetre-sized diodes rectify the voltage induced between their electrodes. The resulting particle-localized electro-osmotic flow propels them in the direction of either the cathode or the anode, depending on their surface charge. These rudimentary self-propelling devices can emit light or respond to light and could be controlled by internal logic. Diodes embedded in the walls of microfluidic channels provide locally distributed pumping or mixing functions powered by a global external field. The combined application of a.c. and d.c. fields in such devices allows decoupling of the velocity of the particles and the liquid and could be used for on-chip separations.

  18. The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual

    Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)

  19. Guiding Principles in Selecting AC To DC Converters For Power Factor Corrections in AC Transmission System

    Ibekwe B.E

    2014-10-01

    Full Text Available The ac to dc converters’ power factors correction in ac transmission system were investigated. The studies include: phase-controlled converter; pulse width modulated (PWM converter and ac input current shaped converter. Using Fourier series, power factors of these converters were calculated and simulated using MATLAB. The resulting curves are displayed in the hard copies for practical guides in the choice of converters; and comparatively, current shaped type is the best.

  20. Scavenged body heat powered infusion pump

    An infusion pump powered by body heat is investigated in this paper, with the goal of addressing the needs of dermal wound healing. The infusion pump incorporates a Knudsen gas pump, a type of thermally driven pump, to pneumatic push the pharmaceutical agent from a reservoir. Two designs are considered: an integrated pump and reservoir, and a design with cascaded pump and reservoir. Thermal models are developed for both pumps, and the simulations agree well with the experimental results. The integrated pump and reservoir design uses hydrophobic materials to prevent a flow from occurring unless the infusion pump is placed on a human body. Flow rates in the µL min−1 range for the integrated pump and reservoir, and approximately 70 µL min−1 for the cascaded pump were obtained. The dynamic behavior of the cascaded pump is described based on the thermal models. Multiple copies of the cascaded pump are easily made in series or parallel, to increase either the pressure or the flow rate. The flow rate of multiple pumps in series does not change, and the pressure of multiple pumps in parallel does not change. (paper)

  1. A Simple Load Power Estimator For Quasi-Direct AC-AC Converter System

    Marian GAICEANU; Emil ROSU

    2003-01-01

    In this paper a simple load power estimator for the three-phase quasi-direct acac converter system is reported. Since the ac-ac converter control by means of pulsewidth modulation (PWM) is based on the power balance concept, its load power should be known. Two control boards, based on the dSMC (digital Smart Motion Controller) 30 MIPS 32-bit fixed-point digital signal processor (DSP), were involved in the ac-ac system driving. By using the power balance control, the DC link voltage variation ...

  2. Transport AC losses in YBCO coated conductors

    Majoros, M [Ohio State University, Columbus, OH 43210 (United States); Ye, L [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Velichko, A V [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Coombs, T A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Sumption, M D [Ohio State University, Columbus, OH 43210 (United States); Collings, E W [Ohio State University, Columbus, OH 43210 (United States)

    2007-09-15

    Transport AC loss measurements have been made on YBCO-coated conductors prepared on two different substrate templates-RABiTS (rolling-assisted biaxially textured substrate) and IBAD (ion-beam-assisted deposition). RABiTS samples show higher losses compared with the theoretical values obtained from the critical state model, with constant critical current density, at currents lower than the critical current. An origin of this extra AC loss was demonstrated experimentally by comparison of the AC loss of two samples with different I-V curves. Despite a difference in I-V curves and in the critical currents, their measured losses, as well as the normalized losses, were practically the same. However, the functional dependence of the losses was affected by the ferromagnetic substrate. An influence of the presence of a ferromagnetic substrate on transport AC losses in YBCO film was calculated numerically by the finite element method. The presence of a ferromagnetic substrate increases transport AC losses in YBCO films depending on its relative magnetic permeability. The two loss contributions-transport AC loss in YBCO films and ferromagnetic loss in the substrate-cannot be considered as mutually independent.

  3. The lunar thermal ice pump

    It has long been suggested that water ice can exist in extremely cold regions near the lunar poles, where sublimation loss is negligible. The geographic distribution of H-bearing regolith shows only a partial or ambiguous correlation with permanently shadowed areas, thus suggesting that another mechanism may contribute to locally enhancing water concentrations. We show that under suitable conditions, water molecules can be pumped down into the regolith by day-night temperature cycles, leading to an enrichment of H2O in excess of the surface concentration. Ideal conditions for pumping are estimated and found to occur where the mean surface temperature is below 105 K and the peak surface temperature is above 120 K. These conditions complement those of the classical cold traps that are roughly defined by peak temperatures lower than 120 K. On the present-day Moon, an estimated 0.8% of the global surface area experiences such temperature variations. Typically, pumping occurs on pole-facing slopes in small areas, but within a few degrees of each pole the equator-facing slopes are preferred. Although pumping of water molecules is expected over cumulatively large areas, the absolute yield of this pump is low; at best, a few percent of the H2O delivered to the surface could have accumulated in the near-surface layer in this way. The amount of ice increases with vapor diffusivity and is thus higher in the regolith with large pore spaces.

  4. The lunar thermal ice pump

    Schorghofer, Norbert [Institute for Astronomy and NASA Astrobiology Institute, University of Hawaii, Honolulu, HI 96822 (United States); Aharonson, Oded, E-mail: norbert@hawaii.edu [Helen Kimmel Center for Planetary Science, Department of Earth and Planetary Sciences, Weizmann Institute of Science, Rehovot, 76100 (Israel)

    2014-06-20

    It has long been suggested that water ice can exist in extremely cold regions near the lunar poles, where sublimation loss is negligible. The geographic distribution of H-bearing regolith shows only a partial or ambiguous correlation with permanently shadowed areas, thus suggesting that another mechanism may contribute to locally enhancing water concentrations. We show that under suitable conditions, water molecules can be pumped down into the regolith by day-night temperature cycles, leading to an enrichment of H{sub 2}O in excess of the surface concentration. Ideal conditions for pumping are estimated and found to occur where the mean surface temperature is below 105 K and the peak surface temperature is above 120 K. These conditions complement those of the classical cold traps that are roughly defined by peak temperatures lower than 120 K. On the present-day Moon, an estimated 0.8% of the global surface area experiences such temperature variations. Typically, pumping occurs on pole-facing slopes in small areas, but within a few degrees of each pole the equator-facing slopes are preferred. Although pumping of water molecules is expected over cumulatively large areas, the absolute yield of this pump is low; at best, a few percent of the H{sub 2}O delivered to the surface could have accumulated in the near-surface layer in this way. The amount of ice increases with vapor diffusivity and is thus higher in the regolith with large pore spaces.

  5. Microelectromechanical pump utilizing porous silicon

    Lantz, Jeffrey W.; Stalford, Harold L.

    2011-07-19

    A microelectromechanical (MEM) pump is disclosed which includes a porous silicon region sandwiched between an inlet chamber and an outlet chamber. The porous silicon region is formed in a silicon substrate and contains a number of pores extending between the inlet and outlet chambers, with each pore having a cross-section dimension about equal to or smaller than a mean free path of a gas being pumped. A thermal gradient is provided along the length of each pore by a heat source which can be an electrical resistance heater or an integrated circuit (IC). A channel can be formed through the silicon substrate so that inlet and outlet ports can be formed on the same side of the substrate, or so that multiple MEM pumps can be connected in series to form a multi-stage MEM pump. The MEM pump has applications for use in gas-phase MEM chemical analysis systems, and can also be used for passive cooling of ICs.

  6. Operating pumps on minimum flow

    The Nuclear Regulatory Commission (NRC) staff issued Information Notice (IN) 87-59 to alert all licensees to two miniflow design concerns identified by Westinghouse. The first potential problem discussed in this IN involves parallel pump operation. If the head/capacity curve of one of the parallel pumps is greater than the other, the weaker pump may be dead-headed when the pumps are operating at low-flow conditions. The other problem related to potential pump damage as a result of hydraulic instability during low-flow operation. In NRC Bulletin 88-04, dated May 5, 1988, the staff requested all licensees to investigate and correct, as applicable, the two miniflow design concerns. The staff also developed a Temporary Instruction, Tl 2515/105, dated January 29, 1990 to inspect for the adequacy of licensee response and follow-up actions to NRC Bulletin 88-04. Oak Ridge National Laboratory has reviewed utility responses to Bulletin 88-04 under auspices of the NRC's Nuclear Plant Aging Research Program, and participated in several NRC inspections. Examples of actions that have been taken, an assessment of the overall industry response, and resultant conclusions and recommendations are presented

  7. Optimized Pump Power Ratio on 2nd Order Pumping Discrete Raman Amplifier

    Renxiang Huang; Youichi Akasaka; David L. Harris; James Pan

    2003-01-01

    By optimizing pump power ratio between 1st order backward pump and 2nd order forward pump on discrete Raman amplifier, we demonstrated over 2dB noise figure improvement without excessive non-linearity degradation.

  8. The role of capacitance in a wind-electric water pumping system

    Ling, Shitao [West Texas A& M Univ., Canyon, TX (United States); Clark, R.N. [Conservation and Production Research Lab., Bushland, TX (United States)

    1997-12-31

    The development of controllers for wind-electric water pumping systems to enable the use of variable voltage, variable frequency electricity to operate standard AC submersible pump motors has provided a more efficient and flexible water pumping system to replace mechanical windmills. A fixed capacitance added in parallel with the induction motor improves the power factor and starting ability of the pump motor at the lower cut-in frequency. The wind-electric water pumping system developed by USDA-Agricultural Research Service, Bushland, TX, operated well at moderate wind speeds (5-12 m/s), but tended to lose synchronization in winds above 12 m/s, especially if they were gusty. Furling generally did not occur until synchronization had been lost and the winds had to subside before synchronization could be reestablished. The frequency needed to reestablish synchronization was much lower (60-65 Hz) than the frequency where synchronization was lost (70-80 Hz). As a result, the load (motor and pump) stayed off an excessive amount of time thus causing less water to be pumped and producing a low system efficiency. The controller described in this paper dynamically connects additional capacitance of the proper amount at the appropriate time to keep the system synchronized (running at 55 to 60 Hz) and pumping water even when the wind speed exceeds 15 m/s. The system efficiency was improved by reducing the system off-line time and an additional benefit was reducing the noise caused by the high speed blade rotation when the load was off line in high winds.

  9. Method for Reducing Pumping Damage to Blood

    Bozeman, Richard J., Jr. (Inventor); Akkerman, James W. (Inventor); Aber, Gregory S. (Inventor); VanDamm, George Arthur (Inventor); Bacak, James W. (Inventor); Svejkovsky, Robert J. (Inventor); Benkowski, Robert J. (Inventor)

    1997-01-01

    Methods are provided for minimizing damage to blood in a blood pump wherein the blood pump comprises a plurality of pump components that may affect blood damage such as clearance between pump blades and housing, number of impeller blades, rounded or flat blade edges, variations in entrance angles of blades, impeller length, and the like. The process comprises selecting a plurality of pump components believed to affect blood damage such as those listed herein before. Construction variations for each of the plurality of pump components are then selected. The pump components and variations are preferably listed in a matrix for easy visual comparison of test results. Blood is circulated through a pump configuration to test each variation of each pump component. After each test, total blood damage is determined for the blood pump. Preferably each pump component variation is tested at least three times to provide statistical results and check consistency of results. The least hemolytic variation for each pump component is preferably selected as an optimized component. If no statistical difference as to blood damage is produced for a variation of a pump component, then the variation that provides preferred hydrodynamic performance is selected. To compare the variation of pump components such as impeller and stator blade geometries, the preferred embodiment of the invention uses a stereolithography technique for realizing complex shapes within a short time period.

  10. Continuous improvement of pump seals

    Pump seal reliability continues to be an area needing improvement and ongoing vigilance. Methods have been developed for identifying and assessing factors relating to seal performance, selecting the most relevant ones for a specific station, and then focusing on the most significant aspects and how to improve. Discussion invariably addresses maintenance practices, seal design, monitoring capabilities, operating conditions, transients, and pump and motor design. Success in reliability improvement requires ongoing dialogue among the station operators, pump manufacturers and seal designers. AECL CAN-seals lead the nuclear industry in reliability and seal life. They effectively save operators millions of dollars in outage time and person-rem. This paper describes some of the significant developments in AECL's ongoing program in seal R and D, as well as recent new installations following the most demanding seal qualification programs to date. (author)

  11. Piston-assisted charge pumping

    Kaur, D; Mourokh, L

    2015-01-01

    We examine charge transport through a system of three sites connected in series in the situation when an oscillating charged piston modulates the energy of the middle site. We show that with an appropriate set of parameters, charge can be transferred against an applied voltage. In this scenario, when the oscillating piston shifts away from the middle site, the energy of the site decreases and it is populated by a charge transferred from the lower energy site. On the other hand, when the piston returns to close proximity, the energy of the middle site increases and it is depopulated by the higher energy site. Thus through this process, the charge is pumped against the potential gradient. Our results can explain the process of proton pumping in one of the mitochondrial enzymes, Complex I. Moreover, this mechanism can be used for electron pumping in semiconductor nanostructures.

