WorldWideScience

Sample records for ac amplifiers

  1. Noise reduction in AC-coupled amplifiers

    Serrano Finetti, Roberto Ernesto; Pallàs Areny, Ramon

    2014-01-01

    AC-coupled amplifiers are noisier than dc-coupled amplifiers because of the thermal noise of the resistor(s) in the ac-coupling network and the increased contribution of the amplifier input noise current i(n). Both contributions, however, diminish if the corner frequency f(c) of the high-pass filter observed by the signal is lowered, the cost being a longer transient response. At the same time, the presence of large resistors in the ac-coupling network suggests that the use of FET-input ampli...

  2. An improved AC-amplifier for electrophysiology

    Jorgovanović Nikola

    2009-01-01

    Full Text Available We present the design, simulation and test results of a new AC amplifier for electrophysiological measurements based on a three op-amp instrumentation amplifier (IA. The design target was to increase the common mode rejection ratio (CMRR, thereby improving the quality of the recorded physiological signals in a noisy environment. The new amplifier actively suppresses the DC component of the differential signal and actively reduces the common mode signal in the first stage of the IA. These functions increase the dynamic range of the amplifier's first stage of the differential signal. The next step was the realization of the amplifier in a single chip technology. The design and tests of the new AC amplifier with a differential gain of 79.2 dB, a CMRR of 130 dB at 50 Hz, a high-pass cutoff frequency at 0.01 Hz and common mode reduction in the first stage of the 49.8 dB are presented in this paper.

  3. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    Ljusev, P.; Andersen, Michael A.E.

    2005-07-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration. (au)

  4. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...... will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration....

  5. A low-noise ac-bridge amplifier for ballistocardiogram measurement on an electronic weighing scale

    Ballistocardiography is a non-invasive technique for evaluating cardiovascular health. This note presents an ac-bridge amplifier for low-noise ballistocardiogram (BCG) recording from a modified weighing scale. The strain gauges in a commercial scale were excited by an ac source—square or sine wave—and the differential output voltage resulting from the BCG was amplified and demodulated synchronously with the excitation waveform. A standard BCG amplifier, with a simple dc-bridge excitation, was also built and the performance was compared to both the square- and sine-wave excited ac-bridge amplifiers. The total input-referred voltage noise (rms) integrated over the relevant BCG bandwidth of 0.3–10 Hz was found to be 30 nV (square wave source) or 25 nV (sine-wave source) for the ac-bridge amplifier and 52 nV for the standard amplifier: an improvement of 4.8 dB or 6 dB, respectively. These correspond to input-referred force noise (rms) values of 5 mN, 4 mN and 8.3 mN. The improvement in SNR was also observed in recorded waveforms from a seated subject whose BCG signal was measured with both dc- and ac-bridge circuits. (note)

  6. Design and technological peculiarities of making vacuum integrated circuit of a thermocathode-based AC amplifier

    Grigorishin, I. L.; Kotova, I. F.; Mukhurov, N. I.

    1997-02-01

    Despite promising prospects and comprehensive nature of contemporary studies aimed at developing autoemission cathodes, only thermoemitter-based vacuum integrated circuits (VIC) have been realized by now. Here, the results are presented of building and testing, in extreme environment, thermoemission VICs of a RF active oscillator and multivibrator. The microcircuits made have limited functional capabilities. To expand their capabilities the VIC of an AC amplifier was developed. This paper deals with circuit design aspects of making the AC amplifier based on the potentialities and specific features of the process of anodic oxidation of aluminium to form dielectric substrates of cathode-heating assemblies (CHA) and anode-grid assemblies (AGA). Design and technological methods are described that are used to make active (five vacuum microtriodes) and passive (resistors, capacitors, commutation) film elements. As compared to earlier devices, the AC amplifier VIC is more economical and has better characteristics in terms of miniaturization and integration. Its fundamental peculiarities are two-sided obtained through anodizing to form dielectric substrates with microrelief and superfine-structure grids of microtriodes. Some characteristics of the AC amplifier VIC are given and ways of improving them are discussed.

  7. A post-SQUID ac amplifier aimed for multiplexed detector readouts

    We have built a room temperature amplifier based on Si JFETs (junction field effect transistors) intended for ac-coupled SQUID (superconducting quantum interference device) readouts, such as in frequency-domain multiplexed transition-edge sensor systems. The amplifier operates at 5 MHz centre frequency where it has the measured noise temperature of 27 K for a 60 Ω load, which includes the noise from the active termination and the room temperature transformer. When it was driven from a SQUID with an on-chip matching transformer, flux noise of 0.45 μΦ0 Hz-1/2 was obtained. Additionally, we consider the potential of the recently introduced SiGe bipolar transistors for the same application. The dynamic range considerations for SQUID multiplexers, which require the use of an amplifier with a low noise temperature, are briefly discussed

  8. High power switch mode linear amplifiers for flexible ac transmission system

    Mwinyiwiwa, B.; Wolanski, Z.; Ooi, B.T. [McGill Univ., Montreal, Quebec (Canada). Dept. of Electrical Engineering

    1996-10-01

    The Pulse Width Modulation (PWM) technique has been proposed for the force-commutated Shunt and Series VAR Controllers and Unified Power Flow Controllers in Flexible AC Transmission Systems. The PWM converters can be operated as linear amplifiers of constant gain so that treasure trove of linear control system theory can be brought to bear more easily when applying feedback controls. For example, pole-placement and active filtering have been successfully applied in laboratory models. This paper is written as a tutorial describing the stages of signal processing: modulation, amplification and demodulation, without reference to power electronics since the solid-state switches are modelled as ON-OFF switches.

  9. Single conversion audio amplifier and DC-AC converters with high performance and low complexity control scheme

    Poulsen, Søren; Andersen, Michael Andreas E.

    2004-01-01

    This paper proposes a novel control topology for a mains isolated single conversion audio amplifier and DC-AC converters. The topology is made for use in audio applications, and differs from prior art in terms of significantly reduced distortion as well as lower system complexity. The topology ca...

  10. An AC modulated near infrared gain calibration system for a "Violin-Mode" transimpedance amplifier, intended for advanced LIGO suspensions.

    Lockerbie, N A; Tokmakov, K V

    2016-07-01

    The background to this work was a prototype shadow sensor, which was designed for retro-fitting to an advanced LIGO (Laser Interferometer Gravitational wave Observatory) test-mass/mirror suspension, in which a 40 kg test-mass/mirror is suspended by four approximately 600 mm long by 0.4 mm diameter fused-silica suspension fibres. The shadow sensor comprised a LED source of Near InfraRed (NIR) radiation, and a "tall-thin" rectangular silicon photodiode detector, which together were to bracket the fibre under test. The photodiode was positioned so as to be sensitive (primarily) to transverse "Violin-Mode" vibrations of such a fibre, via the oscillatory movement of the shadow cast by the fibre, as this moved across the face of the detector. In this prototype shadow sensing system the photodiode was interfaced to a purpose-built transimpedance amplifier, this having both AC and DC outputs. A quasi-static calibration was made of the sensor's DC responsivity, i.e., incremental rate of change of output voltage versus fibre position, by slowly scanning a fused-silica fibre sample transversely through the illuminating beam. The work reported here concerns the determination of the sensor's more important AC (Violin-Mode) responsivity. Recognition of the correspondence between direct AC modulation of the source, and actual Violin-Mode signals, and of the transformative role of the AC/DC gain ratio for the amplifier, at any modulation frequency, f, resulted in the construction of the AC/DC calibration source described here. A method for determining in practice the transimpedance AC/DC gain ratio of the photodiode and amplifier, using this source, is illustrated by a specific numerical example, and the gain ratio for the prototype sensing system is reported over the frequency range 1 Hz-300 kHz. In fact, a maximum DC responsivity of 1.26 kV.m(-1) was measured using the prototype photodiode sensor and amplifier discussed here. Therefore, the measured AC/DC transimpedance gain

  11. A chopper current-feedback instrumentation amplifier with a 1 mHz 1/f noise corner and an AC-coupled ripple reduction loop

    Wu, R; Makinwa, K.A.A.; Huijsing, J.H.

    2009-01-01

    This paper presents a chopper instrumentation amplifier for interfacing precision thermistor bridges. For high CMRR and DC gain, the amplifier employs a three-stage current-feedback topology with nested-Miller compensation. By chopping both the input and intermediate stages of the amplifier, a 1 mHz 1/f noise corner was achieved at an input-referred noise power spectral density (PSD) of 15 nV/¿Hz. To reduce chopper ripple, the amplifier employs a continuous-time AC-coupled ripple reduction l...

  12. Fast switching, modular high-voltage DC/AC-power supplies for RF-Amplifiers and other applications

    A new kind of high voltage high-power Pulse-Step Modulator (PSM) for broadcast transmitters, accelerator sources, for NBI (Neutral Beam Injection for Plasma Heating), gyrotrons and klystrons has been developed. Since its first introduction in 1984 for broadcast transmitters, more than 100 high-power sound broadcast transmitters had been equipped with the first generation of the PSM modulators, using Gate Turn-Off Thyristors (GTOs) as switching elements. Recently, due to faster switching elements and making use of the latest DSP technologies (Digital Signal Processing), the performance data and areas of application could be extended further. In 1994, a precision high voltage source for MW gyrotrons was installed at CRPP in Lausanne. Supplementary very low cost solutions for lower powers but high voltages had been developed. Hence, today, a large area of applications can be satisfied with the family of solutions. The paper describes the principle of operation, the related control systems and refers to some particular applications of the PSM amplifiers, especially the newest developments and corresponding field results

  13. A wideband dc-coupled amplifier

    A method is described whereby an ac-coupled high-frequency amplifier and a dc-coupled low-frequency amplifier are connected in parallel in order to obtain a dc-coupled wideband amplifier. By using an operational amplifier which compares the output voltage with the input voltage, the low-frequency amplifier contributes to the overall gain only when the gain of the ac-coupled amplifier droops at low frequencies. Thus, no frequency splitting networks are necessary and the excellent low-frequency features of an operational amplifier are added to those of the ac-coupled wideband amplifier. As an example, a low noise amplifier is described which exhibits a hundredfold gain, a bandwidth from dc to 550 MHz, an input bias current of less than 1 nA, and an output voltage range of ±1 V

  14. Semiconductor DC amplifier AEP 1487

    A semiconductor dc amplifier has been designed with the object of achieving low drift without component selection or special temperature-balancing adjustments. Modulator and ac-amplifier techniques have been adopted in order to avoid the drifts that occur when transistors are directly coupled. The diode-ring modulator described in CREL-902 has been used as the input chopper. (author)

  15. Operational amplifiers

    Dostal, Jiri

    1993-01-01

    This book provides the reader with the practical knowledge necessary to select and use operational amplifier devices. It presents an extensive treatment of applications and a practically oriented, unified theory of operational circuits.Provides the reader with practical knowledge necessary to select and use operational amplifier devices. Presents an extensive treatment of applications and a practically oriented, unified theory of operational circuits

  16. Low cost instrumentation amplifier

    Sturman, J. C.

