WorldWideScience

Sample records for ac backgrounder table

  1. The Prioritization and Comparison of Technical Background Criteria in the Selection Of Iran's National Table Tennis Coach: Sport Elites Perspectives

    Tahereh RAHMATI

    2015-06-01

    Full Text Available The purpose of this study was the prioritization and comparison of technical background criteria in the selection of Iran's national table tennis coach from the perspectives of sport elites. Method of this research was descriptive and survey kind. The study population were about 100 table tennis sport elites of whom 80 subjects were randomly selected based on Morgan table. Technical background criteria for national coach selection wer e based on McLean and Zakrajsk model. This questionnaire was provided with 7 items. The views of ten sport management professors were used for determining the content validity. To determine the reliability coefficient, Cronbach’s Alpha of 0.968 was used. T hese data were analyzed in both descriptive and inferential statistical. Descriptive statistics was used for description of demographic and inferential statistics was including Friedman Anova test for rating criteria and Kruskal - Wallis test for hypothesis and these data were analyzed using Spss software. The highest rank is for “Goodwill work and the lack of bad records in the past” and the lowest rank is for “Enough experience coaching in league and tournaments. There was no significa nt difference among sport elites to prioritize & compare of technical background criteria in the selection of Iran’s national table tennis coach (P>0.05.

  2. The adult polyglucosan body disease mutation GBE1 c.1076A>C occurs at high frequency in persons of Ashkenazi Jewish background.

    Hussain, Abrar; Armistead, Joy; Gushulak, Lara; Kruck, Christa; Pind, Steven; Triggs-Raine, Barbara; Natowicz, Marvin R

    2012-09-21

    Mutations of the glycogen branching enzyme gene, GBE1, result in glycogen storage disease (GSD) type IV, an autosomal recessive disorder having multiple clinical forms. One mutant allele of this gene, GBE1 c.1076A>C, has been reported in Ashkenazi Jewish cases of an adult-onset form of GSD type IV, adult polyglucosan body disease (APBD), but no epidemiological analyses of this mutation have been performed. We report here the first epidemiological study of this mutation in persons of Ashkenazi Jewish background and find that this mutation has a gene frequency of 1 in 34.5 (95% CI: 0.0145-0.0512), similar to the frequency of the common mutation causing Tay-Sachs disease among Ashkenazi Jews. This finding reveals APBD to be another monogenic disorder that occurs with increased frequency in persons of Ashkenazi Jewish ancestry. PMID:22943850

  3. Elementary Statistics Tables

    Neave, Henry R

    2012-01-01

    This book, designed for students taking a basic introductory course in statistical analysis, is far more than just a book of tables. Each table is accompanied by a careful but concise explanation and useful worked examples. Requiring little mathematical background, Elementary Statistics Tables is thus not just a reference book but a positive and user-friendly teaching and learning aid. The new edition contains a new and comprehensive "teach-yourself" section on a simple but powerful approach, now well-known in parts of industry but less so in academia, to analysing and interpreting process dat

  4. 21 CFR 886.4855 - Ophthalmic instrument table.

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Ophthalmic instrument table. 886.4855 Section 886...) MEDICAL DEVICES OPHTHALMIC DEVICES Surgical Devices § 886.4855 Ophthalmic instrument table. (a) Identification. An ophthalmic instrument table is an AC-powered or manual device on which ophthalmic...

  5. A Table! (At the Table).

    Terry, Robert M.

    A review of French dining habits and table manners outlines: elements of the place setting, courtesies used at the table, serving conventions, restaurant tipping, the size and content of the different meals of the day, subtle differences in common foods, restaurant types, menu types, general wine and cheese choices, waiter-client communication,…

  6. Some background about satellites

    Burns, Joseph A.

    1986-01-01

    Four tables of planetary and satellite data are presented which list satellite discoveries, planetary parameters, satellite orbits, and satellite physical properties respectively. A scheme for classifying the satellites is provided and it is noted that most known moons fall into three general classes: regular satellites, collisional shards, and irregular satellites. Satellite processes are outlined with attention given to origins, dynamical and thermal evolution, surface processes, and composition and cratering. Background material is provided for each family of satellites.

  7. Background Material

    Zandersen, Marianne; Hyytiäinen, Kari; Saraiva, Sofia;

    2016-01-01

    This document serves as a background material to the BONUS Pilot Scenario Workshop, which aims to develop harmonised regional storylines of socio-ecological futures in the Baltic Sea region in a collaborative effort together with other BONUS projects and stakeholders.......This document serves as a background material to the BONUS Pilot Scenario Workshop, which aims to develop harmonised regional storylines of socio-ecological futures in the Baltic Sea region in a collaborative effort together with other BONUS projects and stakeholders....

  8. New Generation of Los Alamos Opacity Tables

    Colgan, James; Kilcrease, D. P.; Magee, N. H.; Sherrill, M. E.; Abdallah, J.; Hakel, P.; Fontes, C. J.; Guzik, J. A.; Mussack, K. A.

    2016-05-01

    We present a new generation of Los Alamos OPLIB opacity tables that have been computed using the ATOMIC code. Our tables have been calculated for all 30 elements from hydrogen through zinc and are publicly available through our website. In this poster we discuss the details of the calculations that underpin the new opacity tables. We also show several recent applications of the use of our opacity tables to solar modeling and other astrophysical applications. In particular, we demonstrate that use of the new opacities improves the agreement between solar models and helioseismology, but does not fully resolve the long-standing `solar abundance' problem. The Los Alamos National Laboratory is operated by Los Alamos National Security, LLC for the National Nuclear Security Administration of the U.S. Department of Energy under Contract No. DE-AC5206NA25396.

  9. ACAC Converters for UPS

    Rusalin Lucian R. Păun

    2008-05-01

    Full Text Available This paper propose a new control technique forsingle – phase ACAC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.

  10. AC power supply systems

    An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)

  11. AcEST: DK950971 [AcEST

    Full Text Available optera acutorost... 37 0.66 tr|B1ACS6|B1ACS6_BALBN DMP1 (Fragment) OS=Balaenoptera ...bonaerens... 37 0.66 tr|B1ACS5|B1ACS5_BALED DMP1 (Fragment) OS=Balaenoptera edeni... GN=... 37 0.66 tr|B1ACS4|B1ACS4_BALBO DMP1 (Fragment) OS=Balaenoptera borealis ... 37 0.66 tr|B1ACS3|B1ACS3..._BALMU DMP1 (Fragment) OS=Balaenoptera musculus ... 37 0.86 tr|B1ACS1|B1ACS1_MEGNO DMP1 (Fragment) OS=Megapt...1ACS2_BALPH DMP1 (Fragment) OS=Balaenoptera physalus ... 37 1.1 tr|B1ACT6|B1ACT6_MESPE DMP1 (Fragment) OS=Me

  12. Tabled Execution in Scheme

    Willcock, J J; Lumsdaine, A; Quinlan, D J

    2008-08-19

    Tabled execution is a generalization of memorization developed by the logic programming community. It not only saves results from tabled predicates, but also stores the set of currently active calls to them; tabled execution can thus provide meaningful semantics for programs that seemingly contain infinite recursions with the same arguments. In logic programming, tabled execution is used for many purposes, both for improving the efficiency of programs, and making tasks simpler and more direct to express than with normal logic programs. However, tabled execution is only infrequently applied in mainstream functional languages such as Scheme. We demonstrate an elegant implementation of tabled execution in Scheme, using a mix of continuation-passing style and mutable data. We also show the use of tabled execution in Scheme for a problem in formal language and automata theory, demonstrating that tabled execution can be a valuable tool for Scheme users.

  13. NNDSS - Table IV. Tuberculosis

    U.S. Department of Health & Human Services — NNDSS - Table IV. Tuberculosis - 2016.This Table includes total number of cases reported in the United States, by region and by states, in accordance with the...

  14. NNDSS - Table IV. Tuberculosis

    U.S. Department of Health & Human Services — NNDSS - Table IV. Tuberculosis - 2015.This Table includes total number of cases reported in the United States, by region and by states, in accordance with the...

  15. NNDSS - Table IV. Tuberculosis

    U.S. Department of Health & Human Services — NNDSS - Table IV. Tuberculosis - 2014.This Table includes total number of cases reported in the United States, by region and by states, in accordance with the...

  16. Pension Insurance Data Tables

    Pension Benefit Guaranty Corporation — Find out about retirement trends in PBGC's data tables. The tables include statistics on the people and pensions that PBGC protects, including how many Americans...

  17. Table Tennis Club

    Table Tennis Club

    2013-01-01

    Apparently table tennis plays an important role in physics, not so much because physicists are interested in the theory of table tennis ball scattering, but probably because it provides useful breaks from their deep intellectual occupation. It seems that many of the greatest physicists took table tennis very seriously. For instance, Heisenberg could not even bear to lose a game of table tennis, Otto Frisch played a lot of table tennis, and had a table set up in his library, and Niels Bohr apparently beat everybody at table tennis. Therefore, as the CERN Table Tennis Club advertises on a poster for the next CERN Table Tennis Tournament: “if you want to be a great physicist, perhaps you should play table tennis”. Outdoor table at restaurant n° 1 For this reason, and also as part of the campaign launched by the CERN medical service “Move! & Eat better”, to encourage everyone at CERN to take regular exercise, the CERN Table Tennis Club, with the supp...

  18. Periodic Table of Students.

    Johnson, Mike

    1998-01-01

    Presents an exercise in which an eighth-grade science teacher decorated the classroom with a periodic table of students. Student photographs were arranged according to similarities into vertical columns. Students were each assigned an atomic number according to their placement in the table. The table is then used to teach students about…

  19. Accumulative Landings System Code Tables

    National Oceanic and Atmospheric Administration, Department of Commerce — Code Tables Used In Landings System. These tables assign meanings to the codes that appear in the data tables. Code tables exist for species, gear, state, county,...

  20. AC1 Wing

    Adrian DOBRE

    2010-03-01

    Full Text Available The AC1 wing replaces the old wing of the wind tunnel model AEROTAXI, which has been made at scale 1:9. The new wing is part of CESAR program and improves the aerodynamic characteristics of the old one. The geometry of the whole wing was given by FOI Sweden and position of AC1 wing must coincide with the structure of the AEROTAXI model.

  1. AC1 Wing

    Adrian DOBRE

    2010-01-01

    The AC1 wing replaces the old wing of the wind tunnel model AEROTAXI, which has been made at scale 1:9. The new wing is part of CESAR program and improves the aerodynamic characteristics of the old one. The geometry of the whole wing was given by FOI Sweden and position of AC1 wing must coincide with the structure of the AEROTAXI model.

  2. Mortality table construction

    Sutawanir

    2015-12-01

    Mortality tables play important role in actuarial studies such as life annuities, premium determination, premium reserve, valuation pension plan, pension funding. Some known mortality tables are CSO mortality table, Indonesian Mortality Table, Bowers mortality table, Japan Mortality table. For actuary applications some tables are constructed with different environment such as single decrement, double decrement, and multiple decrement. There exist two approaches in mortality table construction : mathematics approach and statistical approach. Distribution model and estimation theory are the statistical concepts that are used in mortality table construction. This article aims to discuss the statistical approach in mortality table construction. The distributional assumptions are uniform death distribution (UDD) and constant force (exponential). Moment estimation and maximum likelihood are used to estimate the mortality parameter. Moment estimation methods are easier to manipulate compared to maximum likelihood estimation (mle). However, the complete mortality data are not used in moment estimation method. Maximum likelihood exploited all available information in mortality estimation. Some mle equations are complicated and solved using numerical methods. The article focus on single decrement estimation using moment and maximum likelihood estimation. Some extension to double decrement will introduced. Simple dataset will be used to illustrated the mortality estimation, and mortality table.

  3. CERN Table Tennis Club

    CERN Table Tennis Club

    2014-01-01

    CERN Table Tennis Club Announcing CERN 60th Anniversary Table Tennis Tournament to take place at CERN, from July 1 to July 15, 2014   The CERN Table Tennis Club, reborn in 2008, is encouraging people at CERN to take more regular exercise. This is why the Club, thanks to the strong support of the CERN Staff Association, installed last season a first outdoor table on the terrace of restaurant # 1, and will install another one this season on the terrace of Restaurant # 2. Table tennis provides both physical exercise and friendly social interactions. The CERN Table Tennis club is happy to use the unique opportunity of the 60th CERN anniversary to promote table tennis at CERN, as it is a game that everybody can easily play, regardless of level. Table tennis is particularly well suited for CERN, as many great physicists play table tennis, as you might already know: “Heisenberg could not even bear to lose a game of table tennis”; “Otto Frisch played a lot of table tennis;...

  4. TABLE TENNIS CLUB

    TABLE TENNIS CLUB

    2010-01-01

    2010 CERN Table Tennis Tournament The CERN Table Tennis Club organizes its traditional CERN Table Tennis Tournament, at the Meyrin club, 2 rue de livron, in Meyrin, Saturday August 21st, in the afternoon. The tournament is open to all CERN staff, users, visitors and families, including of course summer students. See below for details. In order to register, simply send an E-mail to Jean-Pierre Revol (jean-pierre.revol@cern.ch). You can also download the registration form from the Club Web page (http://www.cern.ch/tabletennis), and send it via internal mail. Photo taken on August 22, 2009 showing some of the participants in the 2nd CERN Table Tennis tournament. INFORMATION ON CERN TABLE TENNIS CLUB CERN used to have a tradition of table tennis activities at CERN. For some reason, at the beginning of the 1980’s, the CERN Table Tennis club merged with the Meyrin Table Tennis club, a member of the Association Genevoise de Tennis de Table (AGTT). Therefore, if you want to practice table tennis, you...

  5. Ecological periodic tables for nekton and benthic macrofaunal community usage of estuarine habitats Slides

    Ecological periodic tables for nekton and benthic macrofaunal community usage of estuarine habitats Steven P. Ferraro, U.S. Environmental Protection Agency, Newport, OR Background/Questions/Methods The chemical periodic table, the Linnaean system of classification, and the Her...

  6. ac bidirectional motor controller

    Schreiner, K.

    1988-01-01

    Test data are presented and the design of a high-efficiency motor/generator controller at NASA-Lewis for use with the Space Station power system testbed is described. The bidirectional motor driver is a 20 kHz to variable frequency three-phase ac converter that operates from the high-frequency ac bus being designed for the Space Station. A zero-voltage-switching pulse-density-modulation technique is used in the converter to shape the low-frequency output waveform.

  7. Social Background Differences in Early Family Behavior

    Schoen, Robert; Landale, Nancy S.; Daniels, Kimberly; Cheng, Yen-Hsin Alice

    2009-01-01

    Social background has historically been recognized as a major factor influencing family behavior, though recent work has largely emphasized racial/ethnic influences. Here we use 1994 - 1995 and 2001 - 2002 Add Health data to examine the cohabitation, first marriage, and first birth experience of young women. In a multi state life table context,…

  8. The Living Periodic Table

    Nahlik, Mary Schrodt

    2005-01-01

    To help make the abstract world of chemistry more concrete eighth-grade students, the author has them create a living periodic table that can be displayed in the classroom or hallway. This display includes information about the elements arranged in the traditional periodic table format, but also includes visual real-world representations of the…

  9. Table Tennis Club

    Table Tennis Club

    2011-01-01

    CERN Table Tennis Tournament Saturday 20th August 2011 at 13.30 at the CERN/Meyrin TT club (underneath the Piscine de Livron, rue de Livron 2, 1217 Meyrin) Details: http://cern.ch/club-TableTennis Registration: jean-pierre.revol@cern.ch Open to all CERN staff, visitors, summer students, and families

  10. AC/RF Superconductivity

    Ciovati, Gianluigi [JLAB

    2015-02-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  11. AC/RF Superconductivity

    Ciovati, G.

    2015-01-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  12. Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition

    The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity

  13. Hanford Site background: Part 3, Groundwater background

    This report presents and interprets groundwater background data collected from the unconfined aquifer beneath the Hanford Site, a U.S. Department of Energy complex located near Richland, Washington. Characterization of background composition is an important component of environmental characterization activities and serves as a basis for distinguishing the presence and significance of contamination. Background data can also be used to assess the levels of baseline risk to which humans or other receptors are typically exposed and to establish remediation goals. Evaluating background on a sitewide basis provides a consistent, technically defensible definition of background as opposed to determining area-specific background compositions for each waste management unit being considered for remediation across the Hanford Site

  14. Hermetisk AC-Krets

    Hirsch, Carl; Smirnoff, Alexander

    2007-01-01

    Under sex månader våren 2007 har ett samarbete mellan Volvo Lastvagnar och två studenter från KTH, inriktning Integrerad produktutveckling vid institutionen för maskinkonstruktion, pågått i form av ett examensarbete på 20 poäng. Dagens AC-system i Volvos lastbilar avger 20-40 g/år av köldmediet R134a som är en kraftfull växthusgas. Detta sker främst genom diffusion via slangar och tätningsmaterial. Syftet med detta examensarbete är att ta fram förslag på tekniska lösningar på ett nytt AC-syst...

  15. Permit.LOA table

    National Oceanic and Atmospheric Administration, Department of Commerce — This table includes the effective dates by vessel and permit number for each issued letter of authorization (LOA) by the Permit Office (APSD)

  16. Setting the Periodic Table.

    Saturnelli, Annette

    1985-01-01

    Examines problems resulting from different forms of the periodic table, indicating that New York State schools use a form reflecting the International Union of Pure and Applied Chemistry's 1984 recommendations. Other formats used and reasons for standardization are discussed. (DH)

  17. The Periodic Table CD.

    Banks, Alton J.; Holmes, Jon L.

    1995-01-01

    Describes the characteristics of the digitized version of The Periodic Table Videodisc. Provides details about the organization of information and access to the data via Macintosh and Windows computers. (DDR)

  18. VMS forms Output Tables

    National Oceanic and Atmospheric Administration, Department of Commerce — These output tables contain parsed and format validated data from the various VMS forms that are sent from any given vessel, while at sea, from the VMS devices on...

  19. Description of background data in the SKB database GEOTAB

    During the research and development program performed by SKB for the final disposal of spent nuclear fuel, a large quantity of geoscientific data was collected. Most of this data was stored in a database called GEOTAB. This report describes data within the background data group. This data provides information on the location of areas studied, borehole positions and also some drilling information. The background data group (subject), called BGR, is divided into several subgroups (methods): BGAREA area background data; BGDRILL drilling information; BGDRILLP drill penetration data; BGHOLE borehole information; BGTABLES number of rows in a table, and BGTOLR data table tolerance. A method consists of one or several data tables. In each chapter a method and its data tables are described. (orig./HP)

  20. Accurate compressed look up table method for CGH in 3D holographic display.

    Gao, Chuan; Liu, Juan; Li, Xin; Xue, Gaolei; Jia, Jia; Wang, Yongtian

    2015-12-28

    Computer generated hologram (CGH) should be obtained with high accuracy and high speed in 3D holographic display, and most researches focus on the high speed. In this paper, a simple and effective computation method for CGH is proposed based on Fresnel diffraction theory and look up table. Numerical simulations and optical experiments are performed to demonstrate its feasibility. The proposed method can obtain more accurate reconstructed images with lower memory usage compared with split look up table method and compressed look up table method without sacrificing the computational speed in holograms generation, so it is called accurate compressed look up table method (AC-LUT). It is believed that AC-LUT method is an effective method to calculate the CGH of 3D objects for real-time 3D holographic display where the huge information data is required, and it could provide fast and accurate digital transmission in various dynamic optical fields in the future. PMID:26831987

  1. High performance AC drives

    Ahmad, Mukhtar

    2010-01-01

    This book presents a comprehensive view of high performance ac drives. It may be considered as both a text book for graduate students and as an up-to-date monograph. It may also be used by R & D professionals involved in the improvement of performance of drives in the industries. The book will also be beneficial to the researchers pursuing work on multiphase drives as well as sensorless and direct torque control of electric drives since up-to date references in these topics are provided. It will also provide few examples of modeling, analysis and control of electric drives using MATLAB/SIMULIN

  2. Superconducting ac cable

    The components of a superconducting 110 kV ac cable for power ratings >= 2000 MVA have been developed. The cable design especially considered was of the semiflexible type, with a rigid cryogenic envelope and flexible hollow coaxial cable cores pulled into the former. The cable core consists of spirally wound Nb-Al composite wires and a HDPE-tape wrapped electrical insulation. A 35 m long single phase test cable with full load terminations for 110 kV and 10 kA was constructed and successfully tested. The results obtained prove the technical feasibility and capability of our cable design. (orig.)

  3. Periodic table of elements

    Following a recommendation by the International Union for Pure and Applied Chemistry (IUPAC), the groups of the periodic table shall be numbered from 1 to 18, instead of I to VIII as before. The recommendations has been approved of by the Committee on Nomenclature of the American Chemical Society. The new system abandons the distinction between main groups (a) and auxiliary groups (b), which in the past frequently has been the reason for misunderstandings between European and American chemists, due to different handling. The publishing house VCH Verlagsgesellschaft recently produced a new periodic table that shows the old and the new numbering system together at a glance, so that chemists will have time to get familiar with the new system. In addition the new periodic table represents an extensive data compilation arranged by elements. The front page lists the chemical properties of elements, the back page their physical properties. (orig./EF)

  4. Table Tennis Club

    Table Tennis Club

    2012-01-01

    The CERN Table Tennis club and the Meyrin CTT are organizing two Table Tennis workshops from 2 to 6 July and from 20 to 24 August 2012 inclusive in Meyrin. A professional would be with your children from 14.00 pm to 18.00 pm: an instructor J + S category A. Training courses with specific themes, individual courses would be given depending on the level of the child’s game, “discoveries –table tennis games” courses and games with the robot. Other activities (stretching, relaxation). Afternoons (from 18 to 20 children): 40 CHF per workshop and per child. Evenings (from 18 to 20 adults): 60 CHF per workshop and per adult. For further information, please contact Mr. Monteil : Mobile: (+33) 06 61 31 70 47 E-mail: wilfried.monteil@free.fr.

  5. Climate change : transportation table

    The Kyoto Protocol sets greenhouse gas (GHG) reduction targets for the post-2000 period. If ratified, Canada will be committed to reduce emissions of GHGs by 6 per cent below 1990 levels during the period 2008-2012. A recommended national strategy is to establish 'issue tables' that will advise the Ministers of Energy and Environment on preferred options to reach the Kyoto target and to identify early actions that can be taken. The 'Transportation Table' which is the focus of this paper, is one of the 15 sectoral tables. The Transportation Table will identify by July 1999, specific measures to mitigate GHG emissions from Canada's transportation sector. Currently, GHG emissions from the transportation sector are predicted to be 27 per cent above 1990 levels by 2010. Fuel taxes, emissions trading, and research into improved vehicle technologies and automotive fuels are some of the recommended options which can help reduce emissions trading from the transportation sector. Studies are underway to deal with emissions from transport in two sub-groups, freight and passenger. 1 fig

  6. A Modern Periodic Table.

    Herrenden-Harker, B. D.

    1997-01-01

    Presents a modern Periodic Table based on the electron distribution in the outermost shell and the order of filling of the sublevels within the shells. Enables a student to read off directly the electronic configuration of the element and the order in which filling occurs. (JRH)

  7. The Dynamic Force Table

    Geddes, John B.; Black, Kelly

    2008-01-01

    We examine an experimental apparatus that is used to motivate the connections between the basic properties of vectors, potential functions, systems of nonlinear equations, and Newton's method for nonlinear systems of equations. The apparatus is an adaptation of a force table where we remove the center-pin and allow the center-ring to move freely.…

  8. Ac Hybrid Charge Controller

    Shalini S. Durgam

    2015-03-01

    Full Text Available One of the primary needs for socio-economic development in any nation in the world is the provision of reliable electricity supply systems with lower carbon footprint levels. The purpose of this work is the development of a hybrid Power system that harnesses the renewable energy in sun and electricity to generate electricity. The working model can able to run on dual mode- solar and electricity. It can also be driven independently either by solar or electricity. The battery can be charge from solar panel (40W or by power supply. The household single phase A.C. power supply of 230V is converted into 12V D.C. using step down transformer and rectifying circuit. The working model can achieve energy saving, low carbon emission, environmental protection for the upcoming future of human life.

  9. À Table! Improving Temporal Navigation in Soccer Ranking Tables

    Perin, Charles; Vuillemot, Romain; Fekete, Jean-Daniel

    2014-01-01

    International audience This article introduces A Table!, an enhanced soccer ranking table providing temporal navigation by combining two novel interaction techniques. Ranking tables order soccer teams represented as rows, according to values of columns containing attributes e.g., accumulated points, or number of scored goals. Because they represent a snapshot of a championship at a time t, tables are regularly updated with new results. Such updates usually change the rows order, which make...

  10. Building Background Knowledge

    Neuman, Susan B.; Kaefer, Tanya; Pinkham, Ashley

    2014-01-01

    This article make a case for the importance of background knowledge in children's comprehension. It suggests that differences in background knowledge may account for differences in understanding text for low- and middle-income children. It then describes strategies for building background knowledge in the age of common core standards.

  11. Round table presentation

    Full text: This Round Table deals with the main problems in the operational implementation of radiation safety standards. I will not reiterate previous comments that were made in the other sessions and round tables but I will make a very wide and open presentation in this regard. Since we are discussing problems, I will present this from a general perspective and not just from a national one. So, in my experience problems result from two main causes: problems at the organization level and those due to unsolved or pending technical aspects. The first group concerns organizational problems. In my view, according to my experience, and not only in Argentina, the basic problems are usually related to ineffectual regulatory performance. Second, non-appropriate technical competence in radiation protection and safety matters at all levels; that means at worker, employer and regulatory levels. However, legal competence is a necessary condition but not a sufficient one. The basic point here is knowledge - knowledge and experience - and we can have a very formal and appropriate background of real competence, real instruments, but if we don't have real technical competence the results will not be very satisfactory. Another topic concerns the inadequate discharge of managerial responsibilities at the operational level and following on from this, a weak safety culture and a lack of an effective quality system. The operational implementation of radiation protection standards is often more formalistic than realistic. So in this type of case, for any given country, a commitment at a very high political level is a necessity. The second set of factors associated with such problems are unsolved or pending technical factors and in my view the issue with the complex system of exemption, clearance and action levels, particularly in the case of commodities, is to establish an adequate set of activity concentration levels for specific radionuclides, either natural or artificial, for

  12. Global Reference Tables Services Architecture

    Social Security Administration — This database stores the reference and transactional data used to provide a data-driven service access method to certain Global Reference Table (GRT) service tables.

  13. Aggregation Algorithms in Heterogeneous Tables

    Titus Felix FURTUNA; Ivan, Ion; Marian DARDALA

    2006-01-01

    The heterogeneous tables are most used in the problem of aggregation. A solution for this problem is to standardize these tables of figures. In this paper, we proposed some methods of aggregation based on the hierarchical algorithms.

  14. Design of lift positional table

    Bartel, Jindřich

    2015-01-01

    This bachelor´s thesis describes the design of a lift positional table for overcome the height difference between the two roller tracks. Weight of the load is 550 kg and height difference of roller tracks is 2000 mm. The aim is to suggest the type of power lifting, power lifting functional calculation, functional calculation of the driver tray pallets and determining the main dimensions of the lifting table. The Appendix contains technical drawings of the lifting table and the table frame.

  15. AcEST: BP920072 [AcEST

    Full Text Available YMU001_000132_F11 525 Adiantum capillus-veneris mRNA. clone: YMU001_000132_F11. BP920072 - Show ... YGMYGEGEKALETFADMEKSGIVPDSVVFIAII 617 Query: 139 NACSR SCLFHECHSYFEAMSTHHGIVPCLEHHSCVV 32 ACS S L E + FE M ... KLMTRDVVSWNTLIAGYAQVGQNEGLFCTFSDMLGQRVKPDLITFVIVLNACSR ... 125 VF+ + +D VSWN++I+GY Q G F M+ + D IT++++++ +R S ... YGVHGYGKKAIQIFEEMLANGASP 384 Query: 166 DLITFVIVLNACSR SCLFHECHSYFEAMSTHHGIVPCLEHHSCVV 32 +TFV VL ACS L E ... KLMTRDVVSWNTLIAGYAQVGQNEGLFCTFSDMLGQRVKPDLITFVIVLNACSR S 122 +VFDK R + WN L G E + + M V+ D T+ VL AC S Sbjc ...

  16. Radiographic knee osteoarthritis in ex-elite table tennis players

    Rajabi Reza; Johnson Gillian M; Alizadeh Mohammad H; Meghdadi Nazanin

    2012-01-01

    Abstract Background Table tennis involves adoption of the semi-flexed knee and asymmetrical torsional trunk movements creating rotational torques on the knee joint which may predispose players to osteoarthritis (OA) of the knee. This study aims to compare radiographic signs of knee OA and associated functional levels in ex-elite male table tennis players and control subjects. Methods Study participants were 22 ex-elite male table tennis players (mean age 56.64 ± 5.17 years) with 10 years of i...

  17. Biophenols in table olives.

    Blekas, Georgios; Vassilakis, Constantinos; Harizanis, Constantinos; Tsimidou, Maria; Boskou, Dimitrios G

    2002-06-19

    Unprocessed olives are well-known sources of phenolic antioxidants with important biological properties. Processing methods to prepare table olives may cause a reduction of valuable phenols and may deprive the food of precious biological functions. The present work was undertaken to evaluate table olives produced in Greece as sources of biophenols. Commercially available olives were analyzed for their total phenol content by using the Folin-Ciocalteu reagent and for individual phenols by RP-HPLC. Samples were Spanish-style green olives in brine, Greek-style naturally black olives in brine, and Kalamata olives in brine. Most of the types of olives analyzed were found to be good sources of phenols. Hydroxytyrosol, tyrosol, and luteolin were the prevailing phenols in almost all of the samples examined. High levels of hydroxytyrosol were determined mainly in Kalamata olives and Spanish-style green olives, cultivar Chalkidiki (250-760 mg/kg). PMID:12059143

  18. Table Tennis Club

    Table Tennis Club

    2012-01-01

    2012 CERN Table Tennis Tournament As the campaign launched by the CERN medical service “Move! & Eat better” is designed in particular to encourage people at CERN to take more regular exercise, the CERN Table Tennis Club, with its traditional CERN Table Tennis Tournament is providing an excellent opportunity to practice moving. The tournament will take place at the Meyrin CTT, 2 rue de Livron, Saturday August 25, 2012, in the afternoon (starting at 13:30). It is open to all CERN staff, users, visitors and families, including of course summer students, who are strongly encouraged to participate. In order to register, simply send an E-mail to Jean-Pierre Revol (jean-pierre.revol@cern.ch). You may also find useful information on the Club Web page http://www.cern.ch/tabletennis CERN 2011 champion Savitha Flaecher, between the finalist Bertrand Mouches on her left, the winner of the consolation draw on her right (Sudarshan Paramesvaran), and far left, Denis Moriaud (semi-finalist a...

  19. Induction Motor Control through AC/DC/AC Converters

    Elfadili, Abderrahim; Giri, Fouad; Ouadi, Hamid; El Magri, Abdelmounime; Dugard, Luc; Abouloifa, Abdelmajid

    2010-01-01

    We consider the problem of controlling inductions motors driven through AC/DC rectifiers and DC/AC inverters. The control objectives are threefold: (i) forcing the motor speed to track a reference signal, (ii) regulating the DC Link voltage, (iii) assuring a satisfactory power factor correction (PFC) with respect to the power supply net. First, a nonlinear model of the whole controlled system is developed in the Park-coordinates. Then, a nonlinear multi-loop controller is synthesized using th...

  20. AcEST: BP920905 [AcEST

    Full Text Available EM + + D ++S L AC Sbjct: 374 NSAYKLFERMPKKNVVAWNAIISGYSQHGHPHEALALFIEMQAQGIKPDSFAIVSVLPAC 433 Query: 71 SHSSTLNDGKLIHFYILMNNFE...EM++ ++ + V + S L +C Sbjct: 255 SSERIFEKIAKKNAVSWTAMISSYNRGEFSEKALRSFSEMIKSGIEPNLVTLYSVLSSCG 314 Query: 68 HSSTLNDGKLIHFYILMNNFE...VVVMSCLKACS 69 ++ +F RRD VTW A+I GYA HG E A+ LF+ M+ EN+ + V +S L+AC+ Sbjct: 656 DSRLMFEKSLRRDFVTWNAMICGYAHHGKGEEAIQLFERMILEN...ELEKMHNKRLQEMCVSWNSIISGYVMKEQSEDAQMLFTRMME 596 Query: 122 ENVDTDGVVVMSCLKACSHSSTLNDGKLIHFYILMNNFE ...FCEADT-NVITWNAMIASYVHCEQSEKAIALFDRMVSENFKPSSITLVTLLMAC 543 Query: 71 SHSSTLNDGKLIHFYILMNNFEL 3 ++ +L G++

  1. AcEST: DK950147 [AcEST

    Full Text Available TST38A01NGRL0007_O05 706 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0007_O05. 5' end seq ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... OS=Medicago truncatula GN=MtrDRAFT_AC149576g3v2 PE ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... (Fragment) OS=Medicago truncatula GN=MtrDRAFT_AC14 ...

  2. AcEST: DK959344 [AcEST

    Full Text Available TST39A01NGRL0004_G23 714 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0004_G23. 5' end seq ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... OS=Medicago truncatula GN=MtrDRAFT_AC149576g3v2 PE ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... (Fragment) OS=Medicago truncatula GN=MtrDRAFT_AC14 ...

  3. AcEST: DK949716 [AcEST

    Full Text Available TST38A01NGRL0006_L20 613 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0006_L20. 5' end seq ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... OS=Medicago truncatula GN=MtrDRAFT_AC149576g3v2 PE ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... (Fragment) OS=Medicago truncatula GN=MtrDRAFT_AC14 ...

  4. Tissot's table of logarithms (ca. 1880)

    Roegel, Denis

    2011-01-01

    Tissot's table, only in manuscript form, is a table of powers, subdividing the interval from 1 to 10 in 100000 intervals. It is supplemented by the sines, overlayed on the same table. This composed table is reconstructed here.

  5. AC drives for industrial plants. Plant kudoyo AC drive sochi

    Miyazaki, M.; Shibata, M.; Yamada, S. (Toshiba Corp., Tokyo (Japan))

    1992-08-01

    Features and product series of AC drives for industrial plants were outlined. Configurations and features of various types of AC drives were briefly discussed which are put into market to meet various requirements for industrial plants and wide ranges of output voltage and capacity. The following product series were outlined; the power bipolar transistor inverter for 3.5-600 kVA in output capacity, IGBT inverter for AC 400 V in output voltage and 1,000 kVA or less, GTO inverter for AC 600 V and 700-2,000 kVA, and cycloconverter for AC 1,000-3,000 V and 1,000 kW-20 MW. The following subjects were outlined as current technical trends of AC drives for industrial plants; increasing in capacity of voltage-source PWM inverters, downsizing of converters through highly efficient cooling and highly dense mounting, spreading of sensorless vector controls, and development of high-voltage large-capacity PWM inverters. 6 figs., 2 tabs.

  6. The Cosmic Microwave Background

    Silk, Joseph

    2001-01-01

    This set of lectures provides an overview of the basic theory and phenomenology of the cosmic microwave background. Topics include a brief historical review; the physics of temperature and polarization fluctuations; acoustic oscillations of the primordial plasma; the space of inflationary cosmological models; current and potential constraints on these models from the microwave background; and constraints on inflation.

  7. Turning the Tables.

    Wright, Karen; Schroeder, Doris

    2016-04-01

    In bioethics, the concept of vulnerability is applied almost exclusively to research participants and patients. We turn the tables and apply the concept to nurses caring for anorexia nervosa (AN) sufferers. In doing so, and using results from a qualitative research study undertaken in the UK, we show that AN nurses face a significant probability of incurring identifiable harms (inauthentic relationships and nonreciprocal relationships). Some recommendations on how these harms can be avoided or mitigated are given, but further research is needed. PMID:26957447

  8. A Tiled-Table Convention for Compressing FITS Binary Tables

    Pence, William; White, Richard L

    2012-01-01

    This document describes a convention for compressing FITS binary tables that is modeled after the FITS tiled-image compression method (White et al. 2009) that has been in use for about a decade. The input table is first optionally subdivided into tiles, each containing an equal number of rows, then every column of data within each tile is compressed and stored as a variable-length array of bytes in the output FITS binary table. All the header keywords from the input table are copied to the header of the output table and remain uncompressed for efficient access. The output compressed table contains the same number and order of columns as in the input uncompressed binary table. There is one row in the output table corresponding to each tile of rows in the input table. In principle, each column of data can be compressed using a different algorithm that is optimized for the type of data within that column, however in the prototype implementation described here, the gzip algorithm is used to compress every column.

  9. Cosmogenic Backgrounds to 0{\

    :,; Auty, D J; Barbeau, P S; Beck, D; Belov, V; Breidenbach, M; Brunner, T; Burenkov, A; Cao, G F; Chambers, C; Cleveland, B; Coon, M; Craycraft, A; Daniels, T; Danilov, M; Daugherty, S J; Davis, J; Delaquis, S; Der Mesrobian-Kabakian, A; DeVoe, R; Didberidze, T; Dilling, J; Dolgolenko, A; Dolinski, M J; Dunford, M; Fairbank, W; Farine, J; Feldmeier, W; Feyzbakhsh, S; Fierlinger, P; Fudenberg, D; Gornea, R; Graham, K; Gratta, G; Hall, C; Herrin, S; Hughes, M; Jewell, M J; Johnson, A; Johnson, T N; Johnston, S; Karelin, A; Kaufman, L J; Killick, R; Koffas, T; Kravitz, S; Krücken, R; Kuchenkov, A; Kumar, K S; Leonard, D S; Licciardi, C; Lin, Y H; Ling, J; MacLellan, R; Marino, M G; Mong, B; Moore, D; Njoya, O; Nelson, R; Odian, A; Ostrovskiy, I; Piepke, A; Pocar, A; Prescott, C Y; Retière, F; Rowson, P C; Russell, J J; Schubert, A; Sinclair, D; Smith, E; Stekhanov, V; Tarka, M; Tolba, T; Tsang, R; Twelker, K; Vuilleumier, J -L; Waite, A; Walton, J; Walton, T; Weber, M; Wen, L J; Wichoski, U; Wood, J; Yang, L; Yen, Y -R; Zeldovich, O Ya

    2015-01-01

    As neutrinoless double-beta decay experiments become more sensitive and intrinsic radioactivity in detector materials is reduced, previously minor contributions to the background must be understood and eliminated. With this in mind, cosmogenic backgrounds have been studied with the EXO-200 experiment. Using the EXO-200 TPC, the muon flux (through a flat horizontal surface) underground at the Waste Isolation Pilot Plant (WIPP) has been measured to be {\\Phi} = 4.07 $\\pm$ 0.14 (sys) $\\pm$ 0.03 (stat) $\\times$ $10^{-7}$cm$^{-2}$ s$^{-1}$, with a vertical intensity of $I_{v}$ = 2.97$^{+0.14}_{-0.13}$ (sys) $\\pm$ 0.02 (stat) $\\times$ $10^{-7}$cm$^{-2}$ s$^{-1}$ sr$^{-1}$. Simulations of muon-induced backgrounds identified several potential cosmogenic radionuclides, though only 137Xe is a significant background for the 136Xe 0{\

  10. On Background Independence

    Anderson, Edward

    2013-01-01

    This paper concerns what Background Independence itself is (as opposed to some particular physical theory that is background independent). The notions presented mostly arose from a layer-by-layer analysis of the facets of the Problem of Time in Quantum Gravity. Part of this coincides with two relational postulates which are thus identified as classical precursors of two of the facets of the Problem of Time. These are furthemore tied to the forms of each of the GR Hamiltonian and momentum cons...

