WorldWideScience

Sample records for ac backgrounder table

  1. The Prioritization and Comparison of Technical Background Criteria in the Selection Of Iran's National Table Tennis Coach: Sport Elites Perspectives

    Tahereh RAHMATI

    2015-06-01

    Full Text Available The purpose of this study was the prioritization and comparison of technical background criteria in the selection of Iran's national table tennis coach from the perspectives of sport elites. Method of this research was descriptive and survey kind. The study population were about 100 table tennis sport elites of whom 80 subjects were randomly selected based on Morgan table. Technical background criteria for national coach selection wer e based on McLean and Zakrajsk model. This questionnaire was provided with 7 items. The views of ten sport management professors were used for determining the content validity. To determine the reliability coefficient, Cronbach’s Alpha of 0.968 was used. T hese data were analyzed in both descriptive and inferential statistical. Descriptive statistics was used for description of demographic and inferential statistics was including Friedman Anova test for rating criteria and Kruskal - Wallis test for hypothesis and these data were analyzed using Spss software. The highest rank is for “Goodwill work and the lack of bad records in the past” and the lowest rank is for “Enough experience coaching in league and tournaments. There was no significa nt difference among sport elites to prioritize & compare of technical background criteria in the selection of Iran’s national table tennis coach (P>0.05.

  2. The adult polyglucosan body disease mutation GBE1 c.1076A>C occurs at high frequency in persons of Ashkenazi Jewish background.

    Hussain, Abrar; Armistead, Joy; Gushulak, Lara; Kruck, Christa; Pind, Steven; Triggs-Raine, Barbara; Natowicz, Marvin R

    2012-09-21

    Mutations of the glycogen branching enzyme gene, GBE1, result in glycogen storage disease (GSD) type IV, an autosomal recessive disorder having multiple clinical forms. One mutant allele of this gene, GBE1 c.1076A>C, has been reported in Ashkenazi Jewish cases of an adult-onset form of GSD type IV, adult polyglucosan body disease (APBD), but no epidemiological analyses of this mutation have been performed. We report here the first epidemiological study of this mutation in persons of Ashkenazi Jewish background and find that this mutation has a gene frequency of 1 in 34.5 (95% CI: 0.0145-0.0512), similar to the frequency of the common mutation causing Tay-Sachs disease among Ashkenazi Jews. This finding reveals APBD to be another monogenic disorder that occurs with increased frequency in persons of Ashkenazi Jewish ancestry. PMID:22943850

  3. Elementary Statistics Tables

    Neave, Henry R

    2012-01-01

    This book, designed for students taking a basic introductory course in statistical analysis, is far more than just a book of tables. Each table is accompanied by a careful but concise explanation and useful worked examples. Requiring little mathematical background, Elementary Statistics Tables is thus not just a reference book but a positive and user-friendly teaching and learning aid. The new edition contains a new and comprehensive "teach-yourself" section on a simple but powerful approach, now well-known in parts of industry but less so in academia, to analysing and interpreting process dat

  4. 21 CFR 886.4855 - Ophthalmic instrument table.

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Ophthalmic instrument table. 886.4855 Section 886...) MEDICAL DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4855 Ophthalmic instrument table. (a) Identification. An ophthalmic instrument table is an AC-powered or manual device on which ophthalmic...

  5. A Table! (At the Table).

    Terry, Robert M.

    A review of French dining habits and table manners outlines: elements of the place setting, courtesies used at the table, serving conventions, restaurant tipping, the size and content of the different meals of the day, subtle differences in common foods, restaurant types, menu types, general wine and cheese choices, waiter-client communication,…

  6. Some background about satellites

    Burns, Joseph A.

    1986-01-01

    Four tables of planetary and satellite data are presented which list satellite discoveries, planetary parameters, satellite orbits, and satellite physical properties respectively. A scheme for classifying the satellites is provided and it is noted that most known moons fall into three general classes: regular satellites, collisional shards, and irregular satellites. Satellite processes are outlined with attention given to origins, dynamical and thermal evolution, surface processes, and composition and cratering. Background material is provided for each family of satellites.

  7. Background Material

    Zandersen, Marianne; Hyytiäinen, Kari; Saraiva, Sofia;

    2016-01-01

    This document serves as a background material to the BONUS Pilot Scenario Workshop, which aims to develop harmonised regional storylines of socio-ecological futures in the Baltic Sea region in a collaborative effort together with other BONUS projects and stakeholders.......This document serves as a background material to the BONUS Pilot Scenario Workshop, which aims to develop harmonised regional storylines of socio-ecological futures in the Baltic Sea region in a collaborative effort together with other BONUS projects and stakeholders....

  8. New Generation of Los Alamos Opacity Tables

    Colgan, James; Kilcrease, D. P.; Magee, N. H.; Sherrill, M. E.; Abdallah, J.; Hakel, P.; Fontes, C. J.; Guzik, J. A.; Mussack, K. A.

    2016-05-01

    We present a new generation of Los Alamos OPLIB opacity tables that have been computed using the ATOMIC code. Our tables have been calculated for all 30 elements from hydrogen through zinc and are publicly available through our website. In this poster we discuss the details of the calculations that underpin the new opacity tables. We also show several recent applications of the use of our opacity tables to solar modeling and other astrophysical applications. In particular, we demonstrate that use of the new opacities improves the agreement between solar models and helioseismology, but does not fully resolve the long-standing `solar abundance' problem. The Los Alamos National Laboratory is operated by Los Alamos National Security, LLC for the National Nuclear Security Administration of the U.S. Department of Energy under Contract No. DE-AC5206NA25396.

  9. ACAC Converters for UPS

    Rusalin Lucian R. Păun

    2008-05-01

    Full Text Available This paper propose a new control technique forsingle – phase ACAC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.

  10. AC power supply systems

    An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)

  11. AcEST: DK950971 [AcEST

    Full Text Available optera acutorost... 37 0.66 tr|B1ACS6|B1ACS6_BALBN DMP1 (Fragment) OS=Balaenoptera ...bonaerens... 37 0.66 tr|B1ACS5|B1ACS5_BALED DMP1 (Fragment) OS=Balaenoptera edeni... GN=... 37 0.66 tr|B1ACS4|B1ACS4_BALBO DMP1 (Fragment) OS=Balaenoptera borealis ... 37 0.66 tr|B1ACS3|B1ACS3..._BALMU DMP1 (Fragment) OS=Balaenoptera musculus ... 37 0.86 tr|B1ACS1|B1ACS1_MEGNO DMP1 (Fragment) OS=Megapt...1ACS2_BALPH DMP1 (Fragment) OS=Balaenoptera physalus ... 37 1.1 tr|B1ACT6|B1ACT6_MESPE DMP1 (Fragment) OS=Me

  12. NNDSS - Table IV. Tuberculosis

    U.S. Department of Health & Human Services — NNDSS - Table IV. Tuberculosis - 2016.This Table includes total number of cases reported in the United States, by region and by states, in accordance with the...

  13. NNDSS - Table IV. Tuberculosis

    U.S. Department of Health & Human Services — NNDSS - Table IV. Tuberculosis - 2015.This Table includes total number of cases reported in the United States, by region and by states, in accordance with the...

  14. Tabled Execution in Scheme

    Willcock, J J; Lumsdaine, A; Quinlan, D J

    2008-08-19

    Tabled execution is a generalization of memorization developed by the logic programming community. It not only saves results from tabled predicates, but also stores the set of currently active calls to them; tabled execution can thus provide meaningful semantics for programs that seemingly contain infinite recursions with the same arguments. In logic programming, tabled execution is used for many purposes, both for improving the efficiency of programs, and making tasks simpler and more direct to express than with normal logic programs. However, tabled execution is only infrequently applied in mainstream functional languages such as Scheme. We demonstrate an elegant implementation of tabled execution in Scheme, using a mix of continuation-passing style and mutable data. We also show the use of tabled execution in Scheme for a problem in formal language and automata theory, demonstrating that tabled execution can be a valuable tool for Scheme users.

  15. Pension Insurance Data Tables

    Pension Benefit Guaranty Corporation — Find out about retirement trends in PBGC's data tables. The tables include statistics on the people and pensions that PBGC protects, including how many Americans...

  16. NNDSS - Table IV. Tuberculosis

    U.S. Department of Health & Human Services — NNDSS - Table IV. Tuberculosis - 2014.This Table includes total number of cases reported in the United States, by region and by states, in accordance with the...

  17. AC1 Wing

    Adrian DOBRE

    2010-03-01

    Full Text Available The AC1 wing replaces the old wing of the wind tunnel model AEROTAXI, which has been made at scale 1:9. The new wing is part of CESAR program and improves the aerodynamic characteristics of the old one. The geometry of the whole wing was given by FOI Sweden and position of AC1 wing must coincide with the structure of the AEROTAXI model.

  18. AC1 Wing

    Adrian DOBRE

    2010-01-01

    The AC1 wing replaces the old wing of the wind tunnel model AEROTAXI, which has been made at scale 1:9. The new wing is part of CESAR program and improves the aerodynamic characteristics of the old one. The geometry of the whole wing was given by FOI Sweden and position of AC1 wing must coincide with the structure of the AEROTAXI model.

  19. Table Tennis Club

    Table Tennis Club

    2013-01-01

    Apparently table tennis plays an important role in physics, not so much because physicists are interested in the theory of table tennis ball scattering, but probably because it provides useful breaks from their deep intellectual occupation. It seems that many of the greatest physicists took table tennis very seriously. For instance, Heisenberg could not even bear to lose a game of table tennis, Otto Frisch played a lot of table tennis, and had a table set up in his library, and Niels Bohr apparently beat everybody at table tennis. Therefore, as the CERN Table Tennis Club advertises on a poster for the next CERN Table Tennis Tournament: “if you want to be a great physicist, perhaps you should play table tennis”. Outdoor table at restaurant n° 1 For this reason, and also as part of the campaign launched by the CERN medical service “Move! & Eat better”, to encourage everyone at CERN to take regular exercise, the CERN Table Tennis Club, with the supp...

  20. Periodic Table of Students.

    Johnson, Mike

    1998-01-01

    Presents an exercise in which an eighth-grade science teacher decorated the classroom with a periodic table of students. Student photographs were arranged according to similarities into vertical columns. Students were each assigned an atomic number according to their placement in the table. The table is then used to teach students about…

  1. Accumulative Landings System Code Tables

    National Oceanic and Atmospheric Administration, Department of Commerce — Code Tables Used In Landings System. These tables assign meanings to the codes that appear in the data tables. Code tables exist for species, gear, state, county,...

  2. Mortality table construction

    Sutawanir

    2015-12-01

    Mortality tables play important role in actuarial studies such as life annuities, premium determination, premium reserve, valuation pension plan, pension funding. Some known mortality tables are CSO mortality table, Indonesian Mortality Table, Bowers mortality table, Japan Mortality table. For actuary applications some tables are constructed with different environment such as single decrement, double decrement, and multiple decrement. There exist two approaches in mortality table construction : mathematics approach and statistical approach. Distribution model and estimation theory are the statistical concepts that are used in mortality table construction. This article aims to discuss the statistical approach in mortality table construction. The distributional assumptions are uniform death distribution (UDD) and constant force (exponential). Moment estimation and maximum likelihood are used to estimate the mortality parameter. Moment estimation methods are easier to manipulate compared to maximum likelihood estimation (mle). However, the complete mortality data are not used in moment estimation method. Maximum likelihood exploited all available information in mortality estimation. Some mle equations are complicated and solved using numerical methods. The article focus on single decrement estimation using moment and maximum likelihood estimation. Some extension to double decrement will introduced. Simple dataset will be used to illustrated the mortality estimation, and mortality table.

  3. CERN Table Tennis Club

    CERN Table Tennis Club

    2014-01-01

    CERN Table Tennis Club Announcing CERN 60th Anniversary Table Tennis Tournament to take place at CERN, from July 1 to July 15, 2014   The CERN Table Tennis Club, reborn in 2008, is encouraging people at CERN to take more regular exercise. This is why the Club, thanks to the strong support of the CERN Staff Association, installed last season a first outdoor table on the terrace of restaurant # 1, and will install another one this season on the terrace of Restaurant # 2. Table tennis provides both physical exercise and friendly social interactions. The CERN Table Tennis club is happy to use the unique opportunity of the 60th CERN anniversary to promote table tennis at CERN, as it is a game that everybody can easily play, regardless of level. Table tennis is particularly well suited for CERN, as many great physicists play table tennis, as you might already know: “Heisenberg could not even bear to lose a game of table tennis”; “Otto Frisch played a lot of table tennis;...

  4. TABLE TENNIS CLUB

    TABLE TENNIS CLUB

    2010-01-01

    2010 CERN Table Tennis Tournament The CERN Table Tennis Club organizes its traditional CERN Table Tennis Tournament, at the Meyrin club, 2 rue de livron, in Meyrin, Saturday August 21st, in the afternoon. The tournament is open to all CERN staff, users, visitors and families, including of course summer students. See below for details. In order to register, simply send an E-mail to Jean-Pierre Revol (jean-pierre.revol@cern.ch). You can also download the registration form from the Club Web page (http://www.cern.ch/tabletennis), and send it via internal mail. Photo taken on August 22, 2009 showing some of the participants in the 2nd CERN Table Tennis tournament. INFORMATION ON CERN TABLE TENNIS CLUB CERN used to have a tradition of table tennis activities at CERN. For some reason, at the beginning of the 1980’s, the CERN Table Tennis club merged with the Meyrin Table Tennis club, a member of the Association Genevoise de Tennis de Table (AGTT). Therefore, if you want to practice table tennis, you...

  5. Ecological periodic tables for nekton and benthic macrofaunal community usage of estuarine habitats Slides

    Ecological periodic tables for nekton and benthic macrofaunal community usage of estuarine habitats Steven P. Ferraro, U.S. Environmental Protection Agency, Newport, OR Background/Questions/Methods The chemical periodic table, the Linnaean system of classification, and the Her...

  6. ac bidirectional motor controller

    Schreiner, K.

    1988-01-01

    Test data are presented and the design of a high-efficiency motor/generator controller at NASA-Lewis for use with the Space Station power system testbed is described. The bidirectional motor driver is a 20 kHz to variable frequency three-phase ac converter that operates from the high-frequency ac bus being designed for the Space Station. A zero-voltage-switching pulse-density-modulation technique is used in the converter to shape the low-frequency output waveform.

  7. Social Background Differences in Early Family Behavior

    Schoen, Robert; Landale, Nancy S.; Daniels, Kimberly; Cheng, Yen-Hsin Alice

    2009-01-01

    Social background has historically been recognized as a major factor influencing family behavior, though recent work has largely emphasized racial/ethnic influences. Here we use 1994 - 1995 and 2001 - 2002 Add Health data to examine the cohabitation, first marriage, and first birth experience of young women. In a multi state life table context,…

  8. AC/RF Superconductivity

    Ciovati, G.

    2015-01-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  9. AC/RF Superconductivity

    Ciovati, Gianluigi [JLAB

    2015-02-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  10. Table Tennis Club

    Table Tennis Club

    2011-01-01

    CERN Table Tennis Tournament Saturday 20th August 2011 at 13.30 at the CERN/Meyrin TT club (underneath the Piscine de Livron, rue de Livron 2, 1217 Meyrin) Details: http://cern.ch/club-TableTennis Registration: jean-pierre.revol@cern.ch Open to all CERN staff, visitors, summer students, and families

  11. The Living Periodic Table

    Nahlik, Mary Schrodt

    2005-01-01

    To help make the abstract world of chemistry more concrete eighth-grade students, the author has them create a living periodic table that can be displayed in the classroom or hallway. This display includes information about the elements arranged in the traditional periodic table format, but also includes visual real-world representations of the…

  12. Hanford Site background: Part 3, Groundwater background

    This report presents and interprets groundwater background data collected from the unconfined aquifer beneath the Hanford Site, a U.S. Department of Energy complex located near Richland, Washington. Characterization of background composition is an important component of environmental characterization activities and serves as a basis for distinguishing the presence and significance of contamination. Background data can also be used to assess the levels of baseline risk to which humans or other receptors are typically exposed and to establish remediation goals. Evaluating background on a sitewide basis provides a consistent, technically defensible definition of background as opposed to determining area-specific background compositions for each waste management unit being considered for remediation across the Hanford Site

  13. Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition

    The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity

  14. Hermetisk AC-Krets

    Hirsch, Carl; Smirnoff, Alexander

    2007-01-01

    Under sex månader våren 2007 har ett samarbete mellan Volvo Lastvagnar och två studenter från KTH, inriktning Integrerad produktutveckling vid institutionen för maskinkonstruktion, pågått i form av ett examensarbete på 20 poäng. Dagens AC-system i Volvos lastbilar avger 20-40 g/år av köldmediet R134a som är en kraftfull växthusgas. Detta sker främst genom diffusion via slangar och tätningsmaterial. Syftet med detta examensarbete är att ta fram förslag på tekniska lösningar på ett nytt AC-syst...

  15. Description of background data in the SKB database GEOTAB

    During the research and development program performed by SKB for the final disposal of spent nuclear fuel, a large quantity of geoscientific data was collected. Most of this data was stored in a database called GEOTAB. This report describes data within the background data group. This data provides information on the location of areas studied, borehole positions and also some drilling information. The background data group (subject), called BGR, is divided into several subgroups (methods): BGAREA area background data; BGDRILL drilling information; BGDRILLP drill penetration data; BGHOLE borehole information; BGTABLES number of rows in a table, and BGTOLR data table tolerance. A method consists of one or several data tables. In each chapter a method and its data tables are described. (orig./HP)

  16. Setting the Periodic Table.

    Saturnelli, Annette

    1985-01-01

    Examines problems resulting from different forms of the periodic table, indicating that New York State schools use a form reflecting the International Union of Pure and Applied Chemistry's 1984 recommendations. Other formats used and reasons for standardization are discussed. (DH)

  17. The Periodic Table CD.

    Banks, Alton J.; Holmes, Jon L.

    1995-01-01

    Describes the characteristics of the digitized version of The Periodic Table Videodisc. Provides details about the organization of information and access to the data via Macintosh and Windows computers. (DDR)

  18. VMS forms Output Tables

    National Oceanic and Atmospheric Administration, Department of Commerce — These output tables contain parsed and format validated data from the various VMS forms that are sent from any given vessel, while at sea, from the VMS devices on...