    1974-01-01

    Amplifier can be used for many applications requiring high input impedance and common mode rejection, low drift, and gain accuracy on order of one percent. Performance of inexpensive amplifier approaches that of some commercial instrumentation amplifiers in many specifications.

  17. Switching-mode Audio Power Amplifiers with Direct Energy Conversion

    Ljusev, Petar; Andersen, Michael Andreas E.

    2005-01-01

    This paper presents a new class of switching-mode audio power amplifiers, which are capable of direct energy conversion from the AC mains to the audio output. They represent an ultimate integration of a switching-mode power supply and a Class D audio power amplifier, where the intermediate DC bus...... component count, volume and cost....

  18. Gain ranging amplifier

    A gain ranging amplifier system is provided for use in the acquisition of data. Voltage offset compensation is utilized to correct errors in the gain ranging amplifier system caused by thermal drift and temperature dependent voltage offsets, both of which are associated with amplifiers in the gain ranging amplifier system

  19. Amplified Quantum Transforms

    Cornwell, David

    2014-01-01

    In this thesis we investigate two new Amplified Quantum Transforms. In particular we create and analyze the Amplified Quantum Fourier Transform (Amplified-QFT) and the Amplified-Haar Wavelet Transform. First, we provide a brief history of quantum mechanics and quantum computing. Second, we examine the Amplified-QFT in detail and compare it against the Quantum Fourier Transform (QFT) and Quantum Hidden Subgroup (QHS) algorithms for solving the Local Period Problem. We calculate the probabiliti...

  20. Portable musical instrument amplifier

    Christian, David E. (Danbury, CT)

    1990-07-24

    The present invention relates to a musical instrument amplifier which is particularly useful for electric guitars. The amplifier has a rigid body for housing both the electronic system for amplifying and processing signals from the guitar and the system's power supply. An input plug connected to and projecting from the body is electrically coupled to the signal amplifying and processing system. When the plug is inserted into an output jack for an electric guitar, the body is rigidly carried by the guitar, and the guitar is operatively connected to the electrical amplifying and signal processing system without use of a loose interconnection cable. The amplifier is provided with an output jack, into which headphones are plugged to receive amplified signals from the guitar. By eliminating the conventional interconnection cable, the amplifier of the present invention can be used by musicians with increased flexibility and greater freedom of movement.

  1. Amplifier for nuclear spectrometry

    The spectroscopy amplifier model AE-020 is designed to adjust suitable the pulses coming from nuclear radiation detectors. Due to is capacity and specifications, the amplifier can be used together with high and medium resolution spectroscopy system

  2. High voltage distributed amplifier

    Willems, D.; Bahl, I.; Wirsing, K.

    1991-12-01

    A high-voltage distributed amplifier implemented in GaAs MMIC technology has demonstrated good circuit performance over at least two octave bandwidth. This technique allows for very broadband amplifier operation with good efficiency in satellite, active-aperture radar, and battery-powered systems. Also, by increasing the number of FETs, the amplifier can be designed to match different voltage rails. The circuit does require a small amount of additional chip size over conventional distributed amplifiers but does not require power dividers or additional matching networks. This circuit configuration should find great use in broadband power amplifier design.

  3. Single conversion stage amplifier - SICAM

    Ljusev, P.

    2005-12-15

    This Ph.D. thesis presents a thorough analysis of the so called SICAM - SIngle Converter stage AMplifier approach to building direct energy conversion audio power amplifiers. The mainstream approach for building isolated audio power amplifiers today consists of isolated DC power supply and Class D amplifier, which essentially represents a two stage solution, where each of the components can be viewed as separate and independent part. The proposed SICAM solution strives for direct energy conversion from the mains to the audio output, by dedicating the operation of the components one to another and integrating their functions, so that the final audio power amplifier represents a single-stage topology with higher efficiency, lower volume, less board space, lower component count and subsequently lower cost. The SICAM approach is both applicable to non-isolated and isolated audio power amplifiers, but the problems encountered in these two cases are different. Non-isolated SICAM solutions are intended for both AC mains-connected and battery-powered devices. In non-isolated mains-connected SICAMs the main idea is to simplify the power supply or even provide integrated power factor correction (PFC) functions, while still maintaining low component stress and good audio performance by generally decreasing the input voltage level to the Class D audio power amplifier. On the other hand, non-isolated battery-powered SICAMs have to cope with the ever changing battery voltage and provide output voltage levels which are both lower and higher than the battery voltage, while still being simple and single-stage energy conversion solutions. In isolated SICAMs the isolation transformer adjusts the voltage level on the secondary side to the desired level, so the main challenges here are decreasing the size of the magnetic core and reducing the number and size of bulky reactive components as much as possible. The main focus of this thesis is directed towards the isolated SICAMs and

  4. Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach it is not...

  5. RF Power Amplifier Analysis

    M. Lokay; K. Pelikan

    1993-01-01

    The special program is presented for the demonstration of RF power transistor amplifiers for the purposes of the high-school education in courses of radio transmitters. The program is written in Turbo Pascal 6. 0 and enables to study the waveforms in selected points of the amplifier and to draw the trajectories of the working point in a plot of output transistor characteristics.

  6. Amplifier improvement circuit

    Sturman, J.

    1968-01-01

    Stable input stage was designed for the use with a integrated circuit operational amplifier to provide improved performance as an instrumentation-type amplifier. The circuit provides high input impedance, stable gain, good common mode rejection, very low drift, and low output impedance.

  7. Semiconductor optical amplifiers

    Dutta, Niloy K

    2013-01-01

    This invaluable look provides a comprehensive treatment of design and applications of semiconductor optical amplifiers (SOA). SOA is an important component for optical communication systems. It has applications as in-line amplifiers and as functional devices in evolving optical networks. The functional applications of SOAs were first studied in the early 1990's, since then the diversity and scope of such applications have been steadily growing. This is the second edition of a book on Semiconductor Optical Amplifiers first published in 2006 by the same authors. Several chapters and sections rep

  8. A broadband dc SQUID based rf amplifier: experimental basics and development concept

    Prokopenko, G.V.; Shitov, S.V.; Mygind, Jesper

    2002-01-01

    We present a concept of a broadband IF amplifier based on experimental results obtained with a dc SQUID rf amplifier (SQA). The frequency range is broadened by using several SQAs, each one tuned to its own central frequency at both input and output; the numerical simulations are presented. A.......(C) 2002 Elsevier Science B.V. All rights reserved....

  9. RF Power Amplifier Analysis

    M. Lokay

    1993-04-01

    Full Text Available The special program is presented for the demonstration of RF power transistor amplifiers for the purposes of the high-school education in courses of radio transmitters. The program is written in Turbo Pascal 6. 0 and enables to study the waveforms in selected points of the amplifier and to draw the trajectories of the working point in a plot of output transistor characteristics.

  10. Noise in Optical Amplifiers

    Jeppesen, Palle

    1997-01-01

    Noise in optical amplifiers is discussed on the basis of photons and electromagntic fields. Formulas for quantum noise from spontaneous emission, signal-spontaneous beat noise and spontaneous-spontaneous beat noise are derived.......Noise in optical amplifiers is discussed on the basis of photons and electromagntic fields. Formulas for quantum noise from spontaneous emission, signal-spontaneous beat noise and spontaneous-spontaneous beat noise are derived....

  11. Charge-sensitive amplifier

    Startsev V. I.; Yampolsky Ju. S.

    2008-01-01

    The authors consider design and circuit design techniques of reduction of the influence of the pyroelectric effect on operation of the charge sensitive amplifiers. The presented experimental results confirm the validity of the measures taken to reduce the impact of pyroelectric currents. Pyroelectric currents are caused by the influence of the temperature gradient on the piezoelectric sensor and on the output voltage of charge sensitive amplifiers.

  12. E-537 MWPC amplifier

    The design of a fast MWPC amplifier for the beam chambers and the absorber chamber is completed and all parts are on order. A prototype 16 channel board has been built and satisfactorily tested. Artwork is completed for the board and out to be photographed. The board fabrication contract has been let. Listed below is a summary of the amplifier characteristics as well as test results obtained with the prototype

  13. Electrospun Amplified Fiber Optics

    Morello, Giovanni; Camposeo, Andrea; Moffa, Maria; Pisignano, Dario

    2015-01-01

    A lot of research is focused on all-optical signal processing, aiming to obtain effective alternatives to existing data transmission platforms. Amplification of light in fiber optics, such as in Erbium-doped fiber amplifiers, is especially important for an efficient signal transmission. However, the complex fabrication methods, involving high-temperature processes performed in highly pure environment, slow down the fabrication and make amplified components expensive with respect to an ideal, ...