  11. Zambia Country Background Report

    Hampwaye, Godfrey; Jeppesen, Søren; Kragelund, Peter

    This paper provides background data and general information for the Zambia studies focusing on local food processing sub­‐sector; and the local suppliers to the mines as part of the SAFIC project (Successful African Firms and Institutional Change).......This paper provides background data and general information for the Zambia studies focusing on local food processing sub­‐sector; and the local suppliers to the mines as part of the SAFIC project (Successful African Firms and Institutional Change)....

  12. Remark on Applied Statistics Algorithm AS057 Printing Multidimensional Tables

    Hopkins, Tim; Morse, David R.

    1994-01-01

    We provide a Fortran 77 version of the Applied Statistics Algorithm AS57 `Printing Multidimensional Tables'' originally appearing in the book `Applied Statistics Algorithms'' by P. Griffiths and I.D. Hill. We believe that the new code offers improvements both in readability and maintainability. [The file /pub/misc/statlib/apstat/as057.sh contains the Fortran 77 source code, example driver code, data and sample results as a Unix shar file. It is available via anonymous ftp from unix.hensa.ac.uk

  13. AcEST: DK955197 [AcEST

    Full Text Available TST39A01NGRL0022_H07 532 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0022_H07. 5' end seq ... KDEVTALPLLK 192 Query: 194 RFAFGIACELLMSRYEKEEQEMLEEPF TTMMKGILQLPIKLPGTRFSKAIVAANMLRARF 373 R+ F +AC+L S ... KDEVMALPLLK 192 Query: 194 RFAFGIACELLMSRYEKEEQEMLEEPF TTMMKGILQLPIKLPGTRFSKAIVAANMLRARF 373 R+ F +AC+L S ... KDEVKVLP 189 Query: 185 LMKRFAFGIACELLMSRYEKEEQEMLEEPF TTMMKGILQLPIKLPGTRFSKAIVAANMLR 364 L++ F IA L + +Q+ ... KDEATVLP 177 Query: 185 LMKRFAFGIACELLMSRYEKEEQEMLEEPF TTMMKGILQLPIKLPGTRFSKAIVAANMLR 364 L+K F +A L E+ QE ...

  14. AcEST: BP915640 [AcEST

    Full Text Available YMU001_000074_A01 462 Adiantum capillus-veneris mRNA. clone: YMU001_000074_A01. BP915640 CL3685C ... y: 462 GPLILRACLVYMQGAPVGSLAEDGIVSAATGKDMEQSTVGFRLMLAKI IHRLIAAFKEVG 283 G IL+AC YM+G +GSL +D V ++VGF+LMLAK ... : 1032 GYYILKACDAYMKGYLIGSLTKDASVIDERSS-ANSTSVGFKLMLAKI APKLFSALSEVG 1090 Query: 282 AYCDAYE 262 A C+ ++ Sb ... uery: 453 ILRACLVYMQGAPVGSLAEDGIVSAATGKDMEQSTVGFRLMLAKI IHRLIAAFKEVGAYC 274 +L AC YM+G PVGS A G ST GF++ML+K ... ame = -1 Query: 423 GAPVGSLAEDGIVSAATGKDMEQSTVGFRLMLAKI I----HRLIAAFKEVGAYCD 271 G P+ L D +S GK + S RL + L+ ...

  15. Speed Control of DC Motor using AC/AC/DC Converter Based on Intelligent Techniques

    Rakan Kh Antar

    2013-05-01

    Full Text Available    This paper describes the application of ac/ac/dc and ac/dc converters to control the speed of a separately excited DC motor. Artificial neural network and PI controller are trained to select the desired values of firing angles for triggering thyristors of the ac/ac/dc and ac/dc bridge converters in order to control the speed of the dc motor at a desired value with constant and different load torques in order to obtain the best speed response. Simulation results show that the rising time for ac/dc and ac/ac/dc converters at 250rpm are reduced about 79% and 89% respectively, while delay time it reduced about 69% and 64% respectively. Therefore, speed response of the dc motor is more efficient for closed loop system compared with open loop also the response of ac/ac/dc converter is better than ac/dc converter.

  16. Determination of background radiation

    The invention relates to a method and appartus for determining the level of background radiation in a spectral region where a Raman peak characteristic of a particular substance, in particular diamond, is expected to occur. The method includes the steps of isolating the radiation in a first spectral band, and isolating the radiation in a second spectral band which overlaps the first spectral band at least partially to form an overlapping band in the vicinity of the expected Raman Peak and a least one sideband. At least one sideband value representative of the radiation present in the one or more sidebands is then obtained, and further values, representative of the radiation isolated by any one or more of the other spectral bands, such as the first and second bands, are then used to derive a background value indicative of the level of background radiation present at the position of the expected Raman peak

  17. Exploring String Theory Backgrounds

    Williams, B P

    2004-01-01

    This thesis examines phenomenological and theoretical questions by exploring string theoretic backgrounds. Part I focuses on cosmology. First we propose that the induced metric along a brane moving through a curved bulk may be interpreted as the cosmology of the brane universe, providing a resolution to the apparent cosmological singularity on the brane. We then look at various decay channels of the certain meta-stable de Sitter vacua and show that there exist NS5-brane meditated decays which are much faster than decays to decompactification. Part II discusses a new class of nongeometric vacua in string theory. These backgrounds may be described locally as T2 fibrations. By enlarging the monodromy group of the fiber to include perturbative stringy duality symmetries we are able to explicitly construct nongeometric backgrounds.

  18. Unitarity and singular backgrounds

    Brouzakis, Nikos

    2013-01-01

    We compute the graviton Kaluza-Klein spectrum on a gravity-dilaton background with a naked singularity for all possible boundary conditions at the singularity which are consistent with unitary evolution. We apply methods from non-relativistic quantum mechanics with singular Schr\\"{o}dinger potentials. In general the spectrum contains a tachyon, a sign of instability. Only for a particular boundary condition at the singularity the spectrum is free of tachyons. In this case the lowest-lying graviton mode is massless. We argue that this result will also hold for other backgrounds with similar geometry near the curvature singularity. We complete our study with a brief discussion on radion perturbations and Higgs mechanism on this singular background.

  19. Whole genome comparison between table and wine grapes reveals a comprehensive catalog of structural variants

    Di Genova, Alex; Almeida, Andrea Miyasaka; Muñoz-Espinoza, Claudia; Vizoso, Paula; Travisany, Dante; Moraga, Carol; Pinto, Manuel; Hinrichsen, Patricio; Orellana, Ariel; Maass, Alejandro

    2014-01-01

    Background Grapevine (Vitis vinifera L.) is the most important Mediterranean fruit crop, used to produce both wine and spirits as well as table grape and raisins. Wine and table grape cultivars represent two divergent germplasm pools with different origins and domestication history, as well as differential characteristics for berry size, cluster architecture and berry chemical profile, among others. ‘Sultanina’ plays a pivotal role in modern table grape breeding providing the main source of s...

  20. Cosmic Tachyon Background Radiation

    Tomaschitz, R

    1999-01-01

    The equilibrium statistical mechanics of a background radiation of superluminal particles is investigated, based on a vectorial wave equation for tachyons of the Proca type. The partition function, the spectral energy density, and the various thermodynamic variables of an ideal Bose gas of tachyons in an open Robertson-Walker cosmology are derived. The negative mass square in the wave equation changes the frequency scaling in the Rayleigh-Jeans law, and there are also significant changes in the low temperature regime as compared to the microwave background, in particular in the caloric and thermal equations of state.

  1. The natural radiation background

    The components of the natural background radiation and their variations are described. Cosmic radiation is a major contributor to the external dose to the human body whilst naturally-occurring radionuclides of primordial and cosmogenic origin contribute to both the external and internal doses, with the primordial radionuclides being the major contributor in both cases. Man has continually modified the radiation dose to which he has been subjected. The two traditional methods of measuring background radiation, ionisation chamber measurements and scintillation counting, are looked at and the prospect of using thermoluminescent dosimetry is considered

  2. Radioactivity: additional tables

    The following additional tables are presented to the annual report on radioactive discharges from the major establishments in the U.K.: 1) Radioactive gaseous effluent, trends in annual emissions, by site, (civil and M.O.D.) 2) Radioactive liquid effluent (radionuclides specified by authorisations), trends in annual discharges to surface and coastal waters: by site. 3) Liquid effluent (radionuclides not subject to separate limits): annual discharges to surface and coastal waters by site. 4) Isotopic composition of liquid effluent from CEGB stations, 1984. 5) Trends in the amount of radioactivity in waste dumped in the north-east Atlantic. 6) Trends in volume of waste disposed of at Drigg (by source of waste). 7) Solid waste: trends in volume disposed of and level of activity at some other disposal sites. 8) Radioactivity in samples of fish and shellfish: trends in concentrations. (UK)

  3. Nuclear structure of $^{231}$Ac

    Boutami, R; Mach, H; Kurcewicz, W; Fraile, L M; Gulda, K; Aas, A J; García-Raffi, L M; Løvhøiden, G; Martínez, T; Rubio, B; Taín, J L; Tengblad, O

    2008-01-01

    The low-energy structure of 231Ac has been investigated by means of gamma ray spectroscopy following the beta-decay of 231Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a mini-orange electron spectrometer. The decay scheme of 231Ra --> 231Ac has been constructed for the first time. The Advanced Time Delayed beta-gamma-gamma(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

  4. Berkeley Low Background Facility

    The Berkeley Low Background Facility (BLBF) at Lawrence Berkeley National Laboratory (LBNL) in Berkeley, California provides low background gamma spectroscopy services to a wide array of experiments and projects. The analysis of samples takes place within two unique facilities; locally within a carefully-constructed, low background laboratory on the surface at LBNL and at the Sanford Underground Research Facility (SURF) in Lead, SD. These facilities provide a variety of gamma spectroscopy services to low background experiments primarily in the form of passive material screening for primordial radioisotopes (U, Th, K) or common cosmogenic/anthropogenic products; active screening via neutron activation analysis for U,Th, and K as well as a variety of stable isotopes; and neutron flux/beam characterization measurements through the use of monitors. A general overview of the facilities, services, and sensitivities will be presented. Recent activities and upgrades will also be described including an overview of the recently installed counting system at SURF (recently relocated from Oroville, CA in 2014), the installation of a second underground counting station at SURF in 2015, and future plans. The BLBF is open to any users for counting services or collaboration on a wide variety of experiments and projects

  5. Local microwave background radiation

    Soares, Domingos

    2006-01-01

    An inquiry on a possible local origin for the Microwave Background Radiation is made. Thermal MBR photons are contained in a system called {\\it magnetic bottle} which is due to Earth magnetic field and solar wind particles, mostly electrons. Observational tests are anticipated.

  6. Berkeley Low Background Facility

    Thomas, K. J.; Norman, E. B. [Department of Nuclear Engineering, University of California-Berkeley, CA 94720 (United States); Nuclear Science Division, Lawrence Berkeley National Laboratory, CA 94720 (United States); Smith, A. R.; Poon, A. W. P.; Chan, Y. D. [Nuclear Science Division, Lawrence Berkeley National Laboratory, CA 94720 (United States); Lesko, K. T. [Physics Division, Lawrence Berkeley National Laboratory, CA 94720 (United States)

    2015-08-17

    The Berkeley Low Background Facility (BLBF) at Lawrence Berkeley National Laboratory (LBNL) in Berkeley, California provides low background gamma spectroscopy services to a wide array of experiments and projects. The analysis of samples takes place within two unique facilities; locally within a carefully-constructed, low background laboratory on the surface at LBNL and at the Sanford Underground Research Facility (SURF) in Lead, SD. These facilities provide a variety of gamma spectroscopy services to low background experiments primarily in the form of passive material screening for primordial radioisotopes (U, Th, K) or common cosmogenic/anthropogenic products; active screening via neutron activation analysis for U,Th, and K as well as a variety of stable isotopes; and neutron flux/beam characterization measurements through the use of monitors. A general overview of the facilities, services, and sensitivities will be presented. Recent activities and upgrades will also be described including an overview of the recently installed counting system at SURF (recently relocated from Oroville, CA in 2014), the installation of a second underground counting station at SURF in 2015, and future plans. The BLBF is open to any users for counting services or collaboration on a wide variety of experiments and projects.

  7. AcEST: BP920800 [AcEST

    Full Text Available DLNLALQVHSRMVRFGFNAEVEACGALINMYGKCGKVLYAQRVFDDT 298 Query: 206 RQQDVISWNDIISACAQRGHGTEALENFSQMLHEGIVPNSMTFTSVMQA---CNSIEGG...G L +A S F ++ +D+ISW +I +Q EA+ F Sbjct: 217 SEKNEATSNCLINGYMGLGNLEQAESLFNQMPVKDIISWTTMIKGYSQNKRYREAIAVFY 276 Query: 119 QMLHEG...EKAWRIFDGVSCKNLPSWNAIITGCVQGGLLEEAIDLYRHMK 281 Query: 110 HEGIVPNSMTFTSVMQAC---NSIEGGR 36 + + PN +T +V+ AC +...N IIS AQ G +EA+E ++ M Sbjct: 383 DITIGNAVVVMYAKLGLVDSARAVFNWLPNTDVISWNTIISGYAQNGFASEAIEMYNIME 442 Query: 110 HEG...EIDLGEQIHSLSVKTGFESDMYVSGVLIDMYSKYGWLEKARRVLEML 406 Query: 206 RQQDVISWNDIISACAQRGHGTEALENFSQMLHEGIVPNSMTFTSVMQACNSIEGG

  8. AcEST: DK945549 [AcEST

    Full Text Available AGGCGATTTCATCTTTTCTGAGAACCCTGATTTTGTGATTGTGTAATTACA ACTGTGGAACAGAAGGATGAGAAGTCTACTGACACAACAAGATATCTCTGGAGAGGAGA...A AATTGAGAAGGTTTGAGTTCTCAACAATGGGCTATGAGGCAATAATGGGAAGGCACCGAT TGTGGGCTTGTATAGGTTTTGAC...LCTG 239 L++R+LRR + + ++ G AC+ DP +P PLC+G Sbjct: 108 LQQRELRRKLLADSGALNTNSVNGPRNWKACVQQDPSSRPGTPLCSG 154 >sp|A6UUY8|RNZ_META3...49 Tissue type young leaves Developmental stage sporophyte Contig ID CL454Contig1 Sequence GATGAGCGA...CCACCTGTGCAACCGTCAGCGCCTTTGTGCACTGGTG CAATGTCCTGTGGTTACCTTGTTTGGAATCTTAATTGTTCTCATGTAT

  9. AcEST: BP917632 [AcEST

    Full Text Available YMU001_000103_D10 554 Adiantum capillus-veneris mRNA. clone: YMU001_000103_D10. BP917632 - Show ... YSKCKIHQKALELLVLML 154 Query: 466 KDSLEPDEVTYLNVLKACARE EDLKV 543 +D++ P+ TY +VL++C D+++ Sbjct: 155 RDNVRPN ... 185 Query: 415 GHSDSS--KEALKLLTQMRKDSLEPDEVTYLNVLKACARE EDLK 540 + EA KL +M+ ++ PDE+ N++ AC R +++ Sbjct: 18 ...

  10. AcEST: DK961189 [AcEST

    Full Text Available OS=A... 127 7e-29 sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS... 125 2e-28 sp|P00785|AC...IRNSWGLNWGDSGYVKLQRNIDDPFGKCGIAMMPSYP 347 >sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS=

  11. AcEST: DK946687 [AcEST

    Full Text Available YMU02A01NGRL0013_G11 544 Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0013_G11. 5' end seq ... + G P+ TY+ + AC+ E Sbjct: 97 YSFNYMIRGLTNTWN-------DHEA ---ALSLYRRMKFSGLKPDKFTYNFVFIACAKLE 146 Query: 214 A ... Sbjct: 71 LIPKAVELGDFNYSSFLFSVTEEPNHYSFNYMIRGLTNTWNDHEA ALSLYRRMKFSGLKP 130 Query: 469 DGATFSCVLRACGNVGALDV ...

  12. AcEST: DK949372 [AcEST

    Full Text Available TST38A01NGRL0005_N02 627 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0005_N02. 5' end seq ... 363 DQLREKTC-GVDKFDDIVMACXXXXXXXXXXXXXXXXXXKARVHAYGVCD DPEYFYDYVQ 539 Q++EK G+ FDDIV+AC KA+VHA+ VCD DP+YFYD ... 264 QQVQEKKVPGITFFDDIVVACGSGGSIAGLSLGSYLSNLKAKVHAFAVCD DPDYFYDYTQ 323 Query: 540 GLLDGMNANIASRDIVNVIDAKGLG ...

  13. On isomorphisms of integral table algebras

    FAN; Yun(樊恽); SUN; Daying(孙大英)

    2002-01-01

    For integral table algebras with integral table basis T, we can consider integral R-algebra RT over a subring R of the ring of the algebraic integers. It is proved that an R-algebra isomorphism between two integral table algebras must be an integral table algebra isomorphism if it is compatible with the so-called normalizings of the integral table algebras.

  14. The Cosmic Microwave Background

    Jones Aled

    1998-01-01

    Full Text Available We present a brief review of current theory and observations of the cosmic microwave background (CMB. New predictions for cosmological defect theories and an overview of the inflationary theory are discussed. Recent results from various observations of the anisotropies of the microwave background are described and a summary of the proposed experiments is presented. A new analysis technique based on Bayesian statistics that can be used to reconstruct the underlying sky fluctuations is summarised. Current CMB data is used to set some preliminary constraints on the values of fundamental cosmological parameters $Omega$ and $H_circ$ using the maximum likelihood technique. In addition, secondary anisotropies due to the Sunyaev-Zel'dovich effect are described.

  15. Unitarity and singular backgrounds

    Brouzakis, Nikos; Quiros, Mariano

    2013-01-01

    We compute the graviton Kaluza-Klein spectrum on a gravity-dilaton background with a naked singularity for all possible boundary conditions at the singularity which are consistent with unitary evolution. We apply methods from non-relativistic quantum mechanics with singular Schr\\"{o}dinger potentials. In general the spectrum contains a tachyon, a sign of instability. Only for a particular boundary condition at the singularity is the spectrum free of tachyons. In this case the lowest-lying gra...

  16. Australia; Background Material

    International Monetary Fund

    1995-01-01

    This paper describes the developments in the Australian labor market during the 1990s. In 1994, a number of new labor market programs were launched, directed especially at the long-term unemployed, and a further step was taken in the evolutionary reform of the industrial relations system. The paper reviews developments in employment, wages, and productivity in Australia that formed the background to these policy initiatives. It also examines the conduct of fiscal policy at the Commonwealth an...

  17. Sri Lanka; Background Papers

    International Monetary Fund

    1995-01-01

    This Background Paper on Sri Lanka provides information on the economic developments during 1992–95. Developments in the domestic and external sectors are discussed. The deficiencies of the official consumer price index that resulted in a substantial understatement of inflation performance in 1994 and alternative estimates of underlying inflation are described. The structural rigidities in the labor market that perpetuate high unemployment and limit job growth are also described. The paper ...

  18. Background, phenomenology, and motivation

    The authors discuss the background to the kinetics of adsorption and desorption after an elementary introduction to the problem of chemisorption in two limiting cases. Other topics discussed include the thermodynamics of adsorption, reaction mechanisms outside surfaces, and a case history of catalytic hydrogenation of carbon monoxide. Figures show the potential energy barrier as a function of an appropriate reaction coordinate, and bonding of carbon monoxide to platinum metal

  19. Energy saving in ac generators

    Nola, F. J.

    1980-01-01

    Circuit cuts no-load losses, without sacrificing full-load power. Phase-contro circuit includes gate-controlled semiconductor switch that cuts off applied voltage for most of ac cycle if generator idling. Switch "on" time increases when generator is in operation.

  20. Apuntes de Acústica

    Martín Domingo, Agustín

    2014-01-01

    Esta publicacion contiene unos apuntes para la parte de Acústica de las asignaturas de la ETSAM, junto con cierta cantidad de material adicional que excede el ámbito del curso. Aunque está lejos de ser completa y de estar libre de errores, el autor espera sea útil.

  1. SSTI Clark ACS Technology Demonstrations

    Freesland, Douglas

    1997-01-01

    SSTI Clark, one of two spacecraft built under NASA's Small Satellite Technology Initiative, includes seven ACS technology demonstrations. The technologies redefine the performance cost envelope, providing improved sensor and actuator performance at reduced costs. Six sensing technologies are being flown consisting of both hardware and algorithmic demonstrations: autonomous star tracker, hemispherical resonating gyro, GPS attitude determination, miniature horizon sensors, low cost course sun s...

  2. MCNPX Model/Table Comparison

    Hendricks, J S

    2003-01-01

    MCNPX is a Monte Carlo N-Particle radiation transport code extending the capabilities of MCNP4C. As with MCNP, MCNPX uses nuclear data tables to transport neutrons, photons, and electrons. Unlike MCNP, MCNPX also uses (1) nuclear data tables to transport protons; (2) physics models to transport 30 additional particle types (deuterons, tritons, alphas, pions, muons, etc.); and (3) physics models to transport neutrons and protons when no tabular data are available or when the data are above the energy range (20 to 150 MeV) where the data tables end. MCNPX can mix and match data tables and physics models throughout a problem. For example, MCNPX can model neutron transport in a bismuth germinate (BGO) particle detector by using data tables for bismuth and oxygen and using physics models for germanium. Also, MCNPX can model neutron transport in UO sub 2 , making the best use of physics models and data tables: below 20 MeV, data tables are used; above 150 MeV, physics models are used; between 20 and 150 MeV, data t...

  3. Ecological periodic tables for nekton and benthic macrofaunal community usage of estuarine habitats

    Background/Questions/Methods The chemical periodic table, the Linnaean system of classification, and the Hertzsprung-Russell diagram are iconic information organizing systems because they are simple, easy to understand, exceptionally useful, and they foster the expansion of sc...

  4. Backgrounded but not peripheral

    Hovmark, Henrik

    DDAs in question contribute to the socio-cultural construction of identity, i.e. that they play a rather specific role in discursive communication and socio-cultural meaning construction. On the other hand it is clear that the semantics of the DDAs in question, seen in isolation, is very abstract or...... general; furthermore, the DDAs are backgrounded in discourse. Is it reasonable to claim, rather boldly, that “the informants express their identity in the use of the directional adverb ud ‘out’ etc.”? In the course of this article, however, I suggest that the DDAs in question do contribute to the socio-cultural...

  5. The Cosmic Background Radiation

    Smoot, George; Scott, Douglas

    1997-01-01

    We review the current status of experimental data for spectral distortions and angular anisotropies of the cosmic microwave background, as well as discussing the relevant physical processes. This is one of a number of new articles in astrophysics and cosmology which will appear in the 1996 Review of Particle Properties (Phys. Rev. D. in press). Other relevant reviews include: "Big-Bang Cosmology" by K.A. Olive; "Big-Bang Nucleosynthesis" by K.A. Olive & D.N. Schramm; "The Hubble Constant" by ...

  6. Malaysia; Background Paper

    International Monetary Fund

    1996-01-01

    This Background Paper on Malaysia examines developments and trends in the labor market since the mid-1980s. The paper describes the changes in the employment structure and the labor force. It reviews wages and productivity trends and their effects on unit labor cost. The paper highlights that Malaysia’s rapid growth, sustained since 1987, has had a major impact on the labor market. The paper outlines the major policy measures to address the labor constraints. It also analyzes Malaysia’s r...

  7. Background and introduction

    Jensen, Per Anker; van der Voordt, Theo; Coenen, Christian

    2012-01-01

    in scope between FM and CREM is that CREM has its focus on real estate as physical and economical assets utilized by an organisation, while FM has a wider service focus. The difference in scope between FM and CREM on one side and B2B marketing on the other is that FM and CREM are related to...... chapter provides important background information to understand the following chapters in this book. Research limitations: The chapter is mainly based on the experience and knowledge of the editors. It does not include original research but provides an introductory overview of the book. Originality...

  8. Family Background and Entrepreneurship

    Lindquist, Matthew J.; Sol, Joeri; Van Praag, Mirjam;

    Vast amounts of money are currently being spent on policies aimed at promoting entrepreneurship. The success of such policies, however, rests in part on the assumption that individuals are not ‘born entrepreneurs’. In this paper, we assess the importance of family background and neighborhood...... effects as determinants of entrepreneurship. We start by estimating sibling correlations in entrepreneurship. We find that between 20 and 50 percent of the variance in different entrepreneurial outcomes is explained by factors that siblings share. The average is 28 percent. Allowing for differential...... entrepreneurship does play a large role, as do shared genes....

  9. The Periodic Table in Croatia

    Raos, N.

    2011-12-01

    Full Text Available The Croatian (Yugoslav Academy of Sciences and Arts was the first academy to elect D. I. Mendeleev as its honorary member (1882, whereas the periodic table of the elements has been taught regularly at the Zagreb University since 1888. The early interest of Croatian chemists in the periodic table should be attributed primarily to their pan-Slavic attitude, particularly as proof that Slavic people were able to produce "their own Newtons" (M. V. Lomonosov and D. I. Mendeleev. Such enthusiastic views, however, did not help in analyzing the contribution of Mendeleev and other scientists to the discovery and development of the periodic table of the elements.

  10. AcEST: DK950895 [AcEST

    Full Text Available |A7SFA3|A7SFA3_NEMVE Predicted protein OS=Nematostella vectens... 210 5e-53 tr|Q0CVA9|Q0CVA9_ASPTN ATP-citrate synthase subunit...stX Result : Swiss-Prot sp_hit_id Q54YA0 Definition sp|Q54YA0|ACLY_DICDI Probable ATP-citrate synthase OS=Dictyos...PIDYSWAQELGLIRKPAAFISTI 404 >sp|Q8X097|ACL1_NEUCR Probable ATP-citrate synthase subunit 1 OS=Neurospora cras...IRKPASFMTSI 844 >sp|Q9P7W3|ACL1_SCHPO Probable ATP-citrate synthase subunit 1 OS=Schizosaccharomyces pombe G....done Score E Sequences producing significant alignments: (bits) Value sp|Q54YA0|ACLY_DICDI Probable ATP-citrate synthase OS=Dictyos

  11. A comprehensive assessment of the effects of Bt cotton on Coleomegilla maculata demonstrates no detrimental effects by Cry1Ac and Cry2Ab.

    Yunhe Li

    Full Text Available The ladybird beetle, Coleomegilla maculata (DeGeer, is a common and abundant predator in many cropping systems. Its larvae and adults are predaceous, feeding on aphids, thrips, lepidopteran larvae and plant tissues, such as pollen. Therefore, this species is exposed to insecticidal proteins expressed in insect-resistant, genetically engineered cotton expressing Cry proteins derived from Bacillus thuringiensis (Bt. A tritrophic bioassay was conduced to evaluate the potential impact of Cry2Ab- and Cry1Ac-expressing cotton on fitness parameters of C. maculata using Bt-susceptible and -resistant larvae of Trichoplusia ni as prey. Coleomegilla maculata survival, development time, adult weight and fecundity were not different when they were fed with resistant T. ni larvae reared on either Bt or control cotton. To ensure that C. maculata were not sensitive to the tested Cry toxins independent from the plant background and to add certainty to the hazard assessment, C. maculata larvae were fed artificial diet incorporated with Cry2Ab, Cry1Ac or both at >10 times higher concentrations than in cotton tissue. Artificial diet containing E-64 was included as a positive control. No differences were detected in any life-table parameters between Cry protein-containing diet treatments and the control diet. In contrast, larvae of C. maculata fed the E-64 could not develop to the pupal stage and the 7-d larval weight was significantly negatively affected. In both feeding assays, the stability and bioactivity of Cry proteins in the food sources were confirmed by ELISA and sensitive-insect bioassays. Our results show that C. maculata is not affected by Bt cotton and is not sensitive to Cry2Ab and Cry1Ac at concentrations exceeding the levels in Bt cotton, thus demonstrating that Bt cotton will pose a negligible risk to C. maculata. More importantly, this study demonstrates a comprehensive system for assessing the risk of genetically modified plants on non

  12. AcEST: BP914304 [AcEST

    Full Text Available IDEHTFVFTLRAC 4 V+ NA++ Y G+ E A++ + +M+ E++ + TF+ LRAC Sbjct: 670 VTWNAMICGYAHHGKGEEAIQLFERMILENIKPNHVTFISI...KSLRRDFVTWNAMICGYAHHGKGEEAIQLFERMILENIKPN 703 Query: 339 NLTYVSLFKACGNVLDFGQG-RTIHGEARANGFSSDRFICTTLI...TFVFTLRAC 4 +F + + V+ N ++ +YV A +++M + D TL+AC Sbjct: 484 QIFERMCDRDNVTWNTIIGSYVQDENESEAFDLFKRMNLCGIVSDGACL...K + A+Q+ + R + +W++MI++ +A + ++ M Sbjct: 93 LGNSLINFYSKFEDVASAEQVFRRMTLRDVVTWSSMIAAYAGNNHPAKAFDTFERMTDAN 152... + R + +W++MI++ +A + ++ M Sbjct: 93 LGNSLINFYSKFEDVASAEQVFRRMTLRDVVTWSSMIAAYAGNNHPAKAFDTFERM

  13. AcEST: BP911793 [AcEST

    Full Text Available + +VSWN +++ Y QHG + ++L+ M+AE T N + + A Sbjct: 58 EAKFVFERIQNKDVVSWNCIINGYSQHGPSGSSHVMELFQRMRAENTAPNAHTFAGVF... N + + A Sbjct: 58 EAKFVFERIQNKDVVSWNCIINGYSQHGPSGSSHVMELFQRMRAENTAPNAHTFAGVFTA 117 Query: 359 CIQTGNLELCKQM...D VT S+LSACSH G + +G YF Sbjct: 602 IIGGSAQHGRGQDALQLFERMKMEGVKPDIVTFVSLLSACSHAGLLEEGRRYF 654 Score = 115 bit...53 QTGNLELCKQMHFNIVSAGNELNPSLASSLIRTYGNCGSMLDAHAVFDSLPLPDIVSWNV 174 Q +E+ K++ F+++ N S +++I Y CG + +A +FD +P D VSW Sbjct: 324 QGERME... L+ M +E + I+LV +L AC+ TG+LE + +H Sbjct: 498 VITWNAMIASYVHCEQSEKAIALFDRMVSENFKPSSITLVTLLMACVNTGSLER

  14. AcEST: BP921649 [AcEST

    Full Text Available 40 + ++LV YAK L + ++ +P R W+ +I+ + + ++E AL+ + M+ G Sbjct: 144 VASSLVGMYAKFNLFENSLQVFDEMPERDVASWNTVISCFYQSGEAEKALELFGRME...LDCYKEM 52 ++L +GNALVD YAKCG L A ++ +R+ R V W+ +I Y + E A D +K M Sbjct: 461 KNLFVGNALVDMYAKCGALEDARQIFERMCDRDNVTWNTIIGSYVQDEN...RD+ WNA+I Sbjct: 237 LEQGKQIHCYAIRSG-IESDVLVVNGLVNMYAKCGNVNTAHKLFERMPIRDVASWNAIIG 295 Query: 411 GYVNHGRAEVALDCFGKME...SNDVV-GNALVNMYAKCGNVNSAYKLFERMPKKNVVAWNAIIS 396 Query: 411 GYVNHGRAEVALDCFGKME... HGR + AL F +M+ EG PD +TF +L AC G + + + + Sbjct: 603 IGGSAQHGRGQDALQLFERMKMEGVKPDIVTFVSLLSACSHAGLLEEGRRYFCSM

  15. AcEST: BP919669 [AcEST

    Full Text Available D + RDV SW ++S + + G+ ++F M G +P+ Sbjct: 148 LVGMYAKFNLFENSLQVFDEMPERDVASWNTVISCFYQSGEAEKALELFGRMESSGFEPN 20...+ +++AC L + +G+E+H + K+G EL V Sbjct: 190 EKALELFGRMESSGFEPNSVSLTVAISACSRLLWLERGKE...F Sbjct: 468 IY---VVNSLIDSYGKCSHVEDAERIFEECTIGDLVSFTSMITAYAQYGQGEEALKLFLE 524 Query: 226 MVGEGTKPDSISLLVVLRA-YNF...+ IR DV W +LMSGY+K D ++F ++ Sbjct: 44 SLINVYFTCKDHCSARHVFENFDIRSDVYIWNSLMSGYSKNSMFHDTLEVFKRLLNCSIC 103 Query: 208 KPDSISLLVVLRAYNF...KPD Sbjct: 261 VDMYAKCGCIETAVEVFEKLTRRNVFSWAALIGGYAAYGYAKKATTCLDRIEREDGIKPD 320 Query: 199 SISLLVVLRAYNFLGFP

  16. AcEST: DK957916 [AcEST

    Full Text Available PQKQPVPAVSHSPQKSSTPPTPAATKPKEEPSVPKEVPKLQQGKLEKT 967 Query: 577 --TTEASQGIPVEEG...G E+ P+ P Sbjct: 1974 QEQGRAPSQDQEAPSPEALPSPGQEPAAGASPRRGELRRGSSAESALPRAGP 2025 >sp|Q05175|BASP_RAT Brain ac... +P AP P Sbjct: 388 ERETAASAGPQG----AFPEPRPAQPSAGPEPRPAQPSAGPEPRPAQPSAAPEPRP---- 439 Query: 571 GQTTE... L ++ +A+ +E AP Sbjct: 406 IVTTPEPEGSGEEDVPKPDEIPEKEVTEEELIKVSTAAPAKASPEEEVVKATTLAPSEED 465 Query: 550 VSPYIASGQTTE... Query: 424 KGQAYEAIPDPHVDPAAGVHERLAQLQLGDEPEATKPKEAPG-VSPYI--ASGQTTEASQ 594 K A E P + + G E + E EA P A G +P

  17. AcEST: DK956923 [AcEST

    Full Text Available CCATAGTCTCAA CAGCGATAAGCAGGAAATGCATGCAGTGACCATGGGTAAGAAAAGGGTCATGGTGGGCGC CATTAACACGATACTTATCCTA...CTCCTCTTGCAGTTTATGAAGCAATGTTCTTCCTCTTC TAGTCATGATGATGATGGCGATGCCTTTGCGGATGACACTCTAAGCAGACGCAACGAT...AC GGTCGAGTCTGCTCCTCGACATTGGCCAAGGCGAATGCTGGGCAGCCAAGAACCTGCCTC CAACAAGACTTCATATGGTATTCCTGAT...H At1g73965 (CLE13 / CLAVATA3/ESR-Related 13) (CLE13) OS=Arabidopsis thaliana Align length 25 Sco...icant alignments: (bits) Value tr|Q6NMF0|Q6NMF0_ARATH At1g73965 (CLE13 / CLAVATA3/ESR-Related 1... 49 3e-04

  18. AcEST: BP921492 [AcEST

    Full Text Available + AL +G+ +H Sbjct: 286 DVASWNAIIGGYSLNSQHHEALAFFNRMQVRGIKPNSITMVSVLPACAHLFAL... ++ L +GK +H Sbjct: 178 NLVSWTAMVSGYAQGGFADEALRMFYEMQGEDVKANYVTVASVLPACAQLSDLQQGKEIH 237 Query: 153 AC...FDRMPEK 171 Query: 333 DVVSWSAMIAMYGQQGCGKEAFQLFQEMACEGGMPNRVTYVSILDACASVAALPEGKLVH 154 +V+W+++++ + Q G EA Q+F +M G P+ T+VS+L ACA...333 DVVSWSAMIAMYGQQGCGKEAFQLFQEMACE-GGMPNRVTYVSILDACASVAALPEGKLV 157 +V +W+AMI+ YG G G++A +LF +M + G +PN VT+V++L ACA...SKL 85 Query: 288 GCGKEAFQLFQEMACEGGMPNRVTYVSILDACASVAALPEGKLVHACFMESELELDVVVG 109 ++ M P+ T+ S++ +CA ++AL G

  19. The Backgrounds Data Center

    Snyder, W. A.; Gursky, H.; Heckathorn, H. M.; Lucke, R. L.; Berg, S. L.; Dombrowski, E. G.; Kessel, R. A.

    1993-01-01

    The Strategic Defense Initiative Organization has created data centers for midcourse, plumes, and backgrounds phenomenologies. The Backgrounds Data Center (BDC) has been designated as the prime archive for data collected by SDIO programs. The BDC maintains a Summary Catalog that contains 'metadata,' that is, information about data, such as when the data were obtained, what the spectral range of the data is, and what region of the Earth or sky was observed. Queries to this catalog result in a listing of all data sets (from all experiments in the Summary Catalog) that satisfy the specified criteria. Thus, the user can identify different experiments that made similar observations and order them from the BDC for analysis. On-site users can use the Science Analysis Facility (SAFE for this purpose. For some programs, the BDC maintains a Program Catalog, which can classify data in as many ways as desired (rather than just by position, time, and spectral range as in the Summary Catalog). For example, data sets could be tagged with such diverse parameters as solar illumination angle, signal level, or the value of a particular spectral ratio, as long as these quantities can be read from the digital record or calculated from it by the ingest program. All unclassified catalogs and unclassified data will be remotely accessible.