  19. Permit.LOA table

    National Oceanic and Atmospheric Administration, Department of Commerce — This table includes the effective dates by vessel and permit number for each issued letter of authorization (LOA) by the Permit Office (APSD)

  20. Superconducting ac cable

    The components of a superconducting 110 kV ac cable for power ratings >= 2000 MVA have been developed. The cable design especially considered was of the semiflexible type, with a rigid cryogenic envelope and flexible hollow coaxial cable cores pulled into the former. The cable core consists of spirally wound Nb-Al composite wires and a HDPE-tape wrapped electrical insulation. A 35 m long single phase test cable with full load terminations for 110 kV and 10 kA was constructed and successfully tested. The results obtained prove the technical feasibility and capability of our cable design. (orig.)

  1. High performance AC drives

    Ahmad, Mukhtar

    2010-01-01

    This book presents a comprehensive view of high performance ac drives. It may be considered as both a text book for graduate students and as an up-to-date monograph. It may also be used by R & D professionals involved in the improvement of performance of drives in the industries. The book will also be beneficial to the researchers pursuing work on multiphase drives as well as sensorless and direct torque control of electric drives since up-to date references in these topics are provided. It will also provide few examples of modeling, analysis and control of electric drives using MATLAB/SIMULIN

  2. Accurate compressed look up table method for CGH in 3D holographic display.

    Gao, Chuan; Liu, Juan; Li, Xin; Xue, Gaolei; Jia, Jia; Wang, Yongtian

    2015-12-28

    Computer generated hologram (CGH) should be obtained with high accuracy and high speed in 3D holographic display, and most researches focus on the high speed. In this paper, a simple and effective computation method for CGH is proposed based on Fresnel diffraction theory and look up table. Numerical simulations and optical experiments are performed to demonstrate its feasibility. The proposed method can obtain more accurate reconstructed images with lower memory usage compared with split look up table method and compressed look up table method without sacrificing the computational speed in holograms generation, so it is called accurate compressed look up table method (AC-LUT). It is believed that AC-LUT method is an effective method to calculate the CGH of 3D objects for real-time 3D holographic display where the huge information data is required, and it could provide fast and accurate digital transmission in various dynamic optical fields in the future. PMID:26831987

  3. Periodic table of elements

    Following a recommendation by the International Union for Pure and Applied Chemistry (IUPAC), the groups of the periodic table shall be numbered from 1 to 18, instead of I to VIII as before. The recommendations has been approved of by the Committee on Nomenclature of the American Chemical Society. The new system abandons the distinction between main groups (a) and auxiliary groups (b), which in the past frequently has been the reason for misunderstandings between European and American chemists, due to different handling. The publishing house VCH Verlagsgesellschaft recently produced a new periodic table that shows the old and the new numbering system together at a glance, so that chemists will have time to get familiar with the new system. In addition the new periodic table represents an extensive data compilation arranged by elements. The front page lists the chemical properties of elements, the back page their physical properties. (orig./EF)

  4. Table Tennis Club

    Table Tennis Club

    2012-01-01

    The CERN Table Tennis club and the Meyrin CTT are organizing two Table Tennis workshops from 2 to 6 July and from 20 to 24 August 2012 inclusive in Meyrin. A professional would be with your children from 14.00 pm to 18.00 pm: an instructor J + S category A. Training courses with specific themes, individual courses would be given depending on the level of the child’s game, “discoveries –table tennis games” courses and games with the robot. Other activities (stretching, relaxation). Afternoons (from 18 to 20 children): 40 CHF per workshop and per child. Evenings (from 18 to 20 adults): 60 CHF per workshop and per adult. For further information, please contact Mr. Monteil : Mobile: (+33) 06 61 31 70 47 E-mail: wilfried.monteil@free.fr.

  5. Building Background Knowledge

    Neuman, Susan B.; Kaefer, Tanya; Pinkham, Ashley

    2014-01-01

    This article make a case for the importance of background knowledge in children's comprehension. It suggests that differences in background knowledge may account for differences in understanding text for low- and middle-income children. It then describes strategies for building background knowledge in the age of common core standards.

  6. Ac Hybrid Charge Controller

    Shalini S. Durgam

    2015-03-01

    Full Text Available One of the primary needs for socio-economic development in any nation in the world is the provision of reliable electricity supply systems with lower carbon footprint levels. The purpose of this work is the development of a hybrid Power system that harnesses the renewable energy in sun and electricity to generate electricity. The working model can able to run on dual mode- solar and electricity. It can also be driven independently either by solar or electricity. The battery can be charge from solar panel (40W or by power supply. The household single phase A.C. power supply of 230V is converted into 12V D.C. using step down transformer and rectifying circuit. The working model can achieve energy saving, low carbon emission, environmental protection for the upcoming future of human life.

  7. AcEST: BP920072 [AcEST

    Full Text Available YMU001_000132_F11 525 Adiantum capillus-veneris mRNA. clone: YMU001_000132_F11. BP920072 - Show ... YGMYGEGEKALETFADMEKSGIVPDSVVFIAII 617 Query: 139 NACSR SCLFHECHSYFEAMSTHHGIVPCLEHHSCVV 32 ACS S L E + FE M ... KLMTRDVVSWNTLIAGYAQVGQNEGLFCTFSDMLGQRVKPDLITFVIVLNACSR ... 125 VF+ + +D VSWN++I+GY Q G F M+ + D IT++++++ +R S ... YGVHGYGKKAIQIFEEMLANGASP 384 Query: 166 DLITFVIVLNACSR SCLFHECHSYFEAMSTHHGIVPCLEHHSCVV 32 +TFV VL ACS L E ... KLMTRDVVSWNTLIAGYAQVGQNEGLFCTFSDMLGQRVKPDLITFVIVLNACSR S 122 +VFDK R + WN L G E + + M V+ D T+ VL AC S Sbjc ...

  8. Climate change : transportation table

    The Kyoto Protocol sets greenhouse gas (GHG) reduction targets for the post-2000 period. If ratified, Canada will be committed to reduce emissions of GHGs by 6 per cent below 1990 levels during the period 2008-2012. A recommended national strategy is to establish 'issue tables' that will advise the Ministers of Energy and Environment on preferred options to reach the Kyoto target and to identify early actions that can be taken. The 'Transportation Table' which is the focus of this paper, is one of the 15 sectoral tables. The Transportation Table will identify by July 1999, specific measures to mitigate GHG emissions from Canada's transportation sector. Currently, GHG emissions from the transportation sector are predicted to be 27 per cent above 1990 levels by 2010. Fuel taxes, emissions trading, and research into improved vehicle technologies and automotive fuels are some of the recommended options which can help reduce emissions trading from the transportation sector. Studies are underway to deal with emissions from transport in two sub-groups, freight and passenger. 1 fig

  9. A Modern Periodic Table.

    Herrenden-Harker, B. D.

    1997-01-01

    Presents a modern Periodic Table based on the electron distribution in the outermost shell and the order of filling of the sublevels within the shells. Enables a student to read off directly the electronic configuration of the element and the order in which filling occurs. (JRH)

  10. The Dynamic Force Table

    Geddes, John B.; Black, Kelly

    2008-01-01

    We examine an experimental apparatus that is used to motivate the connections between the basic properties of vectors, potential functions, systems of nonlinear equations, and Newton's method for nonlinear systems of equations. The apparatus is an adaptation of a force table where we remove the center-pin and allow the center-ring to move freely.…

  11. À Table! Improving Temporal Navigation in Soccer Ranking Tables

    Perin, Charles; Vuillemot, Romain; Fekete, Jean-Daniel

    2014-01-01

    International audience This article introduces A Table!, an enhanced soccer ranking table providing temporal navigation by combining two novel interaction techniques. Ranking tables order soccer teams represented as rows, according to values of columns containing attributes e.g., accumulated points, or number of scored goals. Because they represent a snapshot of a championship at a time t, tables are regularly updated with new results. Such updates usually change the rows order, which make...

  12. Round table presentation

    Full text: This Round Table deals with the main problems in the operational implementation of radiation safety standards. I will not reiterate previous comments that were made in the other sessions and round tables but I will make a very wide and open presentation in this regard. Since we are discussing problems, I will present this from a general perspective and not just from a national one. So, in my experience problems result from two main causes: problems at the organization level and those due to unsolved or pending technical aspects. The first group concerns organizational problems. In my view, according to my experience, and not only in Argentina, the basic problems are usually related to ineffectual regulatory performance. Second, non-appropriate technical competence in radiation protection and safety matters at all levels; that means at worker, employer and regulatory levels. However, legal competence is a necessary condition but not a sufficient one. The basic point here is knowledge - knowledge and experience - and we can have a very formal and appropriate background of real competence, real instruments, but if we don't have real technical competence the results will not be very satisfactory. Another topic concerns the inadequate discharge of managerial responsibilities at the operational level and following on from this, a weak safety culture and a lack of an effective quality system. The operational implementation of radiation protection standards is often more formalistic than realistic. So in this type of case, for any given country, a commitment at a very high political level is a necessity. The second set of factors associated with such problems are unsolved or pending technical factors and in my view the issue with the complex system of exemption, clearance and action levels, particularly in the case of commodities, is to establish an adequate set of activity concentration levels for specific radionuclides, either natural or artificial, for

  13. Global Reference Tables Services Architecture

    Social Security Administration — This database stores the reference and transactional data used to provide a data-driven service access method to certain Global Reference Table (GRT) service tables.

  14. Aggregation Algorithms in Heterogeneous Tables

    Titus Felix FURTUNA; Ivan, Ion; Marian DARDALA

    2006-01-01

    The heterogeneous tables are most used in the problem of aggregation. A solution for this problem is to standardize these tables of figures. In this paper, we proposed some methods of aggregation based on the hierarchical algorithms.

  15. Design of lift positional table

    Bartel, Jindřich

    2015-01-01

    This bachelor´s thesis describes the design of a lift positional table for overcome the height difference between the two roller tracks. Weight of the load is 550 kg and height difference of roller tracks is 2000 mm. The aim is to suggest the type of power lifting, power lifting functional calculation, functional calculation of the driver tray pallets and determining the main dimensions of the lifting table. The Appendix contains technical drawings of the lifting table and the table frame.

  16. AcEST: DK950147 [AcEST

    Full Text Available TST38A01NGRL0007_O05 706 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0007_O05. 5' end seq ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... OS=Medicago truncatula GN=MtrDRAFT_AC149576g3v2 PE ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... (Fragment) OS=Medicago truncatula GN=MtrDRAFT_AC14 ...

  17. AcEST: DK959344 [AcEST

    Full Text Available TST39A01NGRL0004_G23 714 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0004_G23. 5' end seq ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... OS=Medicago truncatula GN=MtrDRAFT_AC149576g3v2 PE ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... (Fragment) OS=Medicago truncatula GN=MtrDRAFT_AC14 ...

  18. AcEST: DK949716 [AcEST

    Full Text Available TST38A01NGRL0006_L20 613 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0006_L20. 5' end seq ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... OS=Medicago truncatula GN=MtrDRAFT_AC149576g3v2 PE ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... (Fragment) OS=Medicago truncatula GN=MtrDRAFT_AC14 ...

  19. AcEST: BP920905 [AcEST

    Full Text Available EM + + D ++S L AC Sbjct: 374 NSAYKLFERMPKKNVVAWNAIISGYSQHGHPHEALALFIEMQAQGIKPDSFAIVSVLPAC 433 Query: 71 SHSSTLNDGKLIHFYILMNNFE...EM++ ++ + V + S L +C Sbjct: 255 SSERIFEKIAKKNAVSWTAMISSYNRGEFSEKALRSFSEMIKSGIEPNLVTLYSVLSSCG 314 Query: 68 HSSTLNDGKLIHFYILMNNFE...VVVMSCLKACS 69 ++ +F RRD VTW A+I GYA HG E A+ LF+ M+ EN+ + V +S L+AC+ Sbjct: 656 DSRLMFEKSLRRDFVTWNAMICGYAHHGKGEEAIQLFERMILEN...ELEKMHNKRLQEMCVSWNSIISGYVMKEQSEDAQMLFTRMME 596 Query: 122 ENVDTDGVVVMSCLKACSHSSTLNDGKLIHFYILMNNFE ...FCEADT-NVITWNAMIASYVHCEQSEKAIALFDRMVSENFKPSSITLVTLLMAC 543 Query: 71 SHSSTLNDGKLIHFYILMNNFEL 3 ++ +L G++

  20. Induction Motor Control through AC/DC/AC Converters

    Elfadili, Abderrahim; Giri, Fouad; Ouadi, Hamid; El Magri, Abdelmounime; Dugard, Luc; Abouloifa, Abdelmajid

    2010-01-01

    We consider the problem of controlling inductions motors driven through AC/DC rectifiers and DC/AC inverters. The control objectives are threefold: (i) forcing the motor speed to track a reference signal, (ii) regulating the DC Link voltage, (iii) assuring a satisfactory power factor correction (PFC) with respect to the power supply net. First, a nonlinear model of the whole controlled system is developed in the Park-coordinates. Then, a nonlinear multi-loop controller is synthesized using th...

  1. Radiographic knee osteoarthritis in ex-elite table tennis players

    Rajabi Reza; Johnson Gillian M; Alizadeh Mohammad H; Meghdadi Nazanin

    2012-01-01

    Abstract Background Table tennis involves adoption of the semi-flexed knee and asymmetrical torsional trunk movements creating rotational torques on the knee joint which may predispose players to osteoarthritis (OA) of the knee. This study aims to compare radiographic signs of knee OA and associated functional levels in ex-elite male table tennis players and control subjects. Methods Study participants were 22 ex-elite male table tennis players (mean age 56.64 ± 5.17 years) with 10 years of i...

  2. AC drives for industrial plants. Plant kudoyo AC drive sochi

    Miyazaki, M.; Shibata, M.; Yamada, S. (Toshiba Corp., Tokyo (Japan))

    1992-08-01

    Features and product series of AC drives for industrial plants were outlined. Configurations and features of various types of AC drives were briefly discussed which are put into market to meet various requirements for industrial plants and wide ranges of output voltage and capacity. The following product series were outlined; the power bipolar transistor inverter for 3.5-600 kVA in output capacity, IGBT inverter for AC 400 V in output voltage and 1,000 kVA or less, GTO inverter for AC 600 V and 700-2,000 kVA, and cycloconverter for AC 1,000-3,000 V and 1,000 kW-20 MW. The following subjects were outlined as current technical trends of AC drives for industrial plants; increasing in capacity of voltage-source PWM inverters, downsizing of converters through highly efficient cooling and highly dense mounting, spreading of sensorless vector controls, and development of high-voltage large-capacity PWM inverters. 6 figs., 2 tabs.

  3. The Cosmic Microwave Background

    Silk, Joseph

    2001-01-01

    This set of lectures provides an overview of the basic theory and phenomenology of the cosmic microwave background. Topics include a brief historical review; the physics of temperature and polarization fluctuations; acoustic oscillations of the primordial plasma; the space of inflationary cosmological models; current and potential constraints on these models from the microwave background; and constraints on inflation.

  4. Biophenols in table olives.

    Blekas, Georgios; Vassilakis, Constantinos; Harizanis, Constantinos; Tsimidou, Maria; Boskou, Dimitrios G

    2002-06-19

    Unprocessed olives are well-known sources of phenolic antioxidants with important biological properties. Processing methods to prepare table olives may cause a reduction of valuable phenols and may deprive the food of precious biological functions. The present work was undertaken to evaluate table olives produced in Greece as sources of biophenols. Commercially available olives were analyzed for their total phenol content by using the Folin-Ciocalteu reagent and for individual phenols by RP-HPLC. Samples were Spanish-style green olives in brine, Greek-style naturally black olives in brine, and Kalamata olives in brine. Most of the types of olives analyzed were found to be good sources of phenols. Hydroxytyrosol, tyrosol, and luteolin were the prevailing phenols in almost all of the samples examined. High levels of hydroxytyrosol were determined mainly in Kalamata olives and Spanish-style green olives, cultivar Chalkidiki (250-760 mg/kg). PMID:12059143

  5. Tissot's table of logarithms (ca. 1880)

    Roegel, Denis

    2011-01-01

    Tissot's table, only in manuscript form, is a table of powers, subdividing the interval from 1 to 10 in 100000 intervals. It is supplemented by the sines, overlayed on the same table. This composed table is reconstructed here.

  6. Table Tennis Club

    Table Tennis Club

    2012-01-01

    2012 CERN Table Tennis Tournament As the campaign launched by the CERN medical service “Move! & Eat better” is designed in particular to encourage people at CERN to take more regular exercise, the CERN Table Tennis Club, with its traditional CERN Table Tennis Tournament is providing an excellent opportunity to practice moving. The tournament will take place at the Meyrin CTT, 2 rue de Livron, Saturday August 25, 2012, in the afternoon (starting at 13:30). It is open to all CERN staff, users, visitors and families, including of course summer students, who are strongly encouraged to participate. In order to register, simply send an E-mail to Jean-Pierre Revol (jean-pierre.revol@cern.ch). You may also find useful information on the Club Web page http://www.cern.ch/tabletennis CERN 2011 champion Savitha Flaecher, between the finalist Bertrand Mouches on her left, the winner of the consolation draw on her right (Sudarshan Paramesvaran), and far left, Denis Moriaud (semi-finalist a...