  14. A micropower electrocardiogram amplifier.

    Fay, L; Misra, V; Sarpeshkar, R

    2009-10-01

    We introduce an electrocardiogram (EKG) preamplifier with a power consumption of 2.8 muW, 8.1 muVrms input-referred noise, and a common-mode rejection ratio of 90 dB. Compared to previously reported work, this amplifier represents a significant reduction in power with little compromise in signal quality. The improvement in performance may be attributed to many optimizations throughout the design including the use of subthreshold transistor operation to improve noise efficiency, gain-setting capacitors versus resistors, half-rail operation wherever possible, optimal power allocations among amplifier blocks, and the sizing of devices to improve matching and reduce noise. We envision that the micropower amplifier can be used as part of a wireless EKG monitoring system powered by rectified radio-frequency energy or other forms of energy harvesting like body vibration and body heat. PMID:23853270

  15. A vircator amplifier

    A cavity vircator has demonstrated that formation of a virtual cathode in a cavity can improve microwave production efficiency and narrow the radiation bandwidth. When the virtual cathode radiates the microwave fields grow from noise. For each cavity, there is only one or a limited number of allowable modes for a given frequency. In this paper, a novel device - a vircator amplifier is described. The device consists of a relativistic magnetron and a cavity vircator with both devices powered by a 1 MeV, 3 Ω, 65 ns FWHM pulser. The idea is to inject a signal from the magnetron before and during virtual cathode formation in a cavity. The injected signal should lock the frequency and enhance electron bunching and therefore improve efficiency further. Experiments underway to evaluate the amplifier operating characteristics are discussed. The applicability of vircator amplifiers to the next generation of high-power microwave devices are addressed

  16. STABILIZED TRANSISTOR AMPLIFIER

    Noe, J.B.

    1963-05-01

    A temperature stabilized transistor amplifier having a pair of transistors coupled in cascade relation that are capable of providing amplification through a temperature range of - 100 un. Concent 85% F to 400 un. Concent 85% F described. The stabilization of the amplifier is attained by coupling a feedback signal taken from the emitter of second transistor at a junction between two serially arranged biasing resistances in the circuit of the emitter of the second transistor to the base of the first transistor. Thus, a change in the emitter current of the second transistor is automatically corrected by the feedback adjustment of the base-emitter potential of the first transistor and by a corresponding change in the base-emitter potential of the second transistor. (AEC)

  17. Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

    Ljusev, P.; Andersen, Michael A.E.

    2005-07-01

    This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach it is not required to do any measurements, thus making it more reliable. Initial testing made on the prototype prove the feasibility of the approach. (au)

  18. Principal modes in fiber amplifiers

    Fridman, Moti; Dubinskii, Mark; Friesem, Asher A; Davidson, Nir

    2010-01-01

    The dynamics of the state of polarization in single mode and multimode fiber amplifiers are presented. The experimental results reveal that although the state of polarizations at the output can vary over a large range when changing the temperatures of the fiber amplifiers, the variations are significantly reduced when resorting to the principal states of polarization in single mode fiber amplifiers and principal modes in multimode fiber amplifiers.

  19. Helical Fiber Amplifier

    Koplow, Jeffrey P.; Kliner, Dahy; Goldberg, Lew

    2002-12-17

    A multi-mode gain fiber is provided which affords substantial improvements in the maximum pulse energy, peak power handling capabilities, average output power, and/or pumping efficiency of fiber amplifier and laser sources while maintaining good beam quality (comparable to that of a conventional single-mode fiber source). These benefits are realized by coiling the multimode gain fiber to induce significant bend loss for all but the lowest-order mode(s).

  20. Radio Frequency Solid State Amplifiers

    Jacob, J

    2015-01-01

    Solid state amplifiers are being increasingly used instead of electronic vacuum tubes to feed accelerating cavities with radio frequency power in the 100 kW range. Power is obtained from the combination of hundreds of transistor amplifier modules. This paper summarizes a one hour lecture on solid state amplifiers for accelerator applications.

  1. Electronic amplifiers for automatic compensators

    Polonnikov, D Ye

    1965-01-01

    Electronic Amplifiers for Automatic Compensators presents the design and operation of electronic amplifiers for use in automatic control and measuring systems. This book is composed of eight chapters that consider the problems of constructing input and output circuits of amplifiers, suppression of interference and ensuring high sensitivity.This work begins with a survey of the operating principles of electronic amplifiers in automatic compensator systems. The succeeding chapters deal with circuit selection and the calculation and determination of the principal characteristics of amplifiers, as

  2. Simplified design of IC amplifiers

    Lenk, John

    1996-01-01

    Simplified Design of IC Amplifiers has something for everyone involved in electronics. No matter what skill level, this book shows how to design and experiment with IC amplifiers. For experimenters, students, and serious hobbyists, this book provides sufficient information to design and build IC amplifier circuits from 'scratch'. For working engineers who design amplifier circuits or select IC amplifiers, the book provides a variety of circuit configurations to make designing easier.Provides basics for all phases of practical design.Covers the most popular forms for amplif

  3. Building valve amplifiers

    Jones, Morgan

    2013-01-01

    Building Valve Amplifiers is a unique hands-on guide for anyone working with tube audio equipment--as an electronics hobbyist, audiophile or audio engineer. This 2nd Edition builds on the success of the first with technology and technique revisions throughout and, significantly, a major new self-build project, worked through step-by-step, which puts into practice the principles and techniques introduced throughout the book. Particular attention has been paid to answering questions commonly asked by newcomers to the world of the valve, whether audio enthusiasts tackling their first build or

  4. Wideband amplifier design

    Hollister, Allen L

    2007-01-01

    In this book, the theory needed to understand wideband amplifier design using the simplest models possible will be developed. This theory will be used to develop algebraic equations that describe particular circuits used in high frequency design so that the reader develops a ""gut level"" understanding of the process and circuit. SPICE and Genesys simulations will be performed to show the accuracy of the algebraic models. By looking at differences between the algebraic equations and the simulations, new algebraic models will be developed that include parameters originally left out of the model

  5. REGENERATIVE TRANSISTOR AMPLIFIER

    Kabell, L.J.

    1958-11-25

    Electrical circults for use in computers and the like are described. particularly a regenerative bistable transistor amplifler which is iurned on by a clock signal when an information signal permits and is turned off by the clock signal. The amplifier porforms the above function with reduced power requirements for the clock signal and circuit operation. The power requirements are reduced in one way by employing transformer coupling which increases the collector circuit efficiency by eliminating the loss of power in the collector load resistor.

  6. Quantum entanglement degrees amplifier

    Wu, Xiang-Yao; Liu, Xiao-Jing; Liang, Yu; Meng, Xiang-Dong; Li, Hong; Zhang, Si-Qi

    2015-01-01

    The quantum entangled degrees of entangled states become smaller with the transmission distance increasing, how to keep the purity of quantum entangled states is the puzzle in quantum communication. In the paper, we have designed a new type entanglement degrees amplifier by one-dimensional photonic crystal, which is similar as the relay station of classical electromagnetic communication. We find when the entangled states of two-photon and three-photon pass through photonic crystal, their entanglement degrees can be magnified, which make the entanglement states can be long range propagation and the quantum communication can be really realized.

  7. DIAMOND AMPLIFIED PHOTOCATHODES.

    SMEDLEY,J.; BEN-ZVI, I.; BOHON, J.; CHANG, X.; GROVER, R.; ISAKOVIC, A.; RAO, T.; WU, Q.

    2007-11-26

    High-average-current linear electron accelerators require photoinjectors capable of delivering tens to hundreds of mA average current, with peak currents of hundreds of amps. Standard photocathodes face significant challenges in meeting these requirements, and often have short operational lifetimes in an accelerator environment. We report on recent progress toward development of secondary emission amplifiers for photocathodes, which are intended to increase the achievable average current while protecting the cathode from the accelerator. The amplifier is a thin diamond wafer which converts energetic (few keV) primary electrons into hundreds of electron-hole pairs via secondary electron emission. The electrons drift through the diamond under an external bias and are emitted into vacuum via a hydrogen-terminated surface with negative electron affinity (NEA). Secondary emission gain of over 200 has been achieved. Two methods of patterning diamond, laser ablation and reactive-ion etching (RIE), are being developed to produce the required geometry. A variety of diagnostic techniques, including FTIR, SEM and AFM, have been used to characterize the diamonds.

  8. Universal Signal Conditioning Amplifier

    Kinney, Frank

    1997-01-01

    The Technological Research and Development Authority (TRDA) and NASA-KSC entered into a cooperative agreement in March of 1994 to achieve the utilization and commercialization of a technology development for benefiting both the Space Program and U.S. industry on a "dual-use basis". The technology involved in this transfer is a new, unique Universal Conditioning Amplifier (USCA) used in connection with various types of transducers. The project was initiated in partnership with I-Net Corporation, Lockheed Martin Telemetry & Instrumentation (formerly Loral Test and Information Systems) and Brevard Community College. The project consists of designing, miniaturizing, manufacturing, and testing an existing prototype of USCA that was developed for NASA-KSC by the I-Net Corporation. The USCA is a rugged and field-installable self (or remotely)- programmable amplifier that works in combination with a tag random access memory (RAM) attached to various types of transducers. This summary report comprises performance evaluations, TRDA partnership tasks, a project summary, project milestones and results.

  9. A fast large dynamic range shaping amplifier for particle detector front-end

    Rivetti, Angelo; Delaurenti, Paolo

    2007-03-01

    The paper describes a fast shaping amplifier with rail-to-rail output swing. The circuit is based on a CMOS operational amplifier with a class AB output stage. A baseline holder, incorporating a closed-loop unity gain buffer with slew rate limitation, performs the AC coupling with the preamplifier and guarantees a baseline shift smaller than 3 mV for unipolar output pulses of 3 V and 10 MHz rate.