  12. Leak rate analysis of the Westinghouse Reactor Coolant Pump

    An independent analysis was performed by ETEC to determine what the seal leakage rates would be for the Westinghouse Reactor Coolant Pump (RCP) during a postulated station blackout resulting from loss of ac electric power. The object of the study was to determine leakage rates for the following conditions: Case 1: All three seals function. Case 2: No. 1 seal fails open while Nos. 2 and 3 seals function. Case 3: All three seals fail open. The ETEC analysis confirmed Westinghouse calculations on RCP seal performance for the conditions investigated. The leak rates predicted by ETEC were slightly lower than those predicted by Westinghouse for each of the three cases as summarized below. Case 1: ETEC predicted 19.6 gpm, Westinghouse predicted 21.1 gpm. Case 2: ETEC predicted 64.7 gpm, Westinghouse predicted 75.6 gpm. Case 3: ETEC predicted 422 gpm, Westinghouse predicted 480 gpm. 3 refs., 22 figs., 6 tabs

  13. Magnetically induced pumping and memory storage in quantum rings

    Cini, Michele; Perfetto, Enrico

    2011-12-01

    Nanoscopic rings pierced by external magnetic fields and asymmetrically connected to wires behave in sharp contrast with classical expectations. By studying the real-time evolution of tight-binding models in different geometries, we show that the creation of a magnetic dipole by a bias-induced current is a process that can be reversed: connected rings excited by an internal ac flux produce ballistic currents in the external wires. In particular we point out that by employing suitable flux protocols, single-parameter nonadiabatic pumping can be achieved, and an arbitrary amount of charge can be transferred from one side to the other. We also propose a setup that could serve a memory device, in which both the operations of writing and erasing can be efficiently performed.

  14. Optical pumping and xenon NMR

    Raftery, M.D.

    1991-11-01

    Nuclear Magnetic Resonance (NMR) spectroscopy of xenon has become an important tool for investigating a wide variety of materials, especially those with high surface area. The sensitivity of its chemical shift to environment, and its chemical inertness and adsorption properties make xenon a particularly useful NMR probe. This work discusses the application of optical pumping to enhance the sensitivity of xenon NMR experiments, thereby allowing them to be used in the study of systems with lower surface area. A novel method of optically-pumping [sup 129]Xe in low magnetic field below an NMR spectrometer and subsequent transfer of the gas to high magnetic field is described. NMR studies of the highly polarized gas adsorbed onto powdered samples with low to moderate surface areas are now possible. For instance, NMR studies of optically-pumped xenon adsorbed onto polyacrylic acid show that xenon has a large interaction with the surface. By modeling the low temperature data in terms of a sticking probability and the gas phase xenon-xenon interaction, the diffusion coefficient for xenon at the surface of the polymer is determined. The sensitivity enhancement afforded by optical pumping also allows the NMR observation of xenon thin films frozen onto the inner surfaces of different sample cells. The geometry of the thin films results in interesting line shapes that are due to the bulk magnetic susceptibility of xenon. Experiments are also described that combine optical pumping with optical detection for high sensitivity in low magnetic field to observe the quadrupoler evolution of 131 Xe spins at the surface of the pumping cells. In cells with macroscopic asymmetry, a residual quadrupolar interaction causes a splitting in the [sup 131]Xe NMR frequencies in bare Pyrex glass cells and cells with added hydrogen.

  15. Optical pumping and xenon NMR

    Raftery, M.D.

    1991-11-01

    Nuclear Magnetic Resonance (NMR) spectroscopy of xenon has become an important tool for investigating a wide variety of materials, especially those with high surface area. The sensitivity of its chemical shift to environment, and its chemical inertness and adsorption properties make xenon a particularly useful NMR probe. This work discusses the application of optical pumping to enhance the sensitivity of xenon NMR experiments, thereby allowing them to be used in the study of systems with lower surface area. A novel method of optically-pumping {sup 129}Xe in low magnetic field below an NMR spectrometer and subsequent transfer of the gas to high magnetic field is described. NMR studies of the highly polarized gas adsorbed onto powdered samples with low to moderate surface areas are now possible. For instance, NMR studies of optically-pumped xenon adsorbed onto polyacrylic acid show that xenon has a large interaction with the surface. By modeling the low temperature data in terms of a sticking probability and the gas phase xenon-xenon interaction, the diffusion coefficient for xenon at the surface of the polymer is determined. The sensitivity enhancement afforded by optical pumping also allows the NMR observation of xenon thin films frozen onto the inner surfaces of different sample cells. The geometry of the thin films results in interesting line shapes that are due to the bulk magnetic susceptibility of xenon. Experiments are also described that combine optical pumping with optical detection for high sensitivity in low magnetic field to observe the quadrupoler evolution of 131 Xe spins at the surface of the pumping cells. In cells with macroscopic asymmetry, a residual quadrupolar interaction causes a splitting in the {sup 131}Xe NMR frequencies in bare Pyrex glass cells and cells with added hydrogen.

  16. Optical pumping and xenon NMR

    Nuclear Magnetic Resonance (NMR) spectroscopy of xenon has become an important tool for investigating a wide variety of materials, especially those with high surface area. The sensitivity of its chemical shift to environment, and its chemical inertness and adsorption properties make xenon a particularly useful NMR probe. This work discusses the application of optical pumping to enhance the sensitivity of xenon NMR experiments, thereby allowing them to be used in the study of systems with lower surface area. A novel method of optically-pumping 129Xe in low magnetic field below an NMR spectrometer and subsequent transfer of the gas to high magnetic field is described. NMR studies of the highly polarized gas adsorbed onto powdered samples with low to moderate surface areas are now possible. For instance, NMR studies of optically-pumped xenon adsorbed onto polyacrylic acid show that xenon has a large interaction with the surface. By modeling the low temperature data in terms of a sticking probability and the gas phase xenon-xenon interaction, the diffusion coefficient for xenon at the surface of the polymer is determined. The sensitivity enhancement afforded by optical pumping also allows the NMR observation of xenon thin films frozen onto the inner surfaces of different sample cells. The geometry of the thin films results in interesting line shapes that are due to the bulk magnetic susceptibility of xenon. Experiments are also described that combine optical pumping with optical detection for high sensitivity in low magnetic field to observe the quadrupoler evolution of 131 Xe spins at the surface of the pumping cells. In cells with macroscopic asymmetry, a residual quadrupolar interaction causes a splitting in the 131Xe NMR frequencies in bare Pyrex glass cells and cells with added hydrogen

  17. Pumping mechanism for different gases in ion pumps with different configurations

    Audi, M.

    1988-09-01

    Ion pumps have the capability of pumping all gases of gas. Different phenomena are involved whens differnet gases are pumped. According to the pumping mechanisms in ion pump, gases can be divided in three rough groups: getterable gases, hydrogen and moble gases. Several different configurations of ion pumps have been developed through the years, to optimize their performance. Unfortunately, optimizing performance for one type of gas, often dimnishees performance for other gas. Diode ion pumps are the best choice for pumping getterable gases and hydrogen, but shown dramatic instability in pumping noble gases. Differential cathode ion pumps have a better behavior with noble gases, but slightly lower speeds for other gases. Triode ion pumps are stable when pumping noble gases, but have a reduced hydrogen capacity. The last generation of ion pumps has solved this problem: with a triode configuration and a unique cathode design, they have a high pumping speed for getterable gases, a pumping speed and pumping stability for noble gases even better than standard triode, and a pumping speed and capacity for hydrogen comparable to diode pumps.

  18. FED pumped limiter configuration issues

    Impurity control in the Fusion Engineering Device (FED) is provided by a toroidal belt pumped limiter. Limiter design issues addressed in this paper are (1) poloidal location of the limiter belt, (2) shape of the limiter surface facing the plasma, and (3) whether the belt is pumped from one or both sides. The criteria used for evaluation of limiter configuration features were sensitivity to plasma-edge conditions and ease of maintenance and fabrication. The evaluation resulted in the selection of a baseline FED limiter that is located at the bottom of the device and has a flat surface with a single leading edge

  19. Scroll Compressor Oil Pump Analysis

    Branch, S.

    2015-08-01

    Scroll compressors utilize three journal bearings to absorb gas, friction and inertial loads exerted on the crankshaft. To function properly, these bearings must be lubricated with a certain amount of oil. The focus of this paper will be to discuss how computational fluid dynamics can be used to predict oil flow out of a single-stage oil pump. The effects of speed and lubricant viscosity on pump output will also be presented. The comparisons will look at mass flow rates, differences in pressure, and torque at various speeds and dynamic viscosities. The computational fluid dynamic analysis results will be compared with actual lab testing where a crankshaft bench tester was built.

  20. TFCX pumped limiter and vacuum pumping system design and analysis

    Impurity control system design and performance studies were performed in support of the Tokamak Fusion Core Experiment (TFCX) pre-conceptual design. Efforts concentrated on pumped limiter and vacuum pumping system design configuration, thermal/mechanical and erosion lifetime performance of the limiter protective surface, and helium ash removal performance. The reference limiter design forms a continuous toroidal belt at the bottom of the device and features a flat surface with a single leading edge. The vacuum pumping system features large vacuum ducts (diameter approximately 1 m) and high-speed, compound cryopumps. Analysis results indicate that the limiter/vacuum pumping system design provides adequate helium ash removal. Erosion, primarily by disruption-induced vaporization and/or melting, limits the protective surface lifetime to about one calendar year or only about 60 full-power hours of operation. In addition to evaluating impurity control system performance for nominal TFCX conditions, these studies attempt to focus on the key plasma physics and engineering design issues that should be addressed in future research and development programs

  1. Modeling of forward pump EDFA under pump power through MATLAB

    Raghuwanshi, Sanjeev Kumar; Sharma, Reena

    2015-05-01

    Optical fiber loss is a limiting factor for high-speed optical network applications. However, the loss can be compensated by variety of optical amplifiers. Raman amplifier and EDFA amplifier are widely used in optical communication systems. There are certain advantages of EDFA over Raman amplifier like amplifying the signal at 1550 nm wavelength at which the fiber loss is minimum. Apart from that there is no pulse walk-off problem with an EDFA amplifier. With the advent of optical amplifiers like EDFA, it is feasible to achieve a high bit rate beyond terabits in optical network applications. In our study, a MATLAB simulink-based forward pumped EDFA (operating in C-band 1525-1565 nm) simulation platform has been devised to evaluate the following performance parameters like gain, noise figure, amplified spontaneous emission power variations of a forward pumped EDFA operating in C-band (1525-1565 nm) as functions of Er3+ fiber length, injected pump power, signal input power, and Er3+ doping density. The effect of an input pump power on gain and noise figure was illustrated graphically. It is possible to completely characterize and optimize the EDFA performance using our dynamic simulink test bed.

  2. Peristaltic pumps work in nano scales

    Farahpour, Farnoush; Ejtehadi, Mohammad Reza

    2013-01-01

    A design for a pump is suggested which is based on well-known peristaltic pumps. In order to simply describe the operation of the proposed pump, an innovative interpretation of low Reynolds number swimmers is presented and thereafter a similar theoretical model would be suggested to quantify the behavior of the pumps. A coarse-grained molecular dynamic simulation is used to examine the theoretical predictions and measure the efficiency of the pump in nano scales. It is shown that this pump wi...

  3. The Sloan Lens ACS Survey. V. The full ACS strong-lens sample

    Bolton, Adam S.; Burles, Scott; Koopmans, Leon V. E.; Treu, Tommaso; Gavazzi, Raphael; Moustakas, Leonidas A.; Wayth, Randall; Schlegel, David J.

    2008-01-01

    We present the definitive data for the full sample of 131 strong gravitational lens candidates observed with the Advanced Camera for Surveys (ACS) aboard the Hubble Space Telescope by the Sloan Lens ACS (SLACS) Survey. All targets were selected for higher redshift emission lines and lower redshift c

  4. Structure-function analysis of the ATP-driven glycolipid efflux pump DevBCA reveals complex organization with TolC/HgdD.