  7. Cosmogenic Backgrounds to 0{\

    :,; Auty, D J; Barbeau, P S; Beck, D; Belov, V; Breidenbach, M; Brunner, T; Burenkov, A; Cao, G F; Chambers, C; Cleveland, B; Coon, M; Craycraft, A; Daniels, T; Danilov, M; Daugherty, S J; Davis, J; Delaquis, S; Der Mesrobian-Kabakian, A; DeVoe, R; Didberidze, T; Dilling, J; Dolgolenko, A; Dolinski, M J; Dunford, M; Fairbank, W; Farine, J; Feldmeier, W; Feyzbakhsh, S; Fierlinger, P; Fudenberg, D; Gornea, R; Graham, K; Gratta, G; Hall, C; Herrin, S; Hughes, M; Jewell, M J; Johnson, A; Johnson, T N; Johnston, S; Karelin, A; Kaufman, L J; Killick, R; Koffas, T; Kravitz, S; Krücken, R; Kuchenkov, A; Kumar, K S; Leonard, D S; Licciardi, C; Lin, Y H; Ling, J; MacLellan, R; Marino, M G; Mong, B; Moore, D; Njoya, O; Nelson, R; Odian, A; Ostrovskiy, I; Piepke, A; Pocar, A; Prescott, C Y; Retière, F; Rowson, P C; Russell, J J; Schubert, A; Sinclair, D; Smith, E; Stekhanov, V; Tarka, M; Tolba, T; Tsang, R; Twelker, K; Vuilleumier, J -L; Waite, A; Walton, J; Walton, T; Weber, M; Wen, L J; Wichoski, U; Wood, J; Yang, L; Yen, Y -R; Zeldovich, O Ya

    2015-01-01

    As neutrinoless double-beta decay experiments become more sensitive and intrinsic radioactivity in detector materials is reduced, previously minor contributions to the background must be understood and eliminated. With this in mind, cosmogenic backgrounds have been studied with the EXO-200 experiment. Using the EXO-200 TPC, the muon flux (through a flat horizontal surface) underground at the Waste Isolation Pilot Plant (WIPP) has been measured to be {\\Phi} = 4.07 $\\pm$ 0.14 (sys) $\\pm$ 0.03 (stat) $\\times$ $10^{-7}$cm$^{-2}$ s$^{-1}$, with a vertical intensity of $I_{v}$ = 2.97$^{+0.14}_{-0.13}$ (sys) $\\pm$ 0.02 (stat) $\\times$ $10^{-7}$cm$^{-2}$ s$^{-1}$ sr$^{-1}$. Simulations of muon-induced backgrounds identified several potential cosmogenic radionuclides, though only 137Xe is a significant background for the 136Xe 0{\

  8. On Background Independence

    Anderson, Edward

    2013-01-01

    This paper concerns what Background Independence itself is (as opposed to some particular physical theory that is background independent). The notions presented mostly arose from a layer-by-layer analysis of the facets of the Problem of Time in Quantum Gravity. Part of this coincides with two relational postulates which are thus identified as classical precursors of two of the facets of the Problem of Time. These are furthemore tied to the forms of each of the GR Hamiltonian and momentum cons...

  9. Zambia Country Background Report

    Hampwaye, Godfrey; Jeppesen, Søren; Kragelund, Peter

    This paper provides background data and general information for the Zambia studies focusing on local food processing sub­‐sector; and the local suppliers to the mines as part of the SAFIC project (Successful African Firms and Institutional Change).......This paper provides background data and general information for the Zambia studies focusing on local food processing sub­‐sector; and the local suppliers to the mines as part of the SAFIC project (Successful African Firms and Institutional Change)....

  10. Turning the Tables.

    Wright, Karen; Schroeder, Doris

    2016-04-01

    In bioethics, the concept of vulnerability is applied almost exclusively to research participants and patients. We turn the tables and apply the concept to nurses caring for anorexia nervosa (AN) sufferers. In doing so, and using results from a qualitative research study undertaken in the UK, we show that AN nurses face a significant probability of incurring identifiable harms (inauthentic relationships and nonreciprocal relationships). Some recommendations on how these harms can be avoided or mitigated are given, but further research is needed. PMID:26957447

  11. A Tiled-Table Convention for Compressing FITS Binary Tables

    Pence, William; White, Richard L

    2012-01-01

    This document describes a convention for compressing FITS binary tables that is modeled after the FITS tiled-image compression method (White et al. 2009) that has been in use for about a decade. The input table is first optionally subdivided into tiles, each containing an equal number of rows, then every column of data within each tile is compressed and stored as a variable-length array of bytes in the output FITS binary table. All the header keywords from the input table are copied to the header of the output table and remain uncompressed for efficient access. The output compressed table contains the same number and order of columns as in the input uncompressed binary table. There is one row in the output table corresponding to each tile of rows in the input table. In principle, each column of data can be compressed using a different algorithm that is optimized for the type of data within that column, however in the prototype implementation described here, the gzip algorithm is used to compress every column.

  12. AcEST: BP915640 [AcEST

    Full Text Available YMU001_000074_A01 462 Adiantum capillus-veneris mRNA. clone: YMU001_000074_A01. BP915640 CL3685C ... y: 462 GPLILRACLVYMQGAPVGSLAEDGIVSAATGKDMEQSTVGFRLMLAKI IHRLIAAFKEVG 283 G IL+AC YM+G +GSL +D V ++VGF+LMLAK ... : 1032 GYYILKACDAYMKGYLIGSLTKDASVIDERSS-ANSTSVGFKLMLAKI APKLFSALSEVG 1090 Query: 282 AYCDAYE 262 A C+ ++ Sb ... uery: 453 ILRACLVYMQGAPVGSLAEDGIVSAATGKDMEQSTVGFRLMLAKI IHRLIAAFKEVGAYC 274 +L AC YM+G PVGS A G ST GF++ML+K ... ame = -1 Query: 423 GAPVGSLAEDGIVSAATGKDMEQSTVGFRLMLAKI I----HRLIAAFKEVGAYCD 271 G P+ L D +S GK + S RL + L+ ...

  13. AcEST: DK955197 [AcEST

    Full Text Available TST39A01NGRL0022_H07 532 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0022_H07. 5' end seq ... KDEVTALPLLK 192 Query: 194 RFAFGIACELLMSRYEKEEQEMLEEPF TTMMKGILQLPIKLPGTRFSKAIVAANMLRARF 373 R+ F +AC+L S ... KDEVMALPLLK 192 Query: 194 RFAFGIACELLMSRYEKEEQEMLEEPF TTMMKGILQLPIKLPGTRFSKAIVAANMLRARF 373 R+ F +AC+L S ... KDEVKVLP 189 Query: 185 LMKRFAFGIACELLMSRYEKEEQEMLEEPF TTMMKGILQLPIKLPGTRFSKAIVAANMLR 364 L++ F IA L + +Q+ ... KDEATVLP 177 Query: 185 LMKRFAFGIACELLMSRYEKEEQEMLEEPF TTMMKGILQLPIKLPGTRFSKAIVAANMLR 364 L+K F +A L E+ QE ...

  14. Exploring String Theory Backgrounds

    Williams, B P

    2004-01-01

    This thesis examines phenomenological and theoretical questions by exploring string theoretic backgrounds. Part I focuses on cosmology. First we propose that the induced metric along a brane moving through a curved bulk may be interpreted as the cosmology of the brane universe, providing a resolution to the apparent cosmological singularity on the brane. We then look at various decay channels of the certain meta-stable de Sitter vacua and show that there exist NS5-brane meditated decays which are much faster than decays to decompactification. Part II discusses a new class of nongeometric vacua in string theory. These backgrounds may be described locally as T2 fibrations. By enlarging the monodromy group of the fiber to include perturbative stringy duality symmetries we are able to explicitly construct nongeometric backgrounds.

  15. Determination of background radiation

    The invention relates to a method and appartus for determining the level of background radiation in a spectral region where a Raman peak characteristic of a particular substance, in particular diamond, is expected to occur. The method includes the steps of isolating the radiation in a first spectral band, and isolating the radiation in a second spectral band which overlaps the first spectral band at least partially to form an overlapping band in the vicinity of the expected Raman Peak and a least one sideband. At least one sideband value representative of the radiation present in the one or more sidebands is then obtained, and further values, representative of the radiation isolated by any one or more of the other spectral bands, such as the first and second bands, are then used to derive a background value indicative of the level of background radiation present at the position of the expected Raman peak

  16. Unitarity and singular backgrounds

    Brouzakis, Nikos

    2013-01-01

    We compute the graviton Kaluza-Klein spectrum on a gravity-dilaton background with a naked singularity for all possible boundary conditions at the singularity which are consistent with unitary evolution. We apply methods from non-relativistic quantum mechanics with singular Schr\\"{o}dinger potentials. In general the spectrum contains a tachyon, a sign of instability. Only for a particular boundary condition at the singularity the spectrum is free of tachyons. In this case the lowest-lying graviton mode is massless. We argue that this result will also hold for other backgrounds with similar geometry near the curvature singularity. We complete our study with a brief discussion on radion perturbations and Higgs mechanism on this singular background.

  17. The natural radiation background

    The components of the natural background radiation and their variations are described. Cosmic radiation is a major contributor to the external dose to the human body whilst naturally-occurring radionuclides of primordial and cosmogenic origin contribute to both the external and internal doses, with the primordial radionuclides being the major contributor in both cases. Man has continually modified the radiation dose to which he has been subjected. The two traditional methods of measuring background radiation, ionisation chamber measurements and scintillation counting, are looked at and the prospect of using thermoluminescent dosimetry is considered

  18. Cosmic Tachyon Background Radiation

    Tomaschitz, R

    1999-01-01

    The equilibrium statistical mechanics of a background radiation of superluminal particles is investigated, based on a vectorial wave equation for tachyons of the Proca type. The partition function, the spectral energy density, and the various thermodynamic variables of an ideal Bose gas of tachyons in an open Robertson-Walker cosmology are derived. The negative mass square in the wave equation changes the frequency scaling in the Rayleigh-Jeans law, and there are also significant changes in the low temperature regime as compared to the microwave background, in particular in the caloric and thermal equations of state.

  19. Speed Control of DC Motor using AC/AC/DC Converter Based on Intelligent Techniques

    Rakan Kh Antar

    2013-05-01

    Full Text Available    This paper describes the application of ac/ac/dc and ac/dc converters to control the speed of a separately excited DC motor. Artificial neural network and PI controller are trained to select the desired values of firing angles for triggering thyristors of the ac/ac/dc and ac/dc bridge converters in order to control the speed of the dc motor at a desired value with constant and different load torques in order to obtain the best speed response. Simulation results show that the rising time for ac/dc and ac/ac/dc converters at 250rpm are reduced about 79% and 89% respectively, while delay time it reduced about 69% and 64% respectively. Therefore, speed response of the dc motor is more efficient for closed loop system compared with open loop also the response of ac/ac/dc converter is better than ac/dc converter.

  20. Local microwave background radiation

    Soares, Domingos

    2006-01-01

    An inquiry on a possible local origin for the Microwave Background Radiation is made. Thermal MBR photons are contained in a system called {\\it magnetic bottle} which is due to Earth magnetic field and solar wind particles, mostly electrons. Observational tests are anticipated.

  1. Berkeley Low Background Facility

    The Berkeley Low Background Facility (BLBF) at Lawrence Berkeley National Laboratory (LBNL) in Berkeley, California provides low background gamma spectroscopy services to a wide array of experiments and projects. The analysis of samples takes place within two unique facilities; locally within a carefully-constructed, low background laboratory on the surface at LBNL and at the Sanford Underground Research Facility (SURF) in Lead, SD. These facilities provide a variety of gamma spectroscopy services to low background experiments primarily in the form of passive material screening for primordial radioisotopes (U, Th, K) or common cosmogenic/anthropogenic products; active screening via neutron activation analysis for U,Th, and K as well as a variety of stable isotopes; and neutron flux/beam characterization measurements through the use of monitors. A general overview of the facilities, services, and sensitivities will be presented. Recent activities and upgrades will also be described including an overview of the recently installed counting system at SURF (recently relocated from Oroville, CA in 2014), the installation of a second underground counting station at SURF in 2015, and future plans. The BLBF is open to any users for counting services or collaboration on a wide variety of experiments and projects

  2. Berkeley Low Background Facility

    Thomas, K. J.; Norman, E. B. [Department of Nuclear Engineering, University of California-Berkeley, CA 94720 (United States); Nuclear Science Division, Lawrence Berkeley National Laboratory, CA 94720 (United States); Smith, A. R.; Poon, A. W. P.; Chan, Y. D. [Nuclear Science Division, Lawrence Berkeley National Laboratory, CA 94720 (United States); Lesko, K. T. [Physics Division, Lawrence Berkeley National Laboratory, CA 94720 (United States)

    2015-08-17

    The Berkeley Low Background Facility (BLBF) at Lawrence Berkeley National Laboratory (LBNL) in Berkeley, California provides low background gamma spectroscopy services to a wide array of experiments and projects. The analysis of samples takes place within two unique facilities; locally within a carefully-constructed, low background laboratory on the surface at LBNL and at the Sanford Underground Research Facility (SURF) in Lead, SD. These facilities provide a variety of gamma spectroscopy services to low background experiments primarily in the form of passive material screening for primordial radioisotopes (U, Th, K) or common cosmogenic/anthropogenic products; active screening via neutron activation analysis for U,Th, and K as well as a variety of stable isotopes; and neutron flux/beam characterization measurements through the use of monitors. A general overview of the facilities, services, and sensitivities will be presented. Recent activities and upgrades will also be described including an overview of the recently installed counting system at SURF (recently relocated from Oroville, CA in 2014), the installation of a second underground counting station at SURF in 2015, and future plans. The BLBF is open to any users for counting services or collaboration on a wide variety of experiments and projects.

  3. Remark on Applied Statistics Algorithm AS057 Printing Multidimensional Tables

    Hopkins, Tim; Morse, David R.

    1994-01-01

    We provide a Fortran 77 version of the Applied Statistics Algorithm AS57 `Printing Multidimensional Tables'' originally appearing in the book `Applied Statistics Algorithms'' by P. Griffiths and I.D. Hill. We believe that the new code offers improvements both in readability and maintainability. [The file /pub/misc/statlib/apstat/as057.sh contains the Fortran 77 source code, example driver code, data and sample results as a Unix shar file. It is available via anonymous ftp from unix.hensa.ac.uk

  4. Nuclear structure of $^{231}$Ac

    Boutami, R; Mach, H; Kurcewicz, W; Fraile, L M; Gulda, K; Aas, A J; García-Raffi, L M; Løvhøiden, G; Martínez, T; Rubio, B; Taín, J L; Tengblad, O

    2008-01-01

    The low-energy structure of 231Ac has been investigated by means of gamma ray spectroscopy following the beta-decay of 231Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a mini-orange electron spectrometer. The decay scheme of 231Ra --> 231Ac has been constructed for the first time. The Advanced Time Delayed beta-gamma-gamma(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

  5. Whole genome comparison between table and wine grapes reveals a comprehensive catalog of structural variants

    Di Genova, Alex; Almeida, Andrea Miyasaka; Muñoz-Espinoza, Claudia; Vizoso, Paula; Travisany, Dante; Moraga, Carol; Pinto, Manuel; Hinrichsen, Patricio; Orellana, Ariel; Maass, Alejandro

    2014-01-01

    Background Grapevine (Vitis vinifera L.) is the most important Mediterranean fruit crop, used to produce both wine and spirits as well as table grape and raisins. Wine and table grape cultivars represent two divergent germplasm pools with different origins and domestication history, as well as differential characteristics for berry size, cluster architecture and berry chemical profile, among others. ‘Sultanina’ plays a pivotal role in modern table grape breeding providing the main source of s...

  6. AcEST: BP920800 [AcEST

    Full Text Available DLNLALQVHSRMVRFGFNAEVEACGALINMYGKCGKVLYAQRVFDDT 298 Query: 206 RQQDVISWNDIISACAQRGHGTEALENFSQMLHEGIVPNSMTFTSVMQA---CNSIEGG...G L +A S F ++ +D+ISW +I +Q EA+ F Sbjct: 217 SEKNEATSNCLINGYMGLGNLEQAESLFNQMPVKDIISWTTMIKGYSQNKRYREAIAVFY 276 Query: 119 QMLHEG...EKAWRIFDGVSCKNLPSWNAIITGCVQGGLLEEAIDLYRHMK 281 Query: 110 HEGIVPNSMTFTSVMQAC---NSIEGGR 36 + + PN +T +V+ AC +...N IIS AQ G +EA+E ++ M Sbjct: 383 DITIGNAVVVMYAKLGLVDSARAVFNWLPNTDVISWNTIISGYAQNGFASEAIEMYNIME 442 Query: 110 HEG...EIDLGEQIHSLSVKTGFESDMYVSGVLIDMYSKYGWLEKARRVLEML 406 Query: 206 RQQDVISWNDIISACAQRGHGTEALENFSQMLHEGIVPNSMTFTSVMQACNSIEGG

  7. AcEST: DK945549 [AcEST

    Full Text Available AGGCGATTTCATCTTTTCTGAGAACCCTGATTTTGTGATTGTGTAATTACA ACTGTGGAACAGAAGGATGAGAAGTCTACTGACACAACAAGATATCTCTGGAGAGGAGA...A AATTGAGAAGGTTTGAGTTCTCAACAATGGGCTATGAGGCAATAATGGGAAGGCACCGAT TGTGGGCTTGTATAGGTTTTGAC...LCTG 239 L++R+LRR + + ++ G AC+ DP +P PLC+G Sbjct: 108 LQQRELRRKLLADSGALNTNSVNGPRNWKACVQQDPSSRPGTPLCSG 154 >sp|A6UUY8|RNZ_META3...49 Tissue type young leaves Developmental stage sporophyte Contig ID CL454Contig1 Sequence GATGAGCGA...CCACCTGTGCAACCGTCAGCGCCTTTGTGCACTGGTG CAATGTCCTGTGGTTACCTTGTTTGGAATCTTAATTGTTCTCATGTAT

  8. AcEST: BP917632 [AcEST

    Full Text Available YMU001_000103_D10 554 Adiantum capillus-veneris mRNA. clone: YMU001_000103_D10. BP917632 - Show ... YSKCKIHQKALELLVLML 154 Query: 466 KDSLEPDEVTYLNVLKACARE EDLKV 543 +D++ P+ TY +VL++C D+++ Sbjct: 155 RDNVRPN ... 185 Query: 415 GHSDSS--KEALKLLTQMRKDSLEPDEVTYLNVLKACARE EDLK 540 + EA KL +M+ ++ PDE+ N++ AC R +++ Sbjct: 18 ...

  9. AcEST: DK961189 [AcEST

    Full Text Available OS=A... 127 7e-29 sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS... 125 2e-28 sp|P00785|AC...IRNSWGLNWGDSGYVKLQRNIDDPFGKCGIAMMPSYP 347 >sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS=

  10. AcEST: DK946687 [AcEST

    Full Text Available YMU02A01NGRL0013_G11 544 Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0013_G11. 5' end seq ... + G P+ TY+ + AC+ E Sbjct: 97 YSFNYMIRGLTNTWN-------DHEA ---ALSLYRRMKFSGLKPDKFTYNFVFIACAKLE 146 Query: 214 A ... Sbjct: 71 LIPKAVELGDFNYSSFLFSVTEEPNHYSFNYMIRGLTNTWNDHEA ALSLYRRMKFSGLKP 130 Query: 469 DGATFSCVLRACGNVGALDV ...

  11. AcEST: DK949372 [AcEST

    Full Text Available TST38A01NGRL0005_N02 627 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0005_N02. 5' end seq ... 363 DQLREKTC-GVDKFDDIVMACXXXXXXXXXXXXXXXXXXKARVHAYGVCD DPEYFYDYVQ 539 Q++EK G+ FDDIV+AC KA+VHA+ VCD DP+YFYD ... 264 QQVQEKKVPGITFFDDIVVACGSGGSIAGLSLGSYLSNLKAKVHAFAVCD DPDYFYDYTQ 323 Query: 540 GLLDGMNANIASRDIVNVIDAKGLG ...