  10. A fast large dynamic range shaping amplifier for particle detector front-end

    The paper describes a fast shaping amplifier with rail-to-rail output swing. The circuit is based on a CMOS operational amplifier with a class AB output stage. A baseline holder, incorporating a closed-loop unity gain buffer with slew rate limitation, performs the AC coupling with the preamplifier and guarantees a baseline shift smaller than 3 mV for unipolar output pulses of 3 V and 10 MHz rate

  11. Water calorimetry with thermistor bridge operated in DC and AC mode: comparative results

    Guerra, A.S.; Laitano, R.F.; Petrocchi, A. [Ist. Nazionale di Metrologia delle Radiazioni Ionizzanti, ENEA, Roma (Italy)

    1997-09-01

    An experimental study was carried out to find out the optimal conditions for measuring the output signal in a water calorimeter. To this end the thermistor bridge of the calorimeter was operated in AC and in DC mode, respectively. A comparative analysis of these two alternative methods was the made. In the AC mode measurement a lock-in amplifier based experimental assembly was used and compared to the more conventional system based on a high-sensitivty DC amplifier. The AC system resulted to be preferable as far as the short term and long term reproducibility is concerned. (orig.)

  12. Water calorimetry with thermistor bridge operated in DC and AC mode: comparative results

    An experimental study was carried out to find out the optimal conditions for measuring the output signal in a water calorimeter. To this end the thermistor bridge of the calorimeter was operated in AC and in DC mode, respectively. A comparative analysis of these two alternative methods was the made. In the AC mode measurement a lock-in amplifier based experimental assembly was used and compared to the more conventional system based on a high-sensitivty DC amplifier. The AC system resulted to be preferable as far as the short term and long term reproducibility is concerned. (orig.)

  13. Characterisation Of Low Noise Amplifier

    MAULIK B.PATEL; ABHISEK CHOBEY; SUNIL B.PATEL

    2012-01-01

    Amplification is one of the most basic and prevalent microwave circuit functions inmodern RF and microwave systems. Early microwave amplifiers relied on tubes, such asklystrons and traveling-wave tubes, or solid-state reflection amplifiers based on thenegative resistance characteristics of tunnel or varactor diodes. But due to the dramaticimprovements and innovations in solid-state technology that have occurred since the1970s, most RF and microwave amplifiers today use transistor devices such...

  14. Modeling of semiconductor optical amplifiers

    Mørk, Jesper; Bischoff, Svend; Berg, Tommy Winther;

    We discuss the modelling of semiconductor optical amplifiers with emphasis on their high-speed properties. Applications in linear amplification as well as ultrafast optical signal processing are reviewed. Finally, the possible role of quantum-dot based optical amplifiers is discussed.......We discuss the modelling of semiconductor optical amplifiers with emphasis on their high-speed properties. Applications in linear amplification as well as ultrafast optical signal processing are reviewed. Finally, the possible role of quantum-dot based optical amplifiers is discussed....

  15. Amplified leak detection

    Mahony, James

    2011-12-15

    Leaks are one of the major concerns for oil and gas producers. But recently, a Calgary-based company developed a tool that can find natural gas leaks in wellbores. This has relieved the oil and gas producers because the optics of finding downhole leaks just got a little brighter. Since then, there have been continuous efforts to broaden and refine fiber optics based methods. This paper presents amplified leak detection using fiber optics to identify even the smallest liquid leaks downhole. At high volumes, detection of downhole leaks in liquids is not a problem but at lower flow rates, the leaks become harder to detect, and at very low flow rates, they might not be detected at all. Hifi Engineering Inc. has developed the LeakSonar fiber optic acoustic sensor array that is specifically designed to detect and locate fluid migration in wellbores, even through multiple strings of casing.

  16. Metatronic transistor amplifier

    Chettiar, Uday K.; Engheta, Nader

    2015-10-01

    Utilizing the notion of metamaterials, in recent years the concept of a circuit and lumped circuit elements have been extended to the optical domains, providing the paradigm of optical metatronics, i.e., metamaterial-inspired optical nanocircuitry, as a powerful tool for design and study of more complex systems at the nanoscale. In this paper we present a design for a new metatronic element, namely, a metatronic transistor that functions as an amplifier. As shown by our analytical and numerical paper here, this metatronic transistor provides gain as well as isolation between the input and output ports of such two-port device. The cascadability and fan-out aspects of this element are also explored.

  17. ACAC Converters for UPS

    Rusalin Lucian R. Păun

    2008-05-01

    Full Text Available This paper propose a new control technique forsingle – phase ACAC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.

  18. A Low-Drift Solid-State d.c. Amplifier

    This paper describes a solid-state d.c. amplifier developed for low-level current measurement and discusses the design of this system consisting of a parametric modulator, a carrier oscillator, an a.c. amplifier, a demodulator, and an output amplifier. The parametric modulator employing silicon diodes is suitable for amplification of low -level d.c. current, since the input resistance is generally high and the conversion noise is small; In this system, base-emitter junctions of silicon planer transistors are used as parametric diodes, and the modulating frequency and amplitude chosen are 100 kc/s and 100 mV. A conversion gain of this modulator is about 90 dB in current. A crystal oscillator is employed for carrier generation. The a.c. amplifier consists of a directly-coupled a.c. amplifier whose transfer impedance is 1 x 108 Ω, a band-pass amplifier whose voltage gain is about 50 dB, and an emitter follower circuit. A normally connected transistor chopper as the demodulator is followed by a direct-coupled amplifier of low-output impedance hiving gain of 30 dB in order to provide wide dynamic range. Over-all d. c. negative feedback is provided by the feedback resistor. The complete system gives an open-loop transfer impedance of 3 x 1016 Ω and maximum output of ± 15 V. Current drift and voltage drift referred to input are less than 1 x 10-15 A and 0.2 mV respectively in the range of 10 - 35°C, and fluctuation or short-term drift is less than 2 x 10-16 A. This d.c. amplifier can be applied to the picoammeter, the log-N amplifier and various other scientific instruments. (author)

  19. Circuits for differential signal extraction in the lock-in amplifiers

    Baranov, P.; Bukrina, T.

    2014-10-01

    Confirmation of the metrological characteristics of measuring transducers provides maximum accuracy of the method of comparison with the standard instrument. Practical application of this technique is impossible without accurate instruments. As a measurement instrument to ensure the resolution of the order of several nanovolts when comparing two AC signals over a wide dynamic range, widely used lock-in amplifier with a differential input. The paper presents the results of the analysis of circuits based on operational amplifiers for comparing two signals and extraction differential signal in lock-in amplifier with a differential input. Common-mode rejection ratio for each of the circuits was estimated.

  20. Small signal microwave amplifier design

    Grosch, Theodore

    2000-01-01

    This book explains techniques and examples for designing stable amplifiers for high-frequency applications in which the signal is small and the amplifier circuit is linear. An in-depth discussion of linear network theory provides the foundation needed to develop actual designs. Examples throughout the book will show you how to apply the knowledge gained in each chapter leading to the complex design of low noise amplifiers. Many exercises at the end of each chapter will help students to practice their skills. The solutions to these design problems are available in an accompanying solutions book

  1. International Standardization Activities for Optical Amplifiers

    Haruo Okamura

    2003-01-01

    International standardization activities for Optical Amplifiers at IECTC86 and ITU-T SG15 are reviewed. Current discussions include Optical Amplifier safety guideline, Reliability standard, Rest methods of Noise and PMD, Definitions of Raman amplifier parameters and OA classification.

  2. AC power supply systems

    An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)

  3. A Transformer Class E Amplifier

    Mikolajewski Miroslaw

    2014-12-01

    Full Text Available In a high-efficiency Class E ZVS resonant amplifier a matching and isolation transformer can replace some or even all inductive components of the amplifier thus simplifying the circuit and reducing its cost. In the paper a theoretical analysis, a design example and its experimental verification for a transformer Class E amplifier are presented. In the experimental amplifier with a transformer as the only inductive component in the circuit high efficiency ηMAX = 0.95 was achieved for supply voltage VI = 36 V, maximum output power POMAX = 100 W and the switching frequency f = 300 kHz. Measured parameters and waveforms showed a good agreement with theoretical predictions. Moreover, the relative bandwidth of the switching frequency was only 19% to obtain output power control from 4.8 W to POMAX with efficiency not less than 0.9 in the regulation range.

  4. TARC: Carlo Rubbia's Energy Amplifier

    Laurent Guiraud

    1997-01-01

    Transmutation by Adiabatic Resonance Crossing (TARC) is Carlo Rubbia's energy amplifier. This CERN experiment demonstrated that long-lived fission fragments, such as 99-TC, can be efficiently destroyed.

  5. New Packaging for Amplifier Slabs

    Riley, M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Thorsness, C. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Suratwala, T. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Steele, R. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Rogowski, G. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2015-03-18

    The following memo provides a discussion and detailed procedure for a new finished amplifier slab shipping and storage container. The new package is designed to maintain an environment of <5% RH to minimize weathering.

  6. Development of three channel linear bipolar high voltage amplifier (±2 KV) for electrostatic steerer

    Electrostatic steerers and scanners are planned for low energy ion beam facilities at IUAC to steer and scan the ion beam on target. The power supplies for electrostatic steerers are high voltage bipolar DC amplifiers and for scanners are bipolar AC amplifiers. To fulfil the requirements a common unit has been designed and assembled for AC and DC applications. It can be used with electrostatic devices in scanning, steering and sweeping of low energy ion beams at high frequencies to attain uniform implantation. The unit consist of three independent limited bandwidth high voltage, linear bipolar amplifiers (for X-axis, Y-axis and Y1-dog leg plates). The unit has been provided with both local and remote control. (author)

  7. Transistor oscillator and amplifier grids

    Weikle, Robert M., II; Kim, Moonil; Hacker, Jonathan B.; De Lisio, Michael P.; Popvić, Zoya B.; Rutledge, David B.