    Staron, Peter; Forchhammer, Karl; Maldener, Iris

    2014-01-31

    In Gram-negative bacteria, trans-envelope efflux pumps have periplasmic membrane fusion proteins (MFPs) as essential components. MFPs act as mediators between outer membrane factors (OMFs) and inner membrane factors (IMFs). In this study, structure-function relations of the ATP-driven glycolipid efflux pump DevBCA-TolC/HgdD from the cyanobacterium Anabaena sp. PCC 7120 were analyzed. The binding of the MFP DevB to the OMF TolC absolutely required the respective tip-regions. The interaction of DevB with the IMF DevAC mainly involved the β-barrel and the lipoyl domain. Efficient binding to DevAC and TolC, substrate recognition and export activity by DevAC were dependent on stable DevB hexamers. PMID:24361095

  5. Centrifugal and electric field forces dual-pumping CD-like microfluidic platform for biomedical separation.

    Wang, Gou-Jen; Hsu, Wen-Haw; Chang, Yau-Zin; Yang, Hsiharng

    2004-03-01

    In this article, we propose a versatile CD-like multi-channel electrophoresis-based biomedical separation system that is driven by the interactive forces between the centrifugal force and the electric field force. The centrifugal force control of this system is realized through the velocity control of a DC servo motor, while the electric field is governed through the concentric conducting circuits, which are suitably designed and fabricated by sputtering on metal mask method, and can be adjusted to provide multi-stage voltages. Experimental results demonstrate that the electro-osmotic flow (EOF) effect can be effectively reduced when the electric field force and centrifugal force are in the opposite direction. Benefits from this are that the electrophoresis separation time can be prolonged and the length of the microfluidic channels can be shortened; therefore, more effective separation efficiency can be obtained. Moreover, other advantages, such as lower joule-heat generation, low-chemistry reaction, and no variation on the ion concentration during processes, make this biomedical separation system more useful. PMID:15307444

  6. AC losses in filamentary YBCO/hastelloy

    Full text: The AC hysteresis loss of a long YBCO thin-film superconducting strip in a perpendicular AC magnetic field can be reduced by subdividing the film into narrow parallel strips (filaments). The hysteresis loss depends on the film critical current density Jc, the film thickness d, the filament width 2a and the lateral spacing L between filaments as well as on the AC magnetic field amplitude Hm. In addition, if the film is deposited onto a YSZ/hastelloy substrate to form a flexible tape, eddy current loss occurs in the hastelloy metal. The eddy current loss depends on the resistivity p of the hastelloy, the width 2w and thickness dm of the hastelloy substrate as well as on the frequency f and amplitude Hm. We have calculated the hysteresis and eddy current losses as a function of Jc, d, 2a, L, p, w, dm, f, and Hm to find optimal design parameters for a YBCO/hastelloy tape. As the AC loss is related to the loss component X'' of the AC susceptibility, we have measured X'' at different frequencies f and amplitudes Hm for several filamentary designs of YBCO/hastelloy tapes and compared our experimental results with our model calculations

  7. Thermal-powered reciprocating pump

    Sabelman, E. E.

    1972-01-01

    Waste heat from radioisotope thermal generators in spacecraft is transported to keep instruments warm by two-cylinder reciprocating pump powered by energy from warm heat exchange fluid. Each cylinder has thermally nonconductive piston, heat exchange coil, and heat sink surface.

  8. Geometric pumping in autophoretic channels

    Michelin, Sebastien; Montenegro Johnson, Thomas; de Canio, Gabriele; Lobatto-Dauzier, Nicolas; Lauga, Eric

    2015-11-01

    Pumping at the microscale has important applications from biological fluid handling to lab-on-a-chip systems. It can be achieved either from a global (e.g. imposed pressure gradient) or local forcing (e.g. ciliary pumping). Phoretic slip flows generated from concentration or temperature gradients are examples of such local flow forcing. Autophoresis is currently receiving much attention for the design of self-propelled particles achieving force- and torque-free locomotion by combining two essential surface properties: (i) an activity that modifies the solute content of the particle's environment (e.g. catalytic reaction or solute release), and (ii) a mobility that generates a slip flow from the resulting local concentration gradients. Recent work showed that geometric asymmetry is sufficient for a chemically-homogeneous particle to self-propel. Here we extend this idea to micro-pumping in active channels whose walls possess both chemical activity and phoretic mobility. Using a combination of theoretical analysis and numerical simulations, we show that geometrically-asymmetric but chemically-homogeneous channels can generate pumping and analyze the resulting flow patterns.

  9. Proton pump inhibitors and osteoporosis

    Andersen, Bjarne Nesgaard; Johansen, Per Birger; Abrahamsen, Bo

    2016-01-01

    PURPOSE OF REVIEW: The purpose of the review is to provide an update on recent advances in the evidence based on proton pump inhibitors (PPI) as a possible cause of osteoporosis and osteoporotic fractures. This review focuses, in particular, on new studies published in the last 18 months and a...

  10. Breast milk - pumping and storing

    ... pumping. You can use: 2- to 3-ounce bottles or hard plastic cups with screw-on caps. Make sure they have been washed in hot, soapy water and rinsed well. Heavy duty bags that fit into a bottle. DO NOT use everyday plastic bags or formula ...

  11. Proton pump inhibitors and gastroenteritis

    R.J. Hassing (Robert); A. Verbon (Annelies); H. de Visser (Herman); A. Hofman (Albert); B.H.Ch. Stricker (Bruno)

    2016-01-01

    textabstractAn association between proton pump inhibitor (PPI) therapy and bacterial gastroenteritis has been suggested as well as contradicted. The aim of this study was to examine the association between the use of PPIs and occurrence of bacterial gastroenteritis in the prospective Rotterdam Study

  12. Pumps for nuclear power stations

    16 nuclear power plants are in commercial operation in Japan, and nuclear power generation holds the most important position among various substitute energies. Hereafter also, it is expected that the construction of nuclear power stations will continue because other advantageous energy sources are not found. In this paper, the outline of the pumps used for BWR plants is described. Nuclear power stations tend to be large scale to reduce the construction cost per unit power output, therefore the pumps used are those of large capacity. The conditions to be taken in consideration are high temperature, high pressure, radioactive fluids, high reliability, hydrodynamic performances, aseismatic design, relevant laws and regulations, and quality assurance. Pumps are used for reactor recirculation system, control rod driving hydraulic system, boric acid solution injecting system, reactor coolant purifying system, fuel pool cooling and purifying system, residual heat removing system, low pressure and high pressure core spraying systems, and reactor isolation cooling system, for condensate, feed water, drain and circulating water systems of turbines, for fresh water, sea water, make-up water and fire fighting services, and for radioactive waste treating system. The problems of the pumps used for nuclear power stations are described, for example, the requirement of high reliability, the measures to radioactivity and the aseismatic design. (Kako, I.)

  13. Primary pump suction pressure limits

    In conjunction with the operational testing program which was carried out prior to the startup of N Reactor, a study was carried out to establish limits for suction pressure of the primary (reactor coolant) pumps. The purpose of the report is to document the results of the study and interpret them with respect to the current mode of reactor operation

  14. Electromagnetically powered electrolytic pump and thermo-responsive valve for drug delivery

    Yi, Ying

    2015-04-01

    A novel drug delivery device is presented, implementing an electrolytic pump and a thermo-responsive valve. The device is remotely operated by an AC electromagnetic field (40.5∼58.5 mT, 450 kHz) that provides the power for the pump and the valve. It is suitable for long-term therapy applications, which use a solid drug in reservoir (SDR) approach and avoids unwanted drug diffusion. When the electromagnetic field is on, the electrolytic pump drives the drug towards the valve. The valve is made of a magnetic composite consisting of a smart hydrogel: Poly (N-Isopropylacrylamide) (PNIPAm) and iron powder. The heat generated in the iron powder via magnetic losses causes the PNIPAm to shrink, allowing the drug to flow past it. When the electromagnetic field is off, the PNIPAm swells, sealing the outlet. In the meantime, the bubbles generated by electrolysis recombine into water, causing a pressure reduction in the pumping chamber. This draws fresh fluid from outside the pump into the drug reservoir before the valve is fully sealed. The recombination can be accelerated by a platinum (Pt) coated catalytic reformer, allowing more fluid to flow back to the drug reservoir and dissolve the drug. By repeatedly turning on and off the magnetic field, the drug solution can be delivered cyclically. © 2015 IEEE.

  15. Adiabatic and non-adiabatic charge pumping in a single-level molecular motor

    We propose a design for realizing quantum charge pump based on a recent proposal for a molecular motor (Seldenthuis J S et al 2010 ACS Nano 4 6681). Our design is based on the presence of a moiety with a permanent dipole moment which can rotate, thereby modulating the couplings to metallic contacts at both ends of the molecule. Using the non-equilibrium Keldysh Green’s function formalism (NEGF), we show that our design indeed generates a pump current. In the non-interacting pump, the variation of frequency from adiabatic to non-adiabatic regime, can be used to control the direction as well as the amplitude of the average current. The effect of Coulomb interaction is considered within the first- and the second- order perturbation. The numerical implementation of the scheme is quite demanding, and we develop an analytical approximation to obtain a speed-up giving results within a reasonable time. We find that the amplitude of the average pumped current can be controlled by both the driving frequency and the Coulomb interaction. The direction of of pumped current is shown to be determined by the phase difference between left and right anchoring groups. (paper)

  16. Human Aorta Is a Passive Pump

    Pahlevan, Niema; Gharib, Morteza

    2012-11-01

    Impedance pump is a simple valveless pumping mechanism that operates based on the principles of wave propagation and reflection. It has been shown in a zebrafish that a similar mechanism is responsible for the pumping action in the embryonic heart during early stages before valve formation. Recent studies suggest that the cardiovascular system is designed to take advantage of wave propagation and reflection phenomena in the arterial network. Our aim in this study was to examine if the human aorta is a passive pump working like an impedance pump. A hydraulic model with different compliant models of artificial aorta was used for series of in-vitro experiments. The hydraulic model includes a piston pump that generates the waves. Our result indicates that wave propagation and reflection can create pumping mechanism in a compliant aorta. Similar to an impedance pump, the net flow and the flow direction depends on the frequency of the waves, compliance of the aorta, and the piston stroke.

  17. Nuclear power plant safety related pump issues

    Colaccino, J.

    1996-12-01

    This paper summarizes of a number of pump issues raised since the Third NRC/ASME Symposium on Valve and Pump Testing in 1994. General issues discussed include revision of NRC Inspection Procedure 73756, issuance of NRC Information Notice 95-08 on ultrasonic flow meter uncertainties, relief requests for tests that are determined by the licensee to be impractical, and items in the ASME OM-1995 Code, Subsection ISTB, for pumps. The paper also discusses current pump vibration issues encountered in relief requests and plant inspections - which include smooth running pumps, absolute vibration limits, and vertical centrifugal pump vibration measurement requirements. Two pump scope issues involving boiling water reactor waterlog and reactor core isolation cooling pumps are also discussed. Where appropriate, NRC guidance is discussed.

  18. Cardboard Engineering--Making a Force Pump.

    Ward, Alan

    1994-01-01

    Describes a method for using cardboard and paper to make a pump for blowing up balloons. Includes construction diagrams, suggestions for application, and comparison of this force pump with those made commercially. (DDR)

  19. Pierre Gorce working on a helium pump.

    1975-01-01

    This type of pump was designed by Mario Morpurgo, to circulate liquid helium in superconducting magnets wound with hollow conductors. M. Morpurgo, Design and construction of a pump for liquid helium, CRYIOGENICS, February 1977, p. 91

  20. AC loss performance of CS insert coil

    The ITER Central Solenoid (CS) model coil and the CS insert coil were fabricated, and the test was carried out. The AC loss measurement of the coil is one of the most important tests to determine coil performance. The AC loss of a short sample conductor for the CS insert coil was measured by using the calorimetric method, and the coupling time constants of the conductor were estimated to be 30 ms and 20 ms for pulse and discharge tests, respectively. The AC loss of the CS insert coil was measured by using the calorimetric method for pulse and discharge tests. The coupling time constant estimated from the result of the pulse tests was 34 ms and almost equal to that of the short sample. The coupling time constant for the discharge test was estimated to be 140 ms and about 4 times that of the pulse test. (author)

  1. ac propulsion system for an electric vehicle

    Geppert, S.

    1980-01-01

    It is pointed out that dc drives will be the logical choice for current production electric vehicles (EV). However, by the mid-80's, there is a good chance that the price and reliability of suitable high-power semiconductors will allow for a competitive ac system. The driving force behind the ac approach is the induction motor, which has specific advantages relative to a dc shunt or series traction motor. These advantages would be an important factor in the case of a vehicle for which low maintenance characteristics are of primary importance. A description of an EV ac propulsion system is provided, taking into account the logic controller, the inverter, the motor, and a two-speed transmission-differential-axle assembly. The main barrier to the employment of the considered propulsion system in EV is not any technical problem, but inverter transistor cost.

  2. Numerical simulation of pump-intake vortices

    Rudolf Pavel; Klas Roman

    2015-01-01

    Pump pre-swirl or uneven flow distribution in front of the pump can induce pump-intake vortices. These phenomena result in blockage of the impeller suction space, deterioration of efficiency, drop of head curve and earlier onset of cavitation. Real problematic case, where head curve drop was documented, is simulated using commercial CFD software. Computational simulation was carried out for three flow rates, which correspond to three operating regimes of the vertical pump. The domain consists...

  3. Investigations of after-heat removal pumps

    Parameters influencing the pump performance were analysed during stationary and instationary conditions of an original DWR-heat removal pump, which was equipped with special measurement devices. The most important results will be presented by the following: 1) air addition deteriorates pump performance; 2) increasing system temperatures improve cavitation behaviour; 3) instationary tests lead to hysteresis phenomena; 4) pump performance was good within the tested parameter region. With 94 figs

  4. Classical and quantum pumping in closed systems

    Cohen, Doron

    2002-01-01

    Pumping of charge (Q) in a closed ring geometry is not quantized even in the strict adiabatic limit. The deviation form exact quantization can be related to the Thouless conductance. We use Kubo formalism as a starting point for the calculation of both the dissipative and the adiabatic contributions to Q. As an application we bring examples for classical dissipative pumping, classical adiabatic pumping, and in particular we make an explicit calculation for quantum pumping in case of the simpl...