  12. The Cosmic Microwave Background

    Jones Aled

    1998-01-01

    Full Text Available We present a brief review of current theory and observations of the cosmic microwave background (CMB. New predictions for cosmological defect theories and an overview of the inflationary theory are discussed. Recent results from various observations of the anisotropies of the microwave background are described and a summary of the proposed experiments is presented. A new analysis technique based on Bayesian statistics that can be used to reconstruct the underlying sky fluctuations is summarised. Current CMB data is used to set some preliminary constraints on the values of fundamental cosmological parameters $Omega$ and $H_circ$ using the maximum likelihood technique. In addition, secondary anisotropies due to the Sunyaev-Zel'dovich effect are described.

  13. Unitarity and singular backgrounds

    Brouzakis, Nikos; Quiros, Mariano

    2013-01-01

    We compute the graviton Kaluza-Klein spectrum on a gravity-dilaton background with a naked singularity for all possible boundary conditions at the singularity which are consistent with unitary evolution. We apply methods from non-relativistic quantum mechanics with singular Schr\\"{o}dinger potentials. In general the spectrum contains a tachyon, a sign of instability. Only for a particular boundary condition at the singularity is the spectrum free of tachyons. In this case the lowest-lying gra...

  14. Australia; Background Material

    International Monetary Fund

    1995-01-01

    This paper describes the developments in the Australian labor market during the 1990s. In 1994, a number of new labor market programs were launched, directed especially at the long-term unemployed, and a further step was taken in the evolutionary reform of the industrial relations system. The paper reviews developments in employment, wages, and productivity in Australia that formed the background to these policy initiatives. It also examines the conduct of fiscal policy at the Commonwealth an...

  15. Background, phenomenology, and motivation

    The authors discuss the background to the kinetics of adsorption and desorption after an elementary introduction to the problem of chemisorption in two limiting cases. Other topics discussed include the thermodynamics of adsorption, reaction mechanisms outside surfaces, and a case history of catalytic hydrogenation of carbon monoxide. Figures show the potential energy barrier as a function of an appropriate reaction coordinate, and bonding of carbon monoxide to platinum metal

  16. Sri Lanka; Background Papers

    International Monetary Fund

    1995-01-01

    This Background Paper on Sri Lanka provides information on the economic developments during 1992–95. Developments in the domestic and external sectors are discussed. The deficiencies of the official consumer price index that resulted in a substantial understatement of inflation performance in 1994 and alternative estimates of underlying inflation are described. The structural rigidities in the labor market that perpetuate high unemployment and limit job growth are also described. The paper ...

  17. Radioactivity: additional tables

    The following additional tables are presented to the annual report on radioactive discharges from the major establishments in the U.K.: 1) Radioactive gaseous effluent, trends in annual emissions, by site, (civil and M.O.D.) 2) Radioactive liquid effluent (radionuclides specified by authorisations), trends in annual discharges to surface and coastal waters: by site. 3) Liquid effluent (radionuclides not subject to separate limits): annual discharges to surface and coastal waters by site. 4) Isotopic composition of liquid effluent from CEGB stations, 1984. 5) Trends in the amount of radioactivity in waste dumped in the north-east Atlantic. 6) Trends in volume of waste disposed of at Drigg (by source of waste). 7) Solid waste: trends in volume disposed of and level of activity at some other disposal sites. 8) Radioactivity in samples of fish and shellfish: trends in concentrations. (UK)

  18. Apuntes de Acústica

    Martín Domingo, Agustín

    2014-01-01

    Esta publicacion contiene unos apuntes para la parte de Acústica de las asignaturas de la ETSAM, junto con cierta cantidad de material adicional que excede el ámbito del curso. Aunque está lejos de ser completa y de estar libre de errores, el autor espera sea útil.

  19. SSTI Clark ACS Technology Demonstrations

    Freesland, Douglas

    1997-01-01

    SSTI Clark, one of two spacecraft built under NASA's Small Satellite Technology Initiative, includes seven ACS technology demonstrations. The technologies redefine the performance cost envelope, providing improved sensor and actuator performance at reduced costs. Six sensing technologies are being flown consisting of both hardware and algorithmic demonstrations: autonomous star tracker, hemispherical resonating gyro, GPS attitude determination, miniature horizon sensors, low cost course sun s...

  20. Energy saving in ac generators

    Nola, F. J.

    1980-01-01

    Circuit cuts no-load losses, without sacrificing full-load power. Phase-contro circuit includes gate-controlled semiconductor switch that cuts off applied voltage for most of ac cycle if generator idling. Switch "on" time increases when generator is in operation.

  1. On isomorphisms of integral table algebras

    FAN; Yun(樊恽); SUN; Daying(孙大英)

    2002-01-01

    For integral table algebras with integral table basis T, we can consider integral R-algebra RT over a subring R of the ring of the algebraic integers. It is proved that an R-algebra isomorphism between two integral table algebras must be an integral table algebra isomorphism if it is compatible with the so-called normalizings of the integral table algebras.

  2. Malaysia; Background Paper

    International Monetary Fund

    1996-01-01

    This Background Paper on Malaysia examines developments and trends in the labor market since the mid-1980s. The paper describes the changes in the employment structure and the labor force. It reviews wages and productivity trends and their effects on unit labor cost. The paper highlights that Malaysia’s rapid growth, sustained since 1987, has had a major impact on the labor market. The paper outlines the major policy measures to address the labor constraints. It also analyzes Malaysia’s r...

  3. Background and introduction

    Jensen, Per Anker; van der Voordt, Theo; Coenen, Christian

    2012-01-01

    in scope between FM and CREM is that CREM has its focus on real estate as physical and economical assets utilized by an organisation, while FM has a wider service focus. The difference in scope between FM and CREM on one side and B2B marketing on the other is that FM and CREM are related to...... chapter provides important background information to understand the following chapters in this book. Research limitations: The chapter is mainly based on the experience and knowledge of the editors. It does not include original research but provides an introductory overview of the book. Originality...

  4. Backgrounded but not peripheral

    Hovmark, Henrik

    DDAs in question contribute to the socio-cultural construction of identity, i.e. that they play a rather specific role in discursive communication and socio-cultural meaning construction. On the other hand it is clear that the semantics of the DDAs in question, seen in isolation, is very abstract or...... general; furthermore, the DDAs are backgrounded in discourse. Is it reasonable to claim, rather boldly, that “the informants express their identity in the use of the directional adverb ud ‘out’ etc.”? In the course of this article, however, I suggest that the DDAs in question do contribute to the socio-cultural...

  5. The Cosmic Background Radiation

    Smoot, George; Scott, Douglas

    1997-01-01

    We review the current status of experimental data for spectral distortions and angular anisotropies of the cosmic microwave background, as well as discussing the relevant physical processes. This is one of a number of new articles in astrophysics and cosmology which will appear in the 1996 Review of Particle Properties (Phys. Rev. D. in press). Other relevant reviews include: "Big-Bang Cosmology" by K.A. Olive; "Big-Bang Nucleosynthesis" by K.A. Olive & D.N. Schramm; "The Hubble Constant" by ...

  6. Family Background and Entrepreneurship

    Lindquist, Matthew J.; Sol, Joeri; Van Praag, Mirjam;

    Vast amounts of money are currently being spent on policies aimed at promoting entrepreneurship. The success of such policies, however, rests in part on the assumption that individuals are not ‘born entrepreneurs’. In this paper, we assess the importance of family background and neighborhood...... effects as determinants of entrepreneurship. We start by estimating sibling correlations in entrepreneurship. We find that between 20 and 50 percent of the variance in different entrepreneurial outcomes is explained by factors that siblings share. The average is 28 percent. Allowing for differential...... entrepreneurship does play a large role, as do shared genes....

  7. AcEST: DK950895 [AcEST

    Full Text Available |A7SFA3|A7SFA3_NEMVE Predicted protein OS=Nematostella vectens... 210 5e-53 tr|Q0CVA9|Q0CVA9_ASPTN ATP-citrate synthase subunit...stX Result : Swiss-Prot sp_hit_id Q54YA0 Definition sp|Q54YA0|ACLY_DICDI Probable ATP-citrate synthase OS=Dictyos...PIDYSWAQELGLIRKPAAFISTI 404 >sp|Q8X097|ACL1_NEUCR Probable ATP-citrate synthase subunit 1 OS=Neurospora cras...IRKPASFMTSI 844 >sp|Q9P7W3|ACL1_SCHPO Probable ATP-citrate synthase subunit 1 OS=Schizosaccharomyces pombe G....done Score E Sequences producing significant alignments: (bits) Value sp|Q54YA0|ACLY_DICDI Probable ATP-citrate synthase OS=Dictyos

  8. The Backgrounds Data Center

    Snyder, W. A.; Gursky, H.; Heckathorn, H. M.; Lucke, R. L.; Berg, S. L.; Dombrowski, E. G.; Kessel, R. A.

    1993-01-01

    The Strategic Defense Initiative Organization has created data centers for midcourse, plumes, and backgrounds phenomenologies. The Backgrounds Data Center (BDC) has been designated as the prime archive for data collected by SDIO programs. The BDC maintains a Summary Catalog that contains 'metadata,' that is, information about data, such as when the data were obtained, what the spectral range of the data is, and what region of the Earth or sky was observed. Queries to this catalog result in a listing of all data sets (from all experiments in the Summary Catalog) that satisfy the specified criteria. Thus, the user can identify different experiments that made similar observations and order them from the BDC for analysis. On-site users can use the Science Analysis Facility (SAFE for this purpose. For some programs, the BDC maintains a Program Catalog, which can classify data in as many ways as desired (rather than just by position, time, and spectral range as in the Summary Catalog). For example, data sets could be tagged with such diverse parameters as solar illumination angle, signal level, or the value of a particular spectral ratio, as long as these quantities can be read from the digital record or calculated from it by the ingest program. All unclassified catalogs and unclassified data will be remotely accessible.

  9. A comprehensive assessment of the effects of Bt cotton on Coleomegilla maculata demonstrates no detrimental effects by Cry1Ac and Cry2Ab.

    Yunhe Li

    Full Text Available The ladybird beetle, Coleomegilla maculata (DeGeer, is a common and abundant predator in many cropping systems. Its larvae and adults are predaceous, feeding on aphids, thrips, lepidopteran larvae and plant tissues, such as pollen. Therefore, this species is exposed to insecticidal proteins expressed in insect-resistant, genetically engineered cotton expressing Cry proteins derived from Bacillus thuringiensis (Bt. A tritrophic bioassay was conduced to evaluate the potential impact of Cry2Ab- and Cry1Ac-expressing cotton on fitness parameters of C. maculata using Bt-susceptible and -resistant larvae of Trichoplusia ni as prey. Coleomegilla maculata survival, development time, adult weight and fecundity were not different when they were fed with resistant T. ni larvae reared on either Bt or control cotton. To ensure that C. maculata were not sensitive to the tested Cry toxins independent from the plant background and to add certainty to the hazard assessment, C. maculata larvae were fed artificial diet incorporated with Cry2Ab, Cry1Ac or both at >10 times higher concentrations than in cotton tissue. Artificial diet containing E-64 was included as a positive control. No differences were detected in any life-table parameters between Cry protein-containing diet treatments and the control diet. In contrast, larvae of C. maculata fed the E-64 could not develop to the pupal stage and the 7-d larval weight was significantly negatively affected. In both feeding assays, the stability and bioactivity of Cry proteins in the food sources were confirmed by ELISA and sensitive-insect bioassays. Our results show that C. maculata is not affected by Bt cotton and is not sensitive to Cry2Ab and Cry1Ac at concentrations exceeding the levels in Bt cotton, thus demonstrating that Bt cotton will pose a negligible risk to C. maculata. More importantly, this study demonstrates a comprehensive system for assessing the risk of genetically modified plants on non

  10. AcEST: BP914304 [AcEST

    Full Text Available IDEHTFVFTLRAC 4 V+ NA++ Y G+ E A++ + +M+ E++ + TF+ LRAC Sbjct: 670 VTWNAMICGYAHHGKGEEAIQLFERMILENIKPNHVTFISI...KSLRRDFVTWNAMICGYAHHGKGEEAIQLFERMILENIKPN 703 Query: 339 NLTYVSLFKACGNVLDFGQG-RTIHGEARANGFSSDRFICTTLI...TFVFTLRAC 4 +F + + V+ N ++ +YV A +++M + D TL+AC Sbjct: 484 QIFERMCDRDNVTWNTIIGSYVQDENESEAFDLFKRMNLCGIVSDGACL...K + A+Q+ + R + +W++MI++ +A + ++ M Sbjct: 93 LGNSLINFYSKFEDVASAEQVFRRMTLRDVVTWSSMIAAYAGNNHPAKAFDTFERMTDAN 152... + R + +W++MI++ +A + ++ M Sbjct: 93 LGNSLINFYSKFEDVASAEQVFRRMTLRDVVTWSSMIAAYAGNNHPAKAFDTFERM

  11. AcEST: BP911793 [AcEST

    Full Text Available + +VSWN +++ Y QHG + ++L+ M+AE T N + + A Sbjct: 58 EAKFVFERIQNKDVVSWNCIINGYSQHGPSGSSHVMELFQRMRAENTAPNAHTFAGVF... N + + A Sbjct: 58 EAKFVFERIQNKDVVSWNCIINGYSQHGPSGSSHVMELFQRMRAENTAPNAHTFAGVFTA 117 Query: 359 CIQTGNLELCKQM...D VT S+LSACSH G + +G YF Sbjct: 602 IIGGSAQHGRGQDALQLFERMKMEGVKPDIVTFVSLLSACSHAGLLEEGRRYF 654 Score = 115 bit...53 QTGNLELCKQMHFNIVSAGNELNPSLASSLIRTYGNCGSMLDAHAVFDSLPLPDIVSWNV 174 Q +E+ K++ F+++ N S +++I Y CG + +A +FD +P D VSW Sbjct: 324 QGERME... L+ M +E + I+LV +L AC+ TG+LE + +H Sbjct: 498 VITWNAMIASYVHCEQSEKAIALFDRMVSENFKPSSITLVTLLMACVNTGSLER

  12. AcEST: BP921649 [AcEST

    Full Text Available 40 + ++LV YAK L + ++ +P R W+ +I+ + + ++E AL+ + M+ G Sbjct: 144 VASSLVGMYAKFNLFENSLQVFDEMPERDVASWNTVISCFYQSGEAEKALELFGRME...LDCYKEM 52 ++L +GNALVD YAKCG L A ++ +R+ R V W+ +I Y + E A D +K M Sbjct: 461 KNLFVGNALVDMYAKCGALEDARQIFERMCDRDNVTWNTIIGSYVQDEN...RD+ WNA+I Sbjct: 237 LEQGKQIHCYAIRSG-IESDVLVVNGLVNMYAKCGNVNTAHKLFERMPIRDVASWNAIIG 295 Query: 411 GYVNHGRAEVALDCFGKME...SNDVV-GNALVNMYAKCGNVNSAYKLFERMPKKNVVAWNAIIS 396 Query: 411 GYVNHGRAEVALDCFGKME... HGR + AL F +M+ EG PD +TF +L AC G + + + + Sbjct: 603 IGGSAQHGRGQDALQLFERMKMEGVKPDIVTFVSLLSACSHAGLLEEGRRYFCSM

  13. AcEST: BP919669 [AcEST

    Full Text Available D + RDV SW ++S + + G+ ++F M G +P+ Sbjct: 148 LVGMYAKFNLFENSLQVFDEMPERDVASWNTVISCFYQSGEAEKALELFGRMESSGFEPN 20...+ +++AC L + +G+E+H + K+G EL V Sbjct: 190 EKALELFGRMESSGFEPNSVSLTVAISACSRLLWLERGKE...F Sbjct: 468 IY---VVNSLIDSYGKCSHVEDAERIFEECTIGDLVSFTSMITAYAQYGQGEEALKLFLE 524 Query: 226 MVGEGTKPDSISLLVVLRA-YNF...+ IR DV W +LMSGY+K D ++F ++ Sbjct: 44 SLINVYFTCKDHCSARHVFENFDIRSDVYIWNSLMSGYSKNSMFHDTLEVFKRLLNCSIC 103 Query: 208 KPDSISLLVVLRAYNF...KPD Sbjct: 261 VDMYAKCGCIETAVEVFEKLTRRNVFSWAALIGGYAAYGYAKKATTCLDRIEREDGIKPD 320 Query: 199 SISLLVVLRAYNFLGFP

  14. AcEST: DK957916 [AcEST

    Full Text Available PQKQPVPAVSHSPQKSSTPPTPAATKPKEEPSVPKEVPKLQQGKLEKT 967 Query: 577 --TTEASQGIPVEEG...G E+ P+ P Sbjct: 1974 QEQGRAPSQDQEAPSPEALPSPGQEPAAGASPRRGELRRGSSAESALPRAGP 2025 >sp|Q05175|BASP_RAT Brain ac... +P AP P Sbjct: 388 ERETAASAGPQG----AFPEPRPAQPSAGPEPRPAQPSAGPEPRPAQPSAAPEPRP---- 439 Query: 571 GQTTE... L ++ +A+ +E AP Sbjct: 406 IVTTPEPEGSGEEDVPKPDEIPEKEVTEEELIKVSTAAPAKASPEEEVVKATTLAPSEED 465 Query: 550 VSPYIASGQTTE... Query: 424 KGQAYEAIPDPHVDPAAGVHERLAQLQLGDEPEATKPKEAPG-VSPYI--ASGQTTEASQ 594 K A E P + + G E + E EA P A G +P

  15. AcEST: DK956923 [AcEST

    Full Text Available CCATAGTCTCAA CAGCGATAAGCAGGAAATGCATGCAGTGACCATGGGTAAGAAAAGGGTCATGGTGGGCGC CATTAACACGATACTTATCCTA...CTCCTCTTGCAGTTTATGAAGCAATGTTCTTCCTCTTC TAGTCATGATGATGATGGCGATGCCTTTGCGGATGACACTCTAAGCAGACGCAACGAT...AC GGTCGAGTCTGCTCCTCGACATTGGCCAAGGCGAATGCTGGGCAGCCAAGAACCTGCCTC CAACAAGACTTCATATGGTATTCCTGAT...H At1g73965 (CLE13 / CLAVATA3/ESR-Related 13) (CLE13) OS=Arabidopsis thaliana Align length 25 Sco...icant alignments: (bits) Value tr|Q6NMF0|Q6NMF0_ARATH At1g73965 (CLE13 / CLAVATA3/ESR-Related 1... 49 3e-04

  16. AcEST: BP921492 [AcEST

    Full Text Available + AL +G+ +H Sbjct: 286 DVASWNAIIGGYSLNSQHHEALAFFNRMQVRGIKPNSITMVSVLPACAHLFAL... ++ L +GK +H Sbjct: 178 NLVSWTAMVSGYAQGGFADEALRMFYEMQGEDVKANYVTVASVLPACAQLSDLQQGKEIH 237 Query: 153 AC...FDRMPEK 171 Query: 333 DVVSWSAMIAMYGQQGCGKEAFQLFQEMACEGGMPNRVTYVSILDACASVAALPEGKLVH 154 +V+W+++++ + Q G EA Q+F +M G P+ T+VS+L ACA...333 DVVSWSAMIAMYGQQGCGKEAFQLFQEMACE-GGMPNRVTYVSILDACASVAALPEGKLV 157 +V +W+AMI+ YG G G++A +LF +M + G +PN VT+V++L ACA...SKL 85 Query: 288 GCGKEAFQLFQEMACEGGMPNRVTYVSILDACASVAALPEGKLVHACFMESELELDVVVG 109 ++ M P+ T+ S++ +CA ++AL G

  17. Ecological periodic tables for nekton and benthic macrofaunal community usage of estuarine habitats

    Background/Questions/Methods The chemical periodic table, the Linnaean system of classification, and the Hertzsprung-Russell diagram are iconic information organizing systems because they are simple, easy to understand, exceptionally useful, and they foster the expansion of sc...