    1992-01-01

    Although quasi-optical techniques are applicable to a large variety of solid-state devices, special attention is given to transistors, which are attractive because they can be used as either amplifiers or oscillators. Experimental results for MESFET bar-grid and planar grid oscillators are presented. A MESFET grid amplifier that receives only vertically polarized waves at the input and radiates horizontally polarized waves at the output is discussed. These planar grids can be scaled for opera...

  8. A KIND OF NEW AMPLIFIER

    YIN XUN-HE; FENG RU-PENG; REN YONG

    2000-01-01

    Chaotic characteristics in the iteration of logistic map (one-dimensional discrete dynamic system) are simulatedand analyzed. The circuit implementation of a kind of chaotic amplifier model is based on the chaotic characteristicsthat chaos is sensitively dependent on its initial conditions, and the circuit simulation result is given using simulationprogram with integrated circuit emphasis for personal computer (PSPICE), and is compared with linear amplifier.Advantages and disadvantages of such a model are indicated.

  9. Casimir force on amplifying bodies

    Sambale, Agnes; Welsch, Dirk-Gunnar; Buhmann, Stefan Yoshi; Dung, Ho Trung

    2009-01-01

    Based on a unified approach to macroscopic QED that allows for the inclusion of amplification in a limited space and frequency range, we study the Casimir force as a Lorentz force on an arbitrary partially amplifying system of linearly locally responding (isotropic) magnetoelectric bodies. We demonstrate that the force on a weakly polarisable/magnetisable amplifying object in the presence of a purely absorbing environment can be expressed as a sum over the Casimir--Polder forces on the excite...

  10. AcEST: DK950971 [AcEST

    Full Text Available optera acutorost... 37 0.66 tr|B1ACS6|B1ACS6_BALBN DMP1 (Fragment) OS=Balaenoptera ...bonaerens... 37 0.66 tr|B1ACS5|B1ACS5_BALED DMP1 (Fragment) OS=Balaenoptera edeni... GN=... 37 0.66 tr|B1ACS4|B1ACS4_BALBO DMP1 (Fragment) OS=Balaenoptera borealis ... 37 0.66 tr|B1ACS3|B1ACS3..._BALMU DMP1 (Fragment) OS=Balaenoptera musculus ... 37 0.86 tr|B1ACS1|B1ACS1_MEGNO DMP1 (Fragment) OS=Megapt...1ACS2_BALPH DMP1 (Fragment) OS=Balaenoptera physalus ... 37 1.1 tr|B1ACT6|B1ACT6_MESPE DMP1 (Fragment) OS=Me

  11. Computer Aided Design and Analysis of a 2-4 GHz Broadband Balanced Microstrip Amplifier

    S. H. Ibrahim

    2012-07-01

    Full Text Available In this paper, a computer-aided design and analysis of a 2-4 GHz broadband balanced microstrip amplifier using a full computer simulation program developed by the author and others is presented. A short and efficient CAD procedure for broadband amplifier design is introduced. The first step is to design an initial narrow-band high gain microstrip amplifier at 3-GHz central frequency. The second step is to optimize the initial lengths and widths of the input and output microstrip-matching circuits to get the broadband amplifier over the range 2-4 GHz. The analysis of both narrow and broadband amplifiers is investigated. In addition, with the design and analysis of a low-pass microstrip filter, the paper introduces the design and analysis of a Lange coupler. The final AC schematic diagram of the designed amplifier with the lengths and widths of microstrip lines is presented.Key Words: Computer-Aided Design and Analysis, Microstrip Amplifier, Microwave Amplifier.

  12. AC1 Wing

    Adrian DOBRE

    2010-03-01

    Full Text Available The AC1 wing replaces the old wing of the wind tunnel model AEROTAXI, which has been made at scale 1:9. The new wing is part of CESAR program and improves the aerodynamic characteristics of the old one. The geometry of the whole wing was given by FOI Sweden and position of AC1 wing must coincide with the structure of the AEROTAXI model.

  13. AC1 Wing

    Adrian DOBRE

    2010-01-01

    The AC1 wing replaces the old wing of the wind tunnel model AEROTAXI, which has been made at scale 1:9. The new wing is part of CESAR program and improves the aerodynamic characteristics of the old one. The geometry of the whole wing was given by FOI Sweden and position of AC1 wing must coincide with the structure of the AEROTAXI model.

  14. Low-Noise Band-Pass Amplifier

    Kleinberg, L.

    1982-01-01

    Circuit uses standard components to overcome common limitation of JFET amplifiers. Low-noise band-pass amplifier employs JFET and operational amplifier. High gain and band-pass characteristics are achieved with suitable choice of resistances and capacitances. Circuit should find use as low-noise amplifier, for example as first stage instrumentation systems.

  15. EMI-resilient amplifier circuits

    van der Horst, Marcel J; Linnenbank, André C

    2014-01-01

    This book enables circuit designers to reduce the errors introduced by the fundamental limitations and electromagnetic interference (EMI) in negative-feedback amplifiers.  The authors describe a systematic design approach for application specific negative-feedback amplifiers, with specified signal-to-error ratio (SER).  This approach enables designers to calculate noise, bandwidth, EMI, and the required bias parameters of the transistors used in  application specific amplifiers in order to meet the SER requirements.   ·         Describes design methods that incorporate electromagnetic interference (EMI) in the design of application specific negative-feedback amplifiers; ·         Provides designers with a structured methodology to avoid the use of trial and error in meeting signal-to-error ratio (SER) requirements; ·         Equips designers to increase EMI immunity of the amplifier itself, thus avoiding filtering at the input, reducing the number of components and avoiding detr...

  16. Spectroscopic amplifier for pin diode

    The photodiode remains the basic choice for the photo-detection and is widely used in optical communications, medical diagnostics and field of corpuscular radiation. In detecting radiation it has been used for monitoring radon and its progeny and inexpensive spectrometric systems. The development of a spectroscopic amplifier for Pin diode is presented which has the following characteristics: canceler Pole-Zero (P/Z) with a time constant of 8 μs; constant gain of 57, suitable for the acquisition system; 4th integrator Gaussian order to waveform change of exponential input to semi-Gaussian output and finally a stage of baseline restorer which prevents Dc signal contribution to the next stage. The operational amplifier used is the TLE2074 of BiFET technology of Texas Instruments with 10 MHz bandwidth, 25 V/μs of slew rate and a noise floor of 17 nv/(Hz)1/2. The integrated circuit has 4 operational amplifiers and in is contained the total of spectroscopic amplifier that is the goal of electronic design. The results show like the exponential input signal is converted to semi-Gaussian, modifying only the amplitude according to the specifications in the design. The total system is formed by the detector, which is the Pin diode, a sensitive preamplifier to the load, the spectroscopic amplifier that is what is presented and finally a pulse height analyzer (Mca) which is where the spectrum is shown. (Author)

  17. Gaussian amplifier for nuclear spectrometry

    One of the major goals of nuclear spectrometry is the determination of the energy spectrum of a radioactive source. To measure this spectrum with electronic instrumentation one need to use a nuclear spectrometry chain of which the amplifier is part of, and whose filter shaping considerably influences the final energy resolution achieved. The amplifier released accomplishes a 7th order Gaussian filter shape with Taylor series approximation synthesized by the Shifted Companion Form and mounted using only electronic components availablein Brazil. The final version has been tested and the results showed a very good performance and the energy resolution achieved was equivalent to the imported models. (Author)

  18. Diagnostics of the Fermilab Tevatron using an AC dipole

    Miyamoto, Ryoichi; /Texas U.

    2008-08-01

    The Fermilab Tevatron is currently the world's highest energy colliding beam facility. Its counter-rotating proton and antiproton beams collide at 2 TeV center-of-mass. Delivery of such intense beam fluxes to experiments has required improved knowledge of the Tevatron's beam optical lattice. An oscillating dipole magnet, referred to as an AC dipole, is one of such a tool to non-destructively assess the optical properties of the synchrotron. We discusses development of an AC dipole system for the Tevatron, a fast-oscillating (f {approx} 20 kHz) dipole magnet which can be adiabatically turned on and off to establish sustained coherent oscillations of the beam particles without affecting the transverse emittance. By utilizing an existing magnet and a higher power audio amplifier, the cost of the Tevatron AC dipole system became relatively inexpensive. We discuss corrections which must be applied to the driven oscillation measurements to obtain the proper interpretation of beam optical parameters from AC dipole studies. After successful operations of the Tevatron AC dipole system, AC dipole systems, similar to that in the Tevatron, will be build for the CERN LHC. We present several measurements of linear optical parameters (beta function and phase advance) for the Tevatron, as well as studies of non-linear perturbations from sextupole and octupole elements.

  19. Characterisation Of Low Noise Amplifier

    MAULIK B.PATEL

    2012-08-01

    Full Text Available Amplification is one of the most basic and prevalent microwave circuit functions inmodern RF and microwave systems. Early microwave amplifiers relied on tubes, such asklystrons and traveling-wave tubes, or solid-state reflection amplifiers based on thenegative resistance characteristics of tunnel or varactor diodes. But due to the dramaticimprovements and innovations in solid-state technology that have occurred since the1970s, most RF and microwave amplifiers today use transistor devices such as Si or SiGeBJTs, GaAs HBTs, GaAs or InP FETs, or GaAs HEMTs. Microwave transistor amplifiersare rugged, low-cost, reliable, and can be easily integrated in both hybrid andmonolithic integrated circuitry. Transistor amplifiers can be used at frequencies inexcess of 100 GHz in a wide range of applications requiring small size, low-noise figure,broad bandwidth, and low to medium power capacity. Although microwave tubes are stillrequired for very high power and/or very high frequency applications, continuingimprovement in the performance of microwave transistors is steadily reducing the needfor microwave tubes

  20. Dielectric waveguide amplifiers and lasers

    Pollnau, M.