  5. Quantum pumping : coherent rings versus open conductors

    Moskalets, Mykhaylo; Buttiker, Markus

    2003-01-01

    We examine adiabatic quantum pumping generated by an oscillating scatterer embedded in a one-dimensional ballistic ring and compare it with pumping caused by the same scatterer connected to external reservoirs. The pumped current for an open conductor, paradoxically, is non-zero even in the limit of vanishing transmission. In contrast, for the ring geometry the pumped current vanishes in the limit of vanishing transmission. We explain this paradoxical result and demonstrate that the physics u...

  6. Non-adiabatic topological spin pumping

    Deng, W. Y.; Luo, W.; Geng, H; Chen, M. N.; Sheng, L.; Xing, D. Y.

    2016-01-01

    Based on the Floquet scattering theory, we analytically investigate the topological spin pumping for an exactly solvable model. Floquet spin Chern numbers are introduced to characterize the periodically time-dependent system. The topological spin pumping remains robust both in the presence and in the absence of the time-reversal symmetry, as long as the pumping frequency is smaller than the band gap, where the electron transport involves only the Floquet evanescent modes in the pump. For the ...

  7. Engineering Aspects in Blood Pump Development

    Golding, Leonard; Veres, Joseph P.

    1997-01-01

    NASA turbomachinery computer codes assisted in the design of the Cleveland Clinic Foundation's centrifugal bladed blood pump. The codes were originally developed for the aerospace industry, but are applicable to the blood pump because of a high degree of synergy with this application. Traditional turbomachinery design criteria were used in the design of the blood pump centrifugal impeller and volute casing. The fluid dynamic performance of the blood pump is meeting the engineering design goals of flow rate and pressure rise.

  8. Performances analysis of a piezo-pump

    Belkhiat S.; Benaissa A.

    2012-01-01

    Piezo-pumps, in the last decade, have received extensive attention because of their potential applications in biomedical devices, biological and chemical analysis, micro-electronics cooling and space exploration. In this paper an analytical model is developed to analysis the parameters effect on the pump flow. The micro-pump driven by piezostack (PZT alloy multilayer) as actuator is studied as function size and working middle. This one is compared with SCMCP pump actuated by PZT alloy as piez...

  9. Insulin Pump Safety Meeting: Summary Report

    Klonoff, David C; Reyes, Juliet S.

    2009-01-01

    Diabetes Technology Society convened a panel of insulin pump experts in Bethesda, Maryland, on November 12, 2008, at the request of the Food and Drug Administration. The group consisted of physicians, nurses, diabetes educators, and engineers from across the United States. The panel members (1) discussed safety features of insulin pump therapy and (2) recommended adjustments to current insulin pump design and use to enhance overall safety. Software and hardware features of insulin pumps were ...

  10. AC loss in superconducting tapes and cables

    Oomen, Marijn Pieter

    High-temperature superconductors are developed for use in power-transmission cables, transformers and motors. The alternating magnetic field in these devices causes AC loss, which is a critical factor in the design. The study focuses on multi-filament Bi-2223/Ag tapes exposed to a 50-Hz magnetic field at 77 K. The AC loss is measured with magnetic, electric and calorimetric methods. The results are compared to theoretical predictions based mainly on the Critical-State Model. The loss in high- temperature superconductors is affected by their characteristic properties: increased flux creep, high aspect ratio and inhomogeneties. Filament intergrowths and a low matrix resistivity cause a high coupling-current loss especially when the filaments are fully coupled. When the wide side of the tape is parallel to the external magnetic field, the filaments are decoupled by twisting. In a perpendicular field the filaments can be decoupled only by combining a short twist pitch with a transverse resistivity much higher than that of silver. The arrangement of the inner filaments determines the transverse resistivity. Ceramic barriers around the filaments cause partial decoupling in perpendicular magnetic fields at power frequencies. The resultant decrease in AC loss is greater than the accompanying decrease in critical current. With direct transport current in alternating magnetic field, the transport-current loss is well described with a new model for the dynamic resistance. The Critical- State Model describes well the magnetisation and total AC loss in parallel magnetic fields, at transport currents up to 0.7 times the critical current. When tapes are stacked face-to-face in a winding, the AC-loss density in perpendicular fields is greatly decreased due to the mutual shielding of the tapes. Coupling currents between the tapes in a cable cause an extra AC loss, which is reduced by a careful cable design. The total AC loss in complex devices with many tapes is generally well

  11. ACS air bearing test-bed design

    Glitt, Sascha

    2010-01-01

    This thesis is about the construction and design of a new air bearing test-bed to verify the programmed ACS attitude control algorithm and to validate the ACS MATLAB/SimuLink¬ model of NPSAT1, the second small satellite currently under development at the Naval Postgraduate School Space Systems Academic Group. The software was already verified and validated using a comparable air bearing test-bed. But due to changes in hardware from commercial magnetic torque rods to custom, NPS-built, magneti...

  12. The Effective AC Response of Nonlinear Composites

    WEI En-Bo; GU Guo-Qing

    2001-01-01

    A perturbative approach is used to study the AC response of nonlinear composite media, which obey a current-field relation of the form J = σ E + χ|E|2 E with components having nonlinear response at finite frequencies. For a sinusoidal applied field, we extend the local potential in terms of sinusoidal components at fundamental frequency and high-order harmonic frequencies to treat the nonlinear composites. For nonlinear composite media vith a low concentrations of spherical inclusions, we give the formulae of the nonlinear effective AC susceptibility χ*3ω at the third harmonic frequency.

  13. Analysis on Photovoltaic Assisted Three Phase five level Unipolar PWM Inverter for Induction Motor Driven Water Pumping System

    Ajay Kumar Maurya, Kishore Chahar, Y. K. Chauhan

    2013-01-01

    This paper presents the analysis of a photovoltaicbases three-phase five level voltage source inverter(VSI) supplying induction motor driven waterpump. The VSI uses a unipolar PWM technique forproducing three phase 5 level voltage output andthis output is used to drive three-phase inductionmotor driving a pump load. Multilevel inverters areused for generating AC voltage from several levelsof DC voltages and enhance the performance of thesystem. The proposed system is used to reduce thefilteri...

  14. Properties of Graphene Based Parametric Pump

    LUO Song-Lin; WEI Ya-Dong

    2009-01-01

    The adiabatic parametric electron pump of the infinite zigzag graphene ribbons and the infinite armchair graphene ribbons is investigated by the tight binding method. The pumping signals are added by two gates around the ribbons. It is shown that the dc current can be pumped out by cyclically varying the two gate voltages and the pumped current strongly depends on the driving frequency, the pumping amplitude and the phase difference of the gate voltages. The pumped current is mediated by the graphene energy levels and its peaks occur around the energies where transmission coefficients and density of states are large. The pump current may give one peak or two opposite peaks corresponding to each transmission peak or transmission pair peaks. The height and width of the current peaks increase with the amplitude of the pumping driving voltages. The pumped current is antisymmetric about the phase difference φ=π and for small pumping amplitude the pumped current is a sinusoidal function of the phase difference. Some graphene ribbons, although with different widths, have very similar contours of the transmission coefficients and give the same pumped current figures.

  15. 46 CFR 108.471 - Water pump.

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Water pump. 108.471 Section 108.471 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) A-MOBILE OFFSHORE DRILLING UNITS DESIGN AND EQUIPMENT Fire Extinguishing Systems Foam Extinguishing Systems § 108.471 Water pump. Each water pump in a foam...

  16. How to Use Nasal Pump Sprays

    Using Nasal Pump SpraysBlow your nose gently before using the spray. Prime the pump bottle by spraying it into the air a ... Breathe in quickly while squeezing down on the pump bottle one time. Repeat in other nostril. Do ...

  17. Problem of heat pumps in central Russia

    This article describes the problems of heat pumps due to climatic conditions and the characteristics of energy sources. As energy sources for heat pumps, solar power, air, groundwater, soil, and rejected heat are considered. It is shown that in central Russia it is only rational to use waste heat as an energy source for heat pump systems. (author)

  18. Liquid Scavenger for Separator/Pump

    Berg, P. F.

    1986-01-01

    Pump for hydrogen modified to remove moisture that condenses in impeller stage. Impeller-pump housing has circumferential groove leading to exit hole near high-pressure outlet. As impeller disk rotates, flings water droplets condensed in pump toward groove. Aerodynamic drag drives water around groove to exit hole.

  19. Technique for testing high-vacuum pump pumping-out rate

    Technique for measuring high-vacuum pump pumping-out rate using calibrated diaphragm is presented. Account of measuring chamber intrinsic gas release permits to determine pumping-out characteristics of pumps over the whole operating range of pressures, including the limiting values

  20. Off-pump versus on-pump coronary artery bypass grafting for ischaemic heart disease

    Møller, Christian H; Penninga, Luit; Wetterslev, Jørn; Steinbrüchel, Daniel A; Gluud, Christian

    2012-01-01

    Coronary artery bypass grafting (CABG) is performed both without and with cardiopulmonary bypass, referred to as off-pump and on-pump CABG respectively. However, the preferable technique is unclear.......Coronary artery bypass grafting (CABG) is performed both without and with cardiopulmonary bypass, referred to as off-pump and on-pump CABG respectively. However, the preferable technique is unclear....

  1. A simplified heat pump model for use in solar plus heat pump system simulation studies

    Perers, Bengt; Andersen, Elsa; Nordman, Roger; Kovacs, Peter

    2012-01-01

    Solar plus heat pump systems are often very complex in design, with sometimes special heat pump arrangements and control. Therefore detailed heat pump models can give very slow system simulations and still not so accurate results compared to real heat pump performance in a system. The idea here is...

  2. YBCO thin films in ac and dc films

    Shahzada, S

    2001-01-01

    We report studies on the dc magnetization of YBCO thin films in simultaneously applied dc and ac fields. The effect of the ac fields is to decrease the irreversible magnetization drastically leading to complete collapse of the hysteresis loops for relatively small ac fields (250e). The magnitude of the decrease depends on the component of the ac field parallel to the c-axis. The decrease is non-linear with ac amplitude and is explained in the framework of the critical state response of ultra thin films in perpendicular geometry. The ac fields increase the relaxation rapidly at short times while the long time response appears unaffected. (author)

  3. SINGLE PHASE HIGH FREQUENCY AC CONVERTER FOR INDUCTION HEATING APPLICATION

    M.A INAYATHULLAAH,

    2010-12-01

    Full Text Available The proposed topology reduces the total harmonic distortion (THD of a high frequency AC/AC Converter well below the acceptable limit. This paper deals with a novel single phase AC/DC/AC soft switching utility frequency AC to high frequency AC converter. In this paper a single phase full bridge inverter with Vienna rectifier as front end is used instead of conventional diode bridge rectifier to provide continuous sinusoidal input current with nearly unity power factor at the source side with extremely low distortion.. This power converter is more suitable and acceptable for cost effective high frequency (HF consumer induction heating applications.

  4. AcsA-AcsB: The core of the cellulose synthase complex from Gluconacetobacter hansenii ATCC23769.

    McManus, John B; Deng, Ying; Nagachar, Nivedita; Kao, Teh-hui; Tien, Ming

    2016-01-01

    The gram-negative bacterium, Gluconacetobacter hansenii, produces cellulose of exceptionally high crystallinity in comparison to the cellulose of higher plants. This bacterial cellulose is synthesized and extruded into the extracellular medium by the cellulose synthase complex (CSC). The catalytic component of this complex is encoded by the gene AcsAB. However, several other genes are known to encode proteins critical to cellulose synthesis and are likely components of the bacterial CSC. We have purified an active heterodimer AcsA-AcsB from G. hansenii ATCC23769 to homogeneity by two different methods. With the purified protein, we have determined how it is post-translationally processed, forming the active heterodimer AcsA-AcsB. Additionally, we have performed steady-state kinetic studies on the AcsA-AcsB complex. Finally through mutagenesis studies, we have explored the roles of the postulated CSC proteins AcsC, AcsD, and CcpAx. PMID:26672449

  5. Assessing the energy efficiency of pumps and pump units background and methodology

    Bernd Stoffel, em Dr-Ing

    2015-01-01

    Assessing the Energy Efficiency of Pumps and Pump Units, developed in cooperation with Europump, is the first book available providing the background, methodology, and assessment tools for understanding and calculating energy efficiency for pumps and extended products (pumps+motors+drives). Responding to new EU requirements for pump efficiency, and US DOE exploratory work in setting pump energy efficiency guidelines, this book provides explanation, derivation, and illustration of PA and EPA methods for assessing energy efficiency. It surveys legislation related to pump energy eff

  6. Mechanism of a high-Tc superconducting flux pump: Using alternating magnetic field to trigger flux flow

    Geng, Jianzhao; Coombs, T. A.