  18. MCNPX Model/Table Comparison

    Hendricks, J S

    2003-01-01

    MCNPX is a Monte Carlo N-Particle radiation transport code extending the capabilities of MCNP4C. As with MCNP, MCNPX uses nuclear data tables to transport neutrons, photons, and electrons. Unlike MCNP, MCNPX also uses (1) nuclear data tables to transport protons; (2) physics models to transport 30 additional particle types (deuterons, tritons, alphas, pions, muons, etc.); and (3) physics models to transport neutrons and protons when no tabular data are available or when the data are above the energy range (20 to 150 MeV) where the data tables end. MCNPX can mix and match data tables and physics models throughout a problem. For example, MCNPX can model neutron transport in a bismuth germinate (BGO) particle detector by using data tables for bismuth and oxygen and using physics models for germanium. Also, MCNPX can model neutron transport in UO sub 2 , making the best use of physics models and data tables: below 20 MeV, data tables are used; above 150 MeV, physics models are used; between 20 and 150 MeV, data t...

  19. Holography for Schrodinger backgrounds

    Guica, Monica; Taylor, Marika; van Rees, Balt

    2010-01-01

    We discuss holography for Schrodinger solutions of both topologically massive gravity in three dimensions and massive vector theories in (d+1) dimensions. In both cases the dual field theory can be viewed as a d-dimensional conformal field theory (two dimensional in the case of TMG) deformed by certain operators that respect the Schrodinger symmetry. These operators are irrelevant from the viewpoint of the relativistic conformal group but they are exactly marginal with respect to the non-relativistic conformal group. The spectrum of linear fluctuations around the background solutions corresponds to operators that are labeled by their scaling dimension and the lightcone momentum k_v. We set up the holographic dictionary and compute 2-point functions of these operators both holographically and in field theory using conformal perturbation theory and find agreement. The counterterms needed for holographic renormalization are non-local in the v lightcone direction.

  20. Performance of AC/graphite capacitors at high weight ratios of AC/graphite

    Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)

    2008-03-01

    The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)

  1. Simultaneous distribution of AC and DC power

    Polese, Luigi Gentile

    2015-09-15

    A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.

  2. The Periodic Table in Croatia

    Raos, N.

    2011-12-01

    Full Text Available The Croatian (Yugoslav Academy of Sciences and Arts was the first academy to elect D. I. Mendeleev as its honorary member (1882, whereas the periodic table of the elements has been taught regularly at the Zagreb University since 1888. The early interest of Croatian chemists in the periodic table should be attributed primarily to their pan-Slavic attitude, particularly as proof that Slavic people were able to produce "their own Newtons" (M. V. Lomonosov and D. I. Mendeleev. Such enthusiastic views, however, did not help in analyzing the contribution of Mendeleev and other scientists to the discovery and development of the periodic table of the elements.

  3. Background information to the installers guide for small scale mains connected PV

    NONE

    2002-07-01

    This report contains background information used by BRE, EA Technology, Halcrows and Sundog when compiling guidance for the UK's New and Renewable Energy Programme on the installation of small-scale photovoltaics (PV) in buildings. The report considers: relevant standards; general safety issues; fire and safety issues, including the fire resistance of PV modules; PV module ratings such as maximum voltage and maximum current; DC cabling; the DC disconnect; the DC junction box; fault analysis; general and AC side earthing; DC earthing; lightning and surge suppression; inverters; AC modules; AC systems; getting connection; mounting options; and installation issues.

  4. Genetical background of intelligence.

    Junkiert-Czarnecka, Anna; Haus, Olga

    2016-01-01

    Intelligence as an ability to reason, think abstractly and adapt effectively to the environment is a subject of research in the field of psychology, neurobiology, and in the last twenty years genetics as well. Genetical testing of twins carried out from XX century indicated heritebility of intelligence, therefore confirmed an influence of genetic factor on cognitive processes. Studies on genetic background of intelligence focus on dopaminergic (DRD2, DRD4, COMT, SLC6A3, DAT1, CCKAR) and adrenergic system (ADRB2, CHRM2) genes as well as, neutrofins (BDNF) and oxidative stress genes (LTF, PRNP). Positive effect of investigated gene polymorphism was indicated by variation c.957C>T DRD2 gene (if in polymorphic site is thymine), polymorphism c.472G>A COMT gene (presence of adenine) and also gene ADRB2 c.46A->G (guanine), CHRM2 (thymine in place c.1890A>T) and BDNF (guanine in place c.472G>A) Obtained results indicate that intelligence is a feature dependent not only on genetic but also an environmental factor. PMID:27333929

  5. Biological aerosol background characterization

    Blatny, Janet; Fountain, Augustus W., III

    2011-05-01

    To provide useful information during military operations, or as part of other security situations, a biological aerosol detector has to respond within seconds or minutes to an attack by virulent biological agents, and with low false alarms. Within this time frame, measuring virulence of a known microorganism is extremely difficult, especially if the microorganism is of unknown antigenic or nucleic acid properties. Measuring "live" characteristics of an organism directly is not generally an option, yet only viable organisms are potentially infectious. Fluorescence based instruments have been designed to optically determine if aerosol particles have viability characteristics. Still, such commercially available biological aerosol detection equipment needs to be improved for their use in military and civil applications. Air has an endogenous population of microorganisms that may interfere with alarm software technologies. To design robust algorithms, a comprehensive knowledge of the airborne biological background content is essential. For this reason, there is a need to study ambient live bacterial populations in as many locations as possible. Doing so will permit collection of data to define diverse biological characteristics that in turn can be used to fine tune alarm algorithms. To avoid false alarms, improving software technologies for biological detectors is a crucial feature requiring considerations of various parameters that can be applied to suppress alarm triggers. This NATO Task Group will aim for developing reference methods for monitoring biological aerosol characteristics to improve alarm algorithms for biological detection. Additionally, they will focus on developing reference standard methodology for monitoring biological aerosol characteristics to reduce false alarm rates.

  6. Low background infrared (LBIR) facility

    Federal Laboratory Consortium — The Low background infrared (LBIR) facility was originally designed to calibrate user supplied blackbody sources and to characterize low-background IR detectors and...

  7. The redoubtable ecological periodic table

    Ecological periodic tables are repositories of reliable information on quantitative, predictably recurring (periodic) habitat–community patterns and their uncertainty, scaling and transferability. Their reliability derives from their grounding in sound ecological principle...

  8. The Table Mountain Field Site

    Federal Laboratory Consortium — The Table Mountain Field Site, located north of Boulder, Colorado, is designated as an area where the magnitude of strong, external signals is restricted (by State...

  9. Automation of BESSY scanning tables

    A micro processor M6800 is used for the automation of scanning and premeasuring BESSY tables. The tasks achieved by the micro processor are: 1. control of spooling of the four asynchronous film winding devices and switching on and off the 4 projections lamps, 2. pre-processing of the data coming from a bi-polar coordinates measuring device, 3. bi-directional interchange of informations between the operator, the BESSY table and the DEC PDP 11/34 mini computer controling the scanning operations, 4. control of the magnification on the table by swapping the projection lenses of appropriate focal lengths and the associated light boxes (under development). In connection with point 4, study is being made for the use of BESSY tables for accurate measurements (+/-5 microns), by encoding the displacements of the projections lenses. (orig.)

  10. Using Tables to Teach Mathematics.

    Keller, Clifton

    1978-01-01

    The construction of tables of numbers is discussed as a learning activity that involves work in such things as reciprocals, calculators, formulas, patterns, discovery, prime numbers, and other types of numbers. (MP)

  11. Hanford Site background: Part 1, Soil background for nonradioactive analytes

    Volume two contains the following appendices: Description of soil sampling sites; sampling narrative; raw data soil background; background data analysis; sitewide background soil sampling plan; and use of soil background data for the detection of contamination at waste management unit on the Hanford Site

  12. The Periodic Table in Croatia

    Raos, N.

    2011-01-01

    The Croatian (Yugoslav) Academy of Sciences and Arts was the first academy to elect D. I. Mendeleev as its honorary member (1882), whereas the periodic table of the elements has been taught regularly at the Zagreb University since 1888. The early interest of Croatian chemists in the periodic table should be attributed primarily to their pan-Slavic attitude, particularly as proof that Slavic people were able to produce "their own Newtons" (M. V. Lomonosov and D. I. Mendeleev). Such enthusiasti...

  13. The tables of the discipline

    Doroshin B. A.

    2013-03-01

    Full Text Available This publication presents the training table, which presents the material on the theory of the origin of the state, causes and effects in the formation of the state in terms of socio-economic determinism, political, economic, social, environmental, law enforcement, national, cultural and external functions of the state. The tables can be used by teachers as a component of training materials provided to students for independent work, and to create presentations, students demonstrated in classroom learning.

  14. Bayesian analysis of contingency tables

    Gómez Villegas, Miguel A.; González Pérez, Beatriz

    2005-01-01

    The display of the data by means of contingency tables is used in different approaches to statistical inference, for example, to broach the test of homogeneity of independent multinomial distributions. We develop a Bayesian procedure to test simple null hypotheses versus bilateral alternatives in contingency tables. Given independent samples of two binomial distributions and taking a mixed prior distribution, we calculate the posterior probability that the proportion of successes in the first...

  15. STIL - Starlink Tables Infrastructure Library

    Taylor, Mark

    STIL is a set of Java class libraries which allow input, manipulation and output of tabular data and metadata. Among its key features are support for many tabular formats (including VOTable, FITS, CDF, text-based formats and SQL databases) and support for dealing with very large tables in limited memory. As well as an abstract and format-independent definition of what constitutes a table, and an extensible framework for "pull-model" table processing, it provides a number of format-specific handlers which know how to serialize/deserialize tables. The framework for interaction between the core table manipulation facilities and the format-specific handlers is open and pluggable, so that handlers for new formats can easily be added, programmatically or at run-time. The VOTable handling in particular is provided by classes which perform efficient XML parsing and can read and write VOTables in any of the defined formats (TABLEDATA, BINARY or FITS). It supports table-aware SAX- or DOM-mode processing and may be used on its own for VOTable I/O without much reference to the format-independent parts of the library.

  16. AcEST: DK952954 [AcEST

    Full Text Available TST38A01NGRL0015_H21 616 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0015_H21. 5' end seq ... LIHAHIVCSCNDVDNFVRSTLVNLYSKCGSIEDAHNVFAKLATRRSVDWSMMIS ... 541 ++ Q K +HA I + D + V + L+++Y+KCGSI DA F +++T+ ... LIHAHIVCSCNDVDNFVRSTLVNLYSKCGSIEDAHNVFAKLATRRSVDWSMMIS GS 547 + + IHA S D ++ LV LYS+CG IE+++ F + ++ W+ ++S ... LIHAHIVCSCNDVDNFVRSTLVNLYSKCGSIEDAHNVFAKLATRRSVDWSMMIS ... 541 DL + IH+ I+ + ++ +V S L+++Y+K G ++ A ++ + A + ... EA+ LF +M G+ P + + L AC Sbjct: 243 RVFDGLRLKDHSSWVAMIS GLSKNECEAEAIRLFCDMYVLGIMPTPYAFSSVLSACKKIE 302 Query ...

  17. AcEST: BP912540 [AcEST

    Full Text Available YMU001_000020_B03 501 Adiantum capillus-veneris mRNA. clone: YMU001_000020_B03. BP912540 - Show ... 2 EELTVHHTASVGDVEALKALLAEGADKDEKDSEGRTALHFACGYGEVMCAE VLLEAGVAV 181 EE VH TAS+GDVE LKA LA G +KDE+DSEGRTAL ... ry: 14 VHHTASVGDVEALKALLAEGADKDEKDSEGRTALHFACGYGEVMCAE VLLEAGVAVDAVD 193 +H A V ++ LL GAD KD G LH AC YG AE ... uery: 26 ASVGDVEALKALLAEGADKDEKDSEGR--TALHFACGYGEVMCAE VLLEAGVAVDAVDKN 199 + GD+E +K L + + + +D EGR T LHFA ... ry: 14 VHHTASVGDVEALKALLAEGADKDEKDSEGRTALHFACGYGEVMCAE VLLEAGVAVDAVD 193 +H A ++E + LL GAD + +D G LH A YG ...

  18. AcEST: DK948526 [AcEST

    Full Text Available TST38A01NGRL0003_I19 675 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0003_I19. 5' end seq ... IAMVRTTTPVYV 214 Query: 542 ALALFNQARVSSLPIIDDNGSLIDIY ARSDITALARDDTY 661 AL +F Q RVS+LP++D+ G ++DIY ++ D+ ... LA + TY Sbjct: 215 ALGIFVQHRVSALPVVDEKGRVVDIY SKFDVINLAAEKTY 254 >sp|Q09138|AAKG1_PIG 5'-AMP-acti ... IAMVRTTTPVYV 215 Query: 542 ALALFNQARVSSLPIIDDNGSLIDIY ARSDITALARDDTY 661 AL +F Q RVS+LP++D+ G ++DIY ++ D+ ... LA + TY Sbjct: 216 ALGIFVQHRVSALPVVDEKGRVVDIY SKFDVINLAAEKTY 255 >sp|O54950|AAKG1_MOUSE 5'-AMP-ac ...

  19. AcEST: DK962916 [AcEST

    Full Text Available TST39A01NGRL0015_C06 596 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0015_C06. 5' end seq ... NA. clone: TST39A01NGRL0015_C06. 5' end sequence. Acce ssion DK962916 Tissue type prothallia with plantlet ... 2 Query: 317 MPKSKEPCSQEACDIQTCLVKNNFITERCFPVIEALQACCE K 442 MP+ K+PC ++AC+IQ CL NN++ +C VI+ L+ CC + Sbjct ... me = +2 Query: 335 PCSQEACDIQTCLVKNNFITERCFPVIEALQACCE K 442 PC +EAC IQ CL+ + + +C VI+ L CC K Sbjct: 4 PCQ ... = +2 Query: 326 SKEPCSQEACDIQTCLVKNNFITERCFPVIEALQACCE KCNSK 454 + E C+ CD +TC +K F +C AL CCE KC K Sbjct: 4 ...

  20. AcEST: DK955705 [AcEST

    Full Text Available TST39A01NGRL0023_N02 635 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0023_N02. 5' end seq ... NA. clone: TST39A01NGRL0023_N02. 5' end sequence. Acce ssion DK955705 Tissue type prothallia with plantlet ... 2 Query: 296 MPKSKEPCSQEACDIQTCLVKNNFITERCFPVIEALQACCE K 421 MP+ K+PC ++AC+IQ CL NN++ +C VI+ L+ CC + Sbjct ... me = +2 Query: 314 PCSQEACDIQTCLVKNNFITERCFPVIEALQACCE K 421 PC +EAC IQ CL+ + + +C VI+ L CC K Sbjct: 4 PCQ ... = +2 Query: 305 SKEPCSQEACDIQTCLVKNNFITERCFPVIEALQACCE KCNSK 433 + E C+ CD +TC +K F +C AL CCE KC K Sbjct: 4 ...