    2014-01-01

    The performance of semiconductor amplifiers and lasers has made them the preferred choice for optical gain on a micro-chip. In the past few years, we have demonstrated that also rare-earth-ion-doped dielectric waveguides show remarkable performance, ranging from a small-signal gain per unit length o

  1. ac bidirectional motor controller

    Schreiner, K.

    1988-01-01

    Test data are presented and the design of a high-efficiency motor/generator controller at NASA-Lewis for use with the Space Station power system testbed is described. The bidirectional motor driver is a 20 kHz to variable frequency three-phase ac converter that operates from the high-frequency ac bus being designed for the Space Station. A zero-voltage-switching pulse-density-modulation technique is used in the converter to shape the low-frequency output waveform.

  2. High-speed thyristor power amplifier control for the JT-60 poloidal field

    In undertaking basic research into a high power thyristor amplifier system for the JT-60, we have developed direct computer control employing modern control theory, and have experimented on a small model system. This paper describes how to attain the required high speed and accuracy and the hardware. To simulate the actual system, a model system composed of a flywheel driven a-c generator, a computer-controlled thyristor amplifier and three coupled magnetic field coils was used. From the experimental results, 0.2% static accuracy, 0.5% dynamic accuracy and 3 msec control delay were obtained. (author)

  3. Low Cost RF Amplifier for Community TV

    Ch, Syafaruddin; Sasongko, Sudi Mariyanto Al; Made Budi Suksmadana, I.; Mustiko Okta Muvianto, Cahyo; Ariessaputra, Suthami

    2016-01-01

    he capability of television to deliver audio video makes this media become the most effective method to spread information. This paper presents an experiment of RF amplifier design having low-cost design and providing sufficient RF power particularly for community television. The RF amplifier consists of two stages of amplifier. The first stage amplifier was used to leverage output of TV modulator from 11dBm to enable to drive next stage amplifier. CAD simulation and fabrication were run to reach optimum RF amplifier design circuit. The associated circuit was made by determining stability circle, stability gain, and matching impedance. Hence, the average power of first stage RF amplifier was 24.68dBm achieved. The second stage used RF modules which was ready match to 50 ohm for both input and output port. The experiment results show that the RF amplifier may operate at frequency ranging from 174 to 230MHz. The average output power of the 2nd stage amplifier was 33.38 Watt with the overall gain of 20.54dB. The proposed RF amplifier is a cheap way to have a stable RF amplifier for community TV. The total budget for the designed RF amplifier is only a 1/5 compared to local design of final TV amplifier.

  4. AC/RF Superconductivity

    Ciovati, Gianluigi [JLAB

    2015-02-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  5. AC/RF Superconductivity

    Ciovati, G.

    2015-01-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  6. Amplifying the evanescent field of free electrons

    So, J.-K.; Ou, J.-Y.; Adamo, G.; García de Abajo, F. J.; MacDonald, K. F.; Zheludev, N.I.

    2013-01-01

    We provide the first experimental demonstration that the evanescent field of free electrons can be amplified by a plasmonic nanolayer in much that same way as optical evanescent fields are amplified in the ‘poor-man’s superlens’.

  7. Amplifying free-electron evanescent fields

    So, J.-K.; Ou, J.-Y.; Adamo, G.; García de Abajo, F. J.; MacDonald, K. F.; Zheludev, N.I.

    2013-01-01

    We show experimentally for the first time that free-electron evanescent fields can be amplified by a plasmonic nanolayer in a manner analogous to the way in which optical fields are amplified in the poor-man's superlens.

  8. Analog circuit design designing high performance amplifiers

    Feucht, Dennis

    2010-01-01

    The third volume Designing High Performance Amplifiers applies the concepts from the first two volumes. It is an advanced treatment of amplifier design/analysis emphasizing both wideband and precision amplification.

  9. Compact dual channel spectroscopy amplifier cum discriminator

    A single width NIM module having two channels of spectroscopy amplifier cum discriminator has been developed for Nuclear Physics experiments at IUAC. Each channel contains a shaping amplifier along with logic circuits to generate the energy and timing information respectively

  10. European Research on THz Vacuum Amplifiers

    Brunetti, F.; Cojocarua, C.-S.; de Rossi, A.; Di Carlo, A.; Dispenza, M.; Dolfi, D.; Durand, A.; Fiorello, A.; Gohier, A.; Guiset, P.; Korantia, M.; Krozer, V.; Legagneux, P.; Marchesin, R.; Megtert, S.; Bouamrane, F.; Mineo, M.; Paoloni, C.; Pham, K.; Schnell, J.P.; Secchi, A.; Tamburri, E.; Terranova, M.L.; Ulisse, G.; Zhurbenko, Vitaliy

    The OPTHER (OPtically Driven TeraHertz AmplifiERs) project represents a considerable advancement in the field of high frequency amplification. The design and realization of a THz amplifier within this project is a consolidation of efforts at the international level from the main players of the Eu...... European research, academy and industry in vacuum electronics. This paper describes the status of the project and progress towards the THz amplifier realization....

  11. Improved charge amplifier using hybrid hysteresis compensation

    Amin-Shahidi, Darya; Trumper, David L.

    2013-08-01

    We present a novel charge amplifier, with a robust feedback circuit and a method for compensating piezoelectric actuator's hysteresis at low frequencies. The amplifier uses a modified feedback circuit which improves robustness to the addition of series load impedance such as in cabling. We also describe a hybrid hysteresis compensation method for enabling the charge amplifier to reduce hysteresis at low frequencies. Experimental results demonstrate the utility of the new amplifier design.

  12. Quantum Theory of Laser Amplifiers.

    Mander, Gillian Linda

    Available from UMI in association with The British Library. Requires signed TDF. We calculate the input-output characteristics of a below threshold laser amplifier. Expressions are derived for the output second- and fourth-order spectral and temporal correlation functions in terms of the corresponding input quantities, and for the photocount first and second factorial moments for both homodyne and direct detection. The general results are applied to several cases of practical interest, including specific non-classical input states. We show that a maximum of twofold amplification is permitted if squeezing in the input is to survive at the output. Similarly, for preservation of photon antibunching in amplification we show that only very small gains are allowed. The model treated here provides a detailed example of the amplifier noise limitations imposed by quantum mechanics. In particular, we show that minimum noise occurs in a cavity that is asymmetric with respect to the mirror reflectivities. The latter part of this work treats the above threshold laser amplifier. The laser output is back-scattered from a moving target to provide a weak Doppler-shifted signal which re-enters the laser cavity and is amplified. We show that the three-level atomic lasing medium is equivalent to a two-level medium pumped by an inverted bath. We use the methods of quantum statistical analysis to obtain time -evolution equations for the c-number amplitudes of the laser and signal fields. We show that the results may be applied to the below threshold regime for appropriate values of the pump parameter. By considering the amplitude differential gain we show explicitly that the behaviour of the laser around threshold is characteristic of a second -order phase transition. We calculate the output intensity gain appropriate to a heterodyne detection process, and find good agreement between the predicted gain profiles and measured data for both carbon dioxide and argon-ion lasers.

  13. Compact, harmonic multiplying gyrotron amplifiers

    Guo, H.Z.; Granatstein, V.L.; Antonsen, T.M. Jr.; Levush, B.; Tate, J.; Chen, S.H. [Univ. of Maryland, College Park, MD (United States). Inst. for Plasma Research

    1995-12-31

    A compact, harmonic multiplying gyrotron traveling wave amplifier is being developed. The device is a three-stage tube with the output section running as a fourth harmonic gyro-TWT, the input section running as a fundamental gyro-TWT, and the middle operating at the second harmonic of the cyclotron frequency. Radiation is suppressed by servers between the sections. The operating beam of the tube is produced by a magnetron injection gun (MIG). A TE{sub 0n} mode selective interaction circuit consisting of mode converters and a filter waveguide is employed for both input and output sections to solve the mode competition problem, which is pervasive in gyro-TWT operation. The input section has an input coupler designed as a TE{sub 0n} mode launcher. It excites a signal at the fundamental cyclotron frequency (17.5 GHz), which is amplified in the first TWT interaction region. So far the device is similar to a two-stage harmonic gyro-TWT. The distinction is that in the three-stage device the second section will be optimized not for output power but for fourth harmonic bunching of the beam. A gyroklystron amplifier has also been designed. The configuration is similar to the gyro-TWT but with the traveling wave interaction structures replaced by mode selective special complex cavities. Cold test results of the wideband input coupler and the TE{sub 0n} mode selective interaction circuit have been obtained.

  14. SPS RF System Amplifier plant

    1977-01-01

    The picture shows a 2 MW, 200 MHz amplifier plant with feeder lines. The main RF-system of the SPS comprises four cavities: two of 20 m length and two of 16.5 m length. They are all installed in one long straight section (LSS 3). These cavities are of the travelling-wave type operating at a centre frequency of 200.2 MHz. They are wideband, filling time about 700 ns and untuned. The power amplifiers, using tetrodes are installed in a surface building 200 m from the cavities. Initially only two cavities were installed, a third cavity was installed in 1978 and a forth one in 1979. The number of power amplifiers was also increased: to the first 2 MW plant a second 2 MW plant was added and by end 1979 there were 8 500 kW units combined in pairs to feed each of the 4 cavities with up to about 1 MW RF power, resulting in a total accelerating voltage of about 8 MV. See also 7412016X, 7412017X, 7411048X.

  15. European Research on THz Vacuum Amplifiers

    Brunetti, F.; Cojocarua, C.-S.; de Rossi, A.;

    2010-01-01

    The OPTHER (OPtically Driven TeraHertz AmplifiERs) project represents a considerable advancement in the field of high frequency amplification. The design and realization of a THz amplifier within this project is a consolidation of efforts at the international level from the main players of the Eu...