  20. Automation of BESSY scanning tables

    A micro processor M6800 is used for the automation of scanning and premeasuring BESSY tables. The tasks achieved by the micro processor are: 1. control of spooling of the four asynchronous film winding devices and switching on and off the 4 projections lamps, 2. pre-processing of the data coming from a bi-polar coordinates measuring device, 3. bi-directional interchange of informations between the operator, the BESSY table and the DEC PDP 11/34 mini computer controling the scanning operations, 4. control of the magnification on the table by swapping the projection lenses of appropriate focal lengths and the associated light boxes (under development). In connection with point 4, study is being made for the use of BESSY tables for accurate measurements (+/-5 microns), by encoding the displacements of the projections lenses. (orig.)

  1. The redoubtable ecological periodic table

    Ecological periodic tables are repositories of reliable information on quantitative, predictably recurring (periodic) habitat–community patterns and their uncertainty, scaling and transferability. Their reliability derives from their grounding in sound ecological principle...

  2. The Table Mountain Field Site

    Federal Laboratory Consortium — The Table Mountain Field Site, located north of Boulder, Colorado, is designated as an area where the magnitude of strong, external signals is restricted (by State...

  3. Using Tables to Teach Mathematics.

    Keller, Clifton

    1978-01-01

    The construction of tables of numbers is discussed as a learning activity that involves work in such things as reciprocals, calculators, formulas, patterns, discovery, prime numbers, and other types of numbers. (MP)

  4. Performance of AC/graphite capacitors at high weight ratios of AC/graphite

    Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)

    2008-03-01

    The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)

  5. Simultaneous distribution of AC and DC power

    Polese, Luigi Gentile

    2015-09-15

    A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.

  6. The tables of the discipline

    Doroshin B. A.

    2013-03-01

    Full Text Available This publication presents the training table, which presents the material on the theory of the origin of the state, causes and effects in the formation of the state in terms of socio-economic determinism, political, economic, social, environmental, law enforcement, national, cultural and external functions of the state. The tables can be used by teachers as a component of training materials provided to students for independent work, and to create presentations, students demonstrated in classroom learning.

  7. The Periodic Table in Croatia

    Raos, N.

    2011-01-01

    The Croatian (Yugoslav) Academy of Sciences and Arts was the first academy to elect D. I. Mendeleev as its honorary member (1882), whereas the periodic table of the elements has been taught regularly at the Zagreb University since 1888. The early interest of Croatian chemists in the periodic table should be attributed primarily to their pan-Slavic attitude, particularly as proof that Slavic people were able to produce "their own Newtons" (M. V. Lomonosov and D. I. Mendeleev). Such enthusiasti...

  8. Bayesian analysis of contingency tables

    Gómez Villegas, Miguel A.; González Pérez, Beatriz

    2005-01-01

    The display of the data by means of contingency tables is used in different approaches to statistical inference, for example, to broach the test of homogeneity of independent multinomial distributions. We develop a Bayesian procedure to test simple null hypotheses versus bilateral alternatives in contingency tables. Given independent samples of two binomial distributions and taking a mixed prior distribution, we calculate the posterior probability that the proportion of successes in the first...

  9. Holography for Schrodinger backgrounds

    Guica, Monica; Taylor, Marika; van Rees, Balt

    2010-01-01

    We discuss holography for Schrodinger solutions of both topologically massive gravity in three dimensions and massive vector theories in (d+1) dimensions. In both cases the dual field theory can be viewed as a d-dimensional conformal field theory (two dimensional in the case of TMG) deformed by certain operators that respect the Schrodinger symmetry. These operators are irrelevant from the viewpoint of the relativistic conformal group but they are exactly marginal with respect to the non-relativistic conformal group. The spectrum of linear fluctuations around the background solutions corresponds to operators that are labeled by their scaling dimension and the lightcone momentum k_v. We set up the holographic dictionary and compute 2-point functions of these operators both holographically and in field theory using conformal perturbation theory and find agreement. The counterterms needed for holographic renormalization are non-local in the v lightcone direction.

  10. STIL - Starlink Tables Infrastructure Library

    Taylor, Mark

    STIL is a set of Java class libraries which allow input, manipulation and output of tabular data and metadata. Among its key features are support for many tabular formats (including VOTable, FITS, CDF, text-based formats and SQL databases) and support for dealing with very large tables in limited memory. As well as an abstract and format-independent definition of what constitutes a table, and an extensible framework for "pull-model" table processing, it provides a number of format-specific handlers which know how to serialize/deserialize tables. The framework for interaction between the core table manipulation facilities and the format-specific handlers is open and pluggable, so that handlers for new formats can easily be added, programmatically or at run-time. The VOTable handling in particular is provided by classes which perform efficient XML parsing and can read and write VOTables in any of the defined formats (TABLEDATA, BINARY or FITS). It supports table-aware SAX- or DOM-mode processing and may be used on its own for VOTable I/O without much reference to the format-independent parts of the library.

  11. Background information to the installers guide for small scale mains connected PV

    NONE

    2002-07-01

    This report contains background information used by BRE, EA Technology, Halcrows and Sundog when compiling guidance for the UK's New and Renewable Energy Programme on the installation of small-scale photovoltaics (PV) in buildings. The report considers: relevant standards; general safety issues; fire and safety issues, including the fire resistance of PV modules; PV module ratings such as maximum voltage and maximum current; DC cabling; the DC disconnect; the DC junction box; fault analysis; general and AC side earthing; DC earthing; lightning and surge suppression; inverters; AC modules; AC systems; getting connection; mounting options; and installation issues.

  12. Genetical background of intelligence.

    Junkiert-Czarnecka, Anna; Haus, Olga

    2016-01-01

    Intelligence as an ability to reason, think abstractly and adapt effectively to the environment is a subject of research in the field of psychology, neurobiology, and in the last twenty years genetics as well. Genetical testing of twins carried out from XX century indicated heritebility of intelligence, therefore confirmed an influence of genetic factor on cognitive processes. Studies on genetic background of intelligence focus on dopaminergic (DRD2, DRD4, COMT, SLC6A3, DAT1, CCKAR) and adrenergic system (ADRB2, CHRM2) genes as well as, neutrofins (BDNF) and oxidative stress genes (LTF, PRNP). Positive effect of investigated gene polymorphism was indicated by variation c.957C>T DRD2 gene (if in polymorphic site is thymine), polymorphism c.472G>A COMT gene (presence of adenine) and also gene ADRB2 c.46A->G (guanine), CHRM2 (thymine in place c.1890A>T) and BDNF (guanine in place c.472G>A) Obtained results indicate that intelligence is a feature dependent not only on genetic but also an environmental factor. PMID:27333929

  13. Biological aerosol background characterization

    Blatny, Janet; Fountain, Augustus W., III

    2011-05-01

    To provide useful information during military operations, or as part of other security situations, a biological aerosol detector has to respond within seconds or minutes to an attack by virulent biological agents, and with low false alarms. Within this time frame, measuring virulence of a known microorganism is extremely difficult, especially if the microorganism is of unknown antigenic or nucleic acid properties. Measuring "live" characteristics of an organism directly is not generally an option, yet only viable organisms are potentially infectious. Fluorescence based instruments have been designed to optically determine if aerosol particles have viability characteristics. Still, such commercially available biological aerosol detection equipment needs to be improved for their use in military and civil applications. Air has an endogenous population of microorganisms that may interfere with alarm software technologies. To design robust algorithms, a comprehensive knowledge of the airborne biological background content is essential. For this reason, there is a need to study ambient live bacterial populations in as many locations as possible. Doing so will permit collection of data to define diverse biological characteristics that in turn can be used to fine tune alarm algorithms. To avoid false alarms, improving software technologies for biological detectors is a crucial feature requiring considerations of various parameters that can be applied to suppress alarm triggers. This NATO Task Group will aim for developing reference methods for monitoring biological aerosol characteristics to improve alarm algorithms for biological detection. Additionally, they will focus on developing reference standard methodology for monitoring biological aerosol characteristics to reduce false alarm rates.

  14. Low background infrared (LBIR) facility

    Federal Laboratory Consortium — The Low background infrared (LBIR) facility was originally designed to calibrate user supplied blackbody sources and to characterize low-background IR detectors and...

  15. Hanford Site background: Part 1, Soil background for nonradioactive analytes

    Volume two contains the following appendices: Description of soil sampling sites; sampling narrative; raw data soil background; background data analysis; sitewide background soil sampling plan; and use of soil background data for the detection of contamination at waste management unit on the Hanford Site

  16. AcEST: DK948526 [AcEST

    Full Text Available TST38A01NGRL0003_I19 675 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0003_I19. 5' end seq ... IAMVRTTTPVYV 214 Query: 542 ALALFNQARVSSLPIIDDNGSLIDIY ARSDITALARDDTY 661 AL +F Q RVS+LP++D+ G ++DIY ++ D+ ... LA + TY Sbjct: 215 ALGIFVQHRVSALPVVDEKGRVVDIY SKFDVINLAAEKTY 254 >sp|Q09138|AAKG1_PIG 5'-AMP-acti ... IAMVRTTTPVYV 215 Query: 542 ALALFNQARVSSLPIIDDNGSLIDIY ARSDITALARDDTY 661 AL +F Q RVS+LP++D+ G ++DIY ++ D+ ... LA + TY Sbjct: 216 ALGIFVQHRVSALPVVDEKGRVVDIY SKFDVINLAAEKTY 255 >sp|O54950|AAKG1_MOUSE 5'-AMP-ac ...

  17. AcEST: DK962916 [AcEST

    Full Text Available TST39A01NGRL0015_C06 596 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0015_C06. 5' end seq ... NA. clone: TST39A01NGRL0015_C06. 5' end sequence. Acce ssion DK962916 Tissue type prothallia with plantlet ... 2 Query: 317 MPKSKEPCSQEACDIQTCLVKNNFITERCFPVIEALQACCE K 442 MP+ K+PC ++AC+IQ CL NN++ +C VI+ L+ CC + Sbjct ... me = +2 Query: 335 PCSQEACDIQTCLVKNNFITERCFPVIEALQACCE K 442 PC +EAC IQ CL+ + + +C VI+ L CC K Sbjct: 4 PCQ ... = +2 Query: 326 SKEPCSQEACDIQTCLVKNNFITERCFPVIEALQACCE KCNSK 454 + E C+ CD +TC +K F +C AL CCE KC K Sbjct: 4 ...

  18. AcEST: DK955705 [AcEST

    Full Text Available TST39A01NGRL0023_N02 635 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0023_N02. 5' end seq ... NA. clone: TST39A01NGRL0023_N02. 5' end sequence. Acce ssion DK955705 Tissue type prothallia with plantlet ... 2 Query: 296 MPKSKEPCSQEACDIQTCLVKNNFITERCFPVIEALQACCE K 421 MP+ K+PC ++AC+IQ CL NN++ +C VI+ L+ CC + Sbjct ... me = +2 Query: 314 PCSQEACDIQTCLVKNNFITERCFPVIEALQACCE K 421 PC +EAC IQ CL+ + + +C VI+ L CC K Sbjct: 4 PCQ ... = +2 Query: 305 SKEPCSQEACDIQTCLVKNNFITERCFPVIEALQACCE KCNSK 433 + E C+ CD +TC +K F +C AL CCE KC K Sbjct: 4 ...

  19. AcEST: DK961330 [AcEST

    Full Text Available FWVPCMHTPIKQEKHTHA 405 +AR P W +++PI+ ++C++ P + AK+ PL DVTH+F+V + +QE Sbjct: 61 VARRTRP-SWHEDNPINYVQCDISDPDD...+IL +D PGGPWKVYG Sbjct: 4 WWAGAIGAAKKKLEEDDAPPKHS---SVALIVGVTGIIGNSLAEILPLADTPGGP...AWHEDNPINYIQCDISDPDDSLAKLSPLTDVTHVFYVTCANR--STEPENCE 117 Query: 406 MATHMFENIIGVLLTHAPNLQHVCMQTSDKHY-... : Swiss-Prot sp_hit_id Q7MXT7 Definition sp|Q7MXT7|LPXD_PORGI UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac...lue sp|Q7MXT7|LPXD_PORGI UDP-3-O-[3-hydroxymyristoyl] glucosamine N-... 34 0.62 sp|P60369|KR103_HUMAN Kerati

  20. AcEST: BP913772 [AcEST

    Full Text Available N VT V L C+ G G+ H Sbjct: 350 NVVTWSAVIAGYAQRGLGFEALDVFRQMRLCGSEPNVVTLVSLLSGCALAGTLLHGKETH 409 Query: 376 IEIER--RGLLEVDP-...VFNKLSVQDIVSW 236 + + A ++G+++H I RRGL + PV+ + LV MY R G L Q VF+++ +D+VSW Sbjct: 296 ASLAALEQGKLIHGYILRRGLDSILPVI-S... TF M+ +PN+VT V VL+AC+ + Q + Sbjct: 250 SWSAMIACYAKNGKAFEALRTFREMMRETKDSSPNSVTMVSVLQACASLA...MIEGGVAPNAVTFVVVLRACSQTGSYSQSQTFFEAMSKNF 50 + G A G + F+ M + GV PNAVTFV VLR CS G + Q F++M F Sbjct: 312 ALNGLAMNGFGEKCLELFSL...L YA G + + +F++ D+ +TA + + Sbjct: 48 IHAAILRHNLLLHPRYPVLNLKLHRAYASHGKIRHSLALFHQTIDP

  1. AcEST: DK952954 [AcEST

    Full Text Available TST38A01NGRL0015_H21 616 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0015_H21. 5' end seq ... LIHAHIVCSCNDVDNFVRSTLVNLYSKCGSIEDAHNVFAKLATRRSVDWSMMIS ... 541 ++ Q K +HA I + D + V + L+++Y+KCGSI DA F +++T+ ... LIHAHIVCSCNDVDNFVRSTLVNLYSKCGSIEDAHNVFAKLATRRSVDWSMMIS GS 547 + + IHA S D ++ LV LYS+CG IE+++ F + ++ W+ ++S ... LIHAHIVCSCNDVDNFVRSTLVNLYSKCGSIEDAHNVFAKLATRRSVDWSMMIS ... 541 DL + IH+ I+ + ++ +V S L+++Y+K G ++ A ++ + A + ... EA+ LF +M G+ P + + L AC Sbjct: 243 RVFDGLRLKDHSSWVAMIS GLSKNECEAEAIRLFCDMYVLGIMPTPYAFSSVLSACKKIE 302 Query ...

  2. AcEST: BP912540 [AcEST

    Full Text Available YMU001_000020_B03 501 Adiantum capillus-veneris mRNA. clone: YMU001_000020_B03. BP912540 - Show ... 2 EELTVHHTASVGDVEALKALLAEGADKDEKDSEGRTALHFACGYGEVMCAE VLLEAGVAV 181 EE VH TAS+GDVE LKA LA G +KDE+DSEGRTAL ... ry: 14 VHHTASVGDVEALKALLAEGADKDEKDSEGRTALHFACGYGEVMCAE VLLEAGVAVDAVD 193 +H A V ++ LL GAD KD G LH AC YG AE ... uery: 26 ASVGDVEALKALLAEGADKDEKDSEGR--TALHFACGYGEVMCAE VLLEAGVAVDAVDKN 199 + GD+E +K L + + + +D EGR T LHFA ... ry: 14 VHHTASVGDVEALKALLAEGADKDEKDSEGRTALHFACGYGEVMCAE VLLEAGVAVDAVD 193 +H A ++E + LL GAD + +D G LH A YG ...

  3. Assessing the allelotypic effect of two aminocyclopropane carboxylic acid synthase-encoding genes MdACS1 and MdACS3a on fruit ethylene production and softening in Malus

    Dougherty, Laura; Zhu, Yuandi; Xu, Kenong

    2016-01-01

    Phytohormone ethylene largely determines apple fruit shelf life and storability. Previous studies demonstrated that MdACS1 and MdACS3a, which encode 1-aminocyclopropane-1-carboxylic acid synthases (ACS), are crucial in apple fruit ethylene production. MdACS1 is well-known to be intimately involved in the climacteric ethylene burst in fruit ripening, while MdACS3a has been regarded a main regulator for ethylene production transition from system 1 (during fruit development) to system 2 (during fruit ripening). However, MdACS3a was also shown to have limited roles in initiating the ripening process lately. To better assess their roles, fruit ethylene production and softening were evaluated at five time points during a 20-day post-harvest period in 97 Malus accessions and in 34 progeny from 2 controlled crosses. Allelotyping was accomplished using an existing marker (ACS1) for MdACS1 and two markers (CAPS866 and CAPS870) developed here to specifically detect the two null alleles (ACS3a-G289V and Mdacs3a) of MdACS3a. In total, 952 Malus accessions were allelotyped with the three markers. The major findings included: The effect of MdACS1 was significant on fruit ethylene production and softening while that of MdACS3a was less detectable; allele MdACS1–2 was significantly associated with low ethylene and slow softening; under the same background of the MdACS1 allelotypes, null allele Mdacs3a (not ACS3a-G289V) could confer a significant delay of ethylene peak; alleles MdACS1–2 and Mdacs3a (excluding ACS3a-G289V) were highly enriched in M. domestica and M. hybrid when compared with those in M. sieversii. These findings are of practical implications in developing apples of low and delayed ethylene profiles by utilizing the beneficial alleles MdACS1-2 and Mdacs3a. PMID:27231553

  4. Speed Control of DC Motor using AC/AC/DC Converter Based on Intelligent Techniques

    Rakan Kh Antar

    2013-01-01

       This paper describes the application of ac/ac/dc and ac/dc converters to control the speed of a separately excited DC motor. Artificial neural network and PI controller are trained to select the desired values of firing angles for triggering thyristors of the ac/ac/dc and ac/dc bridge converters in order to control the speed of the dc motor at a desired value with constant and different load torques in order to obtain the best speed response. Simulation results show that the rising time fo...

  5. Aroma characterization based on aromatic series analysis in table grapes

    Wu, Yusen; Duan, Shuyan; Zhao, Liping; Gao, Zhen; Luo, Meng; Song, Shiren; Xu, Wenping; Zhang, Caixi; Ma, Chao; Wang, Shiping

    2016-01-01

    Aroma is an important part of quality in table grape, but the key aroma compounds and the aroma series of table grapes remains unknown. In this paper, we identified 67 aroma compounds in 20 table grape cultivars; 20 in pulp and 23 in skin were active compounds. C6 compounds were the basic background volatiles, but the aroma contents of pulp juice and skin depended mainly on the levels of esters and terpenes, respectively. Most obviously, ‘Kyoho’ grapevine series showed high contents of esters in pulp, while Muscat/floral cultivars showed abundant monoterpenes in skin. For the aroma series, table grapes were characterized mainly by herbaceous, floral, balsamic, sweet and fruity series. The simple and visualizable aroma profiles were established using aroma fingerprints based on the aromatic series. Hierarchical cluster analysis (HCA) and principal component analysis (PCA) showed that the aroma profiles of pulp juice, skin and whole berries could be classified into 5, 3, and 5 groups, respectively. Combined with sensory evaluation, we could conclude that fatty and balsamic series were the preferred aromatic series, and the contents of their contributors (β-ionone and octanal) may be useful as indicators for the improvement of breeding and cultivation measures for table grapes. PMID:27487935

  6. Aroma characterization based on aromatic series analysis in table grapes.

    Wu, Yusen; Duan, Shuyan; Zhao, Liping; Gao, Zhen; Luo, Meng; Song, Shiren; Xu, Wenping; Zhang, Caixi; Ma, Chao; Wang, Shiping

    2016-01-01

    Aroma is an important part of quality in table grape, but the key aroma compounds and the aroma series of table grapes remains unknown. In this paper, we identified 67 aroma compounds in 20 table grape cultivars; 20 in pulp and 23 in skin were active compounds. C6 compounds were the basic background volatiles, but the aroma contents of pulp juice and skin depended mainly on the levels of esters and terpenes, respectively. Most obviously, 'Kyoho' grapevine series showed high contents of esters in pulp, while Muscat/floral cultivars showed abundant monoterpenes in skin. For the aroma series, table grapes were characterized mainly by herbaceous, floral, balsamic, sweet and fruity series. The simple and visualizable aroma profiles were established using aroma fingerprints based on the aromatic series. Hierarchical cluster analysis (HCA) and principal component analysis (PCA) showed that the aroma profiles of pulp juice, skin and whole berries could be classified into 5, 3, and 5 groups, respectively. Combined with sensory evaluation, we could conclude that fatty and balsamic series were the preferred aromatic series, and the contents of their contributors (β-ionone and octanal) may be useful as indicators for the improvement of breeding and cultivation measures for table grapes. PMID:27487935

  7. The Alfonsine tables of Toledo

    Chabás, José

    2003-01-01

    The Alfonsine Tables of Toledo is for historians working in the fields of astronomy, science, the Middle Ages, Spanish and other Romance languages. It is also of interest to scholars interested in the history of Castile, in Castilian-French relations in the Middle Ages and in the history of patronage. It explores the Castilian canons of the Alfonsine Tables and offers a study of their context, language, astronomical content, and diffusion. The Alfonsine Tables of Toledo is unique in that it: includes an edition of a crucial text in history of science; provides an explanation of astronomy as it was practiced in the Middle Ages; presents abundant material on early scientific language in Castilian; presents new material on the diffusion of Alfonsine astronomy in Europe; describes the role of royal patronage of science in a medieval context.

  8. Universality of ac conduction in disordered solids

    Dyre, Jeppe; Schrøder, Thomas

    2000-01-01

    non-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally......The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual...

  9. Comparison And Application Of Table Manners In Cross-cultural Communication

    陈俊屹

    2015-01-01

    Table etiquette reflects the social-cultural meaning and values of a nation. With the development of China’s opening-up, and more western culture gets into our sights. The dining table is one of the most important places where good manners are displayed. Elegant manners at the table may bring friendship and even success. The different table manners between Chinese and British are the core of this thesis. By comparison of table manners between China and Britain, the thesis aims to make a research on the cultural differences in seating arrangement, using tableware, serving order, dining atmosphere and toasting. Furthermore, this paper displays some taboos of table manners in Chinese and British dinners, which helps a better understanding of the customs.Also,the author collected some business etiquette used in real commercial field and do a lot of investigations. With the comparative research into cultural contrast of table manners in China and Britain, I suggest that you should combine the theory and practice of table manners, understand each cultural background clearly and deeply. Therefore, we can take a better utilization of table manners in social communication and commercial affairs. I hope this paper can help people achieve a successful cross-cultural communication.

  10. Short term dynamic aperture with AC dipoles

    Mönig, Saskia; Persson, Tobias Hakan Bjorn; Coello De Portugal, Jaime; Langner, Andy; Tomas, Rogelio; CERN. Geneva. ATS Department

    2015-01-01

    The dynamic aperture of an accelerator is determined by its non-linear components and errors. Control of the dynamic aperture is important for a good understanding and operation of the accelerator. The AC dipole, installed in the LHC for the diagnostic of linear and non-linear optics, could serve as a tool for the determination of the dynamic aperture. However, since the AC dipole itself modifies the non-linear dynamics, the dynamic aperture with and without AC dipole are expected to differ. The effect of the AC dipole on the dynamic aperture is studied within this note.

  11. ac electroosmosis in rectangular microchannels.

    Campisi, Michele; Accoto, Dino; Dario, Paolo

    2005-11-22

    Motivated by the growing interest in ac electroosmosis as a reliable no moving parts strategy to control fluid motion in microfluidic devices for biomedical applications, such as lab-on-a-chip, we study transient and steady-state electrokinetic phenomena (electroosmosis and streaming currents) in infinitely extended rectangular charged microchannels. With the aid of Fourier series and Laplace transforms we provide a general formal solution of the problem, which is used to study the time-dependent response to sudden ac applied voltage differences in case of finite electric double layer. The Debye-Huckel approximation has been adopted to allow for an algebraic solution of the Poisson-Boltzmann problem in Fourier space. We obtain the expressions of flow velocity profiles, flow rates, streaming currents, as well as expressions of the complex hydraulic and electrokinetic conductances. We analyze in detail the dependence of the electrokinetic conductance on the extension of linear dimensions relative to the Debye length, with an eye on finite electric double layer effects. PMID:16351310

  12. DESARROLLO RURAL A.C.

    Alfredo Aguilar Valdés

    2015-01-01

    Full Text Available El objetivo de este trabajo fue analizar el diagnostico situacional de una Empresa de Servicios Profesionales en el caso de: Instituto de Promoción Para el Desarrollo Rural A.C., a través de la Metodología “UALAE” así como la oportunidad que como empresa presenta. Este estudio se realizó en el municipio de Saltillo, Coahuila, México. Adoptó esta Metodología UALAE y se difundió su opinión. El Instituto de Promoción Para el Desarrollo Rural A.C., está formado por profesionistas y productores cuya finalidad es la de contribuir al desarrollo del medio rural con proyectos de viabilidad técnica, económica y social, sobre la base de necesidades reales y al aprovechamiento sustentable del potencial de los recursos naturales. Su buen funcionamiento es indispensable e importante para el desarrollo de los productores agropecuarios principalmente, debido a que se ven muy beneficiados con todos los servicios que se les brinda, se han logrado buenos proyectos, buenas capacitaciones y un gran crecimiento de sus productos. Mediante el proceso de asistencia técnica a organizaciones de productores, se induce la formulación adecuada de proyectos viables desde el punto visto del mercado, la rentabilidad económica, las tecnologías disponibles y de la organización social.

  13. AcEST: BP920845 [AcEST

    Full Text Available 45|Adiantum capillus-veneris mRNA, clone: YMU001_000142_D08. (514 letters) Database: uniprot_sprot.fasta 412,525 seq...P7 OS=Magnapor... 33 1.0 sp|Q7VF68|SYH_HELHP Histidyl-tRNA synthetase OS=Helicobacter hep... 31 3.8 sp|P1305...90 FTGFLVLHSEPRQQPQVDL 1608 >sp|A4QX49|DBP7_MAGGR ATP-dependent RNA helicase DBP7 OS=Magnaporthe grise...T PT VT+H + T+ AC+ A+TT+ H H Sbjct: 481 PPKETKPTK------PVTNHTESTVGKACYITSAANTTITLHKLH 519 >sp|Q7VF68|SYH_HELHP His...rot_trembl.fasta 7,341,751 sequences; 2,391,615,440 total letters Searching.................................

  14. AcEST: DK960083 [AcEST

    Full Text Available ome P450 71D7 OS=Solanum chacoense ... 96 1e-19 sp|Q9SAB6|C71AI_ARATH Cytochrome ...... 96 2e-19 sp|P93530|C71D6_SOLCH Cytochrome P450 71D6 OS=Solanum chacoense ... 94 5e-19 sp|Q9T0K2|C71AK_AR... paten... 176 1e-42 tr|Q9AXP9|Q9AXP9_POPJC Cinnamate 4-hydroxylase OS=Populus jackii... 176 2e-42 tr|Q40907|Q40907_POPKI Cinnamic ac...8 KVVQQSRGAWEDEALRVIQDLKA 160 >tr|Q9AXP9|Q9AXP9_POPJC Cinnamate 4-hydroxylase OS=Populus jackii GN=C4H PE=2 ...e-42 tr|A9PBZ7|A9PBZ7_POPTR Putative uncharacterized protein OS=Popul... 176 2e-4

  15. AcEST: DK955376 [AcEST

    Full Text Available TST39A01NGRL0022_O23 611 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0022_O23. 5' end seq ... LMDETRAAGIKL 210 Query: 602 AIC 610 A+C Sbjct: 211 AVC ... 213 >tr|A9SM81|A9SM81_PHYPA Predicted protein OS=P ... C 610 VLELMD A+ KGLKVA+C Sbjct: 196 VLELMDAAREKGLKVAVC ... 213 >tr|Q8L7U1|Q8L7U1_ARATH AT4g39970/T5J17_140 OS ... LKVAIC 610 LMDEA+A G K+A+C Sbjct: 182 RLMDEAKAAGKKLAVC ... 197 >tr|Q680K2|Q680K2_ARATH MRNA, complete cds, cl ... LKVAIC 610 LMDEA+A G K+A+C Sbjct: 182 RLMDEAKAAGKKLAVC ... 197 >tr|Q8LAS1|Q8LAS1_ARATH Putative uncharacteriz ...

  16. AcEST: BP913416 [AcEST

    Full Text Available GCATGTAGTTTGGA CAGAGATG ■■Homology search results ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swi...AC_BACFN Uronate isomerase OS=Bacteroides fragilis (... 30 4.5 sp|Q3ITT7|SYA_NATPD Alanyl-tRNA synthetase OS=Natronomonas phar...C++ N IP+ M C Sbjct: 417 LSYPRHEYFRRTLCNLLGCDVENGEIPLSEMERVC 451 >sp|Q3ITT7|SYA_NATPD Alanyl-tRNA synthetase OS=Natronomonas phar...ng, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database searc...148,809,765 total letters Searching..................................................done Score E Sequences

  17. AcEST: DK947388 [AcEST

    Full Text Available Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Ac...ids Res. 25:3389-3402. Query= DK947388|Adiantum capillus-veneris mRNA, clone: YMU02A01NGRL0015_L18, 5' (587 letters) Databa... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK947388|Adiantum c...apillus-veneris mRNA, clone: YMU02A01NGRL0015_L18, 5' (587 letters) Database: uniprot_trembl.fasta...-ribosylation factor 1 OS=Salix bakko GN... 268 1e-71 sp|P49076|ARF_MAIZE ADP-ribosylation factor OS=Zea may

  18. AcEST: BP916217 [AcEST

    Full Text Available inase kinase 7-interacting protein 3 OS=Mus musculus Align length 119 Score (bit) 35.0 E-value 0.16 Report B...visiae GN... 30 6.8 >sp|Q571K4|TAB3_MOUSE Mitogen-activated protein kinase kinase kinase 7-interacting protein 3 OS=Mus musculus...protein kinase kinase kinase 7 interacting protein 3 OS=Mus musculus GN=Map3k7ip3 PE=2 SV=1 Length = 716 Sco...(3)malignant brain tumor-like 2 prot... 31 2.3 sp|P33234|ADIY_ECOLI HTH-type transcriptional regulator adiY ...ZZC3_PSEU2 Membrane protein, putative OS=Pseudomonas... 35 2.5 tr|Q5U7D5|Q5U7D5_9BACI OpuAC OS=Halobacillus trueperi GN=opu

  19. AcEST: DK953324 [AcEST

    Full Text Available |LSRR_PHOLL Transcriptional regulator lsrR OS=Photorhab... 30 6.1 sp|A0JY64|ATPB_ARTS2 ATP synthase subunit beta OS=Arthroba...cter s... 30 6.1 sp|A1R7V3|ATPB_ARTAT ATP synthase subunit beta OS=Arthroba...ATP synthase subunit beta OS=Arthrobacter sp. (strain FB24) GN=atpD PE=3 SV=1 Len...KD 372 Query: 311 HLHFTHRGKQRL 346 H + R KQ L Sbjct: 373 HYNTAVRVKQIL 384 >sp|A1R7V3|ATPB_ARTAT ATP synthase subunit beta OS=Arthroba...T and PSI-BLAST: a new generation of protein database search programs, Nucleic Ac

  20. AcEST: DK945049 [AcEST

    Full Text Available R 148 >sp|Q9X5X3|ATCU_SINMW Copper-transporting P-type ATPase OS=Sinorhizobium medicae (strain WSM419) GN=ac...|Q4EPP8|Q4EPP8_LISMO Heavy metal-binding protein OS=Listeria m... 34 3.2 tr|A6AST1|A6AST1_VIBHA Copper-trans..... 31 2.7 sp|Q4X0S7|DPH1_ASPFU Diphthamide biosynthesis protein 1 OS=Asper... 30 4.5 sp|A2VDJ0|T131L_HUMAN Transmembran...P58342|ATCU2_RHIME Copper-transporting ATPase 2 OS=Rhizobium meliloti Align length 75 Score (bit) 34.7 E-val...sophila ... 30 7.8 >sp|P58342|ATCU2_RHIME Copper-transporting ATPase 2 OS=Rhizobium me

  1. Spectral clustering and biclustering learning large graphs and contingency tables

    Bolla, Marianna

    2013-01-01

    Explores regular structures in graphs and contingency tables by spectral theory and statistical methods This book bridges the gap between graph theory and statistics by giving answers to the demanding questions which arise when statisticians are confronted with large weighted graphs or rectangular arrays. Classical and modern statistical methods applicable to biological, social, communication networks, or microarrays are presented together with the theoretical background and proofs. This book is suitable for a one-semester course for graduate students in data mining, mult

  2. Ken Thompson's 6-man Tables

    Tamplin, John T; Haworth, Guy McCrossan

    2001-01-01

    Ken Thompson recently communicated some results mined from his set of 64 6-man endgame tables. These list some positions of interest, namely, mutual zugzwangs and those of maximum depth. The results have been analysed by the authors and found to be identical or compatible with the available or published findings of Karrer, Nalimov, Stiller and Wirth.

  3. Superconductivity and the periodic table

    Compiled data on superconducting transition temperature Tc for pure metals (including amorphous and high-pressure phases) from the first, second, and third long periods of the Periodic Table and for their analogous compounds show that a significant regularity exists in the relative values of Tc

  4. Putting food on the table

    Candel, J.J.L.

    2016-01-01

    Putting food on the table: the European Union governance of the wicked problem of food security Jeroen Candel Food security concerns and arguments have made a revival in European Union (EU) governance since the 2007-8 and 2010 global food price crises. This renaissa

  5. Sand and Water Table Play

    Wallace, Ann H.; White, Mary J.; Stone, Ryan

    2010-01-01

    The authors observed preschoolers engaged at the sand and water table to determine if math could be found within their play. Wanting to understand how children interact with provided materials and what kinds of math ideas they explore during these interactions, the authors offer practical examples of how such play can promote mathematical…

  6. JEM-X background models

    Huovelin, J.; Maisala, S.; Schultz, J.;

    2003-01-01

    revolution 41 of INTEGRAL. Total observing time used for the analysis was 216 502 s, with the average of 25 cps of background for each of the two JEM-X telescopes. JEM-X1 showed slightly higher average background intensity than JEM-X2. The detectors were stable during the long exposures, and weak orbital...... phase dependence in the background outside radiation belts was observed. The analysis yielded an average of 5 cps for the diffuse background, and 20 cps for the instrument background. The instrument background was found highly dependent on position, both for spectral shape and intensity. Diff use...... background was enhanced in the central area of a detector, and it decreased radially towards the edge, with a clear vignetting effect for both JEM-X units. The instrument background was weakest in the central area of a detector and showed a steep increase at the very edges of both JEM-X detectors, with...

  7. 76 FR 49569 - Use of Actuarial Tables in Valuing Annuities, Interests for Life or Terms of Years, and Remainder...

    2011-08-10

    ...: Background On May 7, 2009, the IRS published in the Federal Register (74 FR 21438 and 74 FR 21519) final and... Use of Actuarial Tables in Valuing Annuities, Interests for Life or Terms of Years, and Remainder or..., and 25 RIN 1545-BH67 Use of Actuarial Tables in Valuing Annuities, Interests for Life or Terms...

  8. New algebraic tables of SU(2) quantities

    Formulas for Clebsch-Gordan Coefficients, 6-j symbols and 9-j symbols of SU(2) are presented in a ready-to-program way for obtaining algebraic tables. An excerpt of the complete tables are also presented. (Author)

  9. Global Reference Tables for Management Information Systems.

    Social Security Administration — This database is a collection of reference tables that store common information used throughout SSA. These tables standardize code structures and code usage of SSA...

  10. NNDSS - Table II. Lyme disease to Meningococcal

    U.S. Department of Health & Human Services — NNDSS - Table II. Lyme disease to Meningococcal - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  11. NNDSS - Table II. Tetanus to Vibriosis

    U.S. Department of Health & Human Services — NNDSS - Table II. Tetanus to Vibriosis - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding year),...

  12. NNDSS - Table II. Cryptosporidiosis to Dengue

    U.S. Department of Health & Human Services — NNDSS - Table II. Cryptosporidiosis to Dengue - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during the...

  13. NNDSS - Table II. Mumps to Rabies, animal

    U.S. Department of Health & Human Services — NNDSS - Table II. Mumps to Rabies, animal - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  14. NNDSS - Table II. Babesiosis to Coccidioidomycosis

    U.S. Department of Health & Human Services — NNDSS - Table II. Babesiosis to Coccidioidomycosis - 2014.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  15. NNDSS - Table II. Salmonellosis to Shigellosis

    U.S. Department of Health & Human Services — NNDSS - Table II. Salmonellosis to Shigellosis - 2014. In this Table, all conditions with a 5-year average annual national total of more than or equals 1,000 cases...

  16. NNDSS - Table II. Lyme disease to Meningococcal

    U.S. Department of Health & Human Services — NNDSS - Table II. Lyme disease to Meningococcal - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during the...

  17. NNDSS - Table I. infrequently reported notifiable diseases

    U.S. Department of Health & Human Services — NNDSS - Table I. infrequently reported notifiable diseases - 2014.In this Table, provisional cases of selected infrequently reported notifiable diseases (<1,000...

  18. NNDSS - Table I. infrequently reported notifiable diseases

    U.S. Department of Health & Human Services — NNDSS - Table I. infrequently reported notifiable diseases - 2016. In this Table, provisional* cases of selected†infrequently reported notifiable diseases...

  19. NNDSS - Table II. Ehrlichiosis/Anaplasmosis

    U.S. Department of Health & Human Services — NNDSS - Table II. Ehrlichiosis/Anaplasmosis - 2014.In this Table, all conditions with a 5-year average annual national total of more than or equals 1,000 cases but...

  20. NNDSS - Table II. Mumps to Rabies, animal

    U.S. Department of Health & Human Services — NNDSS - Table II. Mumps to Rabies, animal - 2014.In this Table, all conditions with a 5-year average annual national total of more than or equals 1,000 cases but...

  1. NNDSS - Table II. Chlamydia to Coccidioidomycosis

    U.S. Department of Health & Human Services — NNDSS - Table II. Chlamydia to Coccidioidomycosis - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  2. Global Reference Tables for Production Systems.

    Social Security Administration — This database is a collection of reference tables that store common information used throughout SSA. These tables standardized code structures and code usage of SSA...