  1. AcEST: DK961330 [AcEST

    Full Text Available FWVPCMHTPIKQEKHTHA 405 +AR P W +++PI+ ++C++ P + AK+ PL DVTH+F+V + +QE Sbjct: 61 VARRTRP-SWHEDNPINYVQCDISDPDD...+IL +D PGGPWKVYG Sbjct: 4 WWAGAIGAAKKKLEEDDAPPKHS---SVALIVGVTGIIGNSLAEILPLADTPGGP...AWHEDNPINYIQCDISDPDDSLAKLSPLTDVTHVFYVTCANR--STEPENCE 117 Query: 406 MATHMFENIIGVLLTHAPNLQHVCMQTSDKHY-... : Swiss-Prot sp_hit_id Q7MXT7 Definition sp|Q7MXT7|LPXD_PORGI UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac...lue sp|Q7MXT7|LPXD_PORGI UDP-3-O-[3-hydroxymyristoyl] glucosamine N-... 34 0.62 sp|P60369|KR103_HUMAN Kerati

  2. AcEST: BP913772 [AcEST

    Full Text Available N VT V L C+ G G+ H Sbjct: 350 NVVTWSAVIAGYAQRGLGFEALDVFRQMRLCGSEPNVVTLVSLLSGCALAGTLLHGKETH 409 Query: 376 IEIER--RGLLEVDP-...VFNKLSVQDIVSW 236 + + A ++G+++H I RRGL + PV+ + LV MY R G L Q VF+++ +D+VSW Sbjct: 296 ASLAALEQGKLIHGYILRRGLDSILPVI-S... TF M+ +PN+VT V VL+AC+ + Q + Sbjct: 250 SWSAMIACYAKNGKAFEALRTFREMMRETKDSSPNSVTMVSVLQACASLA...MIEGGVAPNAVTFVVVLRACSQTGSYSQSQTFFEAMSKNF 50 + G A G + F+ M + GV PNAVTFV VLR CS G + Q F++M F Sbjct: 312 ALNGLAMNGFGEKCLELFSL...L YA G + + +F++ D+ +TA + + Sbjct: 48 IHAAILRHNLLLHPRYPVLNLKLHRAYASHGKIRHSLALFHQTIDP

  3. Assessing the allelotypic effect of two aminocyclopropane carboxylic acid synthase-encoding genes MdACS1 and MdACS3a on fruit ethylene production and softening in Malus

    Dougherty, Laura; Zhu, Yuandi; Xu, Kenong

    2016-01-01

    Phytohormone ethylene largely determines apple fruit shelf life and storability. Previous studies demonstrated that MdACS1 and MdACS3a, which encode 1-aminocyclopropane-1-carboxylic acid synthases (ACS), are crucial in apple fruit ethylene production. MdACS1 is well-known to be intimately involved in the climacteric ethylene burst in fruit ripening, while MdACS3a has been regarded a main regulator for ethylene production transition from system 1 (during fruit development) to system 2 (during fruit ripening). However, MdACS3a was also shown to have limited roles in initiating the ripening process lately. To better assess their roles, fruit ethylene production and softening were evaluated at five time points during a 20-day post-harvest period in 97 Malus accessions and in 34 progeny from 2 controlled crosses. Allelotyping was accomplished using an existing marker (ACS1) for MdACS1 and two markers (CAPS866 and CAPS870) developed here to specifically detect the two null alleles (ACS3a-G289V and Mdacs3a) of MdACS3a. In total, 952 Malus accessions were allelotyped with the three markers. The major findings included: The effect of MdACS1 was significant on fruit ethylene production and softening while that of MdACS3a was less detectable; allele MdACS1–2 was significantly associated with low ethylene and slow softening; under the same background of the MdACS1 allelotypes, null allele Mdacs3a (not ACS3a-G289V) could confer a significant delay of ethylene peak; alleles MdACS1–2 and Mdacs3a (excluding ACS3a-G289V) were highly enriched in M. domestica and M. hybrid when compared with those in M. sieversii. These findings are of practical implications in developing apples of low and delayed ethylene profiles by utilizing the beneficial alleles MdACS1-2 and Mdacs3a. PMID:27231553

  4. Speed Control of DC Motor using AC/AC/DC Converter Based on Intelligent Techniques

    Rakan Kh Antar

    2013-01-01

       This paper describes the application of ac/ac/dc and ac/dc converters to control the speed of a separately excited DC motor. Artificial neural network and PI controller are trained to select the desired values of firing angles for triggering thyristors of the ac/ac/dc and ac/dc bridge converters in order to control the speed of the dc motor at a desired value with constant and different load torques in order to obtain the best speed response. Simulation results show that the rising time fo...

  5. Universality of ac conduction in disordered solids

    Dyre, Jeppe; Schrøder, Thomas

    2000-01-01

    non-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally......The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual...

  6. Aroma characterization based on aromatic series analysis in table grapes

    Wu, Yusen; Duan, Shuyan; Zhao, Liping; Gao, Zhen; Luo, Meng; Song, Shiren; Xu, Wenping; Zhang, Caixi; Ma, Chao; Wang, Shiping

    2016-01-01

    Aroma is an important part of quality in table grape, but the key aroma compounds and the aroma series of table grapes remains unknown. In this paper, we identified 67 aroma compounds in 20 table grape cultivars; 20 in pulp and 23 in skin were active compounds. C6 compounds were the basic background volatiles, but the aroma contents of pulp juice and skin depended mainly on the levels of esters and terpenes, respectively. Most obviously, ‘Kyoho’ grapevine series showed high contents of esters in pulp, while Muscat/floral cultivars showed abundant monoterpenes in skin. For the aroma series, table grapes were characterized mainly by herbaceous, floral, balsamic, sweet and fruity series. The simple and visualizable aroma profiles were established using aroma fingerprints based on the aromatic series. Hierarchical cluster analysis (HCA) and principal component analysis (PCA) showed that the aroma profiles of pulp juice, skin and whole berries could be classified into 5, 3, and 5 groups, respectively. Combined with sensory evaluation, we could conclude that fatty and balsamic series were the preferred aromatic series, and the contents of their contributors (β-ionone and octanal) may be useful as indicators for the improvement of breeding and cultivation measures for table grapes. PMID:27487935

  7. Aroma characterization based on aromatic series analysis in table grapes.

    Wu, Yusen; Duan, Shuyan; Zhao, Liping; Gao, Zhen; Luo, Meng; Song, Shiren; Xu, Wenping; Zhang, Caixi; Ma, Chao; Wang, Shiping

    2016-01-01

    Aroma is an important part of quality in table grape, but the key aroma compounds and the aroma series of table grapes remains unknown. In this paper, we identified 67 aroma compounds in 20 table grape cultivars; 20 in pulp and 23 in skin were active compounds. C6 compounds were the basic background volatiles, but the aroma contents of pulp juice and skin depended mainly on the levels of esters and terpenes, respectively. Most obviously, 'Kyoho' grapevine series showed high contents of esters in pulp, while Muscat/floral cultivars showed abundant monoterpenes in skin. For the aroma series, table grapes were characterized mainly by herbaceous, floral, balsamic, sweet and fruity series. The simple and visualizable aroma profiles were established using aroma fingerprints based on the aromatic series. Hierarchical cluster analysis (HCA) and principal component analysis (PCA) showed that the aroma profiles of pulp juice, skin and whole berries could be classified into 5, 3, and 5 groups, respectively. Combined with sensory evaluation, we could conclude that fatty and balsamic series were the preferred aromatic series, and the contents of their contributors (β-ionone and octanal) may be useful as indicators for the improvement of breeding and cultivation measures for table grapes. PMID:27487935

  8. Short term dynamic aperture with AC dipoles

    Mönig, Saskia; Persson, Tobias Hakan Bjorn; Coello De Portugal, Jaime; Langner, Andy; Tomas, Rogelio; CERN. Geneva. ATS Department

    2015-01-01

    The dynamic aperture of an accelerator is determined by its non-linear components and errors. Control of the dynamic aperture is important for a good understanding and operation of the accelerator. The AC dipole, installed in the LHC for the diagnostic of linear and non-linear optics, could serve as a tool for the determination of the dynamic aperture. However, since the AC dipole itself modifies the non-linear dynamics, the dynamic aperture with and without AC dipole are expected to differ. The effect of the AC dipole on the dynamic aperture is studied within this note.

  9. DESARROLLO RURAL A.C.

    Alfredo Aguilar Valdés

    2015-01-01

    Full Text Available El objetivo de este trabajo fue analizar el diagnostico situacional de una Empresa de Servicios Profesionales en el caso de: Instituto de Promoción Para el Desarrollo Rural A.C., a través de la Metodología “UALAE” así como la oportunidad que como empresa presenta. Este estudio se realizó en el municipio de Saltillo, Coahuila, México. Adoptó esta Metodología UALAE y se difundió su opinión. El Instituto de Promoción Para el Desarrollo Rural A.C., está formado por profesionistas y productores cuya finalidad es la de contribuir al desarrollo del medio rural con proyectos de viabilidad técnica, económica y social, sobre la base de necesidades reales y al aprovechamiento sustentable del potencial de los recursos naturales. Su buen funcionamiento es indispensable e importante para el desarrollo de los productores agropecuarios principalmente, debido a que se ven muy beneficiados con todos los servicios que se les brinda, se han logrado buenos proyectos, buenas capacitaciones y un gran crecimiento de sus productos. Mediante el proceso de asistencia técnica a organizaciones de productores, se induce la formulación adecuada de proyectos viables desde el punto visto del mercado, la rentabilidad económica, las tecnologías disponibles y de la organización social.

  10. ac electroosmosis in rectangular microchannels.

    Campisi, Michele; Accoto, Dino; Dario, Paolo

    2005-11-22

    Motivated by the growing interest in ac electroosmosis as a reliable no moving parts strategy to control fluid motion in microfluidic devices for biomedical applications, such as lab-on-a-chip, we study transient and steady-state electrokinetic phenomena (electroosmosis and streaming currents) in infinitely extended rectangular charged microchannels. With the aid of Fourier series and Laplace transforms we provide a general formal solution of the problem, which is used to study the time-dependent response to sudden ac applied voltage differences in case of finite electric double layer. The Debye-Huckel approximation has been adopted to allow for an algebraic solution of the Poisson-Boltzmann problem in Fourier space. We obtain the expressions of flow velocity profiles, flow rates, streaming currents, as well as expressions of the complex hydraulic and electrokinetic conductances. We analyze in detail the dependence of the electrokinetic conductance on the extension of linear dimensions relative to the Debye length, with an eye on finite electric double layer effects. PMID:16351310

  11. The Alfonsine tables of Toledo

    Chabás, José

    2003-01-01

    The Alfonsine Tables of Toledo is for historians working in the fields of astronomy, science, the Middle Ages, Spanish and other Romance languages. It is also of interest to scholars interested in the history of Castile, in Castilian-French relations in the Middle Ages and in the history of patronage. It explores the Castilian canons of the Alfonsine Tables and offers a study of their context, language, astronomical content, and diffusion. The Alfonsine Tables of Toledo is unique in that it: includes an edition of a crucial text in history of science; provides an explanation of astronomy as it was practiced in the Middle Ages; presents abundant material on early scientific language in Castilian; presents new material on the diffusion of Alfonsine astronomy in Europe; describes the role of royal patronage of science in a medieval context.

  12. AcEST: DK960083 [AcEST

    Full Text Available ome P450 71D7 OS=Solanum chacoense ... 96 1e-19 sp|Q9SAB6|C71AI_ARATH Cytochrome ...... 96 2e-19 sp|P93530|C71D6_SOLCH Cytochrome P450 71D6 OS=Solanum chacoense ... 94 5e-19 sp|Q9T0K2|C71AK_AR... paten... 176 1e-42 tr|Q9AXP9|Q9AXP9_POPJC Cinnamate 4-hydroxylase OS=Populus jackii... 176 2e-42 tr|Q40907|Q40907_POPKI Cinnamic ac...8 KVVQQSRGAWEDEALRVIQDLKA 160 >tr|Q9AXP9|Q9AXP9_POPJC Cinnamate 4-hydroxylase OS=Populus jackii GN=C4H PE=2 ...e-42 tr|A9PBZ7|A9PBZ7_POPTR Putative uncharacterized protein OS=Popul... 176 2e-4

  13. AcEST: DK955376 [AcEST

    Full Text Available TST39A01NGRL0022_O23 611 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0022_O23. 5' end seq ... LMDETRAAGIKL 210 Query: 602 AIC 610 A+C Sbjct: 211 AVC ... 213 >tr|A9SM81|A9SM81_PHYPA Predicted protein OS=P ... C 610 VLELMD A+ KGLKVA+C Sbjct: 196 VLELMDAAREKGLKVAVC ... 213 >tr|Q8L7U1|Q8L7U1_ARATH AT4g39970/T5J17_140 OS ... LKVAIC 610 LMDEA+A G K+A+C Sbjct: 182 RLMDEAKAAGKKLAVC ... 197 >tr|Q680K2|Q680K2_ARATH MRNA, complete cds, cl ... LKVAIC 610 LMDEA+A G K+A+C Sbjct: 182 RLMDEAKAAGKKLAVC ... 197 >tr|Q8LAS1|Q8LAS1_ARATH Putative uncharacteriz ...

  14. AcEST: BP913416 [AcEST

    Full Text Available GCATGTAGTTTGGA CAGAGATG ■■Homology search results ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swi...AC_BACFN Uronate isomerase OS=Bacteroides fragilis (... 30 4.5 sp|Q3ITT7|SYA_NATPD Alanyl-tRNA synthetase OS=Natronomonas phar...C++ N IP+ M C Sbjct: 417 LSYPRHEYFRRTLCNLLGCDVENGEIPLSEMERVC 451 >sp|Q3ITT7|SYA_NATPD Alanyl-tRNA synthetase OS=Natronomonas phar...ng, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database searc...148,809,765 total letters Searching..................................................done Score E Sequences

  15. AcEST: BP920845 [AcEST

    Full Text Available 45|Adiantum capillus-veneris mRNA, clone: YMU001_000142_D08. (514 letters) Database: uniprot_sprot.fasta 412,525 seq...P7 OS=Magnapor... 33 1.0 sp|Q7VF68|SYH_HELHP Histidyl-tRNA synthetase OS=Helicobacter hep... 31 3.8 sp|P1305...90 FTGFLVLHSEPRQQPQVDL 1608 >sp|A4QX49|DBP7_MAGGR ATP-dependent RNA helicase DBP7 OS=Magnaporthe grise...T PT VT+H + T+ AC+ A+TT+ H H Sbjct: 481 PPKETKPTK------PVTNHTESTVGKACYITSAANTTITLHKLH 519 >sp|Q7VF68|SYH_HELHP His...rot_trembl.fasta 7,341,751 sequences; 2,391,615,440 total letters Searching.................................

  16. AcEST: DK953324 [AcEST

    Full Text Available |LSRR_PHOLL Transcriptional regulator lsrR OS=Photorhab... 30 6.1 sp|A0JY64|ATPB_ARTS2 ATP synthase subunit beta OS=Arthroba...cter s... 30 6.1 sp|A1R7V3|ATPB_ARTAT ATP synthase subunit beta OS=Arthroba...ATP synthase subunit beta OS=Arthrobacter sp. (strain FB24) GN=atpD PE=3 SV=1 Len...KD 372 Query: 311 HLHFTHRGKQRL 346 H + R KQ L Sbjct: 373 HYNTAVRVKQIL 384 >sp|A1R7V3|ATPB_ARTAT ATP synthase subunit beta OS=Arthroba...T and PSI-BLAST: a new generation of protein database search programs, Nucleic Ac

  17. AcEST: DK945049 [AcEST

    Full Text Available R 148 >sp|Q9X5X3|ATCU_SINMW Copper-transporting P-type ATPase OS=Sinorhizobium medicae (strain WSM419) GN=ac...|Q4EPP8|Q4EPP8_LISMO Heavy metal-binding protein OS=Listeria m... 34 3.2 tr|A6AST1|A6AST1_VIBHA Copper-trans..... 31 2.7 sp|Q4X0S7|DPH1_ASPFU Diphthamide biosynthesis protein 1 OS=Asper... 30 4.5 sp|A2VDJ0|T131L_HUMAN Transmembran...P58342|ATCU2_RHIME Copper-transporting ATPase 2 OS=Rhizobium meliloti Align length 75 Score (bit) 34.7 E-val...sophila ... 30 7.8 >sp|P58342|ATCU2_RHIME Copper-transporting ATPase 2 OS=Rhizobium me

  18. AcEST: BP916217 [AcEST

    Full Text Available inase kinase 7-interacting protein 3 OS=Mus musculus Align length 119 Score (bit) 35.0 E-value 0.16 Report B...visiae GN... 30 6.8 >sp|Q571K4|TAB3_MOUSE Mitogen-activated protein kinase kinase kinase 7-interacting protein 3 OS=Mus musculus...protein kinase kinase kinase 7 interacting protein 3 OS=Mus musculus GN=Map3k7ip3 PE=2 SV=1 Length = 716 Sco...(3)malignant brain tumor-like 2 prot... 31 2.3 sp|P33234|ADIY_ECOLI HTH-type transcriptional regulator adiY ...ZZC3_PSEU2 Membrane protein, putative OS=Pseudomonas... 35 2.5 tr|Q5U7D5|Q5U7D5_9BACI OpuAC OS=Halobacillus trueperi GN=opu

  19. AcEST: DK947388 [AcEST

    Full Text Available Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Ac...ids Res. 25:3389-3402. Query= DK947388|Adiantum capillus-veneris mRNA, clone: YMU02A01NGRL0015_L18, 5' (587 letters) Databa... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK947388|Adiantum c...apillus-veneris mRNA, clone: YMU02A01NGRL0015_L18, 5' (587 letters) Database: uniprot_trembl.fasta...-ribosylation factor 1 OS=Salix bakko GN... 268 1e-71 sp|P49076|ARF_MAIZE ADP-ribosylation factor OS=Zea may

  20. Comparison And Application Of Table Manners In Cross-cultural Communication

    陈俊屹

    2015-01-01

    Table etiquette reflects the social-cultural meaning and values of a nation. With the development of China’s opening-up, and more western culture gets into our sights. The dining table is one of the most important places where good manners are displayed. Elegant manners at the table may bring friendship and even success. The different table manners between Chinese and British are the core of this thesis. By comparison of table manners between China and Britain, the thesis aims to make a research on the cultural differences in seating arrangement, using tableware, serving order, dining atmosphere and toasting. Furthermore, this paper displays some taboos of table manners in Chinese and British dinners, which helps a better understanding of the customs.Also,the author collected some business etiquette used in real commercial field and do a lot of investigations. With the comparative research into cultural contrast of table manners in China and Britain, I suggest that you should combine the theory and practice of table manners, understand each cultural background clearly and deeply. Therefore, we can take a better utilization of table manners in social communication and commercial affairs. I hope this paper can help people achieve a successful cross-cultural communication.

  1. JEM-X background models

    Huovelin, J.; Maisala, S.; Schultz, J.;

    2003-01-01

    revolution 41 of INTEGRAL. Total observing time used for the analysis was 216 502 s, with the average of 25 cps of background for each of the two JEM-X telescopes. JEM-X1 showed slightly higher average background intensity than JEM-X2. The detectors were stable during the long exposures, and weak orbital...... phase dependence in the background outside radiation belts was observed. The analysis yielded an average of 5 cps for the diffuse background, and 20 cps for the instrument background. The instrument background was found highly dependent on position, both for spectral shape and intensity. Diff use...... background was enhanced in the central area of a detector, and it decreased radially towards the edge, with a clear vignetting effect for both JEM-X units. The instrument background was weakest in the central area of a detector and showed a steep increase at the very edges of both JEM-X detectors, with...

  2. Spectral clustering and biclustering learning large graphs and contingency tables

    Bolla, Marianna

    2013-01-01

    Explores regular structures in graphs and contingency tables by spectral theory and statistical methods This book bridges the gap between graph theory and statistics by giving answers to the demanding questions which arise when statisticians are confronted with large weighted graphs or rectangular arrays. Classical and modern statistical methods applicable to biological, social, communication networks, or microarrays are presented together with the theoretical background and proofs. This book is suitable for a one-semester course for graduate students in data mining, mult

  3. Supergravity backgrounds and symmetry superalgebras

    Ertem, Ümit

    2016-01-01

    We consider the bosonic sectors of supergravity theories in ten and eleven dimensions which correspond to the low energy limits of string theories and M-theory. The solutions of supergravity field equations are known as supergravity backgrounds and the number of preserved supersymmetries in those backgrounds are determined by Killing spinors. We provide some examples of supergravity backgrounds which preserve different fractions of supersymmetry. An important invariant for the characterization of supergravity backgrounds is their Killing superalgebras which are constructed out of Killing vectors and Killing spinors of the background. After constructing Killing superalgebras of some special supergravity backgrounds, we discuss about the possibilities of the extensions of these superalgebras to include the higher degree hidden symmetries of the background.