    2015-10-01

    High-Tc Superconducting (HTS) magnets operating in persistent current mode suffer a current decay due to flux creep of superconductor and joint resistance. Flux pumps are able to inject direct current into superconducting circuit to compensate the current decay, without the thermal loss caused by current leads. In this work, we proposed a flux pumping mechanism for HTS coils, with an experimental verification and an analytical model. The basic principle we have used is that flux flow can be triggered when the superconductor carrying a direct current is subjected to a perpendicular AC magnetic field. Low frequency alternating current is induced in a loop of YBCO tape using an AC field. A portion of the tape which we refer to as the "bridge" shorts a superconducting coil. A high frequency AC field is applied perpendicular to the bridge tape when alternating current in the tape reaches one polarity. This triggers a net flux flow and results in a current increase in the coil. The proposed flux pump has clear physics and is easily controllable, which may make it promising in practical use.

  7. Water Pump Development for the EVA PLSS

    Schuller, Michael; Kurwitz, Cable; Goldman, Jeff; Morris, Kim; Trevino, Luis

    2009-01-01

    This paper describes the effort by the Texas Engineering Experiment Station (TEES) and Honeywell for NASA to design, fabricate, and test a preflight prototype pump for use in the Extravehicular activity (EVA) portable life support subsystem (PLSS). Major design decisions were driven by the need to reduce the pump s mass, power, and volume compared to the existing PLSS pump. In addition, the pump will accommodate a much wider range of abnormal conditions than the existing pump, including vapor/gas bubbles and increased pressure drop when employed to cool two suits simultaneously. A positive displacement, external gear type pump was selected because it offers the most compact and highest efficiency solution over the required range of flow rates and pressure drops. An additional benefit of selecting a gear pump design is that it is self priming and capable of ingesting noncondensable gas without becoming "air locked." The chosen pump design consists of a 28 V DC, brushless, sealless, permanent magnet motor driven, external gear pump that utilizes a Honeywell development that eliminates the need for magnetic coupling. Although the planned flight unit will use a sensorless motor with custom designed controller, the preflight prototype to be provided for this project incorporates Hall effect sensors, allowing an interface with a readily available commercial motor controller. This design approach reduced the cost of this project and gives NASA more flexibility in future PLSS laboratory testing. The pump design was based on existing Honeywell designs, but incorporated features specifically for the PLSS application, including all of the key features of the flight pump. Testing at TEES will simulate the vacuum environment in which the flight pump will operate. Testing will verify that the pump meets design requirements for range of flow rates, pressure rise, power consumption, working fluid temperature, operating time, and restart capability. Pump testing is currently

  8. Outcome of Coronary Artery Bypass Grafts: Comparison between on Pump and off Pump

    Rasoul Ibrahim Abdulrahman; Rezayat Parvizi

    2010-01-01

    The present study was undertaken to compare the in hospital results of coronary artery bypass graft (CABG) with (on pump) or without (off pump) cardiopulmonary bypass (CPB). Data were collected on all first-time isolated CABGs with saphenous vein and/or artery grafts at Shahid Madani Hospital in Tabriz-Iran, between 2006 and 2009. Age and clinical profile were marched between on pump and off pump group patients. Patients with concomitant cardiac operations or beating pump technique were exclu...

  9. Pump Built-in Hamiltonian Method for Pump-Probe Spectroscopy

    Inoue, Jun-ichi; Shimizu, Akira

    1999-01-01

    We propose a new method of calculating nonlinear optical responses of interacting electronic systems. In this method, the total Hamiltonian (system + system-pump interaction) is transformed into a different form that (apparently) does not have a system-pump interaction. The transformed Hamiltonian, which we call the pump built-in Hamiltonian, has parameters that depend on the strength of the pump beam. Using the pump built-in Hamiltonian, we can calculate nonlinear responses (responses to pro...

  10. Adjusting Frequency of Pump Blade Angles and Optimal Operation for Large Pumping Station System

    Xiaoli Feng; Baoyun Qiu

    2013-01-01

    For pumping stations installed blade full-adjustable pumps with frequently varying head in a wide range, adjusting pump blade angles is an effective way to realize optimum operation. Optimal mathematical models were established aiming at the least daily operation cost for pumping station system, which includes main pump units, inlet and outlet passages and their accessories, forebay and outlet pond, auxiliary equipment, power transmission and transformation equipment, other electromechanical ...

  11. Pump Application as Hydraulic Turbine – Pump as Turbine (PaT)

    Rusovs, D

    2009-01-01

    The paper considers pump operation as hydraulic turbine with purpose to produce mechanical power from liquid flow. The Francis hydraulic turbine was selected for comparison with centrifugal pump in reverse operation. Turbine and centrifugal pump velocity triangles were considered with purpose to evaluate PaT efficiency. Shape of impeller blades for turbine and pumps was analysed. Specific speed calculation is carried out with purpose to obtain similarity in pump and turbine description. For ...

  12. Efficiency model of pumping low viscosity fluids

    This paper introduces the current research situation of pump efficiency, especially in pumping low viscosity fluids. Then we propose a simple and widely used efficiency model for the pump which just depends on the suction, discharge and leakage resistance coefficient. An experimental test rig is setup. After evaluating the efficiency of the pump in different conditions, it is found that the performance is quite different when pumping different medium. A phenomenon has been observed which results of the appearance of the BEP (best efficiency point), and our efficiency model can explain these testing phenomena very well

  13. Accuracy and consistency of modern elastomeric pumps.

    Weisman, Robyn S; Missair, Andres; Pham, Phung; Gutierrez, Juan F; Gebhard, Ralf E

    2014-01-01

    Continuous peripheral nerve blockade has become a popular method of achieving postoperative analgesia for many surgical procedures. The safety and reliability of infusion pumps are dependent on their flow rate accuracy and consistency. Knowledge of pump rate profiles can help physicians determine which infusion pump is best suited for their clinical applications and specific patient population. Several studies have investigated the accuracy of portable infusion pumps. Using methodology similar to that used by Ilfeld et al, we investigated the accuracy and consistency of several current elastomeric pumps. PMID:25140510

  14. Cavitation Effects in Centrifugal Pumps- A Review

    Maxime Binama

    2016-05-01

    Full Text Available Cavitation is one of the most challenging fluid flow abnormalities leading to detrimental effects on both the centrifugal pump flow behaviors and physical characteristics. Centrifugal pumps’ most low pressure zones are the first cavitation victims, where cavitation manifests itself in form of pitting on the pump internal solid walls, accompanied by noise and vibration, all leading to the pump hydraulic performance degradation. In the present article, a general description of centrifugal pump performance and related parameters is presented. Based on the literature survey, some light were shed on fundamental cavitation features; where different aspects relating to cavitation in centrifugal pumps were briefly discussed

  15. AC power generation from microbial fuel cells

    Lobo, Fernanda Leite; Wang, Heming; Forrestal, Casey; Ren, Zhiyong Jason

    2015-11-01

    Microbial fuel cells (MFCs) directly convert biodegradable substrates to electricity and carry good potential for energy-positive wastewater treatment. However, the low and direct current (DC) output from MFC is not usable for general electronics except small sensors, yet commercial DC-AC converters or inverters used in solar systems cannot be directly applied to MFCs. This study presents a new DC-AC converter system for MFCs that can generate alternating voltage in any desired frequency. Results show that AC power can be easily achieved in three different frequencies tested (1, 10, 60 Hz), and no energy storage layer such as capacitors was needed. The DC-AC converter efficiency was higher than 95% when powered by either individual MFCs or simple MFC stacks. Total harmonic distortion (THD) was used to investigate the quality of the energy, and it showed that the energy could be directly usable for linear electronic loads. This study shows that through electrical conversion MFCs can be potentially used in household electronics for decentralized off-grid communities.

  16. Performance of Halbach magnetized brushless AC motors

    Zhu, Z.Q.; Xia, Z.P.; Shi, Y.F.; Howe, D.; Pride, A.; X. J. Chen

    2003-01-01

    The steady-state performance of Halbach magnetized brushless ac machines when operated in constant torque and flux-weakening modes is investigated both theoretically and experimentally, with particular emphasis on the influence of cross-coupling magnetic saturation on the torque capability.

  17. Ac-dc converter firing error detection

    Each of the twelve Booster Main Magnet Power Supply modules consist of two three-phase, full-wave rectifier bridges in series to provide a 560 VDC maximum output. The harmonic contents of the twelve-pulse ac-dc converter output are multiples of the 60 Hz ac power input, with a predominant 720 Hz signal greater than 14 dB in magnitude above the closest harmonic components at maximum output. The 720 Hz harmonic is typically greater than 20 dB below the 500 VDC output signal under normal operation. Extracting specific harmonics from the rectifier output signal of a 6, 12, or 24 pulse ac-dc converter allows the detection of SCR firing angle errors or complete misfires. A bandpass filter provides the input signal to a frequency-to-voltage converter. Comparing the output of the frequency-to-voltage converter to a reference voltage level provides an indication of the magnitude of the harmonics in the ac-dc converter output signal

  18. AC loss in superconducting tapes and cables

    Oomen, Marijn Pieter

    2000-01-01

    The present study discusses the AC loss in high-temperature superconductors. Superconducting materials with a relatively high critical temperature were discovered in 1986. They are presently developed for use in large-scale power-engineering devices such as power-transmission cables, transformers an

  19. Experimental Study on Series Operation of Sliding Vane Pump and Centrifugal Pump

    Tao Li

    2013-01-01

    Full Text Available A platform for sliding vane pump and centrifugal pump tests is installed to study the series operation of them under different characteristics of pipeline. Firstly, the sliding vane pump and the centrifugal pump work independently, and the performance is recorded. Then, the two types of pumps are combined together, with the sliding vane pump acting as the feeding pump. Comparison is made between the performance of the independently working pump and the performance of series operation pump. Results show that the system flow rate is determined by the sliding vane pump. In order to ensure the stability of the series operation pumping system, the energy consumption required by the pipeline under the system flow should be greater than the pressure energy centrifugal pump can generate. Otherwise, the centrifugal pump can not operate stably, with reflux, swirl, gas-liquid two-phase flow in the runner and strong vibration and noise. The sliding vane pump can be in serial operation with the centrifugal pump under limited conditions.

  20. [Temporary use of centrifugal pump for pump thrombosis in patients with paracorporeal ventricular assist device].

    Kimura, Mitsutoshi; Kinoshita, Osamu; Nawata, Kan; Yamauchi, Haruo; Itoda, Yoshifumi; Hoshino, Yasuhiro; Kashiwa, Koichi; Kubo, Hitoshi; Kurosawa, Hideo; Takahashi, Mai; Koga, Sayaka; Ono, Minoru

    2015-05-01

    Nipro paracorporeal ventricular assist device( VAD) is often associated with pump thrombosis which causes severe complications such as brain infarction, often requiring pump change. However, Nipro VAD pump is an expensive device and it is difficult to change pumps frequently at a short interval. We have temporarily used Rotaflow centrifugal pump for recurrent pump thrombosis in patients with Nipro VADs. From January 2012 through December 2013, 19 patients underwent Nipro VADs implantation at our institution, and 9 of them underwent pump change from Nipro pumps to Rotaflow centrifugal pumps. A total of 25 Rotaflow centrifugal pumps were used in these 9 patients, with the total circulatory support duration of 526 days. The median support period was 15 days (range;2-128 days). There were 2 cerebrovascular accidents and 1 Rotaflow pump circuit thrombosis during this period. Change from Rotaflow to Nipro VAD pump resulted in decrease in hematocrit by about 3 point. There was no difference in liver or renal function between before and after the pump change. Our results suggest that temporary use of Rotaflow centrifugal pump for recurrent pump thrombosis in patients with Nipro VADs may be a promising alternative. PMID:25963778

  1. Automatic swirl angle measurements for pump intake design

    Fockert, A. de; Westende, J.M.C. van 't; Verhaart, F.I.H.

    2014-01-01

    Pre-swirl occurring in pump intake basins influences pump efficiency and lifetime. The exact effect on a pump depends on the pump design. In order to optimize the approach flow towards the pump, physical scale modelling is often applied following the guidelines formulated in pump intake design stand

  2. Pumping the stellar hydroxyl maser

    Dickinson, Dale F.

    1987-01-01

    IRAS far-IR flux data for 163 OH maser stars were analyzed to quantify the contributions 35 and 53 microns inversions make to pumping of the hydroxyl maser. The 35 microns transition is from the 3,3 ground state to the 1,5 rotationally excited level and subsequent decay; the 53 microns transition is a change from the ground state to the 1,3 excited level and relaxation. The stars examined included Mira, short period semi-regular and long-period semi-regular variables. Both transition lines had rough parity in contributing to the approximately 8 percent pumping efficiency at 1612 MHz. However, the individual contributions of the lines could not be determined for the stellar population studied.

  3. Screw-fed pump system

    Sprouse, Kenneth M

    2014-11-25

    A pump system includes a pump that includes a first belt and a second belt that are spaced apart from each other to provide generally straight sides of a passage there between. There is an inlet at one end of the passage and an outlet at an opposite end of the passage, with a passage length that extends between the inlet and the outlet. The passage defines a gap distance in a width direction between the straight sides at the passage inlet. A hopper includes an interior space that terminates at a mouth at the passage inlet. At least one screw is located within the interior space of the hopper and includes a screw diameter in the width direction that is less than or equal to the gap distance.