  3. NNDSS - Table II. Giardiasis to Haemophilus influenza

    U.S. Department of Health & Human Services — NNDSS - Table II. Giardiasis to Haemophilus influenza - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during...

  4. NNDSS - Table II. Tetanus to Vibriosis

    U.S. Department of Health & Human Services — NNDSS - Table II. Tetanus to Vibriosis - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during the preceding...

  5. NNDSS - Table II. Rubella to Salmonellosis

    U.S. Department of Health & Human Services — NNDSS - Table II. Rubella to Salmonellosis - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during the preceding...

  6. NNDSS - Table II. Ehrlichiosis/Anaplasmosis

    U.S. Department of Health & Human Services — NNDSS - Table II. Ehrlichiosis/Anaplasmosis - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during the...

  7. NNDSS - Table II. Chlamydia to Coccidioidomycosis

    U.S. Department of Health & Human Services — NNDSS - Table II. Chlamydia to Coccidioidomycosis - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during the...

  8. A new pattern of the periodic table

    Brajendra Nath Tripathi

    1962-07-01

    Full Text Available A new pattern of the Periodic Table is described which incorporates all the points for which various models of two or three dimensional tables have been proposed from time to time.

  9. NNDSS - Table II. Giardiasis to Haemophilus influenza

    U.S. Department of Health & Human Services — NNDSS - Table II. Giardiasis to Haemophilus influenza - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  10. NNDSS - Table II. Giardiasis to Haemophilus influenza

    U.S. Department of Health & Human Services — NNDSS - Table II. Giardiasis to Haemophilus influenza - 2014. In this Table, all conditions with a 5-year average annual national total of more than or equals 1,000...

  11. NNDSS - Table II. Invasive Pneumococcal to Legionellosis

    U.S. Department of Health & Human Services — NNDSS - Table II. Invasive Pneumococcal to Legionellosis - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during...

  12. NNDSS - Table II. Invasive Pneumococcal to Legionellosis

    U.S. Department of Health & Human Services — NNDSS - Table II. Invasive Pneumococcal to Legionellosis - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  13. NNDSS - Table II. Invasive Pneumococcal to Legionellosis

    U.S. Department of Health & Human Services — NNDSS - Table II. Invasive Pneumococcal to Legionellosis - 2014.In this Table, all conditions with a 5-year average annual national total of more than or equals...

  14. NNDSS - Table II. Hepatitis (viral, acute)

    U.S. Department of Health & Human Services — NNDSS - Table II. Hepatitis (viral, acute) - 2014.In this Table, all conditions with a 5-year average annual national total of more than or equals 1,000 cases but...

  15. NNDSS - Table II. Hepatitis (viral, acute)

    U.S. Department of Health & Human Services — NNDSS - Table II. Hepatitis (viral, acute) - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  16. NNDSS - Table II. Hepatitis (viral, acute)

    U.S. Department of Health & Human Services — NNDSS - Table II. Hepatitis (viral, acute) - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during the preceding...

  17. NNDSS - Table II. Babesiosis to Campylobacteriosis

    U.S. Department of Health & Human Services — NNDSS - Table II. Babesiosis to Campylobacteriosis - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during the...

  18. NNDSS - Table II. Lyme disease to Meningococcal

    U.S. Department of Health & Human Services — NNDSS - Table II. Lyme disease to Meningococcal - 2014In this Table, all conditions with a 5-year average annual national total of more than or equals 1,000 cases...

  19. NNDSS - Table II. Cryptosporidiosis to Dengue

    U.S. Department of Health & Human Services — NNDSS - Table II. Cryptosporidiosis to Dengue - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  20. NNDSS - Table II. Ehrlichiosis/Anaplasmosis

    U.S. Department of Health & Human Services — NNDSS - Table II. Ehrlichiosis/Anaplasmosis - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  1. NNDSS - Table II. Rubella to Salmonellosis

    U.S. Department of Health & Human Services — NNDSS - Table II. Rubella to Salmonellosis - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  2. NNDSS - Table II. Babesiosis to Campylobacteriosis

    U.S. Department of Health & Human Services — NNDSS - Table II. Babesiosis to Campylobacteriosis - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the...

  3. NNDSS - Table II. Shiga toxin to Shigellosis

    U.S. Department of Health & Human Services — NNDSS - Table II. Shiga toxin to Shigellosis - 2015. In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  4. NNDSS - Table II. Shiga toxin to Shigellosis

    U.S. Department of Health & Human Services — NNDSS - Table II. Shiga toxin to Shigellosis - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during the...

  5. NNDSS - Table I. infrequently reported notifiable diseases

    U.S. Department of Health & Human Services — NNDSS - Table I. infrequently reported notifiable diseases - 2015. In this Table, provisional cases of selected infrequently reported notifiable diseases (<1,000...

  6. NNDSS - Table II. West Nile virus disease

    U.S. Department of Health & Human Services — NNDSS - Table II. West Nile virus disease - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during the preceding...

  7. Water-table contours of Nevada

    U.S. Geological Survey, Department of the Interior — This data set consists of water-table contours for Nevada. These data were created as part of an effort to provide statewide information on water table and depth to...

  8. Periodic table as a Binary table for Drug Encryption

    M. Yamuna; Karthika, K.

    2014-01-01

    Modern living styles and change is food habits have lead to new diseases and this number is getting multiplied. Research regarding finding medicines for these diseases is in active process and new drugs get released in market frequent. In developing these new drugs communicating details of these findings cannot be avoided. Any drug is best represented using its molecular formula. In this paper we have developed a new binary periodic table and hence use this for encrypting details about any drug.

  9. Supergravity backgrounds and symmetry superalgebras

    Ertem, Ümit

    2016-01-01

    We consider the bosonic sectors of supergravity theories in ten and eleven dimensions which correspond to the low energy limits of string theories and M-theory. The solutions of supergravity field equations are known as supergravity backgrounds and the number of preserved supersymmetries in those backgrounds are determined by Killing spinors. We provide some examples of supergravity backgrounds which preserve different fractions of supersymmetry. An important invariant for the characterization of supergravity backgrounds is their Killing superalgebras which are constructed out of Killing vectors and Killing spinors of the background. After constructing Killing superalgebras of some special supergravity backgrounds, we discuss about the possibilities of the extensions of these superalgebras to include the higher degree hidden symmetries of the background.

  10. Multiple mobile operating tables for eye surgery

    Pons J.

    2010-01-01

    High-volume eye surgery requires that patients be moved quickly in and out of the operating room (OR). Static operating tables in the OR make this difficult. Better patient flow can be achieved when using mobile tables, which can be expensive. We have developed an economical, wheeled operating table that can be constructed in a local engineering workshop.

  11. The Different Periodic Tables of Dmitrii Mendeleev

    Laing, Michael

    2008-01-01

    Between 1869 and 1905 the Russian chemist Dmitrii Mendeleev published several tables with different arrangements of the chemical elements. Four of these are compared with periodic tables by Russian scientists from 1934 and 1969. The difficulties caused by the lanthanoid elements are clearly seen in the table of 1905, which satisfactorily includes…

  12. 21 CFR 890.3750 - Mechanical table.

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Mechanical table. 890.3750 Section 890.3750 Food... DEVICES PHYSICAL MEDICINE DEVICES Physical Medicine Prosthetic Devices § 890.3750 Mechanical table. (a) Identification. A mechanical table is a device intended for medical purposes that has a flat surface that can...

  13. New reference tables and user-friendly Internet application for predicted heart weights

    Vanhaebost, Jessica; Faouzi, Mohamed; Mangin, Patrice; Michaud, Katarzyna

    2014-01-01

    BACKGROUND: Knowledge of normal heart weight ranges is important information for pathologists. Comparing the measured heart weight to reference values is one of the key elements used to determine if the heart is pathological, as heart weight increases in many cardiac pathologies. The current reference tables are old and in need of an update. AIMS: The purposes of this study are to establish new reference tables for normal heart weights in the local population and to determine the best pred...

  14. SINGLE PHASE HIGH FREQUENCY AC CONVERTER FOR INDUCTION HEATING APPLICATION

    M.A INAYATHULLAAH,; Dr. R. Anita

    2010-01-01

    The proposed topology reduces the total harmonic distortion (THD) of a high frequency AC/AC Converter well below the acceptable limit. This paper deals with a novel single phase AC/DC/AC soft switching utility frequency AC to high frequency AC converter. In this paper a single phase full bridge inverter with Vienna rectifier as front end is used instead of conventional diode bridge rectifier to provide continuous sinusoidal input current with nearly unity power factor at the source side with ...

  15. Superconductivity and the Periodic Table

    In view of the inability of the present theory of superconductivity to make reliable predictions for the magnitude of Tsub(c) it seems useful to search for empirical relationships between the composition of the compound and the Tsub(c) value. Table I gives a list of the available Tsub(c) data for transition metals (TM) having from 3 to 9 outer electrons and Tsub(c) data for non-transition elements (NTE) of groups IIB, IIIB and IVB, including data for amorphous (Am) structures and structures (marked by triangles) obtained at high pressures. The analogous metals have therefore the same structure. In Tables II to IV the Tsub(c) data are presented for analogous compounds of NTE from IB - VIB group. Conclusions are presented. (author)

  16. The Politics of League Tables

    Gita Steiner-Khamsi

    2003-01-01

    The article focuses on the political usages of OECD- and IEA-type studies on student achievement, and suggests that we examine in more detail how policy makers use results from international comparisons to advance fundamental school reform at national level. The author categorizes three types of policy reactions to league tables: (1) scandalization, (2) glorification, and (3) indifference. Drawing from media reports and policy debates that emerged right after the release of the results from T...

  17. Design of small table saws

    Stuchlík, Petr

    2016-01-01

    The main aim of this thesis is the engineering design of a small table circular saw according to the specified parameters. At first, the types of machines available on the market are named and analyzed in detail. Afterwards, the engineering design of the machine is created. The following part is concerned with the individual parts,, tilting of the saw blade, maximum cutting pull through linkage with motion screw and checking of deformation of he critical parts of the machine. The previously s...

  18. Managing Restaurant Tables using Constraints

    Vidotto, Alfio; Brown, Kenneth N.; Beck, J. Christopher

    Restaurant table management can have significant impact on both profitability and the customer experience. The core of the issue is a complex dynamic combinatorial problem. We show how to model the problem as constraint satisfaction, with extensions which generate flexible seating plans and which maintain stability when changes occur. We describe an implemented system which provides advice to users in real time. The system is currently being evaluated in a restaurant environment.

  19. The Periodic Table in Flatland

    Negadi, T.; Kibler, M.

    1995-01-01

    The $D$-dimensional Coulomb system serves as a starting point for generating generalized atomic shells. These shells are ordered according to a generalized Madelung rule in $D$ dimensions. This rule together with an {\\it Aufbau Prinzip} is applied to produce a $D$-dimensional periodic table. A model is developed to rationalize the ordering of the shells predicted by the generalized Madelung rule. This model is based on the introduction of an Hamiltonian, invariant under the $q$-deformed algeb...

  20. Guide to mathematical tables supplement no 1

    Burunova, N M; Fedorova, R M

    2014-01-01

    A Guide to Mathematical Tables is a supplement to the Guide to Mathematical Tables published by the U.S.S.R. Academy of Sciences in 1956. The tables contain information on subjects such as powers, rational and algebraic functions, and trigonometric functions, as well as logarithms and polynomials and Legendre functions. An index listing all functions included in both the Guide and the Supplement is included.Comprised of 15 chapters, this supplement first describes mathematical tables in the following order: the accuracy of the table (that is, the number of decimal places or significant

  1. The exenatide analogue AC3174 attenuates hypertension, insulin resistance, and renal dysfunction in Dahl salt-sensitive rats

    Fernandez Rayne

    2010-08-01

    Full Text Available Abstract Background Activation of glucagon-like peptide-1 (GLP-1 receptors improves insulin sensitivity and induces vasodilatation and diuresis. AC3174 is a peptide analogue with pharmacologic properties similar to the GLP-1 receptor agonist, exenatide. Hypothetically, chronic AC3174 treatment could attenuate salt-induced hypertension, cardiac morbidity, insulin resistance, and renal dysfunction in Dahl salt-sensitive (DSS rats. Methods DSS rats were fed low salt (LS, 0.3% NaCl or high salt (HS, 8% NaCl diets. HS rats were treated with vehicle, AC3174 (1.7 pmol/kg/min, or GLP-1 (25 pmol/kg/min for 4 weeks via subcutaneous infusion. Other HS rats received captopril (150 mg/kg/day or AC3174 plus captopril. Results HS rat survival was improved by all treatments except GLP-1. Systolic blood pressure (SBP was lower in LS rats and in GLP-1, AC3174, captopril, or AC3174 plus captopril HS rats than in vehicle HS rats (p Conclusions Thus, AC3174 had antihypertensive, cardioprotective, insulin-sensitizing, and renoprotective effects in the DSS hypertensive rat model. Furthermore, AC3174 improved animal survival, an effect not observed with GLP-1.

  2. Background subtraction theory and practice

    Elgammal, Ahmed

    2014-01-01

    Background subtraction is a widely used concept for detection of moving objects in videos. In the last two decades there has been a lot of development in designing algorithms for background subtraction, as well as wide use of these algorithms in various important applications, such as visual surveillance, sports video analysis, motion capture, etc. Various statistical approaches have been proposed to model scene backgrounds. The concept of background subtraction also has been extended to detect objects from videos captured from moving cameras. This book reviews the concept and practice of back

  3. Characterization of AcMNPV with a deletion of ac69 gene

    Jianhao Ke

    2011-07-01

    Full Text Available ORF69 (Ac69 of Autographa californica multiple nucleopolyhedrovirus (AcMNPV is conserved in some baculovirus genomes. Although it has been shown that Ac69 has cap 0-dependent methyltransferase activity and is not required for budded virus production in Spodoptera frugiperda Sf-9 cells, its role in occlusion-derived virus synthesis and virus oral infectivity is not known. This paper describes generation of an ac69 knockout AcMNPV bacmid mutant and analyses of the influence of ac69 deletion on the viral infectivity in Sf-9 cells and Trichoplusia ni larvae so as to investigate the role of ac69 in the viral life cycle. Results indicated that ac69 deletion has little effect on the production rates and morphogenesis of budded virus and occlusion-derived virus in Sf-9 cells. In addition, animal experiment revealed that the deletion mutant did not affect AcMNPV infectivity for Trichoplusia ni larvae in LD50 and LT50 bioassay when administered orally. These results suggest that ac69 may be dispensable for viral infectivity both in vitro and in vivo.

  4. Noise reduction in AC-coupled amplifiers

    Serrano Finetti, Roberto Ernesto; Pallàs Areny, Ramon

    2014-01-01

    AC-coupled amplifiers are noisier than dc-coupled amplifiers because of the thermal noise of the resistor(s) in the ac-coupling network and the increased contribution of the amplifier input noise current i(n). Both contributions, however, diminish if the corner frequency f(c) of the high-pass filter observed by the signal is lowered, the cost being a longer transient response. At the same time, the presence of large resistors in the ac-coupling network suggests that the use of FET-input ampli...

  5. Hanford Site background: Part 1, Soil background for nonradioactive analytes

    The determination of soil background is one of the most important activities supporting environmental restoration and waste management on the Hanford Site. Background compositions serve as the basis for identifying soil contamination, and also as a baseline in risk assessment processes used to determine soil cleanup and treatment levels. These uses of soil background require an understanding of the extent to which analytes of concern occur naturally in the soils. This report documents the results of sampling and analysis activities designed to characterize the composition of soil background at the Hanford Site, and to evaluate the feasibility for use as Sitewide background. The compositions of naturally occurring soils in the vadose Zone have been-determined for-nonradioactive inorganic and organic analytes and related physical properties. These results confirm that a Sitewide approach to the characterization of soil background is technically sound and is a viable alternative to the determination and use of numerous local or area backgrounds that yield inconsistent definitions of contamination. Sitewide soil background consists of several types of data and is appropriate for use in identifying contamination in all soils in the vadose zone on the Hanford Site. The natural concentrations of nearly every inorganic analyte extend to levels that exceed calculated health-based cleanup limits. The levels of most inorganic analytes, however, are well below these health-based limits. The highest measured background concentrations occur in three volumetrically minor soil types, the most important of which are topsoils adjacent to the Columbia River that are rich in organic carbon. No organic analyte levels above detection were found in any of the soil samples

  6. Periodic table as a Binary table for Drug Encryption

    M. Yamuna

    2014-06-01

    Full Text Available Modern living styles and change is food habits have lead to new diseases and this number is getting multiplied. Research regarding finding medicines for these diseases is in active process and new drugs get released in market frequent. In developing these new drugs communicating details of these findings cannot be avoided. Any drug is best represented using its molecular formula. In this paper we have developed a new binary periodic table and hence use this for encrypting details about any drug.

  7. Background reduction in cryogenic detectors

    Bauer, Daniel A.; /Fermilab

    2005-04-01

    This paper discusses the background reduction and rejection strategy of the Cryogenic Dark Matter Search (CDMS) experiment. Recent measurements of background levels from CDMS II at Soudan are presented, along with estimates for future improvements in sensitivity expected for a proposed SuperCDMS experiment at SNOLAB.

  8. Children of ethnic minority backgrounds

    Johansen, Stine Liv

    2010-01-01

    Children of ethnic minority background balance their everyday life between a cultural background rooted in their ethnic origin and a daily life in day care, schools and with peers that is founded in a majority culture. This means, among other things, that they often will have access to different ...

  9. Calculation of background lifetime risk of cancer mortality in Japan

    This study was designed to calculate the background lifetime risk of cancer mortality in Japan. The mortality and population data obtained from national surveys for the vital statistics and population census in 2010 are stratified at 5-year age intervals of 0-4, 5-9, ..., 80-84, with a final open interval of 85+ for use in a life table. It was found that the gender-averaged background lifetime risk of cancer mortality ranges from 23.7% to 28.3% among 47 prefectures, and the arithmetic mean was calculated to be 25.4%. It is important to consider the incremental risk of cancer mortality posed by exposure to ionizing radiation (e.g., an additive lifetime risk of 0.5% at the effective dose of 100 mSv) in the context of the level of the background lifetime risk of cancer mortality of the exposed population. (author)

  10. The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual

    Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)

  11. Guiding Principles in Selecting AC To DC Converters For Power Factor Corrections in AC Transmission System

    Ibekwe B.E

    2014-10-01

    Full Text Available The ac to dc converters’ power factors correction in ac transmission system were investigated. The studies include: phase-controlled converter; pulse width modulated (PWM converter and ac input current shaped converter. Using Fourier series, power factors of these converters were calculated and simulated using MATLAB. The resulting curves are displayed in the hard copies for practical guides in the choice of converters; and comparatively, current shaped type is the best.

  12. A Simple Load Power Estimator For Quasi-Direct AC-AC Converter System

    Marian GAICEANU; Emil ROSU

    2003-01-01

    In this paper a simple load power estimator for the three-phase quasi-direct acac converter system is reported. Since the ac-ac converter control by means of pulsewidth modulation (PWM) is based on the power balance concept, its load power should be known. Two control boards, based on the dSMC (digital Smart Motion Controller) 30 MIPS 32-bit fixed-point digital signal processor (DSP), were involved in the ac-ac system driving. By using the power balance control, the DC link voltage variation ...

  13. Table-top job analysis

    1994-12-01

    The purpose of this Handbook is to establish general training program guidelines for training personnel in developing training for operation, maintenance, and technical support personnel at Department of Energy (DOE) nuclear facilities. TTJA is not the only method of job analysis; however, when conducted properly TTJA can be cost effective, efficient, and self-validating, and represents an effective method of defining job requirements. The table-top job analysis is suggested in the DOE Training Accreditation Program manuals as an acceptable alternative to traditional methods of analyzing job requirements. DOE 5480-20A strongly endorses and recommends it as the preferred method for analyzing jobs for positions addressed by the Order.

  14. Transport AC losses in YBCO coated conductors

    Majoros, M [Ohio State University, Columbus, OH 43210 (United States); Ye, L [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Velichko, A V [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Coombs, T A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Sumption, M D [Ohio State University, Columbus, OH 43210 (United States); Collings, E W [Ohio State University, Columbus, OH 43210 (United States)

    2007-09-15

    Transport AC loss measurements have been made on YBCO-coated conductors prepared on two different substrate templates-RABiTS (rolling-assisted biaxially textured substrate) and IBAD (ion-beam-assisted deposition). RABiTS samples show higher losses compared with the theoretical values obtained from the critical state model, with constant critical current density, at currents lower than the critical current. An origin of this extra AC loss was demonstrated experimentally by comparison of the AC loss of two samples with different I-V curves. Despite a difference in I-V curves and in the critical currents, their measured losses, as well as the normalized losses, were practically the same. However, the functional dependence of the losses was affected by the ferromagnetic substrate. An influence of the presence of a ferromagnetic substrate on transport AC losses in YBCO film was calculated numerically by the finite element method. The presence of a ferromagnetic substrate increases transport AC losses in YBCO films depending on its relative magnetic permeability. The two loss contributions-transport AC loss in YBCO films and ferromagnetic loss in the substrate-cannot be considered as mutually independent.

  15. Generalized Background-Field Method

    Feng, Y J

    1997-01-01

    The graphical method discussed previously can be used to create new gauges not reachable by the path-integral formalism. By this means a new gauge is designed for more efficient two-loop QCD calculations. It is related to but simpler than the ordinary background-field gauge, in that even the triple-gluon vertices for internal lines contain only four terms, not the usual six. This reduction simplifies the calculation inspite of the necessity to include other vertices for compensation. Like the ordinary background-field gauge, this generalized background-field gauge also preserves gauge invariance of the external particles. As a check of the result and an illustration for the reduction in labour, an explicit calculation of the two-loop QCD 45% of computation compared to the ordinary background-field gauge.

  16. The Cosmic Background Radiation, 1997

    Smoot, G F; Smoot, George; Scott, Douglas

    1997-01-01

    We summarise the current status of cosmic microwave background spectrum and anisotropy measurements, and their theoretical interpretation. This is the update of the mini-review for the 1997 web-version of the Review of Particle Properties.

  17. Geometrodynamics on a background spacetime

    Papadopoulos, P P; Papadopoulos, Philippos; Sopuerta, Carlos F.

    2001-01-01

    The formulation of the initial value problem for the Einstein equations is at the heart of obtaining interesting new solutions using numerical relativity and still very much under theoretical and applied scrutiny. We develop a specialised background geometry approach, for systems where there is non-trivial a priori knowledge about the spacetime under study. The background three-geometry and associated connection are used to express the ADM evolution equations in terms of physical non-linear deviations from that background. Expressing the equations in first order form leads naturally to a system closely linked to the Einstein-Christoffel system, introduced by Anderson and York, and sharing its hyperbolicity properties. The background metric approach can drastically alter the source structure of the equations, and we present an argument as to why this is likely to be numerically advantageous.

  18. QED_2 in Curved Backgrounds

    Ghosh, Amit

    1996-01-01

    Here we discuss the two dimensional quantum electrodynamics in curved space-time, especially in the background of some black holes. We first show the existence of some new quantum mechanical solution which has interesting properties. Then for some special black holes we discuss the fermion-black hole scattering problem. The issue of confinement is intimately connected with these solutions and we also comment on this in this background. Finally, the entanglement entropy and the Hawking radiati...

  19. Backgrounds in AFP Detector Estimation

    Huang, Yicong

    2016-01-01

    The ATLAS Forward Proton (AFP) detectors aim to measure protons that are scattered in the ATLAS interaction point under very small angles ($90-160 \\mu rad$). The diffractive protons detected by the AFP may be accompanied by beam halo. This report presents an estimation of the beam halo backgrounds in the AFP using low pile-up data, and position distributions of the backgrounds in the AFP.

  20. The Supernova Relic Neutrino Background

    Kaplinghat, M.; Steigman, G.; Walker, T. P.

    1999-01-01

    An upper bound to the supernova relic neutrino background from all past Type II supernovae is obtained using observations of the Universal metal enrichment history. We show that an unambiguous detection of these relic neutrinos by the Super-Kamiokande detector is unlikely. We also analyze the event rate in the Sudbury Neutrino Observatory (where coincident neutrons from anti-nu_e + D --> n + n + e+ might enhance background rejection), and arrive at the same conclusion. If the relic neutrino f...

  1. CONSUMER PREFERENCES FOR TABLE OLIVES IN TIRANA

    Elvina Merkaj

    2012-06-01

    Full Text Available Table olive production sector is undergoing rapid changes, as the government is undertaking an ambitious program supporting the expansion of olive grove plantations. Despite the increase in domestic production, import of table olive is still high, due to constraints in quantity and quality of domestically supplied olives. In the context of import substitution strategy, embraced by producers and policy-makers, it is important to analyze the consumer preferences for table olives. The objective of this paper is to segment the table olive market according to preferences for table olives attributes applying Conjoint Choice Experiment (CCE and Latent Class Analysis to collect and analyze the data. The research results show a strong consumer preference for domestic table olives whereas preferences for other attributes vary between consumer groups.

  2. A table-top LHC

    Barbara Warmbein

    2011-01-01

    Many years ago, when ATLAS was no more than a huge empty underground cavern and Russian artillery shell casings were being melted down to become part of the CMS calorimetry system, science photographer Peter Ginter started documenting the LHC’s progress. He was there when special convoys of equipment crossed the Jura at night, when cranes were lowering down detector slices and magnet coils were being wound in workshops. Some 18 years of LHC history have been documented by Ginter, and the result has just come out as a massive coffee table book full of double-page spreads of Ginter’s impressive images.   The new coffee table book, LHC: the Large Hadron Collider. Published by the Austrian publisher Edition Lammerhuber in cooperation with CERN and UNESCO Publishing, LHC: the Large Hadron Collider is an unusual piece in the company’s portfolio. As the publisher’s first science book, LHC: the Large Hadron Collider weighs close to five kilos and comes in a s...

  3. Early Poststroke Rehabilitation Using a Robotic Tilt-Table Stepper and Functional Electrical Stimulation

    Alexey N. Kuznetsov

    2013-01-01

    Full Text Available Background. Stroke frequently leaves survivors with hemiparesis. To prevent persistent deficits, rehabilitation may be more effective if started early. Early training is often limited because of orthostatic reactions. Tilt-table stepping robots and functional electrical stimulation (FES may prevent these reactions. Objective. This controlled convenience sample study compares safety and feasibility of robotic tilt-table training plus FES (ROBO-FES and robotic tilt-table training (ROBO against tilt-table training alone (control. A preliminary assessment of efficacy is performed. Methods. Hemiparetic ischemic stroke survivors (age years, days after stroke were assigned to 30 days of ROBO-FES (, ROBO (, or control ( in addition to conventional physical therapy. Impedance cardiography and transcranial doppler sonography were performed before, during, and after training. Hemiparesis was assessed using the British Medical Research Council (MRC strength scale. Results. No serious adverse events occurred; 8 patients in the tilt-table group prematurely quit the study because of orthostatic reactions. Blood pressure and CBFV dipped % during robot training. In 52% of controls mean arterial pressure decreased by %. ROBO-FES increased leg strength by points, ROBO by more than control (, . CBFV increased in both robotic groups more than in controls (. Conclusions. Robotic tilt-table exercise with or without FES is safe and may be more effective in improving leg strength and cerebral blood flow than tilt table alone.

  4. XSB: Extending Prolog with Tabled Logic Programming

    Swift, Terrance; Warren, David S

    2010-01-01

    The paradigm of Tabled Logic Programming (TLP) is now supported by a number of Prolog systems, including XSB, YAP Prolog, B-Prolog, Mercury, ALS, and Ciao. The reasons for this are partly theoretical: tabling ensures termination and optimal known complexity for queries to a large class of programs. However the overriding reasons are practical. TLP allows sophisticated programs to be written concisely and efficiently, especially when mechanisms such as tabled negation and call and answer subsu...

  5. Environmental regulatory update table, March 1989

    Houlberg, L.; Langston, M.E.; Nikbakht, A.; Salk, M.S.

    1989-04-01

    The Environmental Regulatory Update Table provides information on regulatory initiatives of interest to DOE operations and contractor staff with environmental management responsibilities. The table is updated each month with information from the Federal Register and other sources, including direct contact with regulatory agencies. Each table entry provides a chronological record of the rulemaking process for that initiative with an abstract and a projection of further action.

  6. Environmental Regulatory Update Table, April 1989

    The Environmental Regulatory Update Table provides information on regulatory initiatives of interest to DOE operations and contractor staff with environmental management responsibilities. The table is updated each month with information from the Federal Register and other sources, including direct contact with regulatory agencies. Each table entry provides a chronological record of the rulemaking process for that initiative with an abstract and a projection of further action

  7. Environmental Regulatory Update Table, November 1991

    Houlberg, L.M.; Hawkins, G.T.; Salk, M.S.

    1991-12-01

    The Environmental Regulatory Update Table provides information on regulatory initiatives of interest to DOE operations and contractor staff with environmental management responsibilities. The table is updated each month with information from the Federal Register and other sources, including direct contact with regulatory agencies. Each table entry provides a chronological record of the rulemaking process for that initiative with an abstract and a projection of further action.

  8. Environmental regulatory update table, July 1991

    Houlberg, L.M.; Hawkins, G.T.; Salk, M.S.

    1991-08-01

    This Environmental Regulatory Update Table (July 1991) provides information on regulatory initiatives of interest to DOE operations and contractor staff with environmental management responsibilities. The table is updated each month with information from the Federal Register and other sources, including direct contact with regulatory agencies. Each table entry provides a chronological record of the rulemaking process for that initiative with an abstract and a projection of further action.

  9. Environmental Regulatory Update Table, December 1989

    The Environmental Regulatory Update Table provides information on regulatory initiatives of interest to DOE operations and contractor staff with environmental management responsibilities. The table is updated each month with information from the Federal Register and other sources, including direct contact with regulatory agencies. Each table entry provides a chronological record of the rulemaking process for that initiative with an abstract and a projection of further action

  10. The periodic table of elementary particles

    Chung, Ding-Yu

    2000-01-01

    All leptons, quarks, and gauge bosons can be placed in the periodic table of elementary particles. The periodic table is derived from dualities of string theory and a Kaluza-Klein substructure for the six extra spatial dimensions. As a molecule is the composite of atoms with chemical bonds, a hadron is the composite of elementary particles with hadronic bonds. The masses of elementary particles and hadrons can be calculated using the periodic table with only four known constants: the number o...

  11. Environmental Regulatory Update Table, September 1991

    Houlberg, L.M.; Hawkins, G.T.; Salk, M.S.

    1991-10-01

    The Environmental Regulatory Update Table provides information on regulatory initiatives of interest to DOE operations and contractor staff with environmental management responsibilities. The table is updated each month with information from the Federal Register and other sources, including direct contact with regulatory agencies. Each table entry provides a chronological record of the rulemaking process for that initiative with an abstract and a projection of further action.

  12. Environmental Regulatory Update Table, October 1991

    Houlberg, L.M.; Hawkins, G.T.; Salk, M.S.

    1991-11-01

    The Environmental Regulatory Update Table provides information on regulatory initiatives of interest to DOE operations and contractor staff with environmental management responsibilities. The table is updated each month with information from the Federal Register and other sources, including direct contact with regulatory agencies. Each table entry provides a chronological record of the rulemaking process for that initiative with an abstract and a projection of further action.

  13. Environmental Regulatory Update Table, August 1991

    Houlberg, L.M., Hawkins, G.T.; Salk, M.S.

    1991-09-01

    This Environmental Regulatory Update Table (August 1991) provides information on regulatory initiatives of interest to DOE operations and contractor staff with environmental management responsibilities. The table is updated each month with information from the Federal Register and other sources, including direct contact with regulatory agencies. Each table entry provides a chronological record of the rulemaking process for that initiative with an abstract and a projection of further action.

  14. Environmental Regulatory Update Table, December 1991

    Houlberg, L.M.; Hawkins, G.T.; Salk, M.S.

    1992-01-01

    The Environmental Regulatory Update Table provides information on regulatory initiatives of interest to DOE operations and contractor staff with environmental management responsibilities. The table is updated each month with information from the Federal Register and other sources, including direct contact with regulatory agencies. Each table entry provides a chronological record of the rulemaking process for that initiative with an abstract and a projection of further action.

  15. Tests in contingency tables as regression tests

    Stanislav Anatolyev; Grigory Kosenok

    2006-01-01

    Applied researchers often use tests based on contingency tables in preliminary data analysis and diagnostic testing. We show that many of such tests may be alternatively implemented by testing for coecient restrictions in linear regression systems (as a rule, employing the Wald test). This uni es the theories of regression analysis and contingency tables, sheds more light on intuitive contents of contingency table tests, and provides a more convenient and familiar tool for practitioners.

  16. Environmental regulatory update table, March 1989

    The Environmental Regulatory Update Table provides information on regulatory initiatives of interest to DOE operations and contractor staff with environmental management responsibilities. The table is updated each month with information from the Federal Register and other sources, including direct contact with regulatory agencies. Each table entry provides a chronological record of the rulemaking process for that initiative with an abstract and a projection of further action

  17. Environmental Regulatory Update Table, August 1990

    The Environmental Regulatory Update Table provides information on regulatory initiatives of interest to DOE operations and contractor staff with environmental management responsibilities. The table is updated each month with information from the Federal Register and other sources, including direct contact with regulatory agencies. Each table entry provides a chronological record of the rulemaking process for that initiative with an abstract and a projection of further action

  18. Improvements to background level of the low background HPGe setup

    A low background HPGe counting setup has been installed at TIFR. The detector, shielded with low activity Pb and Cu shield, has been extensively used for material screening for the TIN. TIN detector (The INdia-based TIN detector). It is proposed to use this setup for the search of rare decay processes like double beta decay (DBD) to the excited states of the daughter nuclei where T1/2 > 1018 years. To enhance the sensitivity of measurement, the background levels of the detector has been further improved by an addition of an active cosmic muon veto system in the FPGA based DAQ system

  19. CRC standard mathematical tables and formulae

    Zwillinger, Daniel

    2002-01-01

    New in the 31st edition:Game theory and voting powerHeuristic search techniquesQuadratic fieldsReliabilityRisk analysis and decision rulesA table of solutions to Pell's equationA table of irreducible polynomials in Z2[x]An interpretation of powers of 10A collection of ""proofs without words""Representations of groups of small orderCounting principlesTesselations and tilings…and much more!An indispensable, up-to-date resource, CRC Standard Mathematical Tables and Formulae, 31st Edition makes it effortless to find the equations, tables, and formulae you need most often.

  20. EJSCREEN States Percentiles Lookup Table--2015 Intranet

    U.S. Environmental Protection Agency — The States table provides percentile breaks of important EJSCREEN elements (demographic indicators and indexes, environmental indicators and indexes) at the state...

  1. EJSCREEN Regions Percentiles Lookup Table--2015 Intranet

    U.S. Environmental Protection Agency — The Regions table provides percentile breaks of important EJSCREEN elements (demographic indicators and indexes, environmental indicators and indexes) at the EPA...

  2. EJSCREEN National Percentiles Lookup Table--2015 Intranet

    U.S. Environmental Protection Agency — The USA table provides percentile breaks of important EJSCREEN elements (demographic indicators and indexes, environmental indicators and indexes) at the national...

  3. The slow penetration of the Mendeleev Table in the French school curricula

    The great influence of the Berthelot's ideas about the non existence of atoms froze the teaching of chemistry in France for quite a long time. It is only after the Second World War that the study of the atom structure appeared in school curricula. The Mendeleev periodic system that sets the relationship between chemical properties and atom structure entered the curriculum even later in 1978. The article shows that the authors of most school manuals had anticipated the change, for in 1966 all the chemistry manuals of the 6. form had a chapter dedicated to the Mendeleev table while the issue was not yet on the syllabus. (A.C.)

  4. The Sloan Lens ACS Survey. V. The full ACS strong-lens sample

    Bolton, Adam S.; Burles, Scott; Koopmans, Leon V. E.; Treu, Tommaso; Gavazzi, Raphael; Moustakas, Leonidas A.; Wayth, Randall; Schlegel, David J.

    2008-01-01

    We present the definitive data for the full sample of 131 strong gravitational lens candidates observed with the Advanced Camera for Surveys (ACS) aboard the Hubble Space Telescope by the Sloan Lens ACS (SLACS) Survey. All targets were selected for higher redshift emission lines and lower redshift c

  5. Position of actinide elements in the periodic table : evolution of a generalised form (Preprint no. SSC-33)

    All the actinides and lanthanides are placed in III group and are shown separately, in the most popular forms of the periodic table, including the latest version of IUPAC. This has been leading to an avoidable debate i.e. whether to place La and Ac or Lu and Lw below Sc and Y in the III-B group. Apart from this, the group characteristic nature of most of the actinides elements, demands that a more appropriate position is to be given to these f block elements. The situation is more complex in the higher periods, in which new elements belonging to g block, h block, ... are to be included. Also, there seems to be no consensus in following a uniform and acceptable subgroup notation. The author arrived at a new form of the periodic table to successfully sort out all these issues. The table is presented. (author). 10 refs., 1 fig

  6. Eddy Current Rail Inspection Using AC Bridge Techniques.

    Liu, Ze; Koffman, Andrew D; Waltrip, Bryan C; Wang, Yicheng

    2013-01-01

    AC bridge techniques commonly used for precision impedance measurements have been adapted to develop an eddy current sensor for rail defect detection. By using two detection coils instead of just one as in a conventional sensor, we can balance out the large baseline signals corresponding to a normal rail. We have significantly enhanced the detection sensitivity of the eddy current method by detecting and demodulating the differential signal of the two coils induced by rail defects, using a digital lock-in amplifier algorithm. We have also explored compensating for the lift-off effect of the eddy current sensor due to vibrations by using the summing signal of the detection coils to measure the lift-off distance. The dominant component of the summing signal is a constant resulting from direct coupling from the excitation coil, which can be experimentally determined. The remainder of the summing signal, which decreases as the lift-off distance increases, is induced by the secondary eddy current. This dependence on the lift-off distance is used to calibrate the differential signal, allowing for a more accurate characterization of the defects. Simulated experiments on a sample rail have been performed using a computer controlled X-Y moving table with the X-axis mimicking the train's motion and the Y-axis mimicking the train's vibrational bumping. Experimental results demonstrate the effectiveness of the new detection method. PMID:26401427

  7. A definition of background independence

    We propose a definition for background (in)/dependence in dynamical theories of the evolution of configurations that have a continuous symmetry and test this definition on particle models and on gravity. Our definition draws from Barbour's best matching framework developed for the purpose of implementing spatial and temporal relationalism. Among other interesting theories, general relativity can be derived within this framework in novel ways. We study the detailed canonical structure of a wide range of best matching theories and show that their actions must have a local gauge symmetry. When gauge theory is derived in this way, we obtain at the same time a conceptual framework for distinguishing between background-dependent and -independent theories. Gauge invariant observables satisfying Kuchar's criterion are identified and, in simple cases, explicitly computed. We propose a procedure for inserting a global background time into temporally relational theories. Interestingly, using this procedure in general relativity leads to unimodular gravity.