  16. NASA developments in solid state power amplifiers

    Leonard, Regis F.

    1990-01-01

    Over the last ten years, NASA has undertaken an extensive program aimed at development of solid state power amplifiers for space applications. Historically, the program may be divided into three phases. The first efforts were carried out in support of the advanced communications technology satellite (ACTS) program, which is developing an experimental version of a Ka-band commercial communications system. These first amplifiers attempted to use hybrid technology. The second phase was still targeted at ACTS frequencies, but concentrated on monolithic implementations, while the current, third phase, is a monolithic effort that focusses on frequencies appropriate for other NASA programs and stresses amplifier efficiency. The topics covered include: (1) 20 GHz hybrid amplifiers; (2) 20 GHz monolithic MESFET power amplifiers; (3) Texas Instruments' (TI) 20 GHz variable power amplifier; (4) TI 20 GHz high power amplifier; (5) high efficiency monolithic power amplifiers; (6) GHz high efficiency variable power amplifier; (7) TI 32 GHz monolithic power amplifier performance; (8) design goals for Hughes' 32 GHz variable power amplifier; and (9) performance goals for Hughes' pseudomorphic 60 GHz power amplifier.

  17. Solid state, S-band, power amplifier

    Digrindakis, M.

    1973-01-01

    The final design and specifications for a solid state, S-band, power amplifier is reported. Modifications from a previously proposed design were incorporated to improve efficiency and meet input overdrive and noise floor requirements. Reports on the system design, driver amplifier, power amplifier, and voltage and current limiter are included along with a discussion of the testing program.

  18. Solid state ku-band power amplifier

    Bowers, H. C.; Lockyear, W. H.

    1972-01-01

    The design, fabrication, and testing of two types of IMPATT diode reflection amplifiers and a transmission amplifier are given. The Ku-band IMPATT diode development is discussed. Circuitry and electrical performance of the final version of the Ku-band amplifier is described. Construction details and an outline and mounting drawing are presented.

  19. low pump power photonic crystal fibre amplifiers

    Hougaard, Kristian G.; Broeng, Jes; Bjarklev, Anders Overgaard

    2003-01-01

    Designs of low pump power optical amplifiers, based on photonic crystal fibres are presented. The potential of these fibre amplifiers is investigated, and it is demonstrated that such amplifiers may deliver gains of more than 15 dB at 1550 nm with less than 1 mW of optical pump power....

  20. Concurrent Electroencephalography Recording During Transcranial Alternating Current Stimulation (tACS).

    Fehér, Kristoffer D; Morishima, Yosuke

    2016-01-01

    Oscillatory brain activities are considered to reflect the basis of rhythmic changes in transmission efficacy across brain networks and are assumed to integrate cognitive neural processes. Transcranial alternating current stimulation (tACS) holds the promise to elucidate the causal link between specific frequencies of oscillatory brain activity and cognitive processes. Simultaneous electroencephalography (EEG) recording during tACS would offer an opportunity to directly explore immediate neurophysiological effects of tACS. However, it is not trivial to measure EEG signals during tACS, as tACS creates a huge artifact in EEG data. Here we explain how to set up concurrent tACS-EEG experiments. Two necessary considerations for successful EEG recording while applying tACS are highlighted. First, bridging of the tACS and EEG electrodes via leaking EEG gel immediately saturates the EEG amplifier. To avoid bridging via gel, the viscosity of the EEG gel is the most important parameter. The EEG gel must be viscous to avoid bridging, but at the same time sufficiently fluid to create contact between the tACS electrode and the scalp. Second, due to the large amplitude of the tACS artifact, it is important to consider using an EEG system with a high resolution analog-to-digital (A/D) converter. In particular, the magnitude of the tACS artifact can exceed 100 mV at the vicinity of a stimulation electrode when 1 mA tACS is applied. The resolution of the A/D converter is of importance to measure good quality EEG data from the vicinity of the stimulation site. By following these guidelines for the procedures and technical considerations, successful concurrent EEG recording during tACS will be realized. PMID:26862814

  1. Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition

    The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity

  2. A Low Cost Amplifier And Acquisition System For Cortical-Electroncephalography In Non-Human Applications

    Viggiano, Andrea; Coppola, Giangennaro

    2014-01-01

    A simple circuit is described to make an AC-amplifier and an analog-to-digital converter in a single, compact solution, for use in basic research, but not on humans. The circuit sends data to and is powered from a common USB port of modern computers; using proper firmware and driver the communication with the device is an emulated RS232 serial port.

  3. A Low Cost Amplifier and Acquisition System for Cortical-Electroncephalography in Non-Human Applications

    2014-01-01

    A simple circuit is described to make an AC-amplifier and an analog-to-digital converter in a single, compact solution, for use in basic research, but not on humans. The circuit sends data to and is powered from a common USB port of modern computers; using proper firmware and driver the communication with the device is an emulated RS232 serial port.

  4. NIF/LMJ prototype amplifier mechanical design

    Amplifier prototypes for the National Ignition Facility and the Laser Megajoule will be tested at Lawrence Livermore National Laboratory. The prototype amplifier, which is an ensemble of modules from LLNL and Centre d'Etudes de Limeil-Valenton, is cassette-based with bottom access for maintenance. A sealed maintenance transfer vehicle which moves optical cassettes between the amplifier and the assembly cleanroom, and a vacuum gripper which holds laser slabs during cassette assembly will also be tested. The prototype amplifier will be used to verify amplifier optical performance, thermal recovery time, and cleanliness of mechanical operations

  5. An Implantable CMOS Amplifier for Nerve Signals

    Nielsen, Jannik Hammel; Lehmann, Torsten

    In this paper, a low noise high gain CMOS amplifier for minute nerve signals is presented. The amplifier is constructed in a fully differential topology to maximize noise rejection. By using a mixture of weak- and strong inversion transistors, optimal noise suppression in the amplifier is achieved....... A continuous-time current-steering offset-compensation technique is utilized in order to minimize the noise contribution and to minimize dynamic impact on the amplifier input nodes. The method for signal recovery from noisy nerve signals is presented. A prototype amplifier is realized in a standard...

  6. Hermetisk AC-Krets

    Hirsch, Carl; Smirnoff, Alexander

    2007-01-01

    Under sex månader våren 2007 har ett samarbete mellan Volvo Lastvagnar och två studenter från KTH, inriktning Integrerad produktutveckling vid institutionen för maskinkonstruktion, pågått i form av ett examensarbete på 20 poäng. Dagens AC-system i Volvos lastbilar avger 20-40 g/år av köldmediet R134a som är en kraftfull växthusgas. Detta sker främst genom diffusion via slangar och tätningsmaterial. Syftet med detta examensarbete är att ta fram förslag på tekniska lösningar på ett nytt AC-syst...

  7. HIGH AVERAGE POWER OPTICAL FEL AMPLIFIERS

    Historically, the first demonstration of the optical FEL was in an amplifier configuration at Stanford University [l]. There were other notable instances of amplifying a seed laser, such as the LLNL PALADIN amplifier [2] and the BNL ATF High-Gain Harmonic Generation FEL [3]. However, for the most part FELs are operated as oscillators or self amplified spontaneous emission devices. Yet, in wavelength regimes where a conventional laser seed can be used, the FEL can be used as an amplifier. One promising application is for very high average power generation, for instance FEL's with average power of 100 kW or more. The high electron beam power, high brightness and high efficiency that can be achieved with photoinjectors and superconducting Energy Recovery Linacs (ERL) combine well with the high-gain FEL amplifier to produce unprecedented average power FELs. This combination has a number of advantages. In particular, we show that for a given FEL power, an FEL amplifier can introduce lower energy spread in the beam as compared to a traditional oscillator. This properly gives the ERL based FEL amplifier a great wall-plug to optical power efficiency advantage. The optics for an amplifier is simple and compact. In addition to the general features of the high average power FEL amplifier, we will look at a 100 kW class FEL amplifier is being designed to operate on the 0.5 ampere Energy Recovery Linac which is under construction at Brookhaven National Laboratory's Collider-Accelerator Department

  8. High temperature charge amplifier for geothermal applications

    Lindblom, Scott C.; Maldonado, Frank J.; Henfling, Joseph A.

    2015-12-08

    An amplifier circuit in a multi-chip module includes a charge to voltage converter circuit, a voltage amplifier a low pass filter and a voltage to current converter. The charge to voltage converter receives a signal representing an electrical charge and generates a voltage signal proportional to the input signal. The voltage amplifier receives the voltage signal from the charge to voltage converter, then amplifies the voltage signal by the gain factor to output an amplified voltage signal. The lowpass filter passes low frequency components of the amplified voltage signal and attenuates frequency components greater than a cutoff frequency. The voltage to current converter receives the output signal of the lowpass filter and converts the output signal to a current output signal; wherein an amplifier circuit output is selectable between the output signal of the lowpass filter and the current output signal.

  9. Audio power amplifier design handbook

    Self, Douglas

    2013-01-01

    This book is essential for audio power amplifier designers and engineers for one simple reason...it enables you as a professional to develop reliable, high-performance circuits. The Author Douglas Self covers the major issues of distortion and linearity, power supplies, overload, DC-protection and reactive loading. He also tackles unusual forms of compensation and distortion produced by capacitors and fuses. This completely updated fifth edition includes four NEW chapters including one on The XD Principle, invented by the author, and used by Cambridge Audio. Cro

  10. Cathode-follower power amplifier

    In circular accelerators and particularly in storage rings it is essential that the total impedance, as seen by the beam, be kept below some critical value. A model of the accelerating system was built using a single-ended cathode-follower amplifier driving a ferrite-loaded cavity. The system operated at 234.5 kHz with a peak output voltage of +-10 kV on the gap. The dynamic output impedance, as measured on the gap, was < 15 ohms

  11. High power RF solid state power amplifier system

    Sims, III, William Herbert (Inventor); Chavers, Donald Gregory (Inventor); Richeson, James J. (Inventor)

    2011-01-01

    A high power, high frequency, solid state power amplifier system includes a plurality of input multiple port splitters for receiving a high-frequency input and for dividing the input into a plurality of outputs and a plurality of solid state amplifier units. Each amplifier unit includes a plurality of amplifiers, and each amplifier is individually connected to one of the outputs of multiport splitters and produces a corresponding amplified output. A plurality of multiport combiners combine the amplified outputs of the amplifiers of each of the amplifier units to a combined output. Automatic level control protection circuitry protects the amplifiers and maintains a substantial constant amplifier power output.