  4. Fluid Dynamics in Sucker Rod Pumps

    Cutler, Robert P.; Mansure, Arthur J.

    1999-06-01

    Sucker rod pumps are installed in approximately 90% of all oil wells in the U.S. Although they have been widely used for decades, there are many issues regarding the fluid dynamics of the pump that have not been filly investigated. A project was conducted at Sandia National Laboratories to develop an improved understanding of the fluid dynamics inside a sucker rod pump. A mathematical flow model was developed to predict pressures in any pump component or an entire pump under single-phase fluid and pumping conditions. Laboratory flow tests were conducted on instrumented individual pump components and on a complete pump to verifi and refine the model. The mathematical model was then converted to a Visual Basic program to allow easy input of fluid, geometry and pump parameters and to generate output plots. Examples of issues affecting pump performance investigated with the model include the effects of viscosity, surface roughness, valve design details, plunger and valve pressure differentials, and pumping rate.

  5. Experiment on performance of adjustable jet pump

    When the water level of upper or lower reaches of hydraulic power station changes, the adjustable jet pump which is different from traditional fixed jet pump can maintain stable pressure and flow rate for the system of technical water supply of hydraulic power plant. The model test indicates that the efficiency of the adjustable jet pump is slightly lower than fixed jet pump near rating operation point. With the decrease of opening degree, both efficiencies are more and more close to each other. The fundamental performance of I-type adjustable jet pump is better than II-type and the cavitation performance of I-type adjustable jet pump is worse than II-type. Test data also indicate that the performance of adjustable jet pump is very different from fixed jet pump, so the theory of fixed jet pump is not able to be copied to adjustable jet pump. It is necessary to farther study on the performance of the adjustable jet pump. This paper has reference value for analogous design of system of circulation water supply to turbine units in hydraulic power station.

  6. Experiment on performance of adjustable jet pump

    Zhu, J. M.; Long, X. P.; Zhang, S. B.; Lu, X.

    2012-11-01

    When the water level of upper or lower reaches of hydraulic power station changes, the adjustable jet pump which is different from traditional fixed jet pump can maintain stable pressure and flow rate for the system of technical water supply of hydraulic power plant. The model test indicates that the efficiency of the adjustable jet pump is slightly lower than fixed jet pump near rating operation point. With the decrease of opening degree, both efficiencies are more and more close to each other. The fundamental performance of I-type adjustable jet pump is better than II-type and the cavitation performance of I-type adjustable jet pump is worse than II-type. Test data also indicate that the performance of adjustable jet pump is very different from fixed jet pump, so the theory of fixed jet pump is not able to be copied to adjustable jet pump. It is necessary to farther study on the performance of the adjustable jet pump. This paper has reference value for analogous design of system of circulation water supply to turbine units in hydraulic power station.

  7. Particles pumping in Tore Supra

    TORE SUPRA and its peripheral equipments are provided with routine clean high vacuum by turbomolecular pumping. During plasma discharges large quantity of very hot gases activating at plasma edge and plasma density in scrape off layer has to be controlled before they strike violently solid wall provoking increase in impurities content and make density up to disruptive level. A Magnetic Ergodic Divertor made of six winding structures - MED - six Vertical Pumped Limiters - VPL - and one Horizontal Pumped Limiter - HPL - are set in the vacuum chamber in order to cope with plasma-wall interactions and neutral gas recycling. Each apparatus is equipped at front side with thermal shield respectively made of polycristallin and pyrolitic graphite bolted on stainless steel support for MED and HPL whereas for VPL it is made of CFC Aerolor 05 brazed on hardened copper. The total heat removal capacity of these plasma facing components is 12 MW. Design of particles collection openings and ducts conductance allow 10% of capture efficiency, that means for TORE SUPRA a flux of 3 x 1021 particles/second has to be sorbed by water cooled titanium getter pumps, settled at rear side. All those facilities were put into plasma operation at the beginning of 1989 for a short time. Preliminary observations go along with theoretical predictions, that actions in scrappe-off layer may provoke effects in bulk plasma. Very first results drawn out, show that particle collection and heat removal were effective by MED, VPL and HPL and that plasma behaviour was not disturbed by their presence and actions but instead tendency to improvement was observed

  8. Self-pumping impurity control

    Brooks, J.N.; Mattas, R.F.

    1983-12-21

    It is an object of the present invention to provide an apparatus for removing impurities from the plasma in a fusion reactor without an external vacuum pumping system. It is also an object of the present invention to provide an apparatus for removing the helium ash from a fusion reactor. It is another object of the present invention to provide an apparatus which removes helium ash and minimizes tritium recycling and inventory.

  9. Fluid pumped by magnetic stress

    Krauss, R; Reimann, B; Richter, R; Rehberg, I; Krauss, Robert; Liu, Mario; Reimann, Bert; Richter, Reinhard; Rehberg, Ingo

    2004-01-01

    A magnetic field rotating on the free surface of a ferrofluid layer is shown to induce considerable fluid motion towards the direction the field is rolling. The measured flow velocity i) increases with the square of the magnetic field amplitude, ii) is proportional to the thickness of the fluid layer, and iii) has a maximum at a driving frequency of about 3 kHz. The pumping speed can be estimated with a two-dimensional flow model.

  10. Thermoelectric electromagnetic pump design for SP-100

    This paper describes the design of the Thermoelectric Electromagnetic (TEM) pump used in the SP-100 space power system. The TEM pump is designed to pump liquid (molten) lithium (Li) coolant in the Primary Heat Transport Subsystem (PHTS) and Heat Rejection Subsystem (HRSS). The pump utilizes advanced Thermoelectric (TE) cells to generate electric current that induces magnetic flux in a Z-shaped magnetic structure. The electric current and magnetic flux pass through the liquid Li perpendicular to each other to create the pumping force. The TE cells are semiconductors located between rectangular ducts connected to the reactor hot PHTS piping and the cooler HRSS piping. The temperature difference (ΔT) across the TE cells generates the voltage to power the pump. The design provides a minimum mass, self-regulated pump, with no moving parts and self-powered by an internal temperature gradient

  11. Pumped limiter results on TFR Tokamak plasma

    Pump limiter experiments are carried out in the TFR Tokamak. The pump limiter is located in the outer part of the torus, its double- throat head is made of graphite tiles and it is pumped by a 2000 ls-1 titanium sublimation pump. The first attempts showed that the exhaust efficiency of this pump limiter was low (ε = 1.5% of the total plasma particle efflux). To improve these results, a new limiter head with a single longer throat has been built; particles were better trapped and the pumping provided an important decrease of the recycling coefficient. Geometric features mainly explain the increase by a factor 3.5 of the exhaust efficiency (ε = 5.5%). Ion temperature of the order of a few eV has been deduced from Doppler broadening measurements at the neutralizer plate of the pump limiter

  12. Topological Thouless pumping of ultracold fermions

    Nakajima, Shuta; Tomita, Takafumi; Taie, Shintaro; Ichinose, Tomohiro; Ozawa, Hideki; Wang, Lei; Troyer, Matthias; Takahashi, Yoshiro

    2016-04-01

    An electron gas in a one-dimensional periodic potential can be transported even in the absence of a voltage bias if the potential is slowly and periodically modulated in time. Remarkably, the transferred charge per cycle is sensitive only to the topology of the path in parameter space. Although this so-called Thouless charge pump was first proposed more than thirty years ago, it has not yet been realized. Here we report the demonstration of topological Thouless pumping using ultracold fermionic atoms in a dynamically controlled optical superlattice. We observe a shift of the atomic cloud as a result of pumping, and extract the topological invariance of the pumping process from this shift. We demonstrate the topological nature of the Thouless pump by varying the topology of the pumping path and verify that the topological pump indeed works in the quantum regime by varying the speed and temperature.

  13. Small centrifugal pumps for low thrust rockets

    Gulbrandsen, N. C.; Furst, R. B.; Burgess, R. M.; Scheer, D. D.

    1985-01-01

    This paper presents the results of a combined analytical and experimental investigation of low specific speed pumps for potential use as components of propellant feed systems for low thrust rocket engines. Shrouded impellers and open face impellers were tested in volute type and vaned diffuser type pumps. Full- and partial-emission diffusers and full- and partial-admission impellers were tested. Axial and radial loads, head and efficiency versus flow, and cavitation tests were conducted. Predicted performance of two pumps are compared when pumping water and liquid hydrogen. Detailed pressure loss and parasitic power values are presented for two pump configurations. Partial-emission diffusers were found to permit use of larger impeller and diffuser passages with a minimal performance penalty. Normal manufacturing tolerances were found to result in substantial power requirement variation with only a small pressure rise change. Impeller wear ring leakage was found to reduce pump pressure rise to an increasing degree as the pump flowrate was decreased.

  14. Large sodium pump coastdown during an earthquake

    Analyses were performed to determine the responses of the main rotary element of a large sodium pump during the simultaneous occurrence of pump coastdown and a seismic event. Analytical procedures are described which enabled reduction of a multi-degree of freedom finite element model of the pump to a representative nonlinear single degree of freedom system with retention of acceptable computational accuracy. Pump rotor bearing impact forces and stresses, and the bearing rub forces which act throughout the pump coastdown were determined. Bearing material wear depth was calculated and an assessment was made of the effect of rub forces and the associated retarding torque on the shortening of pump coastdown time. Pump coastdown time can be very significantly shortened as a result of loss of rotor bearing stiffness and rubbing at the lower rotor speeds

  15. Digital model for harmonic interactions in AC/DC/AC systems

    Guarini, A.P.; Rangel, R.D.; Pilotto, L.A.S.; Pinto, R.J.; Passos Junior, R. [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)

    1994-12-31

    The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.

  16. A Comparison Between Two Average Modelling Techniques of AC-AC Power Converters

    Pawel Szczesniak

    2015-03-01

    Full Text Available In this paper, a comparative evaluation of two modelling tools for switching AC-AC power converters is presented. Both of them are based on average modelling techniques. The first approach is based on the circuit averaging technique and consists in the topological manipulations, applied to a converters states. The second approach makes use of state-space averaged model of the converter and is based on analytical manipulations using the different state representations of a converter. The two modelling techniques are applied to a same AC-AC converter called matrix-reactance frequency converter based on buck-boost topology. These techniques are compared on the basis of their rapidity, quantity of calculations and transformations and its limitations.

  17. High voltage AC/AC electrochemical capacitor operating at low temperature in salt aqueous electrolyte

    Abbas, Qamar; Béguin, François

    2016-06-01

    We demonstrate that an activated carbon (AC)-based electrochemical capacitor implementing aqueous lithium sulfate electrolyte in 7:3 vol:vol water/methanol mixture can operate down to -40 °C with good electrochemical performance. Three-electrode cell investigations show that the faradaic contributions related with hydrogen chemisorption in the negative AC electrode are thermodynamically unfavored at -40 °C, enabling the system to work as a typical electrical double-layer (EDL) capacitor. After prolonged floating of the AC/AC capacitor at 1.6 V and -40°C, the capacitance, equivalent series resistance and efficiency remain constant, demonstrating the absence of ageing related with side redox reactions at this temperature. Interestingly, when temperature is increased back to 24 °C, the redox behavior due to hydrogen storage reappears and the system behaves as a freshly prepared one.

  18. Rapid cycling synchrotron magnet with separate ac and dc circuit

    In present rapid cycling synchrotron magnets ac and dc currents flow in the same coil to give the desired field. The circuit reactance is made zero at dc and the operating frequency by running the magnet in series with an external parallel resonant LC current. We propose to return the ac flux in a gap next to the synchrotron. The dc coil encloses the ac magnetic circuit and thus links no ac flux. A shorted turn between the dc coil and ac flux enhances the separation of the two circuits. Several interesting developments are possible. The dc coil could be a stable superconductor to save power. The ac flux return gap could be identical with the synchrotron gap and contain a second synchrotron. This would double the output of the system. If the return flux gap were used for a booster, the ac coil power could be greatly reduced or radiation hardening of the ac coil could be simplified

  19. Charge-pump voltage converter

    Brainard, John P.; Christenson, Todd R.

    2009-11-03

    A charge-pump voltage converter for converting a low voltage provided by a low-voltage source to a higher voltage. Charge is inductively generated on a transfer rotor electrode during its transit past an inductor stator electrode and subsequently transferred by the rotating rotor to a collector stator electrode for storage or use. Repetition of the charge transfer process leads to a build-up of voltage on a charge-receiving device. Connection of multiple charge-pump voltage converters in series can generate higher voltages, and connection of multiple charge-pump voltage converters in parallel can generate higher currents. Microelectromechanical (MEMS) embodiments of this invention provide a small and compact high-voltage (several hundred V) voltage source starting with a few-V initial voltage source. The microscale size of many embodiments of this invention make it ideally suited for MEMS- and other micro-applications where integration of the voltage or charge source in a small package is highly desirable.