  8. The isotropic radio background revisited

    Fornengo, Nicolao; Regis, Marco; Taoso, Marco

    2014-01-01

    We present an extensive analysis on the determination of the isotropic radio background. We consider six different radio maps, ranging from 22 MHz to 2.3 GHz and covering a large fraction of the sky. The large scale emission is modeled as a linear combination of an isotropic component plus the Galactic synchrotron radiation and thermal bremsstrahlung. Point-like and extended sources are either masked or accounted for by means of a template. We find a robust estimate of the isotropic radio background, with limited scatter among different Galactic models. The level of the isotropic background lies significantly above the contribution obtained by integrating the number counts of observed extragalactic sources. Since the isotropic component dominates at high latitudes, thus making the profile of the total emission flat, a Galactic origin for such excess appears unlikely. We conclude that, unless a systematic offset is present in the maps, and provided that our current understanding of the Galactic synchrotron emi...

  9. Neutron background estimates in GESA

    Fernandes A.C.

    2014-01-01

    Full Text Available The SIMPLE project looks for nuclear recoil events generated by rare dark matter scattering interactions. Nuclear recoils are also produced by more prevalent cosmogenic neutron interactions. While the rock overburden shields against (μ,n neutrons to below 10−8 cm−2 s−1, it itself contributes via radio-impurities. Additional shielding of these is similar, both suppressing and contributing neutrons. We report on the Monte Carlo (MCNP estimation of the on-detector neutron backgrounds for the SIMPLE experiment located in the GESA facility of the Laboratoire Souterrain à Bas Bruit, and its use in defining additional shielding for measurements which have led to a reduction in the extrinsic neutron background to ∼ 5 × 10−3 evts/kgd. The calculated event rate induced by the neutron background is ∼ 0,3 evts/kgd, with a dominant contribution from the detector container.

  10. AC losses in filamentary YBCO/hastelloy

    Full text: The AC hysteresis loss of a long YBCO thin-film superconducting strip in a perpendicular AC magnetic field can be reduced by subdividing the film into narrow parallel strips (filaments). The hysteresis loss depends on the film critical current density Jc, the film thickness d, the filament width 2a and the lateral spacing L between filaments as well as on the AC magnetic field amplitude Hm. In addition, if the film is deposited onto a YSZ/hastelloy substrate to form a flexible tape, eddy current loss occurs in the hastelloy metal. The eddy current loss depends on the resistivity p of the hastelloy, the width 2w and thickness dm of the hastelloy substrate as well as on the frequency f and amplitude Hm. We have calculated the hysteresis and eddy current losses as a function of Jc, d, 2a, L, p, w, dm, f, and Hm to find optimal design parameters for a YBCO/hastelloy tape. As the AC loss is related to the loss component X'' of the AC susceptibility, we have measured X'' at different frequencies f and amplitudes Hm for several filamentary designs of YBCO/hastelloy tapes and compared our experimental results with our model calculations

  11. Generative electronic background music system

    Mazurowski, Lukasz [Faculty of Computer Science, West Pomeranian University of Technology in Szczecin, Zolnierska Street 49, Szczecin, PL (Poland)

    2015-03-10

    In this short paper-extended abstract the new approach to generation of electronic background music has been presented. The Generative Electronic Background Music System (GEBMS) has been located between other related approaches within the musical algorithm positioning framework proposed by Woller et al. The music composition process is performed by a number of mini-models parameterized by further described properties. The mini-models generate fragments of musical patterns used in output composition. Musical pattern and output generation are controlled by container for the mini-models - a host-model. General mechanism has been presented including the example of the synthesized output compositions.

  12. Detector Background at Muon Colliders

    Mokhov, N.V.; Striganov, S.I.; /Fermilab

    2011-09-01

    Physics goals of a Muon Collider (MC) can only be reached with appropriate design of the ring, interaction region (IR), high-field superconducting magnets, machine-detector interface (MDI) and detector. Results of the most recent realistic simulation studies are presented for a 1.5-TeV MC. It is shown that appropriately designed IR and MDI with sophisticated shielding in the detector have a potential to substantially suppress the background rates in the MC detector. The main characteristics of backgrounds are studied.

  13. Background music and cognitive performance.

    Angel, Leslie A; Polzella, Donald J; Elvers, Greg C

    2010-06-01

    The present experiment employed standardized test batteries to assess the effects of fast-tempo music on cognitive performance among 56 male and female university students. A linguistic processing task and a spatial processing task were selected from the Criterion Task Set developed to assess verbal and nonverbal performance. Ten excerpts from Mozart's music matched for tempo were selected. Background music increased the speed of spatial processing and the accuracy of linguistic processing. The findings suggest that background music can have predictable effects on cognitive performance. PMID:20865993

  14. Exotic branes and nongeometric backgrounds.

    de Boer, Jan; Shigemori, Masaki

    2010-06-25

    When string or M theory is compactified to lower dimensions, the U-duality symmetry predicts so-called exotic branes whose higher-dimensional origin cannot be explained by the standard string or M-theory branes. We argue that exotic branes can be understood in higher dimensions as nongeometric backgrounds or U folds, and that they are important for the physics of systems which originally contain no exotic charges, since the supertube effect generically produces such exotic charges. We discuss the implications of exotic backgrounds for black hole microstate (non-)geometries. PMID:20867363

  15. Generative electronic background music system

    In this short paper-extended abstract the new approach to generation of electronic background music has been presented. The Generative Electronic Background Music System (GEBMS) has been located between other related approaches within the musical algorithm positioning framework proposed by Woller et al. The music composition process is performed by a number of mini-models parameterized by further described properties. The mini-models generate fragments of musical patterns used in output composition. Musical pattern and output generation are controlled by container for the mini-models - a host-model. General mechanism has been presented including the example of the synthesized output compositions

  16. Tilt table testing in patients with suspected epilepsy1

    Edfors, R.; Erdal, J.; Rogvi-Hansen, B.

    2008-01-01

    BACKGROUND: Approximately 20-30% of patients with epilepsy are misdiagnosed and syncope often seems to be the mistaken cause. We re-evaluated patients referred to an epilepsy clinic where suspicion of neurally mediated (reflex) syncope were raised using tilt table testing (HUT). METHODS: HUT...... laboratory results and medical records of 120 consecutive patients were reviewed retrospectively over a period of 27 months. RESULTS: HUT was positive in 59 (49%) patients. Seventeen of 38 (45%) patients previously diagnosed with epilepsy and taking antiepileptic drugs were found to be misdiagnosed. Four of...

  17. Breaking GSM with rainbow Tables

    Meyer, Steven

    2011-01-01

    Since 1998 the GSM security has been academically broken but no real attack has ever been done until in 2008 when two engineers of Pico Computing (FPGA manufacture) revealed that they could break the GSM encryption in 30 seconds with 200'000$ hardware and precomputed rainbow tables. Since then the hardware was either available for rich people only or was confiscated by government agencies. So Chris Paget and Karsten Nohl decided to react and do the same thing but in a distributed open source form (on torrent). This way everybody could "enjoy" breaking GSM security and operators will be forced to upgrade the GSM protocol that is being used by more than 4 billion users and that is more than 20 years old.

  18. The periodic table in Flatland

    The D-dimensional Coulomb system serves as a starting point for generating generalized atomic shells. These shells are ordered according to a generalized Madelung rule in D dimensions. This rule together with an Aujbau Prinzip is applied to produce a D-dimensional periodic table. A model is developed to rationalize the ordering of the shells predicted by the generalized Madelung rule. This model is based on the introduction of a Hamiltonian, invariant under the q-deformed algebra Uq(so(D)), that breaks down the SO(D + 1) dynamical symmetry of the hydrogen atom in D dimensions. The D = 2 case (Flatland) is investigated in some detail. It is shown that the neutral atoms and the (moderately) positive ions correspond to the values q = 0.8 and q = 1, respectively, of the deformation parameter q. 55 refs

  19. The periodic table in Flatland

    The D-dimensional Coulomb system serves as a starting point for generating generalized atomic shells. These shells are ordered according to a generalized Madelung rule in D dimensions. This rule together with an Aufbau Prinzip is applied to produce a D-dimensional periodic table. A model is developed to rationalize the ordering of the shells predicted by the generalized Madelung rule. This model is based on the introduction of an Hamiltonian, invariant under the q-deformed algebra Uq (so(D)), that breaks down the SO (D + 1) dynamical symmetry of the hydrogen atom in D dimensions. The D = 2 case (Flatland) is investigated with some details. It is shown that the neutral atoms and the (moderately) positive ions correspond to the values q = 0.8 and q = 1, respectively, of the deformation parameter q. (authors). 55 refs

  20. Table manipulation in simplicial databases

    Spivak, David I

    2010-01-01

    In \\cite{Spi}, we developed a category of databases in which the schema of a database is represented as a simplicial set. Each simplex corresponds to a table in the database. There, our main concern was to find a categorical formulation of databases; the simplicial nature of the schemas was to some degree unexpected and unexploited. In the present note, we show how to use this geometric formulation effectively on a computer. If we think of each simplex as a polygonal tile, we can imagine assembling custom databases by mixing and matching tiles. Queries on this database can be performed by drawing paths through the resulting tile formations, selecting records at the start-point of this path and retrieving corresponding records at its end-point.

  1. Family Perspectives: Using a Cultural Prism to Understand Families from Asian Cultural Backgrounds

    Lee, Suk-Hyang; Turnbull, Ann P.; Zan, Fei

    2009-01-01

    Educators can better serve students who come from diverse cultural backgrounds by understanding the differing cultural values of these students and their families. This article explores different cultural perspectives using a cultural prism approach, focused most specifically on the Korean and Chinese cultures. (Contains 2 tables.)

  2. Vibration transfers to measure the performance of vibration isolated platforms on site using background noise excitation

    Segerink, F.B.; Korterik, J.P.; Offerhaus, H.L.

    2011-01-01

    This article demonstrates a quick and easy way of quantifying the performance of a vibration-isolated platform. We measure the vibration transfer from floor to table using background noise excitation from the floor. As no excitation device is needed, our setup only requires two identical sensors (in

  3. Educational Production in East Asia: The Impact of Family Background and Schooling Policies on Student Performance

    Wößmann, Ludger

    2003-01-01

    East Asian students regularly take top positions in international league tables of educational performance. Using internationally comparable student-level data, I estimate how family background and schooling policies affect student performance in five high-performing East Asian economies. Family background is a strong predictor of student performance in South Korea and Singapore, while Hong Kong and Thailand achieve more equalized outcomes. There is no evidence that smaller classes improve st...

  4. Educational Production in East Asia : The Impact of Family Background and Schooling

    Woessmann, Ludger

    2003-01-01

    East Asian students regularly take top positions in international league tables of educational performance. Using internationally comparable student-level data, I estimate how family background and schooling policies affect student performance in five high-performing East Asian economies. Family background is a strong predictor of student performance in South Korea and Singapore, while Hong Kong and Thailand achieve more equalized outcomes. There is no evidence that smaller classes improve st...

  5. Some Reflections on the Periodic Table and Its Use.

    Fernelius, W. Conard

    1986-01-01

    Discusses early periodic tables; effect on the periodic table of atomic numbers; the periodic table in relation to electron distribution in the atoms of elements; terms and concepts related to the table; and the modern basis of the periodic table. Additional comments about these and other topics are included. (JN)

  6. Low Background Micromegas in CAST

    Garza, J G; Aznar, F.; Calvet, D.; Castel, J.F.; Christensen, F.E.; Dafni, T.; Davenport, M.; Decker, T.; Ferrer-Ribas, E.; Galán, J.; García, J.A.; Giomataris, I.; Hill, R.M.; Iguaz, F.J.; Irastorza, I.G.; Jakobsen, A.C.; Jourde, D.; Mirallas, H.; Ortega, I.; Papaevangelou, T.; Pivovaroff, M.J.; Ruz, J.; Tomás, A.; Vafeiadis, T.; Vogel, J.K.

    2015-01-01

    Solar axions could be converted into x-rays inside the strong magnetic field of an axion helioscope, triggering the detection of this elusive particle. Low background x-ray detectors are an essential component for the sensitivity of these searches. We report on the latest developments of the Micromegas detectors for the CERN Axion Solar Telescope (CAST), including technological pathfinder activities for the future International Axion Observatory (IAXO). The use of low background techniques and the application of discrimination algorithms based on the high granularity of the readout have led to background levels below 10$^{-6}$ counts/keV/cm$^2$/s, more than a factor 100 lower than the first generation of Micromegas detectors. The best levels achieved at the Canfranc Underground Laboratory (LSC) are as low as 10$^{-7}$ counts/keV/cm$^2$/s, showing good prospects for the application of this technology in IAXO. The current background model, based on underground and surface measurements, is presented, as well as ...

  7. Low Background Micromegas in CAST

    Garza, J G; Aune, S.; Aznar, F.;

    2014-01-01

    Solar axions could be converted into x-rays inside the strong magnetic field of an axion helioscope, triggering the detection of this elusive particle. Low background x-ray detectors are an essential component for the sensitivity of these searches. We report on the latest developments of the Micr...

  8. Low background techniques in CANDLES

    CANDLES is a double beta decay experiment using 48Ca in CaF2 crystals. The measurement is being performed with prototype detector (CANDLES III) for high sensitive measurement in the future. Recent status of detector improvements and background reduction techniques are described in this paper

  9. Scenario-based table top simulations

    Broberg, Ole; Edwards, Kasper; Nielsen, J.;

    2012-01-01

    This study developed and tested a scenario-based table top simulation method in a user-driven innovation setting. A team of researchers worked together with a user group of five medical staff members from the existing clinic. Table top simulations of a new clinic were carried out in a simple model...

  10. NNDSS - Table II. West Nile virus disease

    U.S. Department of Health & Human Services — NNDSS - Table II. West Nile virus disease - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during the preceding...

  11. 21 CFR 892.1980 - Radiologic table.

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Radiologic table. 892.1980 Section 892.1980 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICAL DEVICES RADIOLOGY DEVICES Diagnostic Devices § 892.1980 Radiologic table. (a) Identification. A...

  12. 21 CFR 890.3760 - Powered table.

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Powered table. 890.3760 Section 890.3760 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICAL DEVICES PHYSICAL MEDICINE DEVICES Physical Medicine Prosthetic Devices § 890.3760 Powered table. (a)...

  13. NNDSS - Table II. Mumps to Rabies, animal

    U.S. Department of Health & Human Services — NNDSS - Table II. Mumps to Rabies, animal - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported during the preceding...

  14. Periodic orbits of perturbed Andreev billiard tables

    Niemeyer, Robert G.

    2014-01-01

    We formally define Andreev reflection in the boundary of a planar billiard table and show that the flow is never minimal in a polygonal billiard table with a subset exhibiting Andreev reflection. We discuss the effects of particular perturbations on the electron-hole dynamics in an idealized 2D model of a nanowire lying upon a superconductor.

  15. Online Periodic Table: A Cautionary Note

    Izci, Kemal; Barrow, Lloyd H.; Thornhill, Erica

    2013-01-01

    The purpose of this study was (a) to evaluate ten online periodic table sources for their accuracy and (b) to compare the types of information and links provided to users. Limited studies have been reported on online periodic table (Diener and Moore 2011; Slocum and Moore in "J Chem Educ" 86(10):1167, 2009). Chemistry students'…

  16. Relating Functional Groups to the Periodic Table

    Struyf, Jef

    2009-01-01

    An introduction to organic chemistry functional groups and their ionic variants is presented. Functional groups are ordered by the position of their specific (hetero) atom in the periodic table. Lewis structures are compared with their corresponding condensed formulas. (Contains 5 tables.)

  17. AC loss performance of CS insert coil

    The ITER Central Solenoid (CS) model coil and the CS insert coil were fabricated, and the test was carried out. The AC loss measurement of the coil is one of the most important tests to determine coil performance. The AC loss of a short sample conductor for the CS insert coil was measured by using the calorimetric method, and the coupling time constants of the conductor were estimated to be 30 ms and 20 ms for pulse and discharge tests, respectively. The AC loss of the CS insert coil was measured by using the calorimetric method for pulse and discharge tests. The coupling time constant estimated from the result of the pulse tests was 34 ms and almost equal to that of the short sample. The coupling time constant for the discharge test was estimated to be 140 ms and about 4 times that of the pulse test. (author)

  18. ac propulsion system for an electric vehicle

    Geppert, S.

    1980-01-01

    It is pointed out that dc drives will be the logical choice for current production electric vehicles (EV). However, by the mid-80's, there is a good chance that the price and reliability of suitable high-power semiconductors will allow for a competitive ac system. The driving force behind the ac approach is the induction motor, which has specific advantages relative to a dc shunt or series traction motor. These advantages would be an important factor in the case of a vehicle for which low maintenance characteristics are of primary importance. A description of an EV ac propulsion system is provided, taking into account the logic controller, the inverter, the motor, and a two-speed transmission-differential-axle assembly. The main barrier to the employment of the considered propulsion system in EV is not any technical problem, but inverter transistor cost.

  19. Radiographic knee osteoarthritis in ex-elite table tennis players

    Rajabi Reza

    2012-02-01

    Full Text Available Abstract Background Table tennis involves adoption of the semi-flexed knee and asymmetrical torsional trunk movements creating rotational torques on the knee joint which may predispose players to osteoarthritis (OA of the knee. This study aims to compare radiographic signs of knee OA and associated functional levels in ex-elite male table tennis players and control subjects. Methods Study participants were 22 ex-elite male table tennis players (mean age 56.64 ± 5.17 years with 10 years of involvement at the professional level and 22 non-athletic males (mean age 55.63 ± 4.08 years recruited from the general population. A set of three radiographs taken from each knee were evaluated by an experienced radiologist using the Kellgren and Lawrence (KL scale (0-4 to determine radiographic levels of OA severity. The intercondylar distance was taken as a measure of lower limb angulation. Participants also completed the pain, stiffness, and physical function categories of the Western Ontario and McMaster University Osteoarthritis Index (WOMAC 3.1 questionnaire. Results The results showed 78.3% of the ex-elite table tennis players and 36.3% of controls had varying signs of radiographic knee OA with a significant difference in the prevalence levels of definite radiographic OA (KL scale > 2 found between the two groups (P ≤ 0.001. Based on the WOMAC scores, 68.2% of the ex-elite table tennis players reported symptoms of knee pain compared with 27.3% of the controls (p = 0.02 though no significant differences were identified in the mean physical function or stiffness scores between the two groups. In terms of knee alignment, 73.7% of the ex-elite athletes and 32% of the control group had signs of altered lower limb alignment (genu varum (p = 0.01. Statistical differences were found in subjects categorized as having radiographic signs of OA and altered lower limb alignment (p = 0.03. Conclusions Ex-elite table tennis players were found to have increased

  20. The adenylate cyclase gene MaAC is required for virulence and multi-stress tolerance of Metarhizium acridum

    Liu Shuyang

    2012-08-01

    Full Text Available Abstract Background The efficacy of entomopathogenic fungi in pest control is mainly affected by various adverse environmental factors, such as heat shock and UV-B radiation, and by responses of the host insect, such as oxidative stress, osmotic stress and fever. In this study, an adenylate cyclase gene (MaAC was cloned from the locust-specific entomopathogenic fungus, Metarhizium acridum, which is homologous to various fungal adenylate cyclase genes. RNA silencing was adapted to analyze the role of MaAC in virulence and tolerance to adverse environmental and host insect factors. Results Compared with the wild type, the vegetative growth of the RNAi mutant was decreased in PD (potato dextrose medium, Czapek-dox and PDA plates, respectively, demonstrating that MaAC affected vegetative growth. The cAMP levels were also reduced in PD liquid culture, and exogenous cAMP restored the growth of RNAi mutants. These findings suggested that MaAC is involved in cAMP synthesis. The knockdown of MaAC by RNAi led to a reduction in virulence after injection or topical inoculation. Furthermore, the RNAi mutant grew much slower than the wild type in the haemolymph of locust in vitro and in vivo, thus demonstrating that MaAC affects the virulence of M. acridum via fungal growth inside the host locust. A plate assay indicated that the tolerances of the MaAC RNAi mutant under oxidative stress, osmotic stress, heat shock and UV-B radiation was decreased compared with the wild type. Conclusion MaAC is required for virulence and tolerance to oxidative stress, osmotic stress, heat shock and UV-B radiation. MaAC affects fungal virulence via vegetative growth inside the insect and tolerance against oxidative stress, osmotic stress and locust fever.

  1. AC loss in superconducting tapes and cables

    Oomen, Marijn Pieter

    High-temperature superconductors are developed for use in power-transmission cables, transformers and motors. The alternating magnetic field in these devices causes AC loss, which is a critical factor in the design. The study focuses on multi-filament Bi-2223/Ag tapes exposed to a 50-Hz magnetic field at 77 K. The AC loss is measured with magnetic, electric and calorimetric methods. The results are compared to theoretical predictions based mainly on the Critical-State Model. The loss in high- temperature superconductors is affected by their characteristic properties: increased flux creep, high aspect ratio and inhomogeneties. Filament intergrowths and a low matrix resistivity cause a high coupling-current loss especially when the filaments are fully coupled. When the wide side of the tape is parallel to the external magnetic field, the filaments are decoupled by twisting. In a perpendicular field the filaments can be decoupled only by combining a short twist pitch with a transverse resistivity much higher than that of silver. The arrangement of the inner filaments determines the transverse resistivity. Ceramic barriers around the filaments cause partial decoupling in perpendicular magnetic fields at power frequencies. The resultant decrease in AC loss is greater than the accompanying decrease in critical current. With direct transport current in alternating magnetic field, the transport-current loss is well described with a new model for the dynamic resistance. The Critical- State Model describes well the magnetisation and total AC loss in parallel magnetic fields, at transport currents up to 0.7 times the critical current. When tapes are stacked face-to-face in a winding, the AC-loss density in perpendicular fields is greatly decreased due to the mutual shielding of the tapes. Coupling currents between the tapes in a cable cause an extra AC loss, which is reduced by a careful cable design. The total AC loss in complex devices with many tapes is generally well

  2. ACS air bearing test-bed design

    Glitt, Sascha

    2010-01-01

    This thesis is about the construction and design of a new air bearing test-bed to verify the programmed ACS attitude control algorithm and to validate the ACS MATLAB/SimuLink¬ model of NPSAT1, the second small satellite currently under development at the Naval Postgraduate School Space Systems Academic Group. The software was already verified and validated using a comparable air bearing test-bed. But due to changes in hardware from commercial magnetic torque rods to custom, NPS-built, magneti...

  3. The Effective AC Response of Nonlinear Composites

    WEI En-Bo; GU Guo-Qing

    2001-01-01

    A perturbative approach is used to study the AC response of nonlinear composite media, which obey a current-field relation of the form J = σ E + χ|E|2 E with components having nonlinear response at finite frequencies. For a sinusoidal applied field, we extend the local potential in terms of sinusoidal components at fundamental frequency and high-order harmonic frequencies to treat the nonlinear composites. For nonlinear composite media vith a low concentrations of spherical inclusions, we give the formulae of the nonlinear effective AC susceptibility χ*3ω at the third harmonic frequency.

  4. The Periodic Table as a Mnemonic Device for Writing Electronic Configurations.

    Mabrouk, Suzanne T.

    2003-01-01

    Presents an interactive method for using the periodic table as an effective mnemonic for writing electronic configurations. Discusses the intrinsic relevance of configurations to chemistry by building upon past analogies. Addresses pertinent background information, describes the hands-on method, and demonstrates its use. Transforms the traditional…

  5. YBCO thin films in ac and dc films

    Shahzada, S

    2001-01-01

    We report studies on the dc magnetization of YBCO thin films in simultaneously applied dc and ac fields. The effect of the ac fields is to decrease the irreversible magnetization drastically leading to complete collapse of the hysteresis loops for relatively small ac fields (250e). The magnitude of the decrease depends on the component of the ac field parallel to the c-axis. The decrease is non-linear with ac amplitude and is explained in the framework of the critical state response of ultra thin films in perpendicular geometry. The ac fields increase the relaxation rapidly at short times while the long time response appears unaffected. (author)

  6. SINGLE PHASE HIGH FREQUENCY AC CONVERTER FOR INDUCTION HEATING APPLICATION

    M.A INAYATHULLAAH,

    2010-12-01

    Full Text Available The proposed topology reduces the total harmonic distortion (THD of a high frequency AC/AC Converter well below the acceptable limit. This paper deals with a novel single phase AC/DC/AC soft switching utility frequency AC to high frequency AC converter. In this paper a single phase full bridge inverter with Vienna rectifier as front end is used instead of conventional diode bridge rectifier to provide continuous sinusoidal input current with nearly unity power factor at the source side with extremely low distortion.. This power converter is more suitable and acceptable for cost effective high frequency (HF consumer induction heating applications.

  7. AcsA-AcsB: The core of the cellulose synthase complex from Gluconacetobacter hansenii ATCC23769.

    McManus, John B; Deng, Ying; Nagachar, Nivedita; Kao, Teh-hui; Tien, Ming

    2016-01-01

    The gram-negative bacterium, Gluconacetobacter hansenii, produces cellulose of exceptionally high crystallinity in comparison to the cellulose of higher plants. This bacterial cellulose is synthesized and extruded into the extracellular medium by the cellulose synthase complex (CSC). The catalytic component of this complex is encoded by the gene AcsAB. However, several other genes are known to encode proteins critical to cellulose synthesis and are likely components of the bacterial CSC. We have purified an active heterodimer AcsA-AcsB from G. hansenii ATCC23769 to homogeneity by two different methods. With the purified protein, we have determined how it is post-translationally processed, forming the active heterodimer AcsA-AcsB. Additionally, we have performed steady-state kinetic studies on the AcsA-AcsB complex. Finally through mutagenesis studies, we have explored the roles of the postulated CSC proteins AcsC, AcsD, and CcpAx. PMID:26672449

  8. QTL Information Table: 622 [Q-TARO

    Full Text Available qAC9 Physiological trait Eating quality Amylose content SSR C)Interval RIL Moritawase Koshihikar ... sicochemical Properties in Japonica Rice. Breeding Science ... 56, 253-260. ...

  9. The Diffuse Supernova Neutrino Background

    Beacom, John F

    2010-01-01

    The Diffuse Supernova Neutrino Background (DSNB) is the weak glow of MeV neutrinos and antineutrinos from distant core-collapse supernovae. The DSNB has not been detected yet, but the Super-Kamiokande (SK) 2003 upper limit on the electron antineutrino flux is close to predictions, now quite precise, based on astrophysical data. If SK is modified with dissolved gadolinium to reduce detector backgrounds and increase the energy range for analysis, then it should detect the DSNB at a rate of a few events per year, providing a new probe of supernova neutrino emission and the cosmic core-collapse rate. If the DSNB is not detected, then new physics will be required. Neutrino astronomy, while uniquely powerful, has proven extremely difficult -- only the Sun and the nearby Supernova 1987A have been detected to date -- so the promise of detecting new sources soon is exciting indeed.

  10. Stealths on Anisotropic Holographic Backgrounds

    Ayón-Beato, Eloy; Juárez-Aubry, María Montserrat

    2015-01-01

    In this paper, we are interested in exploring the existence of stealth configurations on anisotropic backgrounds playing a prominent role in the non-relativistic version of the gauge/gravity correspondence. By stealth configuration, we mean a nontrivial scalar field nonminimally coupled to gravity whose energy-momentum tensor evaluated on the anisotropic background vanishes identically. In the case of a Lifshitz spacetime with a nontrivial dynamical exponent z, we spotlight the role played by the anisotropy to establish the holographic character of the stealth configurations, i.e. the scalar field is shown to only depend on the radial holographic direction. This configuration which turns out to be massless and without integration constants is possible for a unique value of the nonminimal coupling parameter. Then, using a simple conformal argument, we map this configuration into a stealth solution defined on the so-called hyperscaling violation metric which is conformally related to the Lifshitz spacetime. Thi...

  11. Background paper on aquaculture research

    Wenblad, Axel; Jokumsen, Alfred; Eskelinen, Unto; Torrissen, Ole

    2013-01-01

    The Board of MISTRA established in 2012 a Working Group (WG) on Aquaculture to provide the Board with background information for its upcoming decision on whether the foundation should invest in aquaculture research. The WG included Senior Advisor Axel Wenblad, Sweden (Chairman), Professor Ole Torrissen, Norway, Senior Advisory Scientist Unto Eskelinen, Finland and Senior Advisory Scientist Alfred Jokumsen, Denmark. The WG performed an investigation of the Swedish aquaculture sector including ...

  12. Background radioactivity in environmental materials

    This paper presents the results of a literature search to identify information on concentrations of 'background' radioactivity in foodstuffs and other commonly available environmental materials. The review has concentrated on naturally occurring radioactivity in foods and on UK data, although results from other countries have also been considered where appropriate. The data are compared with established definitions of a 'radioactive' substance and radionuclides which do not appear to be adequately covered in the literature are noted. (author)

  13. Stochastic background of gravitational waves

    D'Araújo, J C N; Aguiar, O D

    2000-01-01

    A continuous stochastic background of gravitational waves (GWs) for burst sources is produced if the mean time interval between the occurrence of bursts is smaller than the average time duration of a single burst at the emission, i.e., the so called duty cycle must be greater than one. To evaluate the background of GWs produced by an ensemble of sources, during their formation, for example, one needs to know the average energy flux emitted during the formation of a single object and the formation rate of such objects as well. In many cases the energy flux emitted during an event of production of GWs is not known in detail, only characteristic values for the dimensionless amplitude and frequencies are known. Here we present a shortcut to calculate stochastic backgrounds of GWs produced from cosmological sources. For this approach it is not necessary to know in detail the energy flux emitted at each frequency. Knowing the characteristic values for the ``lumped'' dimensionless amplitude and frequency we show tha...

  14. Background independence in a background dependent renormalization group

    Labus, Peter; Morris, Tim R.; Slade, Zöe H.

    2016-07-01

    Within the derivative expansion of conformally reduced gravity, the modified split Ward identities are shown to be compatible with the flow equations if and only if either the anomalous dimension vanishes or the cutoff profile is chosen to have a power-law form. No solutions exist if the Ward identities are incompatible. In the compatible case, a clear reason is found for why Ward identities can still forbid the existence of fixed points; however, for any cutoff profile, a background independent (and parametrization independent) flow equation is uncovered. Finally, expanding in vertices, the combined equations are shown generically to become either overconstrained or highly redundant beyond the six-point level.

  15. Background independence in a background dependent renormalization group

    Labus, Peter; Slade, Zoë H

    2016-01-01

    Within the derivative expansion of conformally reduced gravity, the modified split Ward identities are shown to be compatible with the flow equations if and only if either the anomalous dimension vanishes or the cutoff profile is chosen to be power law. No solutions exist if the Ward identities are incompatible. In the compatible case, a clear reason is found for why Ward identities can still forbid the existence of fixed points; however, for any cutoff profile, a background independent (and parametrisation independent) flow equation is uncovered. Finally, expanding in vertices, the combined equations are shown generically to become either over-constrained or highly redundant beyond the six-point level.

  16. Medical Expenditure Panel Survey (MEPS) Summary Data Tables

    U.S. Department of Health & Human Services — Summary Data Tables Data collected through MEPS are used to generate tables with frequently used summary statistics. These tables are available here for both the...

  17. Medicaid Analytic eXtract (MAX) Rx Table Listing

    U.S. Department of Health & Human Services — The Statistical Compendium table listing (below) enables users to choose to view Medicaid prescription drug tables for 1999 - 2009, and to select the tables for the...

  18. Mouton's table of logarithms and its extensions (ca. 1670)

    Roegel, Denis

    2011-01-01

    Mouton's table, only in manuscript form, was an extension of Vlacq's table of logarithms of trigonometric functions to every second of the first four degrees. This table was surprisingly accurate and is reconstructed here.

  19. Potential factors impacting season-long expression of Cry1Ac in 13 commercial varieties of Bollgard® cotton

    John J. Adamczyk, Jr.

    2001-11-01

    Full Text Available Thirteen commercial varieties of transgenic Cry1Ac Bacillus thuringiensis Berliner (Bt cotton were examined across two sites in 2000 for potential factors that impact endotoxin expression. In all cases, two varieties (NuCOTN 33B and DP 458B/RR, Delta and Pineland Co., Scott, MS expressed more Cry1Ac than the other 11 varieties in various plant structures. These two varieties share the same parental background (DP 5415. Furthermore, when the next generation of plants were tested in the greenhouse, the same varietal patterns were exhibited. These data strongly suggest that factors such as parental background had a stronger impact on the expression of Cry1Ac than the environment.

  20. Influence of passive leg movements on blood circulation on the tilt table in healthy adults

    Czell David

    2004-10-01

    Full Text Available Abstract Background One problem in the mobilization of patients with neurological diseases, such as spinal cord injury, is the circulatory collapse that occurs while changing from supine to vertical position because of the missing venous pump due to paralyzed leg muscles. Therefore, a tilt table with integrated stepping device (tilt stepper was developed, which allows passive stepping movements for performing locomotion training in an early state of rehabilitation. The aim of this pilot study was to investigate if passive stepping and cycling movements of the legs during tilt table training could stabilize blood circulation and prevent neurally-mediated syncope in healthy young adults. Methods In the first experiment, healthy subjects were tested on a traditional tilt table. Subjects who had a syncope or near-syncope in this condition underwent a second trial on the tilt stepper. In the second experiment, a group of healthy subjects was investigated on a traditional tilt table, the second group on the tilt ergometer, a device that allows cycling movements during tilt table training. We used the chi-square test to compare the occurrence of near-syncope/syncope in both groups (tilt table/tilt stepper and tilt table/tilt ergometer and ANOVA to compare the blood pressure and heart rate between the groups at the four time intervals (supine, at 2 minutes, at 6 minutes and end of head-up tilt. Results Separate chi-square tests performed for each experiment showed significant differences in the occurrence of near syncope or syncope based on the device used. Comparison of the two groups (tilt stepper/ tilt table in experiment one (ANOVA showed that blood pressure was significantly higher at the end of head-up tilt on the tilt stepper and on the tilt table there was a greater increase in heart rate (2 minutes after head-up tilt. Comparison of the two groups (tilt ergometer/tilt table in experiment 2 (ANOVA showed that blood pressure was significantly

  1. AC power generation from microbial fuel cells

    Lobo, Fernanda Leite; Wang, Heming; Forrestal, Casey; Ren, Zhiyong Jason

    2015-11-01

    Microbial fuel cells (MFCs) directly convert biodegradable substrates to electricity and carry good potential for energy-positive wastewater treatment. However, the low and direct current (DC) output from MFC is not usable for general electronics except small sensors, yet commercial DC-AC converters or inverters used in solar systems cannot be directly applied to MFCs. This study presents a new DC-AC converter system for MFCs that can generate alternating voltage in any desired frequency. Results show that AC power can be easily achieved in three different frequencies tested (1, 10, 60 Hz), and no energy storage layer such as capacitors was needed. The DC-AC converter efficiency was higher than 95% when powered by either individual MFCs or simple MFC stacks. Total harmonic distortion (THD) was used to investigate the quality of the energy, and it showed that the energy could be directly usable for linear electronic loads. This study shows that through electrical conversion MFCs can be potentially used in household electronics for decentralized off-grid communities.

  2. Performance of Halbach magnetized brushless AC motors

    Zhu, Z.Q.; Xia, Z.P.; Shi, Y.F.; Howe, D.; Pride, A.; X. J. Chen

    2003-01-01

    The steady-state performance of Halbach magnetized brushless ac machines when operated in constant torque and flux-weakening modes is investigated both theoretically and experimentally, with particular emphasis on the influence of cross-coupling magnetic saturation on the torque capability.

  3. Ac-dc converter firing error detection

    Each of the twelve Booster Main Magnet Power Supply modules consist of two three-phase, full-wave rectifier bridges in series to provide a 560 VDC maximum output. The harmonic contents of the twelve-pulse ac-dc converter output are multiples of the 60 Hz ac power input, with a predominant 720 Hz signal greater than 14 dB in magnitude above the closest harmonic components at maximum output. The 720 Hz harmonic is typically greater than 20 dB below the 500 VDC output signal under normal operation. Extracting specific harmonics from the rectifier output signal of a 6, 12, or 24 pulse ac-dc converter allows the detection of SCR firing angle errors or complete misfires. A bandpass filter provides the input signal to a frequency-to-voltage converter. Comparing the output of the frequency-to-voltage converter to a reference voltage level provides an indication of the magnitude of the harmonics in the ac-dc converter output signal

  4. AC loss in superconducting tapes and cables

    Oomen, Marijn Pieter

    2000-01-01

    The present study discusses the AC loss in high-temperature superconductors. Superconducting materials with a relatively high critical temperature were discovered in 1986. They are presently developed for use in large-scale power-engineering devices such as power-transmission cables, transformers an

  5. Explaining computation of predictive values: 2 × 2 table versus frequency tree. A randomized controlled trial [ISRCTN74278823

    Berger Jürgen; Balgenorth Andrea; Steckelberg Anke; Mühlhauser Ingrid

    2004-01-01

    Abstract Background Involving patients in decision making on diagnostic procedures requires a basic level of statistical thinking. However, innumeracy is prevalent even among physicians. In medical teaching the 2 × 2 table is widely used as a visual help for computations whereas in psychology the frequency tree is favoured. We assumed that the 2 × 2 table is more suitable to support computations of predictive values. Methods 184 students without prior statistical training were randomised eith...

  6. INTRODUCTION Outline of Round Tables Outline of Round Tables

    Abarzhi, Snezhana I.; Sreenivasan, Katepalli R.