  12. High performance AC drives

    Ahmad, Mukhtar

    2010-01-01

    This book presents a comprehensive view of high performance ac drives. It may be considered as both a text book for graduate students and as an up-to-date monograph. It may also be used by R & D professionals involved in the improvement of performance of drives in the industries. The book will also be beneficial to the researchers pursuing work on multiphase drives as well as sensorless and direct torque control of electric drives since up-to date references in these topics are provided. It will also provide few examples of modeling, analysis and control of electric drives using MATLAB/SIMULIN

  13. Superconducting ac cable

    The components of a superconducting 110 kV ac cable for power ratings >= 2000 MVA have been developed. The cable design especially considered was of the semiflexible type, with a rigid cryogenic envelope and flexible hollow coaxial cable cores pulled into the former. The cable core consists of spirally wound Nb-Al composite wires and a HDPE-tape wrapped electrical insulation. A 35 m long single phase test cable with full load terminations for 110 kV and 10 kA was constructed and successfully tested. The results obtained prove the technical feasibility and capability of our cable design. (orig.)

  14. A low-noise transimpedance amplifier for the detection of “Violin-Mode” resonances in advanced Laser Interferometer Gravitational wave Observatory suspensions

    This paper describes the design and performance of an extremely low-noise differential transimpedance amplifier, which takes its two inputs from separate photodiodes. The amplifier was planned to serve as the front-end electronics for a highly sensitive shadow-displacement sensing system, aimed at detecting very low-level “Violin-Mode” (VM) oscillations in 0.4 mm diameter by 600 mm long fused-silica suspension fibres. Four such highly tensioned fibres support the 40 kg test-masses/mirrors of the Advanced Laser Interferometer Gravitational wave Observatory interferometers. This novel design of amplifier incorporates features which prevent “noise-gain peaking” arising from large area photodiode (and cable) capacitances, and which also usefully separate the DC and AC photocurrents coming from the photodiodes. In consequence, the differential amplifier was able to generate straightforwardly two DC outputs, one per photodiode, as well as a single high-gain output for monitoring the VM oscillations—this output being derived from the difference of the photodiodes’ two, naturally anti-phase, AC photocurrents. Following a displacement calibration, the amplifier's final VM signal output was found to have an AC displacement responsivity at 500 Hz of (9.43 ± 1.20) MV(rms) m−1(rms), and, therefore, a shot-noise limited sensitivity to such AC shadow- (i.e., fibre-) displacements of (69 ± 13) picometres/√Hz at this frequency, over a measuring span of ±0.1 mm

  15. High-efficiency solid state power amplifier

    Wallis, Robert E. (Inventor); Cheng, Sheng (Inventor)

    2005-01-01

    A high-efficiency solid state power amplifier (SSPA) for specific use in a spacecraft is provided. The SSPA has a mass of less than 850 g and includes two different X-band power amplifier sections, i.e., a lumped power amplifier with a single 11-W output and a distributed power amplifier with eight 2.75-W outputs. These two amplifier sections provide output power that is scalable from 11 to 15 watts without major design changes. Five different hybrid microcircuits, including high-efficiency Heterostructure Field Effect Transistor (HFET) amplifiers and Monolithic Microwave Integrated Circuit (MMIC) phase shifters have been developed for use within the SSPA. A highly efficient packaging approach enables the integration of a large number of hybrid circuits into the SSPA.

  16. YANG-MILLS FIELD AMPLIFIER

    Trunev A. P.

    2015-09-01

    Full Text Available The article presents a project of the Yang-Mills amplifier. Amplifier model is a multilayer spherical shell with increasing density towards the center. In the center of the amplifier is the core of high-density material. It is shown that in such a system, the amplitude of the Yang-Mills waves rises from the periphery to the center of several orders of magnitude. The role of the Yang-Mills field in the processes occurring in the nuclei of galaxies, stars and planets is discussed. The data modeling to strengthen the Yang-Mills field in the bowels of the planet, with an atomic explosion, and in some special devices such as the voltaic pile. To describe the mechanism of amplification chromodynamics field used as accurate results in Yang-Mills theory and numerical models developed based on an average and the exact equations as well. Among the exact solutions of the special role played by the centralsymmetric metric describing the contribution of the Yang-Mills field in the speed of recession of galaxies. Among the approximate numerical models can be noted the eight-scalar model we have developed for the simulation of non-linear color oscillations and chaos in the Yang-Mills theory. Earlier models were investigated spatio-temporal oscillations of the YangMills theory in the case of three and eight colors. The results of numerical simulation show that the nonlinear interaction does not lead to a spatial mixing of colors as it might be in the case of turbulent diffusion. Depending on the system parameters there is a suppression of the amplitude of the oscillations the first three by five colors or vice versa. The kinetic energy fluctuations or shared equally between the color components, or dominated by the kinetic energy of repressed groups of colors. In the present study, we found that amplification chromodynamic field leads to a sharp increase in the amplitude of the suppressed color, which can lead to an increase in entropy, excitation of nuclear

  17. Enhanced Gain in Photonic Crystal Amplifiers

    Ek, Sara; Semenova, Elizaveta; Hansen, Per Lunnemann;

    2012-01-01

    study of a 1 QW photonic crystal amplifier. Net gain is achieved which enables laser oscillation in photonic crystal micro cavities. The ability to freely tailor the dispersion in a semiconductor optical amplifier makes it possible to raise the optical gain considerably over a certain bandwidth. These...... results are promising for short and efficient semiconductor optical amplifiers. This effect will also benefit other devices, such as mode locked lasers....

  18. Reflection amplifiers in self-regulated learning

    Verpoorten, Dominique

    2012-01-01

    Verpoorten, D. (2012). Reflection amplifiers in self-regulated learning. Doctoral thesis. November, 9, 2012, Heerlen, The Netherlands: Open Universiteit (CELSTEC). Datawyse / Universitaire Pers Maastricht.

  19. Dynamics of Soliton Cascades in Fiber Amplifiers

    Arteaga-Sierra, F R; Agrawal, Govind P

    2016-01-01

    We study numerically the formation of cascading solitons when femtosecond optical pulses are launched into a fiber amplifier with less energy than required to form a soliton of equal duration. As the pulse is amplified, cascaded fundamental solitons are created at different distances, without soliton fission, as each fundamental soliton moves outside the gain bandwidth through the Raman-induced spectral shifts. As a result, each input pulse creates multiple, temporally separated, ultrashort pulses of different wavelengths at the amplifier output. The number of pulses depends not only on the total gain of the amplifier but also on the width of input pulses.

  20. Ping-pong auto-zero amplifier with glitch reduction

    Larson, Mark R.

    2008-01-22

    A ping-pong amplifier with reduced glitching is described. The ping-pong amplifier includes a nulling amplifier coupled to a switching network. The switching network is used to auto-zero a ping amplifier within a ping-pong amplifier. The nulling amplifier drives the output of a ping amplifier to a proper output voltage level during auto-zeroing of the ping amplifier. By being at a proper output voltage level, glitches associated with transitioning between a ping amplifier and a pong amplifier are reduced or eliminated.

  1. Linearisation of RF Power Amplifiers

    Nielsen, Per Asbeck

    2001-01-01

    linearisation systems with focus on polar modulation feedback, and a chip oriented part focusing on integrating of separate building blocks of the system on a chip. The system oriented part of this thesis deals with analog feedback linearisation systems. The Polar modulation feedback system is compared with the...... more traditional Cartesian modulation feedback system in terms of loop settlement and dependencies between the feedback signals. A method to calculate the distortion functions of the linearisation system (AM/AM and AM/PM)based on the distortion functions of the power amplifier is presented. Also the...... polar loop architecture and it’s suitability to modern digital transmitters is discussed. A proposal of an architecture that is suitable for digital transmitters, which means that it has an interface to the digital back-end, defined by low-pass signals in polar form, is presented. Simulation guidelines...

  2. Transverse pumped laser amplifier architecture

    Bayramian, Andrew James; Manes, Kenneth; Deri, Robert; Erlandson, Al; Caird, John; Spaeth, Mary

    2013-07-09

    An optical gain architecture includes a pump source and a pump aperture. The architecture also includes a gain region including a gain element operable to amplify light at a laser wavelength. The gain region is characterized by a first side intersecting an optical path, a second side opposing the first side, a third side adjacent the first and second sides, and a fourth side opposing the third side. The architecture further includes a dichroic section disposed between the pump aperture and the first side of the gain region. The dichroic section is characterized by low reflectance at a pump wavelength and high reflectance at the laser wavelength. The architecture additionally includes a first cladding section proximate to the third side of the gain region and a second cladding section proximate to the fourth side of the gain region.

  3. Amplified spontaneous emission and its restraint in a terawatt Ti:sapphire amplifier

    2000-01-01

    Amplified spontaneous emission (ASE) and its restraint in a femtosecond Ti: sapphire chirped_pulse amplifier were investigated. The noises arising from ASE were effectively filtered out in the spatial, temporal and spectral domain. Pulses as short as 38 fs were amplified to peak power of 1.4 TW. The power ratio between the amplified femtosecond pulse and the ASE was higher than 106:1.

  4. Distributed