  20. DC voltage profile of a 1D pumped wire with two dynamical and one static impurities

    In this work we study the behavior of the voltage profile of a 1D quantum wire with an impurity when transport is induced by two ac voltages that oscillating with a phase lag define a quantum pump. The voltage profile sensed along the wire by the voltage probe, that we assume weakly coupled to the system, exhibits a Friedel's oscillations structure inside the region delimited by the position of the two ac voltages that induce transport. On the other hand, outside this region the oscillations are suppressed. Using perturbation theory in the coupling constant of the voltage probe we derived analytical expressions for the DC current valid for the adiabatic regime. We also compare our analytical results with the exact numerical calculations using Keldysh non-equilibrium Green's functions formalism.

  1. Design of Three Phase Matrix Converter AC-AC Utility Power Supply using SPWM Technique

    Sagar.S.Pawar; Prakash.T.Patil

    2015-01-01

    This paper describes the control analysis and design of an three phase matrix AC-AC utility power supply .The SPWM modulation techniques is used to control the desired output voltage and gives the control output voltage and reduced input harmonic distortions .In this Matrix converter Input is directly connected to output no DC link components is required. Simulation had been done using mat lab simulink and Simulated results are observed

  2. Design of Three Phase Matrix Converter AC-AC Utility Power Supply using SPWM Technique

    Sagar. S. Pawar

    2015-04-01

    Full Text Available This paper describes the control analysis and design of an three phase matrix AC-AC utility power supply .The SPWM modulation techniques is used to control the desired output voltage and gives the control output voltage and reduced input harmonic distortions .In this Matrix converter Input is directly connected to output no DC link components is required. Simulation had been done using mat lab simulink and Simulated results are observed

  3. A Comparison Between Two Average Modelling Techniques of AC-AC Power Converters

    Pawel Szczesniak

    2015-01-01

    In this paper, a comparative evaluation of two modelling tools for switching AC-AC power converters is presented. Both of them are based on average modelling techniques. The first approach is based on the circuit averaging technique and consists in the topological manipulations, applied to a converters states. The second approach makes use of state-space averaged model of the converter and is based on analytical manipulations using the different state representations of a converter. The two m...

  4. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    Ljusev, P.; Andersen, Michael A.E.

    2005-07-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration. (au)

  5. Implementation of Low Frequency Ac to High Frequency Ac with Single Stage Zvs-Pwm Inverter

    S. Arumugam S. Ramareddy M. Sridhar

    2011-01-01

    This paper presents a novel soft-switching pulse width modulation (PWM) utility frequency AC to high frequency (HF) AC power conversion circuit incorporating boost-active clamp single stage inverter topology. This power converter is more suitable and acceptable for cost effective HF consumer induction heating applications. Its operating principle is presented. The operating performances of this high frequency inverter using the latest insulated gate bipolar transistors are illustrated, which ...

  6. Adaptive Nonlinear Control of Induction Motors through AC/DC/AC Converters

    Elfadili, Abderrahim; Giri, Fouad; El Magri, Abdelmounime; Dugard, Luc; Chaoui, Fatima Zara

    2012-01-01

    The problem of controlling induction motors, together with associated AC/DC rectifiers and DC/AC inverters, is addressed. The control objectives are threefold: (i) the motor speed should track any reference signal despite mechanical parameter uncertainties and variations; (ii) the DC Link voltage must be tightly regulated; (iii) the power factor correction (PFC) w.r.t. the power supply net must be performed in a satisfactory way. First, a nonlinear model of the whole controlled system is deve...

  7. Robust control of synchronous motors through AC/DC/AC converters

    El Magri, Abdelmounime; Giri, Fouad; Abouloifa, Abdelmajid; Chaoui, Fatima Zara

    2010-01-01

    The problem of controlling synchronous motors, driven through AC/DC rectifiers and DC/AC inverters is addressed. The control objectives are three fold: (i) forcing the motor speed to track a varying reference signal in presence of motor parameter uncertainties;(ii) regulating the DC Link voltage; (iii )assuring a satisfactory power factor correction (PFC) with respect to the power supply net .First, a nonlinear model of the whole controlled system is developed in the Park-coordinates. Then, a...

  8. A new class of hybrid AC/AC direct power converters

    Klumpner, Christian; Wijekoon, Thiwanka; Wheeler, Patrick

    2005-01-01

    Variable voltage and variable frequency conversion of electrical energy from an AC source to an AC load is done in traditional power converters via a DC-link where an energy storage element (electrolytic capacitors) is situated. Despite its well-known benefits, it has the disadvantage of being bulky and to limit the converter lifetime. On the other hand, Direct Power Conversion (DPC) is an attractive concept, which doesn’t need an energy storage buffer, but has two main disadvantages: reduced...

  9. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...... will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration....

  10. AC losses in a HTS coil carrying DC current in AC external magnetic field

    We electrically measured AC losses in a Bi2223/Ag-sheathed pancake coil excited by a DC current in AC external magnetic field. Losses in the coil contain two kinds of loss components that are the magnetization losses and dynamic resistance losses. In the measurement, current leads to supply a current to the coil were specially arranged to suppress electromagnetic coupling between the coil current and the AC external magnetic field. A double pick-up coils method was used to suppress a large inductive voltage component contained in voltage signal for measuring the magnetization losses. It was observed that the magnetization losses were dependent on the coil current and that a peak of a curve of the loss factor vs. amplitude of the AC external magnetic field shifted to lower amplitude of the AC magnetic field as the coil current increased. This result suggests the full penetration magnetic field of the coil tape decreases as the coil current increases. The dynamic resistance losses were measured by measuring a DC voltage appearing between the coil terminals. It was observed that the DC voltage appearing in the coil subject to the AC external magnetic field was much larger than that in the coil subject to DC magnetic field

  11. 21 CFR 880.5500 - AC-powered patient lift.

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered patient lift. 880.5500 Section 880.5500... Devices § 880.5500 AC-powered patient lift. (a) Identification. An AC-powered lift is an electrically powered device either fixed or mobile, used to lift and transport patients in the horizontal or...

  12. Damages on pumps and systems the handbook for the operation of centrifugal pumps

    Merkle, Thomas

    2014-01-01

    Damage on Pumps and Systems. The Handbook for the Operation of Centrifugal Pumps offers a combination of the theoretical basics and practical experience for the operation of circulation pumps in the engineering industry. Centrifugal pumps and systems are extremely vulnerable to damage from a variety of causes, but the resulting breakdown can be prevented by ensuring that these pumps and systems are operated properly. This book provides a total overview of operating centrifugal pumps, including condition monitoring, preventive maintenance, life cycle costs, energy savings and economic aspects. Extra emphasis is given to the potential damage to these pumps and systems, and what can be done to prevent breakdown. Addresses specific issues about pumping of metal chips, sand, abrasive dust and other solids in fluidsEmphasis on economic and efficiency aspects of predictive maintenance and condition monitoring Uses life cycle costs (LCC) to evaluate and calculate the costs of pumping systems

  13. AC LED的研究现状与发展%Current research and development of AC LED

    满瑞; 李秋俊

    2012-01-01

    介绍了AC LED的特征及其工作原理,分析了AC LED相比于DC LED的优缺点,概述了AC LED在国内外的研究进展及其应用现状,讨论了AC LED技术发展过程中面临的挑战,并展望了其发展趋势.%The characteristics and operation principles of AC LED were presented.The advantages and disadvantages of AC LED compared with the DC LED were analyzed.The development and the latest application of AC LED were described.The challenges of the competition with the traditional light source were discussed,as well as the development trend of AC LED.

  14. Experiments on pumping of liquids using arrays of microelectrodes subjected to travelling wave potentials

    Garcia-Sanchez, P; Ramos, A [Dpto. de Electronica y Electromagnetismo, Universidad de Sevilla, 41012 Sevilla (Spain); Green, Nicolas G; Morgan, H [School of Electronics and Computer Science, University of Southampton, SO17 1BJ Southampton (United Kingdom)], E-mail: pablogarcia@us.es

    2008-12-01

    Net fluid flow of electrolytes driven on an array of microelectrodes subjected to a travelling-wave potential is presented. Two sizes of platinum microelectrodes have been studied. In both arrays, at low voltages the liquid flows according to the prediction given by ac electroosmotic theory. At voltages above a threshold the fluid flow is reversed. Measurements of the electrical current when the microelectrode array is pumping the liquid are also reported. Transient behaviours in both electrical current and fluid velocity have been observed.

  15. Experiments on pumping of liquids using arrays of microelectrodes subjected to travelling wave potentials

    Net fluid flow of electrolytes driven on an array of microelectrodes subjected to a travelling-wave potential is presented. Two sizes of platinum microelectrodes have been studied. In both arrays, at low voltages the liquid flows according to the prediction given by ac electroosmotic theory. At voltages above a threshold the fluid flow is reversed. Measurements of the electrical current when the microelectrode array is pumping the liquid are also reported. Transient behaviours in both electrical current and fluid velocity have been observed.

  16. The feasibility of gas turbines for alternate AC power at nuclear power plants. Final report, January 1989

    This paper reports on an effort by EPRI and Solar Turbines of San Diego, CA. to investigate the feasibility of using gas turbine generators as sources of 'Alternate AC Power' at Nuclear Power Plants. EPRI's initial intent was to evaluate the gas turbine as a possible source of class IE emergency on-site power. However, several factors emerged that caused the intended application to be changed from class IE emergency power, to the new class of on-site power (Alternate AC) that was created as part of the industry's and NRC's resolution of the Station Blackout issue. These factors were: 1) Achieving the start time required for class IE service could require costly gas turbine design enhancements, and 2) The gas turbine appears ideally suited to the new alternate AC power concept. For Alternate AC a commercially available gas turbine generator can be specified and the required 10 minute start time is easily within a gas turbine's capability. It was shown that the gas turbine can start even the largest electric motor driven safety related pumps with ease. (author)

  17. On-chip high-voltage generator design design methodology for charge pumps

    Tanzawa, Toru

    2016-01-01

    This book provides various design techniques for switched-capacitor on-chip high-voltage generators, including charge pump circuits, regulators, level shifters, references, and oscillators.  Readers will see these techniques applied to system design in order to address the challenge of how the on-chip high-voltage generator is designed for Flash memories, LCD drivers, and other semiconductor devices to optimize the entire circuit area and power efficiency with a low voltage supply, while minimizing the cost.  This new edition includes a variety of useful updates, including coverage of power efficiency and comprehensive optimization methodologies for DC-DC voltage multipliers, modeling of extremely low voltage Dickson charge pumps, and modeling and optimum design of AC-DC switched-capacitor multipliers for energy harvesting and power transfer for RFID.

  18. Dicty_cDB: FCL-AC08 [Dicty_cDB

    Full Text Available FCL (Link to library) FCL-AC08 (Link to dictyBase) - - - Contig-U15080-1 FCL-AC08P ...(Link to Original site) FCL-AC08F 616 FCL-AC08Z 291 FCL-AC08P 907 - - Show FCL-AC08 Library FCL (Link to library) Clone ID FCL-...-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-AC08Q....Seq.d/ Representative seq. ID FCL-AC08P (Link to Original site) Representative DNA sequence >FCL-AC08 (FCL-AC08Q) /CSM/FCL/FCL-...ignificant alignments: (bits) Value FCL-AC08 (FCL-AC08Q) /CSM/FCL/FCL-AC/FCL-AC08Q.Seq.d/ 1322 0.0 SFA226 (S

  19. Power converter with maximum power point tracking MPPT for small wind-electric pumping systems

    Highlights: • We implement a wind electric pumping system of small power. • The power converter allowed to change the operating point of the electro pump. • Two control techniques were implemented in the power converter. • The control V/f variable allowed to increase the power generated by the permanent magnet generator. - Abstract: In this work, an AC–DC–AC direct-drive power converter was implemented for a wind electric pumping system consisting of a permanent magnet generator (PMG) of 1.3 kW and a peripheral single phase pump of 0.74 kW. In addition, the inverter linear V/f control scheme and the maximum power point tracking (MPPT) algorithm with variable V/f were developed. MPPT algorithm seeks to extract water in a wide range of power input using the maximum amount of wind power available. Experimental trials at different pump pressures were conducted. With a MPPT tracking system with variable V/f, a power value of 1.3 kW was obtained at a speed of 350 rpm and a maximum operating hydraulic head of 50 m. At lower operating heads pressures (between 10 and 40 m), variable V/f control increases the power generated by the PMG compared to the linear V/f control. This increase ranged between 4% and 23% depending on the operating pressure, with an average of 13%, getting close to the maximum electrical power curve of the PMG. The pump was driven at variable frequency reaching a minimum speed of 0.5 times the rated speed. Efficiency of the power converter ranges between 70% and 95% with a power factor between 0.4 and 0.85, depending on the operating pressure