    2010-12-01

    The Second International Conference and Advanced School 'Turbulent Mixing and Beyond', TMB-2009, was held at the Abdus Salam International Centre for Theoretical Physics, (ICTP), Trieste, Italy on 27 July-7 August 2009. TMB-2009 united over 180 participants ranging from students to members of the National Academies of Sciences and Engineering, and including researchers at experienced and early stages of their carriers from leading scientific institutions in academia, national laboratories, corporations and industry worldwide. Responding to the community's inquiry and reaffirming the practices established at TMB-2007, two Round Tables were organized for the participants of TMB-2009 on 30 July 2009 and 6 August 2009 in the Oppenheimer Room at the Centre. The goals of the Round Tables were to encourage the information exchange among the members of the interdisciplinary and international TMB community, promote discussions regarding the state-of-the-art in TMB-related scientific areas, identify directions for frontier research, and articulate recommendations for future developments. This article is a summary of the collective work of the Round Table participants (listed alphabetically below by their last names), whose contributions form its substance and, as such, are greatly appreciated. Abarzhi, Snezhana I (University of Chicago, USA) Andrews, Malcolm (Los Alamos National Laboratory, USA) Belotserkovskii, Oleg (Institute for Computer Aided Design of the Russian Academy of Sciences, Russia) Bershadskii, Alexander (ICAR, Israel) Brandenburg, Axel (Nordita, Denmark) Chumakov, Sergei (Stanford University, USA) Desai, Tara (University of Milano-Bicocca, Italy) Galperin, Boris (University of South Florida, USA) Gauthier, Serge (Commissariat à l'Energie Atomique, France) Gekelman, Walter (University of California at Los Angeles, USA) Gibson, Carl (University of California at San Diego, USA) Goddard III, William A (California Institute of Technology, USA) Grinstein, Fernando

  7. A Classification Table for Achondrites

    Chennaoui-Aoudjehane, H.; Larouci, N.; Jambon, A.; Mittlefehldt, D. W.

    2014-01-01

    Classifying chondrites is relatively easy and the criteria are well documented. It is based on mineral compositions, textural characteristics and more recently, magnetic susceptibility. It can be more difficult to classify achondrites, especially those that are very similar to terrestrial igneous rocks, because mineralogical, textural and compositional properties can be quite variable. Achondrites contain essentially olivine, pyroxenes, plagioclases, oxides, sulphides and accessory minerals. Their origin is attributed to differentiated parents bodies: large asteroids (Vesta); planets (Mars); a satellite (the Moon); and numerous asteroids of unknown size. In most cases, achondrites are not eye witnessed falls and some do not have fusion crust. Because of the mineralogical and magnetic susceptibility similarity with terrestrial igneous rocks for some achondrites, it can be difficult for classifiers to confirm their extra-terrestrial origin. We -as classifiers of meteorites- are confronted with this problem with every suspected achondrite we receive for identification. We are developing a "grid" of classification to provide an easier approach for initial classification. We use simple but reproducible criteria based on mineralogical, petrological and geochemical studies. We presented the classes: acapulcoites, lodranites, winonaites and Martian meteorites (shergottite, chassignites, nakhlites). In this work we are completing the classification table by including the groups: angrites, aubrites, brachinites, ureilites, HED (howardites, eucrites, and diogenites), lunar meteorites, pallasites and mesosiderites. Iron meteorites are not presented in this abstract.

  8. Radiation on the dining table

    Zero tolerance to bacterial contamination means considering the acceptance of 'radiation on the table'. The process of food irradiation has been extensively studied, nevertheless its use remains a matter of some controversy. Despite unanimous agreement within the medical community of the safety of this procedure, occasional concerns arise from the consumers. A common consumer misconception is that irradiation may turn the food 'radioactive'. A significant number of scientific studies on the topic were analyzed. We found no scientific study demonstrating that consumption of irradiated food might pose a risk to consumers. All studies conclude that food irradiation at the appropriate dose required to reduce contamination is safe and does not affect its nutritional value. In order to emphasize the issue we discuss the potential benefit vs harm of irradiation of food contaminated with E. coli 0157: H7. The association of this bacteria with severe disease and death has been clearly established in contrast with the lack of a demonstrated risk due to meat irradiation. We conclude that the risks of food irradiation remains 'unknown' simply because, after four decades of research, none has been identified. In contrast to the risks of acquiring a food transmitted bacterial disease, the risk of irradiation is negligible

  9. [Radiation on the dining table].

    Rossi, Laura; Watson, Dana; Escandarani, Soledad; Miranda, Andrea; Troncoso, Alcides

    2009-08-01

    Zero tolerance to bacterial contamination means considering the acceptance of "radiation on the table". The process of food irradiation has been extensively studied, nevertheless its use remains a matter of some controversy. Despite unanimous agreement within the medical community of the safety of this procedure, occasional concerns arise from the consumers. A common consumer misconception is that irradiation may turn the food "radioactive". A significant number of scientific studies on the topic were analyzed. We found no scientific study demonstrating that consumption of irradiated food might pose a risk to consumers. All studies conclude that food irradiation at the appropriate dose required to reduce contamination is safe and does not affect its nutritional value. In order to emphasize the issue we discuss the potential benefit vs harm of irradiation of food contaminated with E. coli 0157: H7. The association of this bacteria with severe disease and death has been clearly established in contrast with the lack of a demonstrated risk due to meat irradiation. We conclude that the risks of food irradiation remains "unknown" simply because, after four decades of research, none has been identified. In contrast to the risks of acquiring a food transmitted bacterial disease, the risk of irradiation is negligible. PMID:19802398

  10. Visualize Your Data with Google Fusion Tables

    Brisbin, K. E.

    2011-12-01

    Google Fusion Tables is a modern data management platform that makes it easy to host, manage, collaborate on, visualize, and publish tabular data online. Fusion Tables allows users to upload their own data to the Google cloud, which they can then use to create compelling and interactive visualizations with the data. Users can view data on a Google Map, plot data in a line chart, or display data along a timeline. Users can share these visualizations with others to explore and discover interesting trends about various types of data, including scientific data such as invasive species or global trends in disease. Fusion Tables has been used by many organizations to visualize a variety of scientific data. One example is the California Redistricting Map created by the LA Times: http://goo.gl/gwZt5 The Pacific Institute and Circle of Blue have used Fusion Tables to map the quality of water around the world: http://goo.gl/T4SX8 The World Resources Institute mapped the threat level of coral reefs using Fusion Tables: http://goo.gl/cdqe8 What attendees will learn in this session: This session will cover all the steps necessary to use Fusion Tables to create a variety of interactive visualizations. Attendees will begin by learning about the various options for uploading data into Fusion Tables, including Shapefile, KML file, and CSV file import. Attendees will then learn how to use Fusion Tables to manage their data by merging it with other data and controlling the permissions of the data. Finally, the session will cover how to create a customized visualization from the data, and share that visualization with others using both Fusion Tables and the Google Maps API.

  11. Digital model for harmonic interactions in AC/DC/AC systems

    Guarini, A.P.; Rangel, R.D.; Pilotto, L.A.S.; Pinto, R.J.; Passos Junior, R. [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)

    1994-12-31

    The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.

  12. A Comparison Between Two Average Modelling Techniques of AC-AC Power Converters

    Pawel Szczesniak

    2015-03-01

    Full Text Available In this paper, a comparative evaluation of two modelling tools for switching AC-AC power converters is presented. Both of them are based on average modelling techniques. The first approach is based on the circuit averaging technique and consists in the topological manipulations, applied to a converters states. The second approach makes use of state-space averaged model of the converter and is based on analytical manipulations using the different state representations of a converter. The two modelling techniques are applied to a same AC-AC converter called matrix-reactance frequency converter based on buck-boost topology. These techniques are compared on the basis of their rapidity, quantity of calculations and transformations and its limitations.

  13. High voltage AC/AC electrochemical capacitor operating at low temperature in salt aqueous electrolyte

    Abbas, Qamar; Béguin, François

    2016-06-01

    We demonstrate that an activated carbon (AC)-based electrochemical capacitor implementing aqueous lithium sulfate electrolyte in 7:3 vol:vol water/methanol mixture can operate down to -40 °C with good electrochemical performance. Three-electrode cell investigations show that the faradaic contributions related with hydrogen chemisorption in the negative AC electrode are thermodynamically unfavored at -40 °C, enabling the system to work as a typical electrical double-layer (EDL) capacitor. After prolonged floating of the AC/AC capacitor at 1.6 V and -40°C, the capacitance, equivalent series resistance and efficiency remain constant, demonstrating the absence of ageing related with side redox reactions at this temperature. Interestingly, when temperature is increased back to 24 °C, the redox behavior due to hydrogen storage reappears and the system behaves as a freshly prepared one.

  14. Rapid cycling synchrotron magnet with separate ac and dc circuit

    In present rapid cycling synchrotron magnets ac and dc currents flow in the same coil to give the desired field. The circuit reactance is made zero at dc and the operating frequency by running the magnet in series with an external parallel resonant LC current. We propose to return the ac flux in a gap next to the synchrotron. The dc coil encloses the ac magnetic circuit and thus links no ac flux. A shorted turn between the dc coil and ac flux enhances the separation of the two circuits. Several interesting developments are possible. The dc coil could be a stable superconductor to save power. The ac flux return gap could be identical with the synchrotron gap and contain a second synchrotron. This would double the output of the system. If the return flux gap were used for a booster, the ac coil power could be greatly reduced or radiation hardening of the ac coil could be simplified

  15. [Toothache with a neuropathic background].

    Khatchaturian, V; de Wijer, A; Kalaykova, S I; Steenks, M H

    2015-03-01

    A 48-year old woman in good general health was referred to the orofacial pain clinic in a centre for special dentistry with a toothache in the premolar region of the left maxillary quadrant. The complaints had existed for 15 years and various dental treatments, including endodontic treatments, apical surgery, extraction and splint therapy, had not helped to alleviate the complaints. As a result of the fact that anti-epileptic drugs were able to reduce the pain it was concluded that this 'toothache' satisfied the criteria of an atypical odontalgia: 'toothache' with a neuropathic background. PMID:26181392

  16. Breast cancer - background and overview

    This summary is to provide the reader with a brief overview of the key concepts relating to epidemiology and etiology; clinical presentation and patterns of spread; Canadian guidelines for management; prognosis; and current Canadian screening recommendations in the diagnosis and treatment of breast cancer. This information will enable the reader to have the appropriate background knowledge before delving into the subsequent articles in this special CJMRT breast cancer edition. A variety of references have been provided for readers who are interested in more than a skeleton version of the current literature. (author)

  17. Design of Three Phase Matrix Converter AC-AC Utility Power Supply using SPWM Technique

    Sagar.S.Pawar; Prakash.T.Patil

    2015-01-01

    This paper describes the control analysis and design of an three phase matrix AC-AC utility power supply .The SPWM modulation techniques is used to control the desired output voltage and gives the control output voltage and reduced input harmonic distortions .In this Matrix converter Input is directly connected to output no DC link components is required. Simulation had been done using mat lab simulink and Simulated results are observed

  18. Design of Three Phase Matrix Converter AC-AC Utility Power Supply using SPWM Technique

    Sagar. S. Pawar

    2015-04-01

    Full Text Available This paper describes the control analysis and design of an three phase matrix AC-AC utility power supply .The SPWM modulation techniques is used to control the desired output voltage and gives the control output voltage and reduced input harmonic distortions .In this Matrix converter Input is directly connected to output no DC link components is required. Simulation had been done using mat lab simulink and Simulated results are observed

  19. A Comparison Between Two Average Modelling Techniques of AC-AC Power Converters

    Pawel Szczesniak

    2015-01-01

    In this paper, a comparative evaluation of two modelling tools for switching AC-AC power converters is presented. Both of them are based on average modelling techniques. The first approach is based on the circuit averaging technique and consists in the topological manipulations, applied to a converters states. The second approach makes use of state-space averaged model of the converter and is based on analytical manipulations using the different state representations of a converter. The two m...

  20. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    Ljusev, P.; Andersen, Michael A.E.

    2005-07-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration. (au)

  1. Implementation of Low Frequency Ac to High Frequency Ac with Single Stage Zvs-Pwm Inverter

    S. Arumugam S. Ramareddy M. Sridhar

    2011-01-01

    This paper presents a novel soft-switching pulse width modulation (PWM) utility frequency AC to high frequency (HF) AC power conversion circuit incorporating boost-active clamp single stage inverter topology. This power converter is more suitable and acceptable for cost effective HF consumer induction heating applications. Its operating principle is presented. The operating performances of this high frequency inverter using the latest insulated gate bipolar transistors are illustrated, which ...

  2. Adaptive Nonlinear Control of Induction Motors through AC/DC/AC Converters

    Elfadili, Abderrahim; Giri, Fouad; El Magri, Abdelmounime; Dugard, Luc; Chaoui, Fatima Zara

    2012-01-01

    The problem of controlling induction motors, together with associated AC/DC rectifiers and DC/AC inverters, is addressed. The control objectives are threefold: (i) the motor speed should track any reference signal despite mechanical parameter uncertainties and variations; (ii) the DC Link voltage must be tightly regulated; (iii) the power factor correction (PFC) w.r.t. the power supply net must be performed in a satisfactory way. First, a nonlinear model of the whole controlled system is deve...

  3. Robust control of synchronous motors through AC/DC/AC converters

    El Magri, Abdelmounime; Giri, Fouad; Abouloifa, Abdelmajid; Chaoui, Fatima Zara

    2010-01-01

    The problem of controlling synchronous motors, driven through AC/DC rectifiers and DC/AC inverters is addressed. The control objectives are three fold: (i) forcing the motor speed to track a varying reference signal in presence of motor parameter uncertainties;(ii) regulating the DC Link voltage; (iii )assuring a satisfactory power factor correction (PFC) with respect to the power supply net .First, a nonlinear model of the whole controlled system is developed in the Park-coordinates. Then, a...

  4. A new class of hybrid AC/AC direct power converters

    Klumpner, Christian; Wijekoon, Thiwanka; Wheeler, Patrick

    2005-01-01

    Variable voltage and variable frequency conversion of electrical energy from an AC source to an AC load is done in traditional power converters via a DC-link where an energy storage element (electrolytic capacitors) is situated. Despite its well-known benefits, it has the disadvantage of being bulky and to limit the converter lifetime. On the other hand, Direct Power Conversion (DPC) is an attractive concept, which doesn’t need an energy storage buffer, but has two main disadvantages: reduced...

  5. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...... will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration....

  6. AC losses in a HTS coil carrying DC current in AC external magnetic field

    We electrically measured AC losses in a Bi2223/Ag-sheathed pancake coil excited by a DC current in AC external magnetic field. Losses in the coil contain two kinds of loss components that are the magnetization losses and dynamic resistance losses. In the measurement, current leads to supply a current to the coil were specially arranged to suppress electromagnetic coupling between the coil current and the AC external magnetic field. A double pick-up coils method was used to suppress a large inductive voltage component contained in voltage signal for measuring the magnetization losses. It was observed that the magnetization losses were dependent on the coil current and that a peak of a curve of the loss factor vs. amplitude of the AC external magnetic field shifted to lower amplitude of the AC magnetic field as the coil current increased. This result suggests the full penetration magnetic field of the coil tape decreases as the coil current increases. The dynamic resistance losses were measured by measuring a DC voltage appearing between the coil terminals. It was observed that the DC voltage appearing in the coil subject to the AC external magnetic field was much larger than that in the coil subject to DC magnetic field

  7. [Cosmic Microwave Background (CMB) Anisotropies

    Silk, Joseph

    1998-01-01

    One of the main areas of research is the theory of cosmic microwave background (CMB) anisotropies and analysis of CMB data. Using the four year COBE data we were able to improve existing constraints on global shear and vorticity. We found that, in the flat case (which allows for greatest anisotropy), (omega/H)0 less than 10-7, where omega is the vorticity and H is the Hubble constant. This is two orders of magnitude lower than the tightest, previous constraint. We have defined a new set of statistics which quantify the amount of non-Gaussianity in small field cosmic microwave background maps. By looking at the distribution of power around rings in Fourier space, and at the correlations between adjacent rings, one can identify non-Gaussian features which are masked by large scale Gaussian fluctuations. This may be particularly useful for identifying unresolved localized sources and line-like discontinuities. Levin and collaborators devised a method to determine the global geometry of the universe through observations of patterns in the hot and cold spots of the CMB. We have derived properties of the peaks (maxima) of the CMB anisotropies expected in flat and open CDM models. We represent results for angular resolutions ranging from 5 arcmin to 20 arcmin (antenna FWHM), scales that are relevant for the MAP and COBRA/SAMBA space missions and the ground-based interferometer. Results related to galaxy formation and evolution are also discussed.

  8. [Cosmic Microwave Background (CMB) Anisotropies

    Silk, Joseph

    1998-01-01

    One of the main areas of research is the theory of cosmic microwave background (CMB) anisotropies and analysis of CMB data. Using the four year COBE data we were able to improve existing constraints on global shear and vorticity. We found that, in the flat case (which allows for greatest anisotropy), (omega/H)0 less than 10(exp -7), where omega is the vorticity and H is the Hubble constant. This is two orders of magnitude lower than the tightest, previous constraint. We have defined a new set of statistics which quantify the amount of non-Gaussianity in small field cosmic microwave background maps. By looking at the distribution of power around rings in Fourier space, and at the correlations between adjacent rings, one can identify non-Gaussian features which are masked by large scale Gaussian fluctuations. This may be particularly useful for identifying unresolved localized sources and line-like discontinuities. Levin and collaborators devised a method to determine the global geometry of the universe through observations of patterns in the hot and cold spots of the CMB. We have derived properties of the peaks (maxima) of the CMB anisotropies expected in flat and open CDM models. We represent results for angular resolutions ranging from 5 arcmin to 20 arcmin (antenna FWHM), scales that are relevant for the MAP and COBRA/SAMBA space missions and the ground-based interferometer. Results related to galaxy formation and evolution are also discussed.

  9. Immunopathogenic Background of Pars Planitis.

    Przeździecka-Dołyk, Joanna; Węgrzyn, Agnieszka; Turno-Kręcicka, Anna; Misiuk-Hojło, Marta

    2016-04-01

    Pars planitis is defined as an intermediate uveitis of unknown background of systemic disease with characteristic formations such as vitreous snowballs, snowbanks and changes in peripheral retina. The incidence of pars planitis varies 2.4-15.4 % of the uveitis patients. The pathogenesis of the disease is to be determined in future. Clinical and histopathological findings suggest an autoimmune etiology, most likely as a reaction to endogenous antigen of unknown source, with T cells predominant in both vitreous and pars plana infiltrations. T cells subsets play an important role as a memory-effector peripheral cell. Snowbanks are formed as an effect of post inflammatory glial proliferation of fibrous astrocytes. There is also a genetic predisposition for pars planitis by human leukocyte antigen and several other genes. A coexistence of multiple sclerosis and optic neuritis has been described in numerous studies. Epiretinal membrane, cataract, cystoid macular edema, retinal detachment, retinal vasculitis, neovascularization, vitreous peripheral traction, peripheral hole formation, vitreous hemorrhage, disc edema are common complications observed in pars planitis. There is a need to expand the knowledge of the pathogenic and immunologic background of the pars planitis to create an accurate pharmacological treatment. PMID:26438050

  10. 21 CFR 880.5500 - AC-powered patient lift.

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered patient lift. 880.5500 Section 880.5500... Devices § 880.5500 AC-powered patient lift. (a) Identification. An AC-powered lift is an electrically powered device either fixed or mobile, used to lift and transport patients in the horizontal or...

  11. AC LED的研究现状与发展%Current research and development of AC LED

    满瑞; 李秋俊

    2012-01-01

    介绍了AC LED的特征及其工作原理,分析了AC LED相比于DC LED的优缺点,概述了AC LED在国内外的研究进展及其应用现状,讨论了AC LED技术发展过程中面临的挑战,并展望了其发展趋势.%The characteristics and operation principles of AC LED were presented.The advantages and disadvantages of AC LED compared with the DC LED were analyzed.The development and the latest application of AC LED were described.The challenges of the competition with the traditional light source were discussed,as well as the development trend of AC LED.

  12. The astronomical tables of Giovanni Bianchini

    Chabas, Jose

    2009-01-01

    This book describes and analyses, for the first time, the astronomical tables of Giovanni Bianchini of Ferrara (d. after 1469), explains their context, inserts them into an astronomical tradition that began in Toledo, and addresses their diffusion.

  13. Authenticated hash tables

    Triandopoulos, Nikolaos; Papamanthou, Charalampos; Tamassia, Roberto

    2008-01-01

    Hash tables are fundamental data structures that optimally answer membership queries. Suppose a client stores n elements in a hash table that is outsourced at a remote server so that the client can save space or achieve load balancing. Authenticating the hash table functionality, i.e., verifying...... the correctness of queries answered by the server and ensuring the integrity of the stored data, is crucial because the server, lying outside the administrative control of the client, can be malicious. We design efficient and secure protocols for optimally authenticating membership queries on hash...... for authenticating a hash table with constant query cost and sublinear update cost. Our solution employs the RSA accumulator in a nested way over the stored data, strictly improving upon previous accumulator-based solutions. Our construction applies to two concrete data authentication models and lends...

  14. Map and table of world copper smelters

    U.S. Geological Survey, Department of the Interior — This map and table comprise information on 124 world copper smelters (2 of which are closed and 1 of which is under development) and 4 (low-grade solvent...

  15. Cohort Working Life Tables for Older Canadians

    Spencer, Byron G.

    2010-01-01

    Full Text Available AbstractWe construct cohort working life tables for Canadian men and women aged 50and older and, for comparison, corresponding period tables. The tables arederived using annual single-age time series of participation rates for 1976-2006from the master files of the Statistics Canada Labour Force Survey. The cohortcalculations are based on stochastic projections of mortality coupled withalternative assumptions about future participation rates. Separate tables areprovided for the years 1976, 1991, and 2006, thus spanning a period ofsubstantial gains in life expectancy and strong upward trends in femaleparticipation. Life expectancies based on the cohort tables are greater thanthose based on the period tables, for both men and women, and that is reflectedin increased retirement expectancies. For example, a male aged 50 in 1976could have expected to live three years longer and to have almost four moreyears in retirement, based on the male cohort table under medium assumptions,as compared with the corresponding period table.RésuméNous avons établis des tables de vie active par génération pour les Canadiens etCanadiennes âgés de 50 ans ou plus ainsi que des tables du momentcorrespondantes pour servir de comparaison. Les tables sont dérivées à l'aidede séries chronologiques annuelles d'un seul âge pour le taux d'activité pour lesannées 1976 à 2006 provenant des fichiers maîtres de l'Enquête sur lapopulation active de Statistique Canada. Les calculs par génération sont baséessur des projections stochastiques de mortalité et sur des suppositions quant àde futurs taux d'activité possibles. Des tables séparées ont été établies pour lesannées 1976, 1991 et 2006 ; ce qui représente une période qui a vu des gainssubstantiels en ce qui concerne l'espérance de vie et une forte hausse d'activitéchez les femmes. Les espérance de vie basées sur les tables par génération sontplus élevées que celles basées sur les tables du

  16. Toward an Organic Chemist's Periodic Table.

    Hall, H. K., Jr.

    1980-01-01

    An analogy between electron transfer reactions of the elements and those of organic molecules is offered. Examples of organic electron transfer reactions are presented. The rationale of constructing an organic chemists' periodic table is also discussed. (HM)

  17. Theodore William Richards and the Periodic Table

    Conant, James B.

    1970-01-01

    Discusses the contribution of Theodore Richards to the accurate determination of atomic weights of copper and other elements; his major contribution was to the building of the definitive periodic table of the elements. (BR)

  18. Ecological periodic tables: In principle and practice

    The chemical periodic table, the Linnaean system of classification and the Hertzsprung-Russell diagram are iconic information organizing structure in chemistry, biology and astronomy, respectively, because they are simple, exceptionally useful and they foster the expansion of sci...

  19. The periodic table: icon and inspiration.

    Poliakoff, Martyn; Tang, Samantha

    2015-03-13

    To start this discussion meeting on the new chemistry of the elements held on 12 May 2014, Martyn Poliakoff, Foreign Secretary of the Royal Society, was invited to give the opening remarks. As a chemist and a presenter of the popular online video channel 'The periodic table of videos', Martyn communicates his personal and professional interest in the elements to the public, who in turn use these videos both as an educational resource and for entertainment purposes. Ever since Mendeleev's first ideas for the periodic table were published in 1869, the table has continued to grow as new elements have been discovered, and it serves as both icon and inspiration; its form is now so well established that it is recognized the world over as a symbol for science. This paper highlights but a few of the varied forms that the table can take, such as an infographic, which can convey the shortage of certain elements with great impact. PMID:25666072

  20. A Direct Iteration Method using Resonance Integral Table for the Self-Shielding Calculations

    In this paper, a direct iteration method using the resonance integral table is introduced for the self-shielding calculations. The basic purpose of this paper is to show the possibility that the HELIOS subgroup method can be replaced with this method. This method doesn't use the subgroup data but only the resonance integral tables given in library. The basic idea of this method is to use the Bondarenko's iteration in order to obtain the self-shielded effective cross sections with the background cross sections which are calculated by the heterogeneous transport calculation. This method is implemented in the KARMA lattice calculation code and tested

  1. A Direct Iteration Method using Resonance Integral Table for the Self-Shielding Calculations

    Hong, Ser Gi; Kim, Kang Seog; Song, Jae Seung [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2009-10-15

    In this paper, a direct iteration method using the resonance integral table is introduced for the self-shielding calculations. The basic purpose of this paper is to show the possibility that the HELIOS subgroup method can be replaced with this method. This method doesn't use the subgroup data but only the resonance integral tables given in library. The basic idea of this method is to use the Bondarenko's iteration in order to obtain the self-shielded effective cross sections with the background cross sections which are calculated by the heterogeneous transport calculation. This method is implemented in the KARMA lattice calculation code and tested.

  2. Ambulatory Medical Assistance - After Cancer (AMA-AC): A model for an early trajectory survivorship survey of lymphoma patients treated with anthracycline-based chemotherapy

    Compaci, Gisèle; Rueter, Manuela; Lamy, Sébastien; Oberic, Lucie; Recher, Christian; Lapeyre-Mestre, Maryse; LAURENT, GUY; Despas, Fabien

    2015-01-01

    Background Cancer survivorship has emerged as an important aspect of oncology due to the possibility of physical and psychosocial complications. The purpose of this study was to assess the feasibility of the Ambulatory Medical Assistance for After Cancer (AMA-AC) procedure for monitoring lymphoma survivorship during the first year after chemotherapy. Methods AMA-AC is based on systematic general practitioner (GP) consultations and telephone interventions conducted by a nurse coordinator (NC) ...

  3. The drift table: designing for ludic engagement

    Gaver, William; Bowers, John; Boucher, Andy; Gellerson, Hans; Pennington, Sarah; Schmidt, Albrecht; Steed, Anthony; Villar, Nicholas; Walker, Brendan

    2004-01-01

    The Drift Table is an electronic coffee table that displays slowly moving aerial photography controlled by the distribution of weight on its surface. It was designed to investigate our ideas about how technologies for the home could support ludic activities-that is, activities motivated by curiosity, exploration, and reflection rather than externally-defined tasks. The many design choices we made, for example to block or disguise utilitarian functionality, helped to articulate our emerging un...

  4. Attitude-adjusting table for neutron monochromator

    The neutron monochromator attitude-adjusting table is one of the mechanical components for most monochromatic neutron scattering spectrometer. It is mainly used for mounting crystal monochromator, and getting monochromatic neutron by adjusting the attitude of monochromator remotely. The table has a compact volume and five adjusting axes with high resolution. It combines optic mechanical electronic technique with computer control technique. This device will be applied to the neutron residual stress spectrometer on CARR firstly. (authors)

  5. Periodic Table for Floquet Topological Insulators

    Roy, Rahul; Harper, Fenner

    2016-01-01

    Dynamical phases with novel topological properties are known to arise in driven systems of free fermions. In this paper, we obtain a `periodic table' to describe the phases of such time-dependent systems, generalizing the periodic table for static topological insulators. Using K-theory, we systematically classify Floquet topological insulators from the ten Altland-Zirnbauer symmetry classes across all dimensions. We find that the static classification scheme described by a group $G$ becomes $...

  6. IUPAC Periodic Table of the Isotopes

    Holden, N.E.; Coplen, T.B.; Böhlke, J.K.; Wieser, M.E.; Singleton, G.; Walczyk, T.; Yoneda, S.; Mahaffy, P.G.; Tarbox, L.V.

    2011-01-01

    For almost 150 years, the Periodic Table of the Elements has served as a guide to the world of elements by highlighting similarities and differences in atomic structure and chemical properties. To introduce students, teachers, and society to the existence and importance of isotopes of the chemical elements, an IUPAC Periodic Table of the Isotopes (IPTI) has been prepared and can be found as a supplement to this issue.

  7. Shaking table testing of mechanical components

    Presented is the experience of the Institute of Earthquake Engineering and Engineering Seismology, Skopje, Republic of Macedonia in seismic qualification of mechanical components by shaking table testing. Technical data and characteristics for the three shaking tables available at the Institute are given. Also, for characteristic mechanical components tested at the Institute laboratories, basic data such as producer, testing investor, description of the component, testing regulation, testing equipment and final user of the results. (author)

  8. Dicty_cDB: FCL-AC08 [Dicty_cDB

    Full Text Available FCL (Link to library) FCL-AC08 (Link to dictyBase) - - - Contig-U15080-1 FCL-AC08P ...(Link to Original site) FCL-AC08F 616 FCL-AC08Z 291 FCL-AC08P 907 - - Show FCL-AC08 Library FCL (Link to library) Clone ID FCL-...-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-AC08Q....Seq.d/ Representative seq. ID FCL-AC08P (Link to Original site) Representative DNA sequence >FCL-AC08 (FCL-AC08Q) /CSM/FCL/FCL-...ignificant alignments: (bits) Value FCL-AC08 (FCL-AC08Q) /CSM/FCL/FCL-AC/FCL-AC08Q.Seq.d/ 1322 0.0 SFA226 (S

  9. Resonant holographic measurements of laser ablation plume expansion in vacuum and argon gas backgrounds

    Lindley, R.A. [Michigan Univ., Ann Arbor, MI (United States)

    1993-10-01

    This thesis discusses the following on resonant holographic measurements of laser ablation plume expansion: Introduction to laser ablation; applications of laser ablation; The study of plume expansion; holographic interferometry; resonant holographic interferometry; accounting for finite laser bandwidth; The solution for doppler broadening and finite bandwidth; the main optical table; the lumonics laser spot shape; developing and reconstructing the holograms; plume expansion in RF/Plasma Environments; Determining {lambda}{sub o}; resonant refraction effects; fringe shift interpretation; shot-to-shot consistency; laser ablation in vacuum and low pressure, inert, background gas; theoretically modeling plume expansion in vacuum and low pressure, inert, background gas; and laser ablation in higher pressure, inert, background gas.

  10. Monitor tables for electron beams in radiotherapy

    The application of electron beams in radiotherapy is still based on tables of monitor units, although 3-D treatment planning systems for electron beams are available. This have several reasons: The need for 3-D treatment planning is not recognized; there is no confidence in the calculation algorithm; Monte-Carlo algorithms are too time-consuming; and the effort necessary to measure basic beam data for 3-D planning is considered disproportionate. However, the increasing clinical need for higher dosimetric precision and for more conformal electron beams leads to the requirement for more sophisticated tables of monitor units. The present paper summarizes and discusses the main aspects concerning the preparation of tables of monitor units for electron beams. The measurement equipment and procedures for measuring basic beam data needed for tables of monitor units for electron beams are described for a standard radiation therapy linac. The design of tables of monitor units for standard electron applicators is presented; this design can be extended for individual electron inserts, to variable applicator surface distances, to oblique beam incidence, and the use of bolus material. Typical data of an Elekta linac are presented in various tables. (orig.)

  11. Cosmic background radiation: a hagiography

    Abramo, Luis Raul [Universidade de Sao Paulo (USP), SP (Brazil). Inst. de Fisica

    2009-07-01

    Full text. Cosmology advanced tremendously since Gamow and his students predicted the cosmic microwave background radiation, and since Penzias and Wilson observed it for the first time. The observations of the CMBR point to a Universe which is beautiful in its simplicity: the amazing richness of structures can be explained by a minimalistic set of well-known physical laws, a reasonable amount of free parameters, and 'natural' initial conditions which realize the idea of maximum entropy. We will revise the latest observations and show how the CMBR is presently allowing the study of the 'fine structure' of cosmological phenomena. We will also discuss the possibility of a detection of rotational modes (B-modes) in the polarization of the CMBR, that may reveal which processes (inflation ?) acted in the very early universe to endow it with these beautiful and simple properties. (author)

  12. Cosmic background radiation: a hagiography

    Full text. Cosmology advanced tremendously since Gamow and his students predicted the cosmic microwave background radiation, and since Penzias and Wilson observed it for the first time. The observations of the CMBR point to a Universe which is beautiful in its simplicity: the amazing richness of structures can be explained by a minimalistic set of well-known physical laws, a reasonable amount of free parameters, and 'natural' initial conditions which realize the idea of maximum entropy. We will revise the latest observations and show how the CMBR is presently allowing the study of the 'fine structure' of cosmological phenomena. We will also discuss the possibility of a detection of rotational modes (B-modes) in the polarization of the CMBR, that may reveal which processes (inflation ?) acted in the very early universe to endow it with these beautiful and simple properties. (author)

  13. Low background aspects of GERDA

    The GERDA experiment operates bare Germanium diodes enriched in 76Ge in an environment of pure liquid argon to search for neutrinoless double beta decay. A very low radioactive background is essential for the success of the experiment. We present here the research done in order to remove radio-impurities coming from the liquid argon, the stainless steel cryostat and the front-end electronics. We found that liquid argon can be purified efficiently from 222Rn. The main source of 222Rn in GERDA is the cryostat which emanates about 55 mBq. A thin copper shroud in the center of the cryostat was implemented to prevent radon from approaching the diodes. Gamma ray screening of radio-pure components for front-end electronics resulted in the development of a pre-amplifier with a total activity of less than 1 mBq 228Th.

  14. Background canceling surface alpha detector

    A background canceling long range alpha detector which is capable of providing output proportional to both the alpha radiation emitted from a surface and to radioactive gas emanating from the surface. The detector operates by using an electrical field between first and second signal planes, an enclosure and the surface or substance to be monitored for alpha radiation. The first and second signal planes are maintained at the same voltage with respect to the electrically conductive enclosure, reducing leakage currents. In the presence of alpha radiation and radioactive gas decay, the signal from the first signal plane is proportional to both the surface alpha radiation and to the airborne radioactive gas, while the signal from the second signal plane is proportional only to the airborne radioactive gas. The difference between these two signals is proportional to the surface alpha radiation alone. 5 figs

  15. Polarization of Cosmic Microwave Background

    Buzzelli, Alessandro; de Gasperis, Giancarlo; Vittorio, Nicola

    2016-01-01

    In this work we present an extension of the ROMA map-making code for data analysis of Cosmic Microwave Background polarization, with particular attention given to the inflationary polarization B-modes. The new algorithm takes into account a possible cross-correlated noise component among the different detectors of a CMB experiment. We tested the code on the observational data of the BOOMERanG (2003) experiment and we show that we are provided with a better estimate of the power spectra, in particular the error bars of the BB spectrum are smaller up to 20% for low multipoles. We point out the general validity of the new method. A possible future application is the LSPE balloon experiment, devoted to the observation of polarization at large angular scales.

  16. The Cosmic Background Imager 2

    Taylor, Angela C; Allison, James R; Angelakis, Emmanouil; Bond, J Richard; Bronfman, Leonardo; Bustos, Ricardo; Davis, Richard J; Dickinson, Clive; Leech, Jamie; Mason, Brian S; Myers, Steven T; Pearson, Timothy J; Readhead, Anthony C S; Reeves, Rodrigo; Shepherd, Martin C; Sievers, Jonathan L

    2011-01-01

    We describe an upgrade to the Cosmic Background Imager instrument to increase its surface brightness sensitivity at small angular scales. The upgrade consisted of replacing the thirteen 0.9-m antennas with 1.4-m antennas incorporating a novel combination of design features, which provided excellent sidelobe and spillover performance for low manufacturing cost. Off-the-shelf spun primaries were used, and the secondary mirrors were oversized and shaped relative to a standard Cassegrain in order to provide an optimum compromise between aperture efficiency and low spillover lobes. Low-order distortions in the primary mirrors were compensated for by custom machining of the secondary mirrors. The secondaries were supported on a transparent dielectric foam cone to minimize scattering. The antennas were tested in the complete instrument, and the beam shape and spillover noise contributions were as expected. We demonstrate the performance of the telescope and the inter-calibration with the previous system using observ...

  17. Gauging the cosmic microwave background

    We provide a new derivation of the anisotropies of the cosmic microwave background (CMB), and find an exact expression that can be readily expanded perturbatively. Close attention is paid to gauge issues, with the motivation to examine the effect of super-Hubble modes on the CMB. We calculate a transfer function that encodes the behavior of the dipole, and examine its long-wavelength behavior. We show that contributions to the dipole from adiabatic super-Hubble modes are strongly suppressed, even in the presence of a cosmological constant, contrary to claims in the literature. We also introduce a naturally defined CMB monopole, which exhibits closely analogous long-wavelength behavior. We discuss the geometrical origin of this super-Hubble suppression, pointing out that it is a simple reflection of adiabaticity, and hence argue that it will occur regardless of the matter content.

  18. Background paper on aquaculture research

    Wenblad, Axel; Jokumsen, Alfred; Eskelinen, Unto;

    Torrissen, Norway, Senior Advisory Scientist Unto Eskelinen, Finland and Senior Advisory Scientist Alfred Jokumsen, Denmark. The WG performed an investigation of the Swedish aquaculture sector including interviews with a range of stakeholders within aquaculture research, farming organisations, authorities......The Board of MISTRA established in 2012 a Working Group (WG) on Aquaculture to provide the Board with background information for its upcoming decision on whether the foundation should invest in aquaculture research. The WG included Senior Advisor Axel Wenblad, Sweden (Chairman), Professor Ole...... tonnes of crayfish altogether corresponding to a total value of SEK 328 million in 2011. Further about 1,000 tonnes of fish and crustaceans were produced for restocking as well as about 3 million fry of salmon and trout were released into rivers. Swedish aquaculture research was overall assessed...