  4. 76 FR 49569 - Use of Actuarial Tables in Valuing Annuities, Interests for Life or Terms of Years, and Remainder...

    2011-08-10

    ...: Background On May 7, 2009, the IRS published in the Federal Register (74 FR 21438 and 74 FR 21519) final and... Use of Actuarial Tables in Valuing Annuities, Interests for Life or Terms of Years, and Remainder or..., and 25 RIN 1545-BH67 Use of Actuarial Tables in Valuing Annuities, Interests for Life or Terms...

  5. Ken Thompson's 6-man Tables

    Tamplin, John T; Haworth, Guy McCrossan

    2001-01-01

    Ken Thompson recently communicated some results mined from his set of 64 6-man endgame tables. These list some positions of interest, namely, mutual zugzwangs and those of maximum depth. The results have been analysed by the authors and found to be identical or compatible with the available or published findings of Karrer, Nalimov, Stiller and Wirth.

  6. Superconductivity and the periodic table

    Compiled data on superconducting transition temperature Tc for pure metals (including amorphous and high-pressure phases) from the first, second, and third long periods of the Periodic Table and for their analogous compounds show that a significant regularity exists in the relative values of Tc

  7. Putting food on the table

    Candel, J.J.L.

    2016-01-01

    Putting food on the table: the European Union governance of the wicked problem of food security Jeroen Candel Food security concerns and arguments have made a revival in European Union (EU) governance since the 2007-8 and 2010 global food price crises. This renaissa

  8. Sand and Water Table Play

    Wallace, Ann H.; White, Mary J.; Stone, Ryan

    2010-01-01

    The authors observed preschoolers engaged at the sand and water table to determine if math could be found within their play. Wanting to understand how children interact with provided materials and what kinds of math ideas they explore during these interactions, the authors offer practical examples of how such play can promote mathematical…

  9. NNDSS - Table II. Lyme disease to Meningococcal

    U.S. Department of Health & Human Services — NNDSS - Table II. Lyme disease to Meningococcal - 2014In this Table, all conditions with a 5-year average annual national total of more than or equals 1,000 cases...

  10. NNDSS - Table II. Shiga toxin to Shigellosis

    U.S. Department of Health & Human Services — NNDSS - Table II. Shiga toxin to Shigellosis - 2015. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  11. NNDSS - Table II. Shiga toxin to Shigellosis

    U.S. Department of Health & Human Services — NNDSS - Table II. Shiga toxin to Shigellosis - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during the...

  12. NNDSS - Table II. Tetanus to Vibriosis

    U.S. Department of Health & Human Services — NNDSS - Table II. Tetanus to Vibriosis - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding year),...

  13. NNDSS - Table II. Cryptosporidiosis to Dengue

    U.S. Department of Health & Human Services — NNDSS - Table II. Cryptosporidiosis to Dengue - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during the...

  14. NNDSS - Table II. Mumps to Rabies, animal

    U.S. Department of Health & Human Services — NNDSS - Table II. Mumps to Rabies, animal - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  15. NNDSS - Table II. Babesiosis to Coccidioidomycosis

    U.S. Department of Health & Human Services — NNDSS - Table II. Babesiosis to Coccidioidomycosis - 2014.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  16. NNDSS - Table II. Salmonellosis to Shigellosis

    U.S. Department of Health & Human Services — NNDSS - Table II. Salmonellosis to Shigellosis - 2014. In this Table, all conditions with a 5-year average annual national total of more than or equals 1,000 cases...

  17. NNDSS - Table II. Lyme disease to Meningococcal

    U.S. Department of Health & Human Services — NNDSS - Table II. Lyme disease to Meningococcal - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during the...

  18. NNDSS - Table I. infrequently reported notifiable diseases

    U.S. Department of Health & Human Services — NNDSS - Table I. infrequently reported notifiable diseases - 2014.In this Table, provisional cases of selected infrequently reported notifiable diseases (<1,000...

  19. NNDSS - Table I. infrequently reported notifiable diseases

    U.S. Department of Health & Human Services — NNDSS - Table I. infrequently reported notifiable diseases - 2016. In this Table, provisional* cases of selected†infrequently reported notifiable diseases...

  20. NNDSS - Table II. Ehrlichiosis/Anaplasmosis

    U.S. Department of Health & Human Services — NNDSS - Table II. Ehrlichiosis/Anaplasmosis - 2014.In this Table, all conditions with a 5-year average annual national total of more than or equals 1,000 cases but...

  1. NNDSS - Table II. Mumps to Rabies, animal

    U.S. Department of Health & Human Services — NNDSS - Table II. Mumps to Rabies, animal - 2014.In this Table, all conditions with a 5-year average annual national total of more than or equals 1,000 cases but...

  2. NNDSS - Table II. Chlamydia to Coccidioidomycosis

    U.S. Department of Health & Human Services — NNDSS - Table II. Chlamydia to Coccidioidomycosis - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  3. Global Reference Tables for Production Systems.

    Social Security Administration — This database is a collection of reference tables that store common information used throughout SSA. These tables standardized code structures and code usage of SSA...

  4. NNDSS - Table II. Giardiasis to Haemophilus influenza

    U.S. Department of Health & Human Services — NNDSS - Table II. Giardiasis to Haemophilus influenza - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during...

  5. NNDSS - Table II. Tetanus to Vibriosis

    U.S. Department of Health & Human Services — NNDSS - Table II. Tetanus to Vibriosis - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during the preceding...

  6. NNDSS - Table II. Rubella to Salmonellosis

    U.S. Department of Health & Human Services — NNDSS - Table II. Rubella to Salmonellosis - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during the preceding...

  7. NNDSS - Table II. Ehrlichiosis/Anaplasmosis

    U.S. Department of Health & Human Services — NNDSS - Table II. Ehrlichiosis/Anaplasmosis - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during the...

  8. NNDSS - Table II. Chlamydia to Coccidioidomycosis

    U.S. Department of Health & Human Services — NNDSS - Table II. Chlamydia to Coccidioidomycosis - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during the...

  9. A new pattern of the periodic table

    Brajendra Nath Tripathi

    1962-07-01

    Full Text Available A new pattern of the Periodic Table is described which incorporates all the points for which various models of two or three dimensional tables have been proposed from time to time.

  10. NNDSS - Table II. Giardiasis to Haemophilus influenza

    U.S. Department of Health & Human Services — NNDSS - Table II. Giardiasis to Haemophilus influenza - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  11. NNDSS - Table II. Giardiasis to Haemophilus influenza

    U.S. Department of Health & Human Services — NNDSS - Table II. Giardiasis to Haemophilus influenza - 2014. In this Table, all conditions with a 5-year average annual national total of more than or equals 1,000...

  12. New algebraic tables of SU(2) quantities

    Formulas for Clebsch-Gordan Coefficients, 6-j symbols and 9-j symbols of SU(2) are presented in a ready-to-program way for obtaining algebraic tables. An excerpt of the complete tables are also presented. (Author)

  13. Global Reference Tables for Management Information Systems.

    Social Security Administration — This database is a collection of reference tables that store common information used throughout SSA. These tables standardize code structures and code usage of SSA...

  14. NNDSS - Table II. Lyme disease to Meningococcal

    U.S. Department of Health & Human Services — NNDSS - Table II. Lyme disease to Meningococcal - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  15. NNDSS - Table II. Ehrlichiosis/Anaplasmosis

    U.S. Department of Health & Human Services — NNDSS - Table II. Ehrlichiosis/Anaplasmosis - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  16. NNDSS - Table II. Rubella to Salmonellosis

    U.S. Department of Health & Human Services — NNDSS - Table II. Rubella to Salmonellosis - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  17. NNDSS - Table II. Babesiosis to Campylobacteriosis

    U.S. Department of Health & Human Services — NNDSS - Table II. Babesiosis to Campylobacteriosis - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  18. Water-table contours of Nevada

    U.S. Geological Survey, Department of the Interior — This data set consists of water-table contours for Nevada. These data were created as part of an effort to provide statewide information on water table and depth to...

  19. NNDSS - Table II. Babesiosis to Campylobacteriosis

    U.S. Department of Health & Human Services — NNDSS - Table II. Babesiosis to Campylobacteriosis - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during the...

  20. NNDSS - Table II. Cryptosporidiosis to Dengue

    U.S. Department of Health & Human Services — NNDSS - Table II. Cryptosporidiosis to Dengue - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  1. NNDSS - Table II. Invasive Pneumococcal to Legionellosis

    U.S. Department of Health & Human Services — NNDSS - Table II. Invasive Pneumococcal to Legionellosis - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during...

  2. NNDSS - Table II. Invasive Pneumococcal to Legionellosis

    U.S. Department of Health & Human Services — NNDSS - Table II. Invasive Pneumococcal to Legionellosis - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  3. NNDSS - Table II. Invasive Pneumococcal to Legionellosis

    U.S. Department of Health & Human Services — NNDSS - Table II. Invasive Pneumococcal to Legionellosis - 2014.In this Table, all conditions with a 5-year average annual national total of more than or equals...

  4. NNDSS - Table II. Hepatitis (viral, acute)

    U.S. Department of Health & Human Services — NNDSS - Table II. Hepatitis (viral, acute) - 2014.In this Table, all conditions with a 5-year average annual national total of more than or equals 1,000 cases but...

  5. NNDSS - Table II. Hepatitis (viral, acute)

    U.S. Department of Health & Human Services — NNDSS - Table II. Hepatitis (viral, acute) - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  6. NNDSS - Table II. Hepatitis (viral, acute)

    U.S. Department of Health & Human Services — NNDSS - Table II. Hepatitis (viral, acute) - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during the preceding...

  7. NNDSS - Table I. infrequently reported notifiable diseases

    U.S. Department of Health & Human Services — NNDSS - Table I. infrequently reported notifiable diseases - 2015. In this Table, provisional cases of selected infrequently reported notifiable diseases (<1,000...

  8. NNDSS - Table II. West Nile virus disease

    U.S. Department of Health & Human Services — NNDSS - Table II. West Nile virus disease - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  9. SINGLE PHASE HIGH FREQUENCY AC CONVERTER FOR INDUCTION HEATING APPLICATION

    M.A INAYATHULLAAH,; Dr. R. Anita

    2010-01-01

    The proposed topology reduces the total harmonic distortion (THD) of a high frequency AC/AC Converter well below the acceptable limit. This paper deals with a novel single phase AC/DC/AC soft switching utility frequency AC to high frequency AC converter. In this paper a single phase full bridge inverter with Vienna rectifier as front end is used instead of conventional diode bridge rectifier to provide continuous sinusoidal input current with nearly unity power factor at the source side with ...

  10. New reference tables and user-friendly Internet application for predicted heart weights

    Vanhaebost, Jessica; Faouzi, Mohamed; Mangin, Patrice; Michaud, Katarzyna

    2014-01-01

    BACKGROUND: Knowledge of normal heart weight ranges is important information for pathologists. Comparing the measured heart weight to reference values is one of the key elements used to determine if the heart is pathological, as heart weight increases in many cardiac pathologies. The current reference tables are old and in need of an update. AIMS: The purposes of this study are to establish new reference tables for normal heart weights in the local population and to determine the best pred...

  11. Periodic table as a Binary table for Drug Encryption

    M. Yamuna; Karthika, K.

    2014-01-01

    Modern living styles and change is food habits have lead to new diseases and this number is getting multiplied. Research regarding finding medicines for these diseases is in active process and new drugs get released in market frequent. In developing these new drugs communicating details of these findings cannot be avoided. Any drug is best represented using its molecular formula. In this paper we have developed a new binary periodic table and hence use this for encrypting details about any drug.

  12. Background subtraction theory and practice

    Elgammal, Ahmed

    2014-01-01

    Background subtraction is a widely used concept for detection of moving objects in videos. In the last two decades there has been a lot of development in designing algorithms for background subtraction, as well as wide use of these algorithms in various important applications, such as visual surveillance, sports video analysis, motion capture, etc. Various statistical approaches have been proposed to model scene backgrounds. The concept of background subtraction also has been extended to detect objects from videos captured from moving cameras. This book reviews the concept and practice of back

  13. The exenatide analogue AC3174 attenuates hypertension, insulin resistance, and renal dysfunction in Dahl salt-sensitive rats

    Fernandez Rayne

    2010-08-01

    Full Text Available Abstract Background Activation of glucagon-like peptide-1 (GLP-1 receptors improves insulin sensitivity and induces vasodilatation and diuresis. AC3174 is a peptide analogue with pharmacologic properties similar to the GLP-1 receptor agonist, exenatide. Hypothetically, chronic AC3174 treatment could attenuate salt-induced hypertension, cardiac morbidity, insulin resistance, and renal dysfunction in Dahl salt-sensitive (DSS rats. Methods DSS rats were fed low salt (LS, 0.3% NaCl or high salt (HS, 8% NaCl diets. HS rats were treated with vehicle, AC3174 (1.7 pmol/kg/min, or GLP-1 (25 pmol/kg/min for 4 weeks via subcutaneous infusion. Other HS rats received captopril (150 mg/kg/day or AC3174 plus captopril. Results HS rat survival was improved by all treatments except GLP-1. Systolic blood pressure (SBP was lower in LS rats and in GLP-1, AC3174, captopril, or AC3174 plus captopril HS rats than in vehicle HS rats (p Conclusions Thus, AC3174 had antihypertensive, cardioprotective, insulin-sensitizing, and renoprotective effects in the DSS hypertensive rat model. Furthermore, AC3174 improved animal survival, an effect not observed with GLP-1.

  14. The Different Periodic Tables of Dmitrii Mendeleev

    Laing, Michael

    2008-01-01

    Between 1869 and 1905 the Russian chemist Dmitrii Mendeleev published several tables with different arrangements of the chemical elements. Four of these are compared with periodic tables by Russian scientists from 1934 and 1969. The difficulties caused by the lanthanoid elements are clearly seen in the table of 1905, which satisfactorily includes…

  15. Multiple mobile operating tables for eye surgery

    Pons J.

    2010-01-01

    High-volume eye surgery requires that patients be moved quickly in and out of the operating room (OR). Static operating tables in the OR make this difficult. Better patient flow can be achieved when using mobile tables, which can be expensive. We have developed an economical, wheeled operating table that can be constructed in a local engineering workshop.

  16. 21 CFR 890.3750 - Mechanical table.

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Mechanical table. 890.3750 Section 890.3750 Food... DEVICES PHYSICAL MEDICINE DEVICES Physical Medicine Prosthetic Devices § 890.3750 Mechanical table. (a) Identification. A mechanical table is a device intended for medical purposes that has a flat surface that can...

  17. Characterization of AcMNPV with a deletion of ac69 gene

    Jianhao Ke

    2011-07-01

    Full Text Available ORF69 (Ac69 of Autographa californica multiple nucleopolyhedrovirus (AcMNPV is conserved in some baculovirus genomes. Although it has been shown that Ac69 has cap 0-dependent methyltransferase activity and is not required for budded virus production in Spodoptera frugiperda Sf-9 cells, its role in occlusion-derived virus synthesis and virus oral infectivity is not known. This paper describes generation of an ac69 knockout AcMNPV bacmid mutant and analyses of the influence of ac69 deletion on the viral infectivity in Sf-9 cells and Trichoplusia ni larvae so as to investigate the role of ac69 in the viral life cycle. Results indicated that ac69 deletion has little effect on the production rates and morphogenesis of budded virus and occlusion-derived virus in Sf-9 cells. In addition, animal experiment revealed that the deletion mutant did not affect AcMNPV infectivity for Trichoplusia ni larvae in LD50 and LT50 bioassay when administered orally. These results suggest that ac69 may be dispensable for viral infectivity both in vitro and in vivo.

  18. Hanford Site background: Part 1, Soil background for nonradioactive analytes

    The determination of soil background is one of the most important activities supporting environmental restoration and waste management on the Hanford Site. Background compositions serve as the basis for identifying soil contamination, and also as a baseline in risk assessment processes used to determine soil cleanup and treatment levels. These uses of soil background require an understanding of the extent to which analytes of concern occur naturally in the soils. This report documents the results of sampling and analysis activities designed to characterize the composition of soil background at the Hanford Site, and to evaluate the feasibility for use as Sitewide background. The compositions of naturally occurring soils in the vadose Zone have been-determined for-nonradioactive inorganic and organic analytes and related physical properties. These results confirm that a Sitewide approach to the characterization of soil background is technically sound and is a viable alternative to the determination and use of numerous local or area backgrounds that yield inconsistent definitions of contamination. Sitewide soil background consists of several types of data and is appropriate for use in identifying contamination in all soils in the vadose zone on the Hanford Site. The natural concentrations of nearly every inorganic analyte extend to levels that exceed calculated health-based cleanup limits. The levels of most inorganic analytes, however, are well below these health-based limits. The highest measured background concentrations occur in three volumetrically minor soil types, the most important of which are topsoils adjacent to the Columbia River that are rich in organic carbon. No organic analyte levels above detection were found in any of the soil samples

  19. Noise reduction in AC-coupled amplifiers

    Serrano Finetti, Roberto Ernesto; Pallàs Areny, Ramon

    2014-01-01

    AC-coupled amplifiers are noisier than dc-coupled amplifiers because of the thermal noise of the resistor(s) in the ac-coupling network and the increased contribution of the amplifier input noise current i(n). Both contributions, however, diminish if the corner frequency f(c) of the high-pass filter observed by the signal is lowered, the cost being a longer transient response. At the same time, the presence of large resistors in the ac-coupling network suggests that the use of FET-input ampli...

  20. Background reduction in cryogenic detectors

    Bauer, Daniel A.; /Fermilab

    2005-04-01

    This paper discusses the background reduction and rejection strategy of the Cryogenic Dark Matter Search (CDMS) experiment. Recent measurements of background levels from CDMS II at Soudan are presented, along with estimates for future improvements in sensitivity expected for a proposed SuperCDMS experiment at SNOLAB.