  20. An experimental study on pump clogging

    For sewage pump that various foreign substance is flowed into, anti-clogging performance is a factor as important as pump efficiency in order to avoid clogging trouble by foreign substance. Many investigations about pump inner flow and pump efficiency estimation have been carried out conventionally in order to realize coexistence with anti-clogging performance and pump performance. And these results have been reflected in construction of the running water section design method. As a index of anti-clogging performance, ''impeller passage diameter'' which is diameter of spherical solid that can pass through the pump is used widely. And there are various type of the sewage pump which have large impeller passage diameter. However real cause of clog is not a solid, and it is fibrous material such as towel and clothes, vinyl and paper diaper. In most case these material accumulate in the pump, so that clog is occurred. In this study, for the purpose of quantification of anti-clogging performance against fibrous materials, the factor that affect to clogging of pump was investigated by pump model test using a string. The test is done based on Taguchi method. In this test, type of the pump model, diameter of the string, material of the string, length of the string and flow rate are selected for the factor, and the effect that they have on the clogging of the pump was investigated. As a result of this test, it was made clear that length of the string has a strong influence on the clogging of the pump. And from the result of this test, evaluation method of anti-clogging performance of the pump against fibrous material by using string was considered. According to the result of above test based on Taguchi method, it was assumed that quantification of anti-clogging performance against fibrous materials is possible by flowing plural strings into the pump and calculating the probability of passing. Plurality sewage pumps of different types were evaluated based

  1. Fractional ac Josephson effect in unconventional superconductors

    For certain orientations of Josephson junctions between two px-wave or two d-wave superconductors, the subgap Andreev bound states produce a 4π-periodic relation between the Josephson current I and the phase difference ψ: I propor to sin(ψ/2) . Consequently, the ac Josephson current has the fractional frequency eV/h where V is the dc voltage. In the tunneling limit, the Josephson current is proportional to the first power (not square) of the electron tunneling amplitude. Thus, the Josephson current between unconventional superconductors is carried by single electrons, rather than by Cooper pairs. The fractional ac Josephson effect can be observed experimentally by measuring frequency spectrum of microwave radiation from the junction

  2. AC motor drive system for electric cars

    Morohoshi, Yukinobu; Yoshinori, Naoto; Naito, Hironobu (Fuji Electric Co., Ltd., Tokyo, (Japan))

    1989-08-10

    Various main circuit equipment with large capacity GTO thyristors are outlined for AC and DC electric cars. The configuration of a PWM converter system is presented for the AC main motor drive system of the Shinkansen trains, and its following features are described: the high power factor control capable of keeping a power factor 100% constantly, energy saving by power regenerative braking, the small triple structure with large capacity reverse-conducting GTO thyristors of 4,500V/3,000A, and the reduction of equivalent interfering current and harmonic current by three phase-triple phase difference operation. Furthermore, a control logic equipment with 16 bit MPU and a main transformer are outlined, and the verification test results of the control logic equipment by an analog model simulation and the combinational test results of the commercial equipment are reported. Prototype VVVF inverter system for DC electric cars is also presented. 6 refs., 13 figs., 3 tabs.

  3. β-delayed fission from 230Ac

    ThO2 is irradiated with 60 MeV/u 18O beams. 230Ra is produced via the multi-nucleon transfer and dissipative fragmentation reactions of the target. 230Ra is radio-chemical separated from ThO2 and the other reaction products. The thin Ra sources are prepared. The mica fission track detectors are exposed to the Ra sources. γ-rays of Ra decay in the sources are measured by a HPGe detector. The mica foil is etched in HF solution. The etched mica foil is scanned with an optical microscope. The fission tracks that should come from β-delayed fission of 230Ac are observed. The β-delayed fission probability of 230Ac is determined to be (1.19 +- 0.85) x 10-8

  4. Submersible canned motor transfer pump

    A transfer pump is described which is used in a waste tank for transferring high-level radioactive liquid waste from a waste tank and having a column assembly, a canned electric motor means, and an impeller assembly with an upper impeller and a lower impeller connected to a shaft of a rotor assembly. The column assembly locates a motor housing with the electric motor means adjacent to the impeller assembly which creates an hydraulic head, and which forces the liquid waste, into the motor housing to cool the electric motor means and to cool and/or lubricate the radial and thrust bearing assemblies. Hard-on-hard bearing surfaces of the bearing assemblies and a ring assembly between the upper impeller and electric motor means grind large particles in the liquid waste flow. Slots in the static bearing member of the radial bearing assemblies further grind down the solid waste particles so that only particles smaller than the clearances in the system can pass there through, thereby resisting damage to and the interruption of the operation of the transfer pump. The column assembly is modular so that sections can be easily assembled, disassembled and/or removed. A second embodiment employs a stator jacket which provides an alternate means for cooling the electric motor means and lubricating and/or cooling the bearing assemblies, and a third embodiment employs a variable level suction device which allows liquid waste to be drawn into the transfer pump from varying and discrete levels in the waste tank. 17 figs

  5. AC Dielectrophoresis Using Elliptic Electrode Geometry

    S. M. Rezaul Hasan; Aanan Khurma

    2011-01-01

    This paper presents negative AC dielectrophoretic investigations using elliptic electrode geometry. Simulations of the electric field gradient variation using various ratios of the semimajor and the semiminor axis were carried out to determine the optimum elliptic geometry for the dielectrophoretic electrokinetics of specimen in an assay with laminar (low Reynolds number) fluid flow. Experimental setup of the elliptic electrode assembly using PCB fabrication and electrokinetic accumulation of...

  6. Lazy AC-Pattern Matching for Rewriting

    Belkhir, Walid; 10.4204/EPTCS.82.3

    2012-01-01

    We define a lazy pattern-matching mechanism modulo associativity and commutativity. The solutions of a pattern-matching problem are stored in a lazy list composed of a first substitution at the head and a non-evaluated object that encodes the remaining computations. We integrate the lazy AC-matching in a strategy language: rewriting rule and strategy application produce a lazy list of terms.

  7. Entropy production in ac-calorimetry

    Garden, Jean-Luc; Richard, Jacques

    2007-01-01

    In calorimetry and particularly in heat capacity measurements, different characteristic relaxation time constants may perturb the experiment which cannot be considered at thermodynamic equilibrium. In this case, thermodynamics of irreversible processes has to be taken into account and the calorimetric measurements must be considered as dynamic. In a temperature modulated experiment, such as ac-calorimetry, these non-equilibrium experiments give rise to the notion of frequency dependent comple...

  8. Sideload vanes for fluid pump

    Erler, Scott R. (Inventor); Dills, Michael H. (Inventor); Rodriguez, Jose L. (Inventor); Tepool, John Eric (Inventor)

    2010-01-01

    A fluid pump assembly includes a rotatable component that can be rotated about an axis and a static vane assembly located adjacent to the rotatable component. The static vane assembly includes a circumferential surface axially spaced from the rotatable component, and one or more vanes extending from the circumferential surface toward the rotatable component. The one or more vanes are configured to produce a radial load on the rotatable component when the rotatable component is rotating about the axis and a fluid is present between the static vane assembly and the rotatable component.

  9. Walking beam pumping unit system efficiency measurements

    The cost of electricity used by walking beam pumping units is a major expense in producing crude oil. However, only very limited information is available on the efficiency of beam pumping systems and less is known about the efficiency of the various components of the pumping units. This paper presents and discusses measurements that have been made on wells at several Shell locations and on a specially designed walking beam pump test stand at Lufkin Industries. These measurements were made in order to determine the overall system efficiency and efficiency of individual components. The results of this work show that the overall beam pumping system efficiency is normally between 48 and 58 percent. This is primarily dependent on the motor size, motor type, gearbox size, system's age, production, pump size, tubing size, and rod sizes

  10. Compact, Lightweight Electromagnetic Pump for Liquid Metal

    Godfroy, Thomas; Palzin, Kurt

    2010-01-01

    A proposed direct-current electromagnetic pump for circulating a molten alkali metal alloy would be smaller and lighter and would demand less input power, relative to currently available pumps of this type. (Molten alkali metals are used as heat-transfer fluids in high-temperature stages of some nuclear reactors.) The principle of operation of this or any such pump involves exploitation of the electrical conductivity of the molten metal: An electric current is made to pass through the liquid metal along an axis perpendicular to the longitudinal axis of the flow channel, and a magnetic field perpendicular to both the longitudinal axis and the electric current is superimposed on the flowchannel region containing the electric current. The interaction between the electric current and the magnetic field produces the pumping force along the longitudinal axis. The advantages of the proposed pump over other such pumps would accrue from design features that address overlapping thermal and magnetic issues.

  11. Design of Solar Steam Irrigation Pump

    Vishal Kumar Dhimmar, Jay Prajapti, Mital Patel, Dhruv Patel, Banti Mistry, Jignesh Parmar

    2014-05-01

    Full Text Available Solar irrigation pump is this type of device which uses solar energy for water pumping. Water pumping is an energy intensive activity and consumes a large amount man power, diesel and electricity. Smallholder farmers in low income countries can benefit from affordable irrigation pump systems as they enable cultivation of high value crops during dry season. Currently the majority of small irrigation pumps are manually operated which is time consuming and requires a high level of physical exertion. There is a potential market for a low cost solar thermal pump that produces a high volume of water as well as reducing the labour burden. This will allow more crops to be grown and free up time for other productive tasks. Compared to the existing manual systems, many hours could be saved each day through reduced labour input.

  12. Pumped Storage and Potential Hydropower from Conduits

    none,

    2015-02-25

    Th is Congressional Report, Pumped Storage Hydropower and Potential Hydropower from Conduits, addresses the technical flexibility that existing pumped storage facilities can provide to support intermittent renewable energy generation. This study considered potential upgrades or retrofit of these facilities, the technical potential of existing and new pumped storage facilities to provide grid reliability benefits, and the range of conduit hydropower opportunities available in the United States.

  13. Fermi liquid theory of resonant spin pumping

    Moca, C. P.; Alex, A.; Shnirman, A.; Zarand, G.

    2013-01-01

    We study resonant all-electric adiabatic spin pumping through a quantum dot with two nearby levels by using a Fermi liquid approach in the strongly interacting regime, combined with a projective numerical renormalization group (NRG) theory. Due to spin-orbit coupling, a strong spin pumping resonance emerges at every charging transition, which allows for the transfer of a spin $~ \\hbar/2$ through the device in a single pumping cycle. Depending on the precise geometry of the device, controlled ...

  14. Reliability-Growth of Triplex Drilling Pump

    Hou Yu; ZhaoZhong

    1996-01-01

    @@ Introduction to triplex pump The triplex pump widely used in oilfields is composed of power end assembly, fluid end assembly, piston-liner spraying system, lubrication system and charging system.The pump delivers mud into oil well. Through nozzles of drilling bit, the mud inside the drilling shaft comes to the annular space between drilling shaft and casing string and then returns to surface.

  15. Transport and Dissipation in Quantum Pumps

    Avron, J. E.; Elgart, A.; Graf, G. M.; Sadun, L.

    2003-01-01

    This paper is about adiabatic transport in quantum pumps. The notion of ``energy shift'', a self-adjoint operator dual to the Wigner time delay, plays a role in our approach: It determines the current, the dissipation, the noise and the entropy currents in quantum pumps. We discuss the geometric and topological content of adiabatic transport and show that the mechanism of Thouless and Niu for quantized transport via Chern numbers cannot be realized in quantum pumps where Chern numbers necessa...

  16. Solar PV energy for water pumping system

    The paper provides an introduction into understanding the relative merits, characteristics, including economics, of photovoltically powered water pumping systems. Although more than 10,000 photovoltaic pumping systems are known to be operating through out the world, many potential users do not know how to decide weather feasibility assessment, and system procurement so that the reader can made an informed decision about water pumping systems, especially those powered with photovoltaics. (author)

  17. Linear peristaltic pump based on electromagnetic actuators

    Maddoui Lotfi

    2014-01-01

    Full Text Available In this paper a study and design of a linear peristaltic pump are presented. A set of electromagnetic (solenoid actuators is used as the active tools to drag the liquid by crushing an elastic tube. The pump consists of six serially-connected electromagnetic actuators controlled via an electronic board. This may be considered as a simulated peristalsis action of intestines. The dynamic performances of the pump are investigated analytically and experimentally.

  18. The Hydraulic Ram (Or Impulse) Pump

    Mills, Allan

    2014-01-01

    The hydraulic impulse pump utilizes a fraction of the momentum of a flowing stream to lift a small portion of that water to a higher level. There it may be accumulated in an elevated cistern to provide sufficient water for several families, for the pump works 24 h a day with no additional source of energy. The operation of the pump is described,…

  19. Estimating aquifer thickness using multiple pumping tests

    Maréchal, Jean-Christophe; Vouillamoz, Jean-Michel; Mohan Kumar, M.S.; Dewandel, Benoit

    2010-01-01

    A method to estimate aquifer thickness and hydraulic conductivity has been developed, consisting of multiple pumping tests. The method requires short-duration pumping cycles on an unconfined aquifer with significant seasonal water-table fluctuations. The interpretation of several pumping tests at a site in India under various initial conditions provides information on the change in hydrodynamic parameters in relation to the initial water-table level. The transmissivity linearly decreases comp...

  20. Performance of a Centrifugal Slurry Pump

    Hawas Yahya Bajawi; Basharat Salim; Ziyadh Suhibani

    2014-01-01

    The aim of this study was to experimentally investigate the effect of speed, concentration and size of slurry on the performance of a centrifugal pump. For this purpose a facility was built where the performance of a centrifugal slurry pump was examined using aggregate slurry. Three sizes of slurry with three concentrations and at three impeller speeds were used for the performance investigations of a centrifugal slurry pump. As a reference performance the performance of centrifugal slurry pu...