  19. The scientific background to decorporation

    The scientific background to chelation therapy is reviewed. A review of the animal studies which have demonstrated that in animals treated with DTPA either a reduction in bone tumour incidence from internally deposited 239Pu and 241Am, or a significant increase in survival time may occur, suggests that it is reasonable to assume that could also occur in humans. The biokinetics and bioinorganic chemistry of cobalt, caesium, thorium, uranium, neptunium, plutonium and americium after their entry into the systemic circulation are reviewed briefly. These reviews discuss the general biokinetic behaviour of each element in adult humans with special reference to those aspects of their bioinorganic chemistry that either underlie existing approaches to decorporation therapy, or which might be exploitable for new types of treatment. (author)

  20. Recognizing foreground-background interaction

    Jenkins, Jeffrey; Szu, Harold

    2010-04-01

    Can the background affect a foreground target in distant, low-quality imagery? If it does, it might occur in our mind, or perhaps it may represent a snapshot of our early vision. An affirmative answer, one way or another, may affect our current understanding of this phenomena and potentially for related applications. How can we be sure about this in the psycho-physical sense? We begin with the physiology of our brain's homeostasis, of which an isothermal equilibrium is characterized by the minimum of Helmholtz isothermal Free Energy: A = U - T0S >= 0, where T0 = 37°C, the Boltzmann Entropy S = KB1n(W), and U is the unknown internal energy to be computed.

  1. RADIOACTIVE CHEMICAL ELEMENTS IN THE ATOMIC TABLE

    In the 1949 Report of the Atomic Weights Commission, a series of new elements were added to the Atomic Weights Table. Since these elements had been produced in the laboratory and were not discovered in nature, the atomic weight value of these artificial products would depend upon the production method. Since atomic weight is a property of an element as it occurs in nature, it would be incorrect to assign an atomic weight value to that element. As a result of that discussion, the Commission decided to provide only the mass number of the most stable (longest-lived) known isotope as the number to be associated with these entries in the Atomic Weights Table. As a function of time, the mass number associated with various elements has changed as longer-lived isotopes of a particular elements has been found in nature, or as improved half-life values of an element's isotopes might cause a shift in the longest-lived isotope from one mass number to another. In the 1957 Report of the Atomic Weights Commission, it was decided to discontinue the listing of the mass number in the Atomic Weights Table on the grounds that the kind of information supplied by the mass number is inconsistent with the primary purpose of the Table, i.e., to provide accurate values of ''these constants'' for use in chemical calculations. In addition to the Table of Atomic Weights, the Commission included an auxiliary Table of Radioactive Elements for the first time, where the entry would be the isotope of that element which was most stable, i.e., it had the longest known half-life. In their 1973 report, the Commission noted that the users of the Atomic Weights Table were dissatisfied with the omission of values in the Table for some elements and it was decided to reintroduce the mass number for elements. In their 1983 report, the Commission decided that radioactive elements were considered to lack a characteristic terrestrial isotopic composition, from which an atomic weight value could be calculated to

  2. Fractional ac Josephson effect in unconventional superconductors

    For certain orientations of Josephson junctions between two px-wave or two d-wave superconductors, the subgap Andreev bound states produce a 4π-periodic relation between the Josephson current I and the phase difference ψ: I propor to sin(ψ/2) . Consequently, the ac Josephson current has the fractional frequency eV/h where V is the dc voltage. In the tunneling limit, the Josephson current is proportional to the first power (not square) of the electron tunneling amplitude. Thus, the Josephson current between unconventional superconductors is carried by single electrons, rather than by Cooper pairs. The fractional ac Josephson effect can be observed experimentally by measuring frequency spectrum of microwave radiation from the junction

  3. AC motor drive system for electric cars

    Morohoshi, Yukinobu; Yoshinori, Naoto; Naito, Hironobu (Fuji Electric Co., Ltd., Tokyo, (Japan))

    1989-08-10

    Various main circuit equipment with large capacity GTO thyristors are outlined for AC and DC electric cars. The configuration of a PWM converter system is presented for the AC main motor drive system of the Shinkansen trains, and its following features are described: the high power factor control capable of keeping a power factor 100% constantly, energy saving by power regenerative braking, the small triple structure with large capacity reverse-conducting GTO thyristors of 4,500V/3,000A, and the reduction of equivalent interfering current and harmonic current by three phase-triple phase difference operation. Furthermore, a control logic equipment with 16 bit MPU and a main transformer are outlined, and the verification test results of the control logic equipment by an analog model simulation and the combinational test results of the commercial equipment are reported. Prototype VVVF inverter system for DC electric cars is also presented. 6 refs., 13 figs., 3 tabs.

  4. β-delayed fission from 230Ac

    ThO2 is irradiated with 60 MeV/u 18O beams. 230Ra is produced via the multi-nucleon transfer and dissipative fragmentation reactions of the target. 230Ra is radio-chemical separated from ThO2 and the other reaction products. The thin Ra sources are prepared. The mica fission track detectors are exposed to the Ra sources. γ-rays of Ra decay in the sources are measured by a HPGe detector. The mica foil is etched in HF solution. The etched mica foil is scanned with an optical microscope. The fission tracks that should come from β-delayed fission of 230Ac are observed. The β-delayed fission probability of 230Ac is determined to be (1.19 +- 0.85) x 10-8

  5. AC Dielectrophoresis Using Elliptic Electrode Geometry

    S. M. Rezaul Hasan; Aanan Khurma

    2011-01-01

    This paper presents negative AC dielectrophoretic investigations using elliptic electrode geometry. Simulations of the electric field gradient variation using various ratios of the semimajor and the semiminor axis were carried out to determine the optimum elliptic geometry for the dielectrophoretic electrokinetics of specimen in an assay with laminar (low Reynolds number) fluid flow. Experimental setup of the elliptic electrode assembly using PCB fabrication and electrokinetic accumulation of...

  6. Lazy AC-Pattern Matching for Rewriting

    Belkhir, Walid; 10.4204/EPTCS.82.3

    2012-01-01

    We define a lazy pattern-matching mechanism modulo associativity and commutativity. The solutions of a pattern-matching problem are stored in a lazy list composed of a first substitution at the head and a non-evaluated object that encodes the remaining computations. We integrate the lazy AC-matching in a strategy language: rewriting rule and strategy application produce a lazy list of terms.

  7. Entropy production in ac-calorimetry

    Garden, Jean-Luc; Richard, Jacques

    2007-01-01

    In calorimetry and particularly in heat capacity measurements, different characteristic relaxation time constants may perturb the experiment which cannot be considered at thermodynamic equilibrium. In this case, thermodynamics of irreversible processes has to be taken into account and the calorimetric measurements must be considered as dynamic. In a temperature modulated experiment, such as ac-calorimetry, these non-equilibrium experiments give rise to the notion of frequency dependent comple...

  8. 44 CFR 208.12 - Maximum Pay Rate Table.

    2010-10-01

    ...) Worldwide for physicians. The rates used in the initial Table can be found at http://www.opm.gov/oca/03... rates used in the initial Table can be found at http://www.opm.gov/oca/03tables/html/gs.asp. (iii...://www.opm.gov/oca/03tables/locdef.asp. (3) Review and update. DHS will review and update the...

  9. 40 CFR Table 2 to Subpart Kkkkk of... - Operating Limits

    2010-07-01

    ... 40 Protection of Environment 13 2010-07-01 2010-07-01 false Operating Limits 2 Table 2 to Subpart.... KKKKK, Table 2 Table 2 to Subpart KKKKK of Part 63—Operating Limits As stated in § 63.8555, you must meet each operating limit in the following table that applies to you. For each . . . You must . . ....

  10. 40 CFR Table 2 to Subpart Sssss of... - Operating Limits

    2010-07-01

    ... 40 Protection of Environment 14 2010-07-01 2010-07-01 false Operating Limits 2 Table 2 to Subpart..., Subpt. SSSSS, Table 2 Table 2 to Subpart SSSSS of Part 63—Operating Limits As stated in § 63.9788, you must comply with the operating limits for affected sources in the following table:] For . . . You...

  11. 40 CFR Table 2 to Subpart Ppppp of... - Operating Limits

    2010-07-01

    ... of appendix M to 40 CFR part 51 Follow the requirements in 3ai and ii of this table. 4. Emission... 40 Protection of Environment 14 2010-07-01 2010-07-01 false Operating Limits 2 Table 2 to Subpart..., Table 2 Table 2 to Subpart PPPPP of Part 63—Operating Limits If you are required to comply...

  12. 40 CFR Table 2 to Subpart Aaaaa of... - Operating Limits

    2010-07-01

    ... 40 Protection of Environment 13 2010-07-01 2010-07-01 false Operating Limits 2 Table 2 to Subpart.... AAAAA, Table 2 Table 2 to Subpart AAAAA of Part 63—Operating Limits As required in § 63.7090(b), you must meet each operating limit in the following table that applies to you. For . . . You must . . ....

  13. 40 CFR Table 2 to Subpart Jjjjj of... - Operating Limits

    2010-07-01

    ... 40 Protection of Environment 13 2010-07-01 2010-07-01 false Operating Limits 2 Table 2 to Subpart... Manufacturing Pt. 63, Subpt. JJJJJ, Table 2 Table 2 to Subpart JJJJJ of Part 63—Operating Limits As stated in § 63.8405, you must meet each operating limit in the following table that applies to you. For...

  14. 38 CFR 4.25 - Combined ratings table.

    2010-07-01

    ... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Combined ratings table. 4... RATING DISABILITIES General Policy in Rating § 4.25 Combined ratings table. Table I, Combined Ratings... order of their severity, beginning with the greatest disability and then combined with use of table I...

  15. Gaussianity of LISA's confusion backgrounds

    different time scales, so no single background source closely resembles any search template. We also briefly discuss other types of LISA searches where the non-Gaussianity of LISA's confusion backgrounds could perhaps have a much greater impact on search reliability and efficacy

  16. The Cosmic Background Radiation, 1995

    Smoot, G F

    1995-01-01

    Observations of the Cosmic Microwave background have provided many of the most powerful constraints we have on cosmology and events in the early universe. The spectrum and isotropy of CBR have long been a pillar of Big Bang models. The discovery of low levels on anisotropy has provided new information and tools for our understanding of the early universe. Further observations promise to enhance greatly our knowledge of processes in the early universe and cosmological parameters. We can anticipate rapid advance in this field up to and through the year 2000 which will dramatically focus our efforts in cosmology during the next millenium. This paper outlines the primary science likely to be discovered and defined by a vigorous airborne and ground-based program which should be strongly supported. If successfully excuted, we an anticipate a measurement of the CBR anisotropy spectrum to within a factor of two of the confidence level unavoidably set by cosmic variance. Even so, observations of the CBR are the best a...

  17. Natural background radiation in Jordan

    An Airborne Gamma Ray survey has been accomplished for Jordan since 1979. A complete report has been submitted to the Natural Resources Authority along with field and processed data ''digital and analogue''. Natural radioelements concentration is not provided with this report. From the corrected count rate data for each natural radioelement, Concentrations and exposure rates at the ground level were calculated. Contoured maps, showing the exposure rates and the dose rates were created. Both maps reflect the surface geology of Jordan, where the Phosphate areas are very well delineated by high-level contours. In southeastern Jordan the Ordovician sandstone, which contain high percentage of Th (around 2000 ppm in some places) and a moderate percentage of U (about 300 ppm), also show high gamma radiation exposures compared with the surrounding areas. Comparing the values of the exposure rates given in (μR/h) to those obtained from other countries such as United States, Canada, Germany, etc. Jordan shows higher background radiation which reach two folds and even more than those in these countries. More detailed studies should be performed in order to evaluate the radiological risk limits on people who are living in areas of high radiation such that the area of the phosphatic belt which covers a vast area of Jordan high Plateau. (author)

  18. Development of a hardware-based AC microgrid for AC stability assessment

    Swanson, Robert R.

    As more power electronic-based devices enable the development of high-bandwidth AC microgrids, the topic of microgrid power distribution stability has become of increased interest. Recently, researchers have proposed a relatively straightforward method to assess the stability of AC systems based upon the time-constants of sources, the net bus capacitance, and the rate limits of sources. In this research, a focus has been to develop a hardware test system to evaluate AC system stability. As a first step, a time domain model of a two converter microgrid was established in which a three phase inverter acts as a power source and an active rectifier serves as an adjustable constant power AC load. The constant power load can be utilized to create rapid power flow transients to the generating system. As a second step, the inverter and active rectifier were designed using a Smart Power Module IGBT for switching and an embedded microcontroller as a processor for algorithm implementation. The inverter and active rectifier were designed to operate simultaneously using a synchronization signal to ensure each respective local controller operates in a common reference frame. Finally, the physical system was created and initial testing performed to validate the hardware functionality as a variable amplitude and variable frequency AC system.

  19. Supersymmetric Kaluza-Klein reductions of AdS backgrounds

    Figueroa-O'Farrill, J M; Farrill, Jos\\'e Figueroa-O'; Sim\\'on, Joan

    2004-01-01

    This paper contains a classification of smooth Kaluza--Klein reductions (by one-parameter subgroups) of the maximally supersymmetric anti de Sitter backgrounds of supergravity theories. We present a classification of one-parameter subgroups of isometries of anti de Sitter spaces, discuss the causal properties of their orbits on these manifolds, and discuss their action on the space of Killing spinors. We analyse the problem of which quotients admit a spin structure. We then apply these results to write down the list of smooth everywhere spacelike supersymmetric quotients of AdS_3 x S^3 (x R^4), AdS_4 x S^7, AdS_5 x S^5 and AdS_7 x S^4, and the fraction of supersymmetry preserved by each quotient. The results are summarised in tables which should be useful on their own. The paper also includes a discussion of supersymmetry of singular quotients.

  20. Scientific background of the project

    The main objective of the proposed project is the development of radioimmunometric assay(s) for the determination of free and total PSA in serum samples from normal and pathological individuals (BPH, PCa). This will be achieved by: A. Selection of appropriate antibody pairs (capture and labelled antibody) for determination of total PSA (free and complex) and for determination of free PSA. From bibliography we have already spotted some antibody pairs. B. Radiolabelling of antibodies. Several labelling and purification procedures will be followed in order to obtain the required analytical sensitivity and dynamic range of the assays. Special attention will be given to the affinity constant as well as to the stability of the radiolabelled molecules. C. Development of protocols for immobilisation of capture antibodies. We will use several solid support formats (plastic tubes, beads and magnetizable particles). Direct adsorption or covalent binding will be used. Immunoadsorption through immobilised second antibody will be also tested in order to decrease the preparation cost of the solid phase reagents. D. Preparation of standards of suitable purity levels. We will test different PSA-free matrices (Bovine serum, buffer solutions etc.) in order to select the most appropriate among them in terms of low background determination and low reagents cost. E. Optimisation of the immunoassays conditions for the free PSA and total PSA (e.g. assay buffers, incubation time, temperature, one or two step procedure, washings). F. Optimisation and standardisation of assay protocols for kit production. G. Production of kits for distribution in clinical laboratories in Greece for comparison with commercial kits. H. Evaluation of the developed assays in real clinical conditions using well characterised human serum samples. This will be performed in co-operation with the Hellenic Society for Tumor Markers, and other anticancer institutions and hospital clinicians of long standing relation

  1. Measurement of tritium background level in urine of general public

    Tritium is a pure beta particle emitter with a maximum energy of 18.6 keV (mean energy 5.7 keV) and has a physical half-life of 12.3 years. It can be found in nature due to the interaction with cosmic rays in the atmospheric gases and atmospheric nuclear weapon test carried out in the past years. In addition, it is mainly produced by human activities such as heavy water-moderated reactors, nuclear fusion techniques and so on. In case of the workers of NPP, tritium level is high due to the chronical effect by HTO, but it was anticipated that tritium level of the general public, not exposed to tritium source, is low similar to background level. Thus, the verification process of the distillation method for urine samples was performed. When all the measurement condition was the same as real samples, the relative deviation was approximately ± 5% (Table 1). The background tritium level in urine samples of general public was estimated. It was slightly different from overseas survey results because it is supposed that the tritium activity in human body is originated from environmental influence such as food, water, and air. In addition, the effective dose was evaluated with reference of ICRP recommend values. As a result, in normal condition without accident tritium level of urine samples from public was similar to background level.

  2. Angular anisotropy representation by probability tables

    In this paper, we improve point-wise or group-wise angular anisotropy representation by using probability tables. The starting point of this study was to give more flexibility (sensitivity analysis) and more accuracy (ray effect) to group-wise anisotropy representation by Dirac functions, independently introduced at CEA (Mao, 1998) and at IRSN (Le Cocq, 1998) ten years ago. Basing ourselves on our experience of cross-section description, acquired in CALENDF (Sublet et al., 2006), we introduce two kinds of moment based probability tables, Dirac (DPT) and Step-wise (SPT) Probability Tables where the angular probability distribution is respectively represented by Dirac functions or by a step-wise function. First, we show how we can improve equi-probable cosine representation of point-wise anisotropy by using step-wise probability tables. Then we show, by Monte Carlo techniques, how we can obtain a more accurate description of group-wise anisotropy than the one usually given by a finite expansion on a Legendre polynomial basis (that can induce negative values) and finally, we describe it by Dirac probability tables. This study is carried out in the framework of GALILEE project R and D activities (Coste-Delclaux, 2008). (authors)

  3. Analyzing and Mining Ordered Information Tables

    SAI Ying (赛英); Y. Y. Yao

    2003-01-01

    Work in inductive learning has mostly been concentrated on classifying. However,there are many applications in which it is desirable to order rather than to classify instances. For modelling ordering problems, we generalize the notion of information tables to ordered information tables by adding order relations in attribute values. Then we propose a data analysis model by analyzing the dependency of attributes to describe the properties of ordered information tables.The problem of mining ordering rules is formulated as finding association between orderings of attribute values and the overall ordering of objects. An ordering rules may state that "if the value of an object x on an attribute a is ordered ahead of the value of another object y on the same attribute, then x is ordered ahead of y". For mining ordering rules, we first transform an ordered information table into a binary information table, and then apply any standard machine learning and data mining algorithms. As an illustration, we analyze in detail Maclean's universities ranking for the year 2000.

  4. TRANSX-2.15, Neutron Gamma Particle Transport Tables from MATXS Format Cross-Sections

    1 - Description of program or function: TRANSX is a computer code that reads nuclear data from a library in MATXS format and produces transport tables compatible with many discrete-ordinates (SN) and diffusion codes. Tables can be produced for neutron, photon, charged-particle, or coupled transport. Options include adjoint tables, mixtures, homogeneous or heterogeneous self-shielding, group collapse, homogenization, thermal up-scatter, prompt or steady-state fission, transport corrections, elastic removal corrections, and flexible response function edits. 2 - Method of solution: TRANSX reads through the materials in a MATXS library and accumulates the cross sections into a transport table using the user's mix instructions. At the same time, response function edit cross sections are accumulated using the user's edit instructions. They can thus be any linear combination of the cross sections available in the library. When the table is complete, it is written out in the desired format. Output options include DTF-style card images, FIDO, ISOTXS, and the binary group-ordered GOXS format. Self-shielding is handled using the background cross section method. Heterogeneity options include homogeneous mixtures, escape using mean chord, lattices of cylinders by the Bell or Sauer approximations, and reflected or periodic slab cell by the bell or E3 approximations. 3 - Restrictions on the complexity of the problem: Only narrow- resonance self-shielding is available in this version. This may affect accuracy for thermal problems

  5. Implementation of Low Frequency Ac to High Frequency Ac with Single Stage Zvs-Pwm Inverter

    S. Arumugam S. Ramareddy M. Sridhar

    2011-12-01

    Full Text Available This paper presents a novel soft-switching pulse width modulation (PWM utility frequency AC to high frequency (HF AC power conversion circuit incorporating boost-active clamp single stage inverter topology. This power converter is more suitable and acceptable for cost effective HF consumer induction heating applications. Its operating principle is presented. The operating performances of this high frequency inverter using the latest insulated gate bipolar transistors are illustrated, which includes HFAC power regulation ranges and actual efficiency characteristics based on zero voltage soft switching operation ranges.. The simulation circuits are models are developed and they are simulated using ORCAD.

  6. Implementation and Control of an AC/DC/AC Converter for Double Wound Flywheel Application

    Oliveira, J. G.; Schettino, H.; Gama, V; Carvalho, R.; H. Bernhoff

    2012-01-01

    An all-electric driveline based on a double wound flywheel, connected in series between main energy storage and a wheel motor, is presented. The flywheel works as a power buffer, allowing the battery to deliver optimized power. It also separates electrically the system in two sides, with the battery connected to the low voltage side and the wheel motor connected to the high voltage side. This paper presents the implementation and control of the AC/DC/AC converter, used to connect the flywheel...

  7. GRID-CONNECTECD DOUBLE-STAGE AC-AC POWER CONVERTER FOR CSP RENEWABLE ENERGY SYSTEMS

    Sorrentino, Vincenzo

    2015-01-01

    In the last years the renewable energy sources have known a state of their advanced diffusion considering their advantages compared to the traditional energy sources like fossil fuels. For this reason the combined heat and power (CHP) plant fueled by renewable sources are widely used. The purpose of this Ph.D. thesis is the design of a new Grid-connected Double-Stage AC-DC/DC-AC Power Converter (DSACPC) for a Concentrating Solar plant for Combined generation of Heat and Power (CS-CHP), th...

  8. AcEST Contig - AcEST | LSDB Archive [Life Science Database Archive metadata

    Full Text Available [ Credit s ] BLAST Search Image Search Home About Archive Update History Contact us AcEST AcEST C ... c.jp/togodb/view/archive_acestcontig#en Data acquisit ion method - Data analysis method - Number of data ... entries 4,298 entries Data it em Description Contig ID ID of contig sequence of A ... ris Number of clones The number of EST clones constit uting the contig sequence of Adiantum capillus-vene ... ris Definit ion Definit ion Link to clone list In the TogoDB edi ...

  9. Realization of a Direct Soft Switching AC/AC Converter for Wireless Power Transfer Applications

    Vuorsalo, Simo

    2015-01-01

    This thesis describes the design, realization and testing of a three-phase to one-phase direct AC/AC converter, also known as the matrix converter. The switching is using the soft-switching strategy which is also known in the literature as the Zero Current Switching strategy. To achieve ZCS, the circuit needs resonant behavior which is achieved by the transmitter primary side that is an LC circuit. This circuit acts as a tank circuit and the switching frequency is the resonant frequency of th...

  10. Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count

    Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin;

    2007-01-01

    This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled to...... low cost alternative to sensitive applications that need to ride-through frequent input voltage sags. For confirming the converter performance, experimental testing using a constructed laboratory prototype is performed with its captured results presented in a later section of the paper....

  11. Three-Level AC-DC-AC Z-Source Converter Using Reduced Passive Component Count

    Loh, Poh Chiang; Gao, Feng; Tan, Pee-Chin;

    2009-01-01

    This paper presents a three-level ac-dc-ac Z-source converter with output voltage buck-boost capability. The converter is implemented by connecting a low-cost front-end diode rectifier to a neutral-point-clamped inverter through a single X-shaped LC impedance network. The inverter is controlled to...... semiconductor commutations, and hence, no increase in switching losses. The proposed converter therefore offers a low-cost alternative to applications that need to ride through frequent input voltage sags. For confirming the converter performance, experimental testing using a constructed laboratory prototype is...

  12. Volume reduction of dry active waste by use of a waste sorting table at the Brunswick nuclear power plant

    Carolina Power and Light Company's Brunswick nuclear power plant has been using a National Nuclear Corporation Model WST-18 Waste Sorting Table to monitor and sort dry active waste for segregating uncontaminated material as a means of low-level waste volume reduction. The WST-18 features 18 large-area, solid scintillation detectors arranged in a 3 x 6 array underneath a sorting/monitoring surface that is shielded from background radiation. An 11-week study at Brunswick showed that the use of the waste sorting table resulted in dramatic improvements in both productivity (man-hours expended per cubic foot of waste processed) and monitoring quality over the previous hand-probe frisking method. Use of the sorting table since the study has confirmed its effectiveness in volume reduction. The waste sorting table paid for its operation in volume reduction savings alone, without accounting for the additional savings from recovering reusable items

  13. QTL Information Table: 770 [Q-TARO

    Full Text Available qAC-6 Physiological trait Eating quality Amylose content SSR C)Interval DHL Wuyujin...apping quantitative trait loci underlying the cooking and eating quality of rice using a DH population Molecular Breeding 15, 117-124. ...

  14. QTL Information Table: 87 [Q-TARO

    Full Text Available ac6 Physiological trait Eating quality Amylose content SSR C)Interval DHL Zhenshan ...n effects, epistatic effects and environmental interactions of QTLs on the cooking and eating quality of rice in a doubled-haploid line population. Theor Appl Genet 110, 1445-1452. ...

  15. QTL Information Table: 6 [Q-TARO

    Full Text Available Ehd1 Physiological trait Flowering Early heading date CAPS A)Physical BC3F5 Nipponbare T65 AC027 ... a B-type response regulator in rice, confers short-day ... promotion of flowering and controls FT-like gene e ...

  16. QTL Information Table: 45 [Q-TARO

    Full Text Available be1 Others Others Bentazon-sensitivities SSR A)Physical F2 PA64Sm Nov-93 AC084282 RM416 RM3867 p ... K., Zhang, J., Wu, X., Zhu, J., and Tu, J. (2006). Map -based cloning of a novel rice cytochrome P450 gene ...

  17. The TViews Table Role-Playing Game

    Dana Van Devender

    2008-08-01

    Full Text Available The TViews Table Role-Playing Game (TTRPG is a digital tabletop role-playing game that runs on the TViews table, bridging the separate worlds of traditional role-playing games with the growing area of massively multiplayer online role-playing games. The TViews table is an interactive tabletop media platform that can track the location of multiple tagged objects in real-time as they are moved around its surface, providing a simultaneous and coincident graphical display. In this paper we present the implementation of the first version of TTRPG, with a content set based on the traditional Dungeons & Dragons rule-set. We also discuss the results of a user study that used TTRPG to explore the possible social context of digital tabletop role-playing games.

  18. Dicty_cDB: FCL-AC03 [Dicty_cDB

    Full Text Available FCL (Link to library) FCL-AC03 (Link to dictyBase) - - - Contig-U16477-1 FCL-AC03P ...(Link to Original site) FCL-AC03F 538 FCL-AC03Z 570 FCL-AC03P 1108 - - Show FCL-AC03 Library FCL (Link to library) Clone ID FCL-...7-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-AC03Q....Seq.d/ Representative seq. ID FCL-AC03P (Link to Original site) Representative DNA sequence >FCL-AC03 (FCL-AC03Q) /CSM/FCL/FCL-...AC/FCL-AC03Q.Seq.d/ AATTTTTAAAAAAAAAAGAAAATAAAAAAAAAAATAATATTTTATTAGTCATTATAAAAT TGTGAAT

  19. Dicty_cDB: FCL-AC20 [Dicty_cDB

    Full Text Available FCL (Link to library) FCL-AC20 (Link to dictyBase) - - - Contig-U15117-1 FCL-AC20Z ...(Link to Original site) - - FCL-AC20Z 600 - - - - Show FCL-AC20 Library FCL (Link to library) Clone ID FCL-A... http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-AC20Q.Seq.d/ Representative seq. ID FCL-...AC20Z (Link to Original site) Representative DNA sequence >FCL-AC20 (FCL-AC20Q) /CSM/FCL/FCL-AC/FCL-...Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value FCL-AC20 (FCL-AC20Q) /CSM/FCL/FCL-AC/FCL-

  20. Submatrices of character tables and basic sets

    Bessenrodt, Christine; Olsson, Jørn Børling

    2012-01-01

    In this investigation of character tables of nite groups we study basic sets and associated representation theoretic data for complementary sets of conjugacy lasses. For the symmetric groups we nd unexpected properties of characters on restricted sets of conjugacy classes, like beautiful combinat......In this investigation of character tables of nite groups we study basic sets and associated representation theoretic data for complementary sets of conjugacy lasses. For the symmetric groups we nd unexpected properties of characters on restricted sets of conjugacy classes, like beautiful...

  1. Poker game realization on RFID table

    Benko, Tine

    2012-01-01

    In this diploma thesis we presented the development of a poker table for live tournaments, which allows to obtain and to present data about the game on remote displays through RFID technology. We described the dynamics of organization and game flow involved in live poker tournaments. We have found out that it is difficult for organizer to monitor the game flow on a particular table that limits him to presentation of only basic tournament data on the displays. This is why we wanted to establis...

  2. IUPAC Periodic Table Quantum Mechanics Consistent

    Bernard Schaeffer

    2014-01-01

    Most periodic tables of the chemical elements are between 96% and 100% in accord with quantum mechanics. Three elements only do not fit correctly into the official tables, in disagreement with the spherical harmonics and the Pauli exclusion principle. Helium, belonging to the s-block, should be placed beside hydrogen in the s-block instead of the p-block. Lutetium and lawrencium belonging to the d-block of the transition metals should not be in the f-block of the lan...

  3. Inductance calculations working formulas and tables

    Grover, Frederick W

    2009-01-01

    This authoritative compilation of formulas and tables simplifies the design of inductors for electrical engineers. It features a single simple formula for virtually every type of inductor, together with tables from which essential numerical factors may be interpolated. Although compiled in the 1940s, before calculators and computers, this book provides fundamental equations that professionals and practitioners can use to produce algorithms for computer programs and spreadsheets.Starting with a survey of general principles, it explains circuits with straight filaments; parallel elements of equa

  4. Modification and expansion of Mendeleev's periodic table

    The periodic table of the chemical elements has provided guidance for the discovery of many elements since its formulation as a guiding principle 125 years ago. It has misled investigators on occasion into temporary excursions along erroneous routes to new elements. Even these tortuous paths, however, have eventually led to the correct destination. It is described, the part that the periodic table has played in the discovery of the man-made elements, especially the transuranium elements, and its possible future role. (author). 7 refs., 6 figs

  5. A contingency table approach to nonparametric testing

    Rayner, JCW

    2000-01-01

    Most texts on nonparametric techniques concentrate on location and linear-linear (correlation) tests, with less emphasis on dispersion effects and linear-quadratic tests. Tests for higher moment effects are virtually ignored. Using a fresh approach, A Contingency Table Approach to Nonparametric Testing unifies and extends the popular, standard tests by linking them to tests based on models for data that can be presented in contingency tables.This approach unifies popular nonparametric statistical inference and makes the traditional, most commonly performed nonparametric analyses much more comp

  6. An approximation algorithm for counting contingency tables

    Barvinok, Alexander; Luria, Zur; Samorodnitsky, Alex; Yong, Alexander

    2008-01-01

    We present a randomized approximation algorithm for counting contingency tables, mxn non-negative integer matrices with given row sums R=(r_1, ..., r_m) and column sums C=(c_1, ..., c_n). We define smooth margins (R,C) in terms of the typical table and prove that for such margins the algorithm has quasi-polynomial N^{O(ln N)} complexity, where N=r_1+...+r_m=c_1+...+c_n. Various classes of margins are smooth, e.g., when m=O(n), n=O(m) and the ratios between the largest and the smallest row sum...

  7. Thermodynamic tables for nuclear waste isolation

    Tables of consistent thermodynamic property values for nuclear waste isolation are given. The tables include critically assessed values for Gibbs energy of formation, enthalpy of formation, entropy and heat capacity for minerals; solids; aqueous ions; ion pairs and complex ions of selected actinide and fission decay products at 25 degree C and zero ionic strength. These intrinsic data are used to calculate equilibrium constants and standard potentials which are compared with typical experimental measurements and other work. Recommendations for additional research are given. 13 figs., 23 tabs

  8. A Stochastic Analysis of Table Tennis

    Dominicy, Yves; Swan, Yvik

    2011-01-01

    We establish a general formula for the distribution of the score in table tennis. We use this formula to derive the probability distribution (and hence the expectation and variance) of the number of rallies necessary to achieve any given score. We use these findings to investigate the dependence of these quantities on the different parameters involved (number of points needed to win a set, number of consecutive serves, etc.), with particular focus on the rule change imposed in 2001 by the International Table Tennis Federation (ITTF). Finally we briefly indicate how our results can lead to more efficient estimation techniques of individual players' abilities.

  9. Tables of nuclear level density parameters

    The Renormalized Gas Model (RGM) has been used to calculate single particle level density parameters for more than 2000 nucleides over the range 9<=Z<=126 (15<=A<=338). Three separate tables present the elements on or near the valley of beta stability, neutron-rich fission fragment nucleides, and transitional nuclei, actinides and light-mass super heavy elements. Each table identifies the nucleus in terms of Z and N and presents the RGM deformation energy of binding, the total RGM structural energy correction over the free gas Fermi surface, and the level density parameter

  10. Levantamiento del campo acústico de una fuente sonora subacuática en el tanque hidroacústico del Instituto de Acústica

    Ranz Guerra, Carlos; Cobo, Pedro

    2000-01-01

    6 pp.-- PACS nrs.: 43.30.Jx, 43.30.Sf.-- Comunicación presentada en los siguientes congresos: Acústica 2000, II Congreso Iberoamericano de Acústica. XXXI Congreso Nacional de Acústica: TecniAcústica 2000. II Congreso Ibérico de Acústica. II Jornadas Iberoamericanas de Acústica. EAA Symposium on Architectural Acoustics.

  11. An Alternate Graphical Representation of Periodic table of Chemical Elements

    Abubakr, Mohd

    2009-01-01

    Periodic table of chemical elements symbolizes an elegant graphical representation of symmetry at atomic level and provides an overview on arrangement of electrons. It started merely as tabular representation of chemical elements, later got strengthened with quantum mechanical description of atomic structure and recent studies have revealed that periodic table can be formulated using SO(4,2)* SU(2) group. IUPAC, the governing body in Chemistry, doesn't approve any periodic table as a standard periodic table. The only specific recommendation provided by IUPAC is that the periodic table should follow the 1 to 18 group numbering. In this technical paper, we describe a new graphical representation of periodic table, referred as 'Circular form of Periodic table'. The advantages of circular form of periodic table over other representations are discussed along with a brief discussion on history of periodic tables.

  12. ACS6, a Hydrogen sulfide-donating derivative of sildenafil, inhibits homocysteine-induced apoptosis by preservation of mitochondrial function

    Tang Xiao-Qing

    2011-08-01

    Full Text Available Abstract Background The hydrogen sulfide-releasing sildenafil, ACS6, has been demonstrated to inhibit superoxide formation through donating hydrogen sulfide (H2S. We have found that H2S antagonizes homocysteine-induced oxidative stress and neurotoxicity. The aim of the present study is to explore the protection of ACS6 against homocysteine-triggered cytotoxicity and apoptosis and the molecular mechanisms underlying in PC12 cells. Methods Cell viability was determined by Cell Counting Kit-8 assay. Cell apoptosis was observed using the chromatin dye Hoechst 33258 and analyzed by Flow Cytometry after propidium iodide staining. Mitochondrial membrane potential was monitored using the fluorescent dye Rh123. Intracellular reactive oxygen species were determined by oxidative conversion of cell permeable 2',7'-dichlorfluorescein-diacetate to fluorescent 2',7'-dichlorfluorescein. The expression of cleaved caspase-3 and bcl-2 and the accumulation of cytosolic cytochrome c were analyzed by Western blot. Results We show that ACS6 protects PC12 cells against cytotoxicity and apoptosis induced by homocysteine and blocks homocysteine-triggered cytochrome c release and caspase-3 activation. ACS6 treatment results in not only prevention of homocysteine-caused mitochondrial membrane potential (Δψ loss and reactive oxygen species (ROS overproduction but also reversal of Bcl-2 down-expression. Conclusions These results indicate that ACS6 protects PC12 cells against homocysteine-induced cytotoxicity and apoptosis by preservation of mitochondrial function though inhibiting both loss of Δψ and accumulation of ROS as well as modulating the expression of Bcl-2. Our study provides evidence both for a neuroprotective effect of ACS6 and for further evaluation of ACS6 as novel neuroprotectants for Alzheimer's disease associated with homocysteine.

  13. DC injection into low voltage AC networks

    NONE

    2005-07-01

    This report summarises the results of a study investigating the impact of levels of injected DC current injections on a low voltage AC distribution network systems in order to recommend acceptable limits of DC from microgeneration. Relevant literature is reviewed, and the impact of DC levels in distribution transformers, transformer modelling, and instrumental transformers are discussed. The impact of DC in residual current devices (RCD) and in domestic electricity watt hour meters is examined along with DC enhanced corrosion, corrosion failure, and the measurement of DC current injection. Sources of DC injection outlined include DC from computer power supplies, network faults, geomagnetic phenomena, lighting circuits/dimmers, and embedded generators.

  14. Mapa acústico parcial de Benetusser

    MORILLA CASTELLANOS, EMILIO

    2012-01-01

    Se establece el mapa de ruido del municipio de Benetússer para evaluar y conocer su exposición al ruido ambiental y así poder dar cumplimiento a la Directiva Europea sobre Gestión y Evaluación de Ruido Ambiental (2002/49/CE) y a la Ley nacional 37/2003 del Ruido. Los mapas estratégicos de ruido nos aportan la información fundamental para diagnosticar la situación acústica y para la gestión del ruido ambiental.

  15. An ac biased superconducting flux transformer

    The coupled motion of the vortex lattice of two electrically insulated, superimposed, superconducting thin films (primary and secondary) in a perpendicular magnetic field, is predicted to exhibit a Josephson-like behavior. For a dc applied current flowing in the primary film, the voltage difference between the time-averaged primary and secondary flux flow voltages obeys the equations of a resistively shunted junction model. If an ac current is superimposed on the dc current. Shapiro-type steps are predicted in the current-voltage characteristic. In contrast to the conventional Josephson effect, the voltage positions of these steps can be tuned by the applied magnetic field. (orig.)

  16. Flexible AC transmission systems modelling and control

    Zhang, Xiao-Ping; Pal, Bikash

    2012-01-01

    The extended and revised second edition of this successful monograph presents advanced modeling, analysis and control techniques of Flexible AC Transmission Systems (FACTS). The book covers comprehensively a range of power-system control problems: from steady-state voltage and power flow control, to voltage and reactive power control, to voltage stability control, to small signal stability control using FACTS controllers. In the six years since the first edition of the book has been published research on the FACTS has continued to flourish while renewable energy has developed into a mature and

  17. Comparison of the Accuracy and Speed of Transient Mobile A/C System Simulation Models: Preprint

    Kiss, T.; Lustbader, J.