  1. Children of ethnic minority backgrounds

    Johansen, Stine Liv

    2010-01-01

    Children of ethnic minority background balance their everyday life between a cultural background rooted in their ethnic origin and a daily life in day care, schools and with peers that is founded in a majority culture. This means, among other things, that they often will have access to different ...

  2. Superconductivity and the Periodic Table

    In view of the inability of the present theory of superconductivity to make reliable predictions for the magnitude of Tsub(c) it seems useful to search for empirical relationships between the composition of the compound and the Tsub(c) value. Table I gives a list of the available Tsub(c) data for transition metals (TM) having from 3 to 9 outer electrons and Tsub(c) data for non-transition elements (NTE) of groups IIB, IIIB and IVB, including data for amorphous (Am) structures and structures (marked by triangles) obtained at high pressures. The analogous metals have therefore the same structure. In Tables II to IV the Tsub(c) data are presented for analogous compounds of NTE from IB - VIB group. Conclusions are presented. (author)

  3. The Periodic Table in Flatland

    Negadi, T.; Kibler, M.

    1995-01-01

    The $D$-dimensional Coulomb system serves as a starting point for generating generalized atomic shells. These shells are ordered according to a generalized Madelung rule in $D$ dimensions. This rule together with an {\\it Aufbau Prinzip} is applied to produce a $D$-dimensional periodic table. A model is developed to rationalize the ordering of the shells predicted by the generalized Madelung rule. This model is based on the introduction of an Hamiltonian, invariant under the $q$-deformed algeb...

  4. The Politics of League Tables

    Gita Steiner-Khamsi

    2003-01-01

    The article focuses on the political usages of OECD- and IEA-type studies on student achievement, and suggests that we examine in more detail how policy makers use results from international comparisons to advance fundamental school reform at national level. The author categorizes three types of policy reactions to league tables: (1) scandalization, (2) glorification, and (3) indifference. Drawing from media reports and policy debates that emerged right after the release of the results from T...

  5. Design of small table saws

    Stuchlík, Petr

    2016-01-01

    The main aim of this thesis is the engineering design of a small table circular saw according to the specified parameters. At first, the types of machines available on the market are named and analyzed in detail. Afterwards, the engineering design of the machine is created. The following part is concerned with the individual parts,, tilting of the saw blade, maximum cutting pull through linkage with motion screw and checking of deformation of he critical parts of the machine. The previously s...

  6. Managing Restaurant Tables using Constraints

    Vidotto, Alfio; Brown, Kenneth N.; Beck, J. Christopher

    Restaurant table management can have significant impact on both profitability and the customer experience. The core of the issue is a complex dynamic combinatorial problem. We show how to model the problem as constraint satisfaction, with extensions which generate flexible seating plans and which maintain stability when changes occur. We describe an implemented system which provides advice to users in real time. The system is currently being evaluated in a restaurant environment.

  7. Guide to mathematical tables supplement no 1

    Burunova, N M; Fedorova, R M

    2014-01-01

    A Guide to Mathematical Tables is a supplement to the Guide to Mathematical Tables published by the U.S.S.R. Academy of Sciences in 1956. The tables contain information on subjects such as powers, rational and algebraic functions, and trigonometric functions, as well as logarithms and polynomials and Legendre functions. An index listing all functions included in both the Guide and the Supplement is included.Comprised of 15 chapters, this supplement first describes mathematical tables in the following order: the accuracy of the table (that is, the number of decimal places or significant

  8. Calculation of background lifetime risk of cancer mortality in Japan

    This study was designed to calculate the background lifetime risk of cancer mortality in Japan. The mortality and population data obtained from national surveys for the vital statistics and population census in 2010 are stratified at 5-year age intervals of 0-4, 5-9, ..., 80-84, with a final open interval of 85+ for use in a life table. It was found that the gender-averaged background lifetime risk of cancer mortality ranges from 23.7% to 28.3% among 47 prefectures, and the arithmetic mean was calculated to be 25.4%. It is important to consider the incremental risk of cancer mortality posed by exposure to ionizing radiation (e.g., an additive lifetime risk of 0.5% at the effective dose of 100 mSv) in the context of the level of the background lifetime risk of cancer mortality of the exposed population. (author)

  9. Guiding Principles in Selecting AC To DC Converters For Power Factor Corrections in AC Transmission System

    Ibekwe B.E

    2014-10-01

    Full Text Available The ac to dc converters’ power factors correction in ac transmission system were investigated. The studies include: phase-controlled converter; pulse width modulated (PWM converter and ac input current shaped converter. Using Fourier series, power factors of these converters were calculated and simulated using MATLAB. The resulting curves are displayed in the hard copies for practical guides in the choice of converters; and comparatively, current shaped type is the best.

  10. The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual

    Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)

  11. A Simple Load Power Estimator For Quasi-Direct AC-AC Converter System

    Marian GAICEANU; Emil ROSU

    2003-01-01

    In this paper a simple load power estimator for the three-phase quasi-direct acac converter system is reported. Since the ac-ac converter control by means of pulsewidth modulation (PWM) is based on the power balance concept, its load power should be known. Two control boards, based on the dSMC (digital Smart Motion Controller) 30 MIPS 32-bit fixed-point digital signal processor (DSP), were involved in the ac-ac system driving. By using the power balance control, the DC link voltage variation ...

  12. Transport AC losses in YBCO coated conductors

    Majoros, M [Ohio State University, Columbus, OH 43210 (United States); Ye, L [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Velichko, A V [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Coombs, T A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Sumption, M D [Ohio State University, Columbus, OH 43210 (United States); Collings, E W [Ohio State University, Columbus, OH 43210 (United States)

    2007-09-15

    Transport AC loss measurements have been made on YBCO-coated conductors prepared on two different substrate templates-RABiTS (rolling-assisted biaxially textured substrate) and IBAD (ion-beam-assisted deposition). RABiTS samples show higher losses compared with the theoretical values obtained from the critical state model, with constant critical current density, at currents lower than the critical current. An origin of this extra AC loss was demonstrated experimentally by comparison of the AC loss of two samples with different I-V curves. Despite a difference in I-V curves and in the critical currents, their measured losses, as well as the normalized losses, were practically the same. However, the functional dependence of the losses was affected by the ferromagnetic substrate. An influence of the presence of a ferromagnetic substrate on transport AC losses in YBCO film was calculated numerically by the finite element method. The presence of a ferromagnetic substrate increases transport AC losses in YBCO films depending on its relative magnetic permeability. The two loss contributions-transport AC loss in YBCO films and ferromagnetic loss in the substrate-cannot be considered as mutually independent.

  13. Periodic table as a Binary table for Drug Encryption

    M. Yamuna

    2014-06-01

    Full Text Available Modern living styles and change is food habits have lead to new diseases and this number is getting multiplied. Research regarding finding medicines for these diseases is in active process and new drugs get released in market frequent. In developing these new drugs communicating details of these findings cannot be avoided. Any drug is best represented using its molecular formula. In this paper we have developed a new binary periodic table and hence use this for encrypting details about any drug.

  14. Generalized Background-Field Method

    Feng, Y J

    1997-01-01

    The graphical method discussed previously can be used to create new gauges not reachable by the path-integral formalism. By this means a new gauge is designed for more efficient two-loop QCD calculations. It is related to but simpler than the ordinary background-field gauge, in that even the triple-gluon vertices for internal lines contain only four terms, not the usual six. This reduction simplifies the calculation inspite of the necessity to include other vertices for compensation. Like the ordinary background-field gauge, this generalized background-field gauge also preserves gauge invariance of the external particles. As a check of the result and an illustration for the reduction in labour, an explicit calculation of the two-loop QCD 45% of computation compared to the ordinary background-field gauge.

  15. The Cosmic Background Radiation, 1997

    Smoot, G F; Smoot, George; Scott, Douglas

    1997-01-01

    We summarise the current status of cosmic microwave background spectrum and anisotropy measurements, and their theoretical interpretation. This is the update of the mini-review for the 1997 web-version of the Review of Particle Properties.

  16. Geometrodynamics on a background spacetime

    Papadopoulos, P P; Papadopoulos, Philippos; Sopuerta, Carlos F.

    2001-01-01

    The formulation of the initial value problem for the Einstein equations is at the heart of obtaining interesting new solutions using numerical relativity and still very much under theoretical and applied scrutiny. We develop a specialised background geometry approach, for systems where there is non-trivial a priori knowledge about the spacetime under study. The background three-geometry and associated connection are used to express the ADM evolution equations in terms of physical non-linear deviations from that background. Expressing the equations in first order form leads naturally to a system closely linked to the Einstein-Christoffel system, introduced by Anderson and York, and sharing its hyperbolicity properties. The background metric approach can drastically alter the source structure of the equations, and we present an argument as to why this is likely to be numerically advantageous.

  17. QED_2 in Curved Backgrounds

    Ghosh, Amit

    1996-01-01

    Here we discuss the two dimensional quantum electrodynamics in curved space-time, especially in the background of some black holes. We first show the existence of some new quantum mechanical solution which has interesting properties. Then for some special black holes we discuss the fermion-black hole scattering problem. The issue of confinement is intimately connected with these solutions and we also comment on this in this background. Finally, the entanglement entropy and the Hawking radiati...

  18. The Supernova Relic Neutrino Background

    Kaplinghat, M.; Steigman, G.; Walker, T. P.

    1999-01-01

    An upper bound to the supernova relic neutrino background from all past Type II supernovae is obtained using observations of the Universal metal enrichment history. We show that an unambiguous detection of these relic neutrinos by the Super-Kamiokande detector is unlikely. We also analyze the event rate in the Sudbury Neutrino Observatory (where coincident neutrons from anti-nu_e + D --> n + n + e+ might enhance background rejection), and arrive at the same conclusion. If the relic neutrino f...

  19. Backgrounds in AFP Detector Estimation

    Huang, Yicong

    2016-01-01

    The ATLAS Forward Proton (AFP) detectors aim to measure protons that are scattered in the ATLAS interaction point under very small angles ($90-160 \\mu rad$). The diffractive protons detected by the AFP may be accompanied by beam halo. This report presents an estimation of the beam halo backgrounds in the AFP using low pile-up data, and position distributions of the backgrounds in the AFP.

  20. Improvements to background level of the low background HPGe setup

    A low background HPGe counting setup has been installed at TIFR. The detector, shielded with low activity Pb and Cu shield, has been extensively used for material screening for the TIN. TIN detector (The INdia-based TIN detector). It is proposed to use this setup for the search of rare decay processes like double beta decay (DBD) to the excited states of the daughter nuclei where T1/2 > 1018 years. To enhance the sensitivity of measurement, the background levels of the detector has been further improved by an addition of an active cosmic muon veto system in the FPGA based DAQ system

  1. Table-top job analysis

    1994-12-01

    The purpose of this Handbook is to establish general training program guidelines for training personnel in developing training for operation, maintenance, and technical support personnel at Department of Energy (DOE) nuclear facilities. TTJA is not the only method of job analysis; however, when conducted properly TTJA can be cost effective, efficient, and self-validating, and represents an effective method of defining job requirements. The table-top job analysis is suggested in the DOE Training Accreditation Program manuals as an acceptable alternative to traditional methods of analyzing job requirements. DOE 5480-20A strongly endorses and recommends it as the preferred method for analyzing jobs for positions addressed by the Order.

  2. The Sloan Lens ACS Survey. V. The full ACS strong-lens sample

    Bolton, Adam S.; Burles, Scott; Koopmans, Leon V. E.; Treu, Tommaso; Gavazzi, Raphael; Moustakas, Leonidas A.; Wayth, Randall; Schlegel, David J.

    2008-01-01

    We present the definitive data for the full sample of 131 strong gravitational lens candidates observed with the Advanced Camera for Surveys (ACS) aboard the Hubble Space Telescope by the Sloan Lens ACS (SLACS) Survey. All targets were selected for higher redshift emission lines and lower redshift c

  3. Early Poststroke Rehabilitation Using a Robotic Tilt-Table Stepper and Functional Electrical Stimulation

    Alexey N. Kuznetsov

    2013-01-01

    Full Text Available Background. Stroke frequently leaves survivors with hemiparesis. To prevent persistent deficits, rehabilitation may be more effective if started early. Early training is often limited because of orthostatic reactions. Tilt-table stepping robots and functional electrical stimulation (FES may prevent these reactions. Objective. This controlled convenience sample study compares safety and feasibility of robotic tilt-table training plus FES (ROBO-FES and robotic tilt-table training (ROBO against tilt-table training alone (control. A preliminary assessment of efficacy is performed. Methods. Hemiparetic ischemic stroke survivors (age years, days after stroke were assigned to 30 days of ROBO-FES (, ROBO (, or control ( in addition to conventional physical therapy. Impedance cardiography and transcranial doppler sonography were performed before, during, and after training. Hemiparesis was assessed using the British Medical Research Council (MRC strength scale. Results. No serious adverse events occurred; 8 patients in the tilt-table group prematurely quit the study because of orthostatic reactions. Blood pressure and CBFV dipped % during robot training. In 52% of controls mean arterial pressure decreased by %. ROBO-FES increased leg strength by points, ROBO by more than control (, . CBFV increased in both robotic groups more than in controls (. Conclusions. Robotic tilt-table exercise with or without FES is safe and may be more effective in improving leg strength and cerebral blood flow than tilt table alone.

  4. Neutron background estimates in GESA

    Fernandes A.C.

    2014-01-01

    Full Text Available The SIMPLE project looks for nuclear recoil events generated by rare dark matter scattering interactions. Nuclear recoils are also produced by more prevalent cosmogenic neutron interactions. While the rock overburden shields against (μ,n neutrons to below 10−8 cm−2 s−1, it itself contributes via radio-impurities. Additional shielding of these is similar, both suppressing and contributing neutrons. We report on the Monte Carlo (MCNP estimation of the on-detector neutron backgrounds for the SIMPLE experiment located in the GESA facility of the Laboratoire Souterrain à Bas Bruit, and its use in defining additional shielding for measurements which have led to a reduction in the extrinsic neutron background to ∼ 5 × 10−3 evts/kgd. The calculated event rate induced by the neutron background is ∼ 0,3 evts/kgd, with a dominant contribution from the detector container.

  5. A definition of background independence

    We propose a definition for background (in)/dependence in dynamical theories of the evolution of configurations that have a continuous symmetry and test this definition on particle models and on gravity. Our definition draws from Barbour's best matching framework developed for the purpose of implementing spatial and temporal relationalism. Among other interesting theories, general relativity can be derived within this framework in novel ways. We study the detailed canonical structure of a wide range of best matching theories and show that their actions must have a local gauge symmetry. When gauge theory is derived in this way, we obtain at the same time a conceptual framework for distinguishing between background-dependent and -independent theories. Gauge invariant observables satisfying Kuchar's criterion are identified and, in simple cases, explicitly computed. We propose a procedure for inserting a global background time into temporally relational theories. Interestingly, using this procedure in general relativity leads to unimodular gravity.

  6. The isotropic radio background revisited

    Fornengo, Nicolao; Regis, Marco; Taoso, Marco

    2014-01-01

    We present an extensive analysis on the determination of the isotropic radio background. We consider six different radio maps, ranging from 22 MHz to 2.3 GHz and covering a large fraction of the sky. The large scale emission is modeled as a linear combination of an isotropic component plus the Galactic synchrotron radiation and thermal bremsstrahlung. Point-like and extended sources are either masked or accounted for by means of a template. We find a robust estimate of the isotropic radio background, with limited scatter among different Galactic models. The level of the isotropic background lies significantly above the contribution obtained by integrating the number counts of observed extragalactic sources. Since the isotropic component dominates at high latitudes, thus making the profile of the total emission flat, a Galactic origin for such excess appears unlikely. We conclude that, unless a systematic offset is present in the maps, and provided that our current understanding of the Galactic synchrotron emi...

  7. CONSUMER PREFERENCES FOR TABLE OLIVES IN TIRANA

    Elvina Merkaj

    2012-06-01

    Full Text Available Table olive production sector is undergoing rapid changes, as the government is undertaking an ambitious program supporting the expansion of olive grove plantations. Despite the increase in domestic production, import of table olive is still high, due to constraints in quantity and quality of domestically supplied olives. In the context of import substitution strategy, embraced by producers and policy-makers, it is important to analyze the consumer preferences for table olives. The objective of this paper is to segment the table olive market according to preferences for table olives attributes applying Conjoint Choice Experiment (CCE and Latent Class Analysis to collect and analyze the data. The research results show a strong consumer preference for domestic table olives whereas preferences for other attributes vary between consumer groups.

  8. A table-top LHC

    Barbara Warmbein

    2011-01-01

    Many years ago, when ATLAS was no more than a huge empty underground cavern and Russian artillery shell casings were being melted down to become part of the CMS calorimetry system, science photographer Peter Ginter started documenting the LHC’s progress. He was there when special convoys of equipment crossed the Jura at night, when cranes were lowering down detector slices and magnet coils were being wound in workshops. Some 18 years of LHC history have been documented by Ginter, and the result has just come out as a massive coffee table book full of double-page spreads of Ginter’s impressive images.   The new coffee table book, LHC: the Large Hadron Collider. Published by the Austrian publisher Edition Lammerhuber in cooperation with CERN and UNESCO Publishing, LHC: the Large Hadron Collider is an unusual piece in the company’s portfolio. As the publisher’s first science book, LHC: the Large Hadron Collider weighs close to five kilos and comes in a s...

  9. Background music and cognitive performance.

    Angel, Leslie A; Polzella, Donald J; Elvers, Greg C

    2010-06-01

    The present experiment employed standardized test batteries to assess the effects of fast-tempo music on cognitive performance among 56 male and female university students. A linguistic processing task and a spatial processing task were selected from the Criterion Task Set developed to assess verbal and nonverbal performance. Ten excerpts from Mozart's music matched for tempo were selected. Background music increased the speed of spatial processing and the accuracy of linguistic processing. The findings suggest that background music can have predictable effects on cognitive performance. PMID:20865993

  10. Generative electronic background music system

    Mazurowski, Lukasz [Faculty of Computer Science, West Pomeranian University of Technology in Szczecin, Zolnierska Street 49, Szczecin, PL (Poland)

    2015-03-10

    In this short paper-extended abstract the new approach to generation of electronic background music has been presented. The Generative Electronic Background Music System (GEBMS) has been located between other related approaches within the musical algorithm positioning framework proposed by Woller et al. The music composition process is performed by a number of mini-models parameterized by further described properties. The mini-models generate fragments of musical patterns used in output composition. Musical pattern and output generation are controlled by container for the mini-models - a host-model. General mechanism has been presented including the example of the synthesized output compositions.