    2014-03-01

    The operation of air conditioning (A/C) systems is a significant contributor to the total amount of fuel used by light- and heavy-duty vehicles. Therefore, continued improvement of the efficiency of these mobile A/C systems is important. Numerical simulation has been used to reduce the system development time and to improve the electronic controls, but numerical models that include highly detailed physics run slower than desired for carrying out vehicle-focused drive cycle-based system optimization. Therefore, faster models are needed even if some accuracy is sacrificed. In this study, a validated model with highly detailed physics, the 'Fully-Detailed' model, and two models with different levels of simplification, the 'Quasi-Transient' and the 'Mapped- Component' models, are compared. The Quasi-Transient model applies some simplifications compared to the Fully-Detailed model to allow faster model execution speeds. The Mapped-Component model is similar to the Quasi-Transient model except instead of detailed flow and heat transfer calculations in the heat exchangers, it uses lookup tables created with the Quasi-Transient model. All three models are set up to represent the same physical A/C system and the same electronic controls. Speed and results of the three model versions are compared for steady state and transient operation. Steady state simulated data are also compared to measured data. The results show that the Quasi-Transient and Mapped-Component models ran much faster than the Fully-Detailed model, on the order of 10- and 100-fold, respectively. They also adequately approach the results of the Fully-Detailed model for steady-state operation, and for drive cycle-based efficiency predictions

  18. Scanning table BIP 101 for bubble chamber pictures

    BIP 101 is a new scanning table for bubble chamber pictures, especially aimed at the full scale projection of the CERN 2m hydrogen chamber. The table itself is divided in two half tables, each of them receiving, successively or simultaneously, the projections of 2 of the 4 films. Projectors with film transport are located in the central space between both half tables. Their light is reflected on 2 mirrors fixed at the ceiling. Thus the 4 sides of the table are freely accessible to the scanners. It will be possible to equip later the table with digitizers, allowing pre-measurements of the events for HPD device, or even measurements. (author)

  19. Image segmentation by background extraction refinements

    Rodriguez, Arturo A.; Mitchell, O. Robert

    1990-01-01

    An image segmentation method refining background extraction in two phases is presented. In the first phase, the method detects homogeneous-background blocks and estimates the local background to be extracted throughout the image. A block is classified homogeneous if its left and right standard deviations are small. The second phase of the method refines background extraction in nonhomogeneous blocks by recomputing the shoulder thresholds. Rules that predict the final background extraction are derived by observing the behavior of successive background statistical measurements in the regions under the presence of dark and/or bright object pixels. Good results are shown for a number of outdoor scenes.

  20. Estudio acústico del Conservatorio de Piles

    VILLA MORANT, SARA

    2014-01-01

    El objetivo de este proyecto es realizar un estudio acústico general de la "Casa de la Cultura" de Piles, sobre todo de los recintos que más lo requieren, como la sala principal de música. El edificio, al tratarse de una construcción antigua, no reúne las especificaciones acústicas establecidas en el Código Técnico vigente en la actualidad. En primer lugar, se realiza el estudio del acondicionamiento acústico de la sala principal, entendiéndose como acondicionamiento acústico la definición de...

  1. AC Own Motion Percentage of Randomly Sampled Cases

    Social Security Administration — Longitudinal report detailing the numbers and percentages of Appeals Council (AC) own motion review actions taken on un-appealed favorable hearing level decisions...

  2. AC electric motors control advanced design techniques and applications

    Giri, Fouad

    2013-01-01

    The complexity of AC motor control lies in the multivariable and nonlinear nature of AC machine dynamics. Recent advancements in control theory now make it possible to deal with long-standing problems in AC motors control. This text expertly draws on these developments to apply a wide range of model-based control designmethods to a variety of AC motors. Contributions from over thirty top researchers explain how modern control design methods can be used to achieve tight speed regulation, optimal energetic efficiency, and operation reliability and safety, by considering online state var

  3. Study of AC electrical conduction mechanisms in an epoxy polymer

    Jilani, Wissal; Mzabi, Nissaf; Gallot-Lavallée, Olivier; Fourati, Najla; Zerrouki, Chouki; Zerrouki, Rachida; Guermazi, Hajer

    2015-11-01

    The AC conductivity of an epoxy resin was investigated in the frequency range 10^{-1} - 106 Hz at temperatures ranging from -100 to 120 °C. The frequency dependence of σ_{ac} was described by the law: σ_{ac}=ω \\varepsilon0\\varepsilon^''_{HN}+Aωs. The study of temperature variation of the exponent (s) reveals two conduction models: the AC conduction dependence upon temperature is governed by the small polaron tunneling mechanism (SPTM) at low temperature (-100 -60 °C) and the correlated barrier hopping (CHB) model at high temperature (80-120 °C).

  4. Djungle power. A more remote AC bus

    Boehnke, Heinz W. [Technosol, Jork (Germany)

    2010-07-01

    The Dzanga-Sangha Reserve in the Central African Republic is probably one of the world's most remote protected rainforest areas, much to the benefit of the rare species of lowland gorilla, forest elephant and local pygmy population Ba'Aka. The park is co-managed by the ''WWF-World Wide Fund for Nature'' with sponsoring from the German Regenwald-Stiftung. In 2008 wwf decided to switch from the old, failing generator supply to a solar hybrid mini-grid, along with stringent measures of energy conservation and management. After a careful energy audit Technosol designed an AC-bus system with a 22 kWp PV generator which should overcome the dependency on the old generators and their fuel demands. For 15 buildings, an entirely new distribution network was installed, state of the art energy saving devices introduced and an energy metering system deviced. The installation is operating since August 2009. In such remote locations, the reliability of the AC-bus over other generator-based solutions will be demonstrated and with the support of international organisations like the wwf the practical application of solar hybrid supply becomes a landmark of sustainable energy concepts. (orig.)

  5. An improved AC-amplifier for electrophysiology

    Jorgovanović Nikola

    2009-01-01

    Full Text Available We present the design, simulation and test results of a new AC amplifier for electrophysiological measurements based on a three op-amp instrumentation amplifier (IA. The design target was to increase the common mode rejection ratio (CMRR, thereby improving the quality of the recorded physiological signals in a noisy environment. The new amplifier actively suppresses the DC component of the differential signal and actively reduces the common mode signal in the first stage of the IA. These functions increase the dynamic range of the amplifier's first stage of the differential signal. The next step was the realization of the amplifier in a single chip technology. The design and tests of the new AC amplifier with a differential gain of 79.2 dB, a CMRR of 130 dB at 50 Hz, a high-pass cutoff frequency at 0.01 Hz and common mode reduction in the first stage of the 49.8 dB are presented in this paper.

  6. Usefulness of Prone Cross-Table Lateral Radiographs in Vertebral Compression Fractures

    Cho, Jae Hwan; Shin, Sang Ik; Lee, Jae Hyup; Yeom, Jin Sup; Chang, Bong-Soon; Lee, Choon-Ki

    2013-01-01

    Background Dynamic radiographs are recommended to investigate non-healing evidence such as the dynamic mobility or intravertebral clefts in osteoporotic vertebral compression fractures (VCFs). However, it is difficult to examine standing flexion and extension lateral radiographs due to severe pain. The use of prone cross-table lateral radiographs (PrLRs) as a diagnostic tool has never been proposed to our knowledge. The purpose of this study is to clarify the usefulness of PrLRs in diagnosis ...

  7. First solar models with OPAS opacity tables

    Pennec, Maëlle Le; Salmon, Sébastien; Blancard, Christophe; Cossé, Philippe; Faussurier, Gérald; Mondet, Guillaume

    2015-01-01

    Stellar seismology appears more and more as a powerful tool for a better determination of the fundamental properties of solar-type stars. However the particular case of Sun is still challenging. The helioseismic sound speed determination continues to disagree with the Standard Solar Model (SSM) prediction for about a decade, questioning the reliability of this model. One of the sources of uncertainty could be in the treatment of the transport of radiation from the solar core to the surface. In this letter, we use the new OPAS opacity tables, recently available for solar modelling, to address this issue. We discuss first the peculiarities of these tables, then we quantify their impact on the solar sound speed and density profiles using the reduced OPAS tables taken on the grids of the OPAL ones. We use the two evolution codes MESA and CLES that led to similar conclusions in the solar radiative zone. In comparison to commonly used OPAL opacity tables, the new solar models computed, for the most recent photosphe...

  8. Education Watch: Achievement Gap Summary Tables.

    Education Trust, Washington, DC.

    These summary tables focus on the state-by-state academic achievement of African American, Hispanic American, American Indian, Asian American, and white students. Data are presented on achievement gains by state (4th grade reading scale scores, 1992-1998; 8th grade science and scale scores, 1996-2000; 4th grade math scale scores, 1992-2000; and…

  9. Water-table altitude of Nevada

    U.S. Geological Survey, Department of the Interior — This is a raster-based, depth to ground-water data set for the State of Nevada. The source of this data set is a statewide water-table contour data set constructed...

  10. Ecological periodic tables for estuarine habitats

    Southwood (1977; J Anim Ecol 46: 337-365) compared the situation in ecology to that in chemistry before the development of the periodic table when each fact, for example, the solubility or reactivity of a chemical element, had to be discovered independently and remembered in isol...

  11. Microbiology and Safety of Table Eggs

    This chapter describes the microbiology of table eggs, effects of processing, regulatory influences, relative risk of egg-borne disease, and the role of retail and consumer practices in outbreaks. Effects of washing, refrigeration, and facility sanitation in US commercial facilities will be describe...

  12. 3D virtual table in anatomy education

    Dahl, Mads Ronald; Simonsen, Eivind Ortind

    The ‘Anatomage’ is a 3D virtual human anatomy table, with touchscreen functionality, where it is possible to upload CT-scans and digital. Learning the human anatomy terminology requires time, a very good memory, anatomy atlas, books and lectures. Learning the 3 dimensional structure, connections...

  13. Symmetry in crystallography understanding the international tables

    Radaelli, Paolo G

    2011-01-01

    A fresh approach to teaching crystallographic symmetry. Rather than being swamped by heavy algebraic notation, the reader is taken through a series of simple and beautiful examples from the visual arts, and taught how to analyse them employing the 'pictorial' diagrams used in the international tables of crystallography.

  14. Table of hyperfine anomaly in atomic systems

    Persson, Jonas R.

    2011-01-01

    This table is a compilation of experimental values of magnetic hyperfine anomaly in atomic and ionic systems. The last extensive compilation was published in 1984 by Buttgenbach (Hyperfine Interactions 20, (1984) p 1) and the aim here is to make an up to date compilation. The literature search covers the period to January 2011.

  15. Continuously moving table MRI in oncology

    Magnetic resonance imaging (MRI) with a continuously moving table (CMT) represents a novel method allowing for the seamless acquisition of an extended field-of-view in the z-direction. One option to realize CMT MRI from a technical point of view is based on very fast sequences like echo planar imaging (EPI). Consequently, table translation for signal sampling and image reconstruction can be neglected. The acquisition of different contrasts, however, necessitates table motion correction, either during acquisition or via post-processing. First clinical studies applying fast steady-state imaging already yielded promising results with respect to metastasis detection. Nevertheless, additional equipment has to be installed for table motion and position tracking. In contrast, the subsequently developed sliding multislice (SMS) technique can be implemented without any additional hardware. In clinical studies, the achievable image quality corresponds to stationary sequences. Additionally, the use of SMS for the detection of pulmonary and abdominal metastases appears to be comparable to computed tomography (CT). Due to the relatively short examination times, CMT MRI can be integrated into highly specialized stationary imaging protocols, thus increasing the possibility to combine local staging with thoracoabdominal metastasis screening within one examination. New contrasts like diffusion-weighted imaging (DWI) or Dixon techniques as well as improved workflow including breathing motion compensation and intuitive scout acquisition have already been proposed and will further expand the clinical applications of this technique. (orig.)

  16. Application of XML to Journal Table Archiving

    Shaya, E. J.; Blackwell, J. H.; Gass, J. E.; Kargatis, V. E.; Schneider, G. L.; Weiland, J. L.; Borne, K. D.; White, R. A.; Cheung, C. Y.

    1998-12-01

    The Astronomical Data Center (ADC) at the NASA Goddard Space Flight Center is a major archive for machine-readable astronomical data tables. Many ADC tables are derived from published journal articles. Article tables are reformatted to be machine-readable and documentation is crafted to facilitate proper reuse by researchers. The recent switch of journals to web based electronic format has resulted in the generation of large amounts of tabular data that could be captured into machine-readable archive format at fairly low cost. The large data flow of the tables from all major North American astronomical journals (a factor of 100 greater than the present rate at the ADC) necessitates the development of rigorous standards for the exchange of data between researchers, publishers, and the archives. We have selected a suitable markup language that can fully describe the large variety of astronomical information contained in ADC tables. The eXtensible Markup Language XML is a powerful internet-ready documentation format for data. It provides a precise and clear data description language that is both machine- and human-readable. It is rapidly becoming the standard format for business and information transactions on the internet and it is an ideal common metadata exchange format. By labelling, or "marking up", all elements of the information content, documents are created that computers can easily parse. An XML archive can easily and automatically be maintained, ingested into standard databases or custom software, and even totally restructured whenever necessary. Structuring astronomical data into XML format will enable efficient and focused search capabilities via off-the-shelf software. The ADC is investigating XML's expanded hyperlinking power to enhance connectivity within the ADC data/metadata and developing XSL display scripts to enhance display of astronomical data. The ADC XML Definition Type Document can be viewed at http://messier.gsfc.nasa.gov/dtdhtml/DTD-TREE.html

  17. Accoustic background of BN-600 steam generator

    In this paper the results of accoustic background for BN-600 steam generator in nominal operating conditions are presented. The 1-200 kHz accoustic background of evaporator and reheater modules are given

  18. Purification of selenium from thorium, uranium, radium, actinium and potassium impurities for low background measurements

    A technique of selenium purification from 232Th, 238U, 226,228Ra, 227Ac and 40K was developed. This technique is simple to perform and employs a minimum number of highly pure reagents (bidistilled water, nitric acid). Operations carried out during purification (elution, evaporation) practically exclude losses of the target product (chemical yields of Se > 99%). A test purification of 100 g of selenium was carried out using this technique. The efficiency of this technique was confirmed by low background gamma spectrometry of the purified selenium sample. Distribution coefficients of Th, U, Ra and Ac on DOWEX 50W- x 8 cation-exchange resin at different concentrations of selenium and nitric acid were experimentally determinated. Instrumental neutron activation analysis of bidistilled water, deionized water and nitric acid was performed. (orig.)

  19. Purification of selenium from thorium, uranium, radium, actinium and potassium impurities for low background measurements

    Rakhimov, A.V. [Joint Institute for Nuclear Research (JINR), Dubna (Russian Federation); Uzbek Academy of Sciences, Tashkent (Uzbekistan). Inst. of Nuclear Physics (INP AS RUz); Warot, G. [CEA-CNRS, Modane (France). Laboratoire Souterrain de Modane (LSM); Karaivanov, D.V. [Joint Institute for Nuclear Research (JINR), Dubna (Russian Federation); Institute for Nuclear Research and Nuclear Energy (INRNE), Sofia (Bulgaria); Kochetov, O.I.; Lebedev, N.A.; Filosofov, D.V. [Joint Institute for Nuclear Research (JINR), Dubna (Russian Federation); Mukhamedshina, N.M.; Sadikov, I.I. [Uzbek Academy of Sciences, Tashkent (Uzbekistan). Inst. of Nuclear Physics (INP AS RUz)

    2013-07-01

    A technique of selenium purification from {sup 232}Th, {sup 238}U, {sup 226,228}Ra, {sup 227}Ac and {sup 40}K was developed. This technique is simple to perform and employs a minimum number of highly pure reagents (bidistilled water, nitric acid). Operations carried out during purification (elution, evaporation) practically exclude losses of the target product (chemical yields of Se > 99%). A test purification of 100 g of selenium was carried out using this technique. The efficiency of this technique was confirmed by low background gamma spectrometry of the purified selenium sample. Distribution coefficients of Th, U, Ra and Ac on DOWEX 50W- x 8 cation-exchange resin at different concentrations of selenium and nitric acid were experimentally determinated. Instrumental neutron activation analysis of bidistilled water, deionized water and nitric acid was performed. (orig.)

  20. Dicty_cDB: FCL-AC29 [Dicty_cDB

    Full Text Available FCL (Link to library) FCL-AC29 (Link to dictyBase) - - - Contig-U15392-1 FCL-AC29P ...(Link to Original site) FCL-AC29F 104 FCL-AC29Z 591 FCL-AC29P 695 - - Show FCL-AC29 Library FCL (Link to library) Clone ID FCL-...-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-AC29Q....Seq.d/ Representative seq. ID FCL-AC29P (Link to Original site) Representative DNA sequence >FCL-AC29 (FCL-AC29Q) /CSM/FCL/FCL-...roducing significant alignments: (bits) Value VSC293 (VSC293Q) /CSM/VS/VSC2-D/VSC293Q.Seq.d/ 1063 0.0 FCL-AC29 (FCL-

  1. From the Mendeleev periodic table to particle physics and back to the periodic table

    Kibler, Maurice R. [Universite de Lyon, Institut de Physique Nucleaire, Universite Lyon 1 and CNRS/IN2P3, 43 Bd du 11 Novembre 1918, F-69622 Villeurbanne Cedex (France)

    2006-11-15

    We briefly describe in this paper the passage from Mendeleev's chemistry (1869) to atomic physics (in the 1900's), nuclear physics (in the 1932's) and particle physics (from 1953 to 2006). We show how the consideration of symmetries, largely used in physics since the end of the 1920's, gave rise to a new format of the periodic table in the 1970's. More specifically, this paper is concerned with the application of the group SO(4,2)xSU(2) to the periodic table of chemical elements. It is shown how the Madelung rule of the atomic shell model can be used for setting up a periodic table that can be further rationalized via the group SO(4,2)xSU(2) and some of its subgroups. Qualitative results are obtained from this nonstandard table. (author)

  2. From the Mendeleev periodic table to particle physics and back to the periodic table

    We briefly describe in this paper the passage from Mendeleev's chemistry (1869) to atomic physics (in the 1900's), nuclear physics (in the 1932's) and particle physics (from 1953 to 2006). We show how the consideration of symmetries, largely used in physics since the end of the 1920's, gave rise to a new format of the periodic table in the 1970's. More specifically, this paper is concerned with the application of the group SO(4,2)xSU(2) to the periodic table of chemical elements. It is shown how the Madelung rule of the atomic shell model can be used for setting up a periodic table that can be further rationalized via the group SO(4,2)xSU(2) and some of its subgroups. Qualitative results are obtained from this nonstandard table. (author)

  3. From the Mendeleev periodic table to particle physics and back to the periodic table

    Kibler, M R

    2006-01-01

    We briefly describe in this paper the passage from Mendeleev's chemistry (1869) to atomic physics (in the 1900's), nuclear physics (in the 1932's) and particle physics (from 1953 to 2006). We show how the consideration of symmetries, largely used in physics since the end of the 1920's, gave rise to a new format of the periodic table in the 1970's. More specifically, this paper is concerned with the application of the group SO(4,2)xSU(2) to the periodic table of chemical elements. It is shown how the Madelung rule of the atomic shell model can be used for setting up a periodic table that can be further rationalized via the group SO(4,2)xSU(2) and some of its subgroups. Qualitative results are obtained from this nonstandard table.

  4. Background subtraction using probabilistic event weights

    Wang, Yadi; Liu, Beijiang; Shen, Xiaoyan; Zhang, Ziping

    2014-01-01

    Background treatment is crucial to extract physics from precision experiments. In this paper, we introduce a novel method to assign each event a signal probability. This could then be used to weight the event's contribution to the likelihood during fitting. To illustrate the effect of this method, we test it with MC samples. The consistence between the constructed background and the background from MC truth shows that the background subtraction method with probabilistic event weights is feasi...

  5. A Non-linear Controller for Single-Phase AC-AC Power Converter to meet UPS Performance Index

    Abdelhafid Ait Elmahjoub

    2012-07-01

    Full Text Available This article focuses on AC-AC power converter that can be used for uninterruptible power supply (UPS. The converter is built on two stages: a AC-DC input stage and a DC-AC output stage. The two blocks are connected by an intermediate DC bus. The aim of control is threefold: i power factor correction ii regulation of DC bus iii generating a sinusoidal voltage at the output. The synthesis of controllers has been achieved through the technique of nonlinear backstepping control. A detailed analysis of the stability control system is presented. The performances of regulators have been validated by numerical simulation in MATLAB / SIMULINK.

  6. Beam-Generated Detector Backgrounds at CESR

    Henderson, Stuart; Cinabro, David

    2000-01-01

    The CESR/CLEO Phase II interaction region is described. The operational experience with beam-generated detector backgrounds is reviewed. The status of our understanding of beam-generated detector backgrounds at CESR is described and comparisons of background measurements with simulation predictions are presented.

  7. On high energy scattering inside gravitational backgrounds

    Nastase, Horatiu

    2004-01-01

    We analyze the high energy scattering inside gravitational backgrounds using 't Hooft's formalism. The scattering is equivalent to geodesic shifts accross Aichelburg-Sexl waves inside the gravitational backgrounds. We find solutions for A-S waves inside various backgrounds and analyze them.

  8. Towards Multi-Threaded Local Tabling Using a Common Table Space

    Areias, Miguel; Rocha, Ricardo

    2012-01-01

    Multi-threading is currently supported by several well-known Prolog systems providing a highly portable solution for applications that can benefit from concurrency. When multi-threading is combined with tabling, we can exploit the power of higher procedural control and declarative semantics. However, despite the availability of both threads and tabling in some Prolog systems, the implementation of these two features implies complex ties to each other and to the underlying engine. Until now, X...

  9. MERIT Code Development for the Generation of Intermediate Resonance Parameters and Resonance Integral Tables

    Resonance treatment is the most important part in the deterministic transport lattice calculation. The conventional resonance treatment requires resonance integrals tabulated as a function of the background cross section (δb) in advance. In the transport lattice calculation, a background cross section is estimated at first, and then the self-shielded resonance cross section can be obtained by looking up a resonance integral (RI) table. This RI table can be prepared by various methods, which include the Bondarenko method, the homogeneous method and the heterogeneous method. These methods are categorized by how to calculate the ultra fine group self shielded fluxes. The third one is the best because it solves the slowing down equation in a heterogeneous geometry. P. H. Kier at Argonne national laboratory developed the RABBLE code and F. Leszczynski at CNEA in Argentina developed RMET21 for this purpose. One of the drawbacks in these codes is that they do not include a module to generate the corresponding δb's. A new transport lattice code LIBERTE has been developed which adopts a subgroup method for a resonance treatment. This subgroup method requires RI tables and intermediate resonance parameters (λ) generated by the heterogeneous method. Therefore, we have developed a new code MERIT (program for Multiregional Effective Resonance Integral Table) to generate RI tables and λ's. This code includes a module to edit ultra fine group (> millions) cross sections with an equal lethargy width, a module to solve the slowing down equation in the homogeneous and 1-D cylindrical geometries by integral transport, a module to calculate the corresponding δb's by the method of characteristics, and a module to calculate λ's

  10. 50 CFR Table 2 to Part 680 - Crab Species Code

    2010-10-01

    ..., Table 2 Table 2 to Part 680—Crab Species Code Species code Common name Scientific name 900 Box... crab Paralithodes platypus. 923 Golden (brown) king crab Lithodes aequispinus. 924 Scarlet king...

  11. Malheur NWR: Initial Survey Instructions for Water Table Depth Survey

    US Fish and Wildlife Service, Department of the Interior — Water table wells assist in filling a critical information gap related to fluctuating water table depth and its influence on habitat expression within wet meadow...

  12. Numerical tables on physical and chemical analyses of Rhine water

    Tables on the places of measurement, the sampling methods and the methods of analysis used. The numerical tables of the measurement results are broken down in general parameters, organic, entrophicating and anorganic substances, orgnic micro-pollutants and radioactivity. (GG)

  13. Ecological periodic tables: Killer apps for translational ecology

    The chemical periodic table, the Linnaean system of classification and the Hertzsprung-Russell diagram are information organizing structures that have transformed chemistry, biology and astronomy, respectively. Ecological periodic tables are information organizing structures wit...

  14. Ecological periodic tables: in principle and practice - January 2013

    The chemical periodic table, the Linnaean system of classification and the Hertzsprung-Russell diagram are iconic information organizing structures in chemistry, biology and astronomy, respectively. Ecological periodic tables are information organizing structures for ecology. T...

  15. NNDSS - Table II. Cryptosporidiosis to Dengue Hemorrhagic Fever

    U.S. Department of Health & Human Services — NNDSS - Table II. Cryptosporidiosis to Dengue Hemorrhagic Fever - 2014. In this Table, all conditions with a 5-year average annual national total of more than or...

  16. NNDSS - Table II. Varicella to West Nile virus disease

    U.S. Department of Health & Human Services — NNDSS - Table II. Varicella to West Nile virus disease - 2014. In this Table, all conditions with a 5-year average annual national total of more than or equals...

  17. NNDSS - Table II. Spotted Fever Rickettsiosis to Syphilis

    U.S. Department of Health & Human Services — NNDSS - Table II. Spotted Fever Rickettsiosis to Syphilis - 2016. In this Table, provisional* cases of selected†notifiable diseases (≥1,000 cases reported...

  18. NNDSS - Table II. Spotted Fever Rickettsiosis to Syphilis

    U.S. Department of Health & Human Services — NNDSS - Table II. Spotted Fever Rickettsiosis to Syphilis - 2015.In this Table, provisional cases of selected notifiable diseases (≥1,000 cases reported during...

  19. NNDSS - Table II. Spotted Fever Rickettsiosis to Syphilis

    U.S. Department of Health & Human Services — NNDSS - Table II. Spotted Fever Rickettsiosis to Syphilis - 2014.In this Table, all conditions with a 5-year average annual national total of more than or equals...

  20. [Intestinal occlusion and abdominal compartment syndrome (ACS)].

    Stagnitti, Franco

    2009-01-01

    Intestinal occlusion is defined as an independent predictive factor of intra-abdominal hypertension (IAH) which represents an independent predictor of mortality. Baggot in 1951 classified patients operated with intestinal occlusion as being at risk for IAH ("abdominal blow-out"), recommending them for open abdomen surgery proposed by Ogilvie. Abdominal surgery provokes IAH in 44.7% of cases with mortality which, in emergency, triples with respect to elective surgery (21.9% vs 6.8%). In particular, IAH is present in 61.2% of ileus and bowel distension and is responsible for 52% of mortality (54.8% in cases with intra-abdominal infection). These patients present with an increasing intra-abdominal pressure (IAP) which, over 20-25 mmHg, triggers an Abdominal Compartment Syndrome (ACS) with altered functions in some organs arriving at Multiple Organ Dysfunction Syndrome (MODS). The intestine normally covers 58% of abdominal volume but when there is ileus distension, intestinal pneumatosis develops (third space) which can occupy up to 90% of the entire cavity. At this moment, Gastro Intestinal Failure (GIF) can appear, which is a specific independent risk factor of mortality, motor of "Organ Failure". The pathophysiological evolution has many factors in 45% of cases: intestinal pneumatosis is associated with mucosal and serous edema, capillary leakage with an increase in extra-cellular volume and peritoneal fluid collections (fourth space). The successive loss of the mucous barrier permits a bacterial translocation which includes bacteria, toxins, pro-inflammatory factors and oxygen free radicals facilitating the passage from an intra-abdominal to inter-systemic vicious cyrcle. IAH provokes the raising of the diaphragm, and vascular and visceral compressions which induce hypertension in the various spaces with compartmental characteristics. These trigger hypertension in the renal, hepatic, pelvic, thoracic, cardiac, intracranial, orbital and lower extremity areas, giving

  1. Scientific Realism and the Periodic Table of Chemical Elements

    Sides, Jonathan David

    2006-01-01

    The periodic table poses a difficulty for both scientific realists and anti-realists. The antirealist has difficulty accounting for the success of the table during a period in chemistry when many theories and concepts changed; the spatial relations of current tables in use do not show fundamental changes from the original tables proposed by Mendeleev. Yet, most versions of scientific realism are based upon the understanding that theories are some collection of written propositi...

  2. Environmental Regulatory Update Table, January/February 1992

    Houlberg, L.M.; Hawkins, G.T.; Salk, M.S.

    1992-03-01

    The Environmental Regulatory Update Table provides information on regulatory initiatives of interest to DOE operations and contractor staff with environmental management responsibilities. The table is updated bi-monthly with information from the Federal Register and other sources, including direct contact with regulatory agencies. Each table entry provides a chronological record of the rulemaking process for that initiative with an abstract and a projection of further action. This table is for January/February 1992.

  3. Visualizing Data Tree-Table Based on the Database

    2001-01-01

    The data tree-table is a type of data structure consisting of data tree and table, which has a wide field ofapplications. The visual and dynamic growing algorithm of data tree-table and its software method are presentedbased on the theory of the data structure and visual technology of software. The method of the expression and man-agement of data tree-table with relational mode are explored.

  4. Bayesian estimation of the orthogonal decomposition of a contingency table

    Ortego Martínez, María Isabel; Egozcue Rubí, Juan José

    2015-01-01

    Contingency tables can be parametrized by probabilities of each cell in a multinomial sampling. These probabilities constitute the joint probability function of the two or more discrete random categorical variables. These probability tables have been previously studied from a compositional point of view. The compositional approach to the problem ensures coherence when analysing contingency sub-tables. The main results are: (1) given a probability table, the closest independent probability tab...

  5. Cooperative Frequency Control for Autonomous AC Microgrids

    Shafiee, Qobad; Quintero, Juan Carlos Vasquez; Guerrero, Josep M.; Nasirian, Vahidreza; Davoudi, Ali

    2015-01-01

    Distributed secondary control strategies have been recently studied for frequency regulation in droop-based AC Microgrids. Unlike centralized secondary control, the distributed one might fail to provide frequency synchronization and proportional active power sharing simultaneously, due to having...... different control parameters. This paper introduces a cooperative algorithm that regulates the system frequency while maintaining the power sharing properties of droop control. Dynamic consensus protocol is used to estimate the average of normalized active powers in the entire MG. This estimation is then...... added to primary control, compensating the frequency drop caused by the droop mechanism. The proposed controller is fully distributed, meaning that each source exchange information with only its direct neighbors through a sparse communication network. This controller has a unique feature that it does...

  6. Mapa Acústico del Gran Madrid

    Santiago Páez, José Salvador; Perera, P

    2006-01-01

    El desarrollo urbanístico de Madrid desde los años 1980 a finales de la década de los 90 hizo que su Ayuntamiento, que ya había promovido la realización entre 1985 y 1991 de un Mapa Acústico parcial de la ciudad, pensase en extender el ámbito de éste a todo el término municipal. Siguiendo el mismo criterio anterior, se superpuso una cuadrícula sobre el plano de Madrid, y se llevaron a cabo registros sonoros de 5 minutos en cada vértice de la misma, en los puntos de medición fuera del área ant...

  7. Josephson arrays for dc and ac metrology

    Large series arrays of underdamped SIS tunnel junctions are the basic element of the primary dc voltage standards used at present. The development of versatile quantum voltmeters for dc and ac metrology requires the preparation of large and perfect series arrays of overdamped Josephson junctions. Overdamped junctions can be realized by externally shunted SIS junctions or by internally shunted SNS or SINIS junctions. Arrays of up to 8000 SINIS junctions or 30000 SNS junctions were successfully operated at the 1 V dc level. In addition to being used in large arrays for voltage metrology and oscillators, the described junction types may become very useful for the preparation of highly integrated single-flux-quantum digital devices. (author)

  8. An ac bridge readout for bolometric detectors

    Rieke, F. M.; Lange, A. E.; Beeman, J. W.; Haller, E. E.

    1989-01-01

    The authors have developed a bolometer readout circuit which greatly improves the low-frequency stability of bolometric detectors. The circuit uses an ac bias voltage and two matched bolometers and allows stable dc bolometer operation for integration times greater than 10 s. In astronomical applications the readout allows for qualitatively different observation modes (e.g. staring or slow-drift scanning) which are particularly well suited for space observations and for the use of arrays. In many applications the readout can increase sensitivity. The authors present noise spectra for 4He temperature bolometers with no excess noise at frequencies greater than 0.1 Hz. The measured optical responsivity of a bolometer operated with the present readout is the same as that of a bolometer operated with a conventional readout.

  9. Composite Based EHV AC Overhead Transmission Lines

    Sørensen, Thomas Kjærsgaard

    Overhead lines at transmission level are the backbone of any national power grid today. New overhead line projects however are at the same time subject to ever greater public resistance due to the lines environmental impact. As full undergrounding of transmission lines at extra high voltage (EHV......) levels are still not seen as possibility, the future expansion of transmission grids are dependent on new solutions with lessened environment impact, especially with regard to the visual impact. In the present Thesis, composite materials and composite based overhead line components are presented and...... analysed with regard to the possibilities, limitations and risks widespread application of composite materials on EHV AC overhead transmission lines may present. To form the basis for evaluation of the useability of composite materials, dierent overhead line projects aimed at reducing the environmental...

  10. Effective ac response in weakly nonlinear composites

    Wei Enbo [Institute of Oceanology, Chinese Academy of Sciences, Qingdao 266071 (China); Yang Zidong [College of Power Engineering, University of Shanghai Science and Technology, Shanghai 200093 (China); Gu Guoqing [Information College of Science and Technology, East China Normal University, Shanghai 200062 (China)

    2004-01-07

    The perturbation method is developed to deal with the problem of determining the effective nonlinear conductivity of Kerr-like nonlinear media under an external ac electric field. As an example, we have considered the cylindrical inclusion embedded in a host under the sinusoidal external field E{sub 1} sin (<{omega}t) + E{sub 3} sin (3<{omega}t) with frequencies{omega} and 3{omega}. The potentials of composites at higher harmonics are derived in both local inclusion particle and host regions. The effective responses of bulk nonlinear composites at basic frequency and harmonics are given for cylindrical composites in the dilute limit. Moreover, the relationships between the nonlinear effective responses at the basic frequency and the third harmonics are derived.

  11. Modeling of long High Voltage AC Underground

    Gudmundsdottir, Unnur Stella; Bak, Claus Leth; Wiechowski, W. T.

    2010-01-01

    This paper presents the work and findings of a PhD project focused on accurate high frequency modelling of long High Voltage AC Underground cables. The project is cooperation between Aalborg University and Energinet.dk. The objective of the project is to investigate the accuracy of most up to date...... cable models, perform highly accurate field measurements for validating the model and identifying possible disadvantages of the cable model. Furthermore the project suggests and implements improvements and validates them against several field measurements. It is shown in this paper how a new method for...... calculating the frequency dependent cables impedance greatly improves the modeling procedure and gives a highly accurate result for high frequency simulations....

  12. Nonlinear ac conductivity of interacting 1d electron systems

    Rosenow, Bernd; Nattermann, Thomas

    2004-01-01

    We consider low energy charge transport in one-dimensional (1d) electron systems with short range interactions under the influence of a random potential. Combining RG and instanton methods, we calculate the nonlinear ac conductivity and discuss the crossover between the nonanalytic field dependence of the electric current at zero frequency and the linear ac conductivity at small electric fields and finite frequency.

  13. Flexible AC transmission systems: the state of the art

    Edris, Abdel-Aty [Electric Power Research Inst., Palo Alto, CA (United States). Electric Systems Division

    1994-12-31

    Flexible AC transmission systems (FACTS) is a concept promoting the use of power electronic controllers to enhance the controllability and usable capacity of AC transmission. This paper presents the state of the art of FACTS and the status of the current projects for the application of the FACTS controllers in transmission systems. (author) 8 refs., 8 figs.

  14. 78 FR 39345 - ACS Wireless, Inc.; Notice of Application

    2013-07-01

    ... will transfer to AWN all remaining tangible and intangible assets owned, leased or held by ACS Wireless.... \\6\\ ACS Group will cause certain of its other subsidiaries to transfer wireless spectrum licenses and...'' as the power to exercise a controlling influence over the management or policies of a company,...

  15. Operation of AC Adapters Visualized Using Light-Emitting Diodes

    Regester, Jeffrey

    2016-01-01

    A bridge rectifier is a diamond-shaped configuration of diodes that serves to convert alternating current(AC) into direct current (DC). In our world of AC outlets and DC electronics, they are ubiquitous. Of course, most bridge rectifiers are built with regular diodes, not the light-emitting variety, because LEDs have a number of disadvantages. For…

  16. Search for β-delayed fission of 228Ac

    Radium was radiochemically separated from natural thorium. Thin 228Ra→β-228Ac sources were prepared and exposed to mica fission track detectors, and measured by an HPGe γ-ray detector. The β-delayed fission events of 228Ac were observed and its β-delayed fission probability was found to be (5±2)x10-12

  17. 40 CFR Table 3 of Subpart Aaaaaaa... - Test Methods

    2010-07-01

    ... 40 Protection of Environment 14 2010-07-01 2010-07-01 false Test Methods 3 Table 3 of Subpart..., Subpt. AAAAAAA, Table 3 Table 3 of Subpart AAAAAAA of Part 63—Test Methods For * * * You must use * * * 1. Selecting the sampling locations a and the number of traverse points EPA test method 1 or 1A...

  18. Environmental Regulatory Update Table, January/February 1995

    Houlberg, L.M.; Hawkins, G.T.; Bock, R.E.; Mayer, S.J.; Salk, M.S.

    1995-03-01

    The Environmental Regulatory Update Table provides information on regulatory initiatives impacting environmental, health, and safety management responsibilities. the table is updated bi-monthly with information from the Federal Register and other sources, including direct contact with regulatory agencies. Each table entry provides a chronological record of the rulemaking process for that initiative with an abstract and a projection of further action.

  19. 40 CFR Table 4 of Subpart Aaaaaaa... - Operating Limits

    2010-07-01

    ... 40 Protection of Environment 14 2010-07-01 2010-07-01 false Operating Limits 4 Table 4 of Subpart..., Subpt. AAAAAAA, Table 4 Table 4 of Subpart AAAAAAA of Part 63—Operating Limits If you comply with the emission limits using * * * You must establish an operating value for * * * And maintain a * * * 1....

  20. 40 CFR Table 2 to Subpart Nnnnn of... - Operating Limits

    2010-07-01

    ... 40 Protection of Environment 14 2010-07-01 2010-07-01 false Operating Limits 2 Table 2 to Subpart..., Table 2 Table 2 to Subpart NNNNN of Part 63—Operating Limits As stated in § 63.9000(b), you must comply with the following operating limits for each emission stream that is part of an affected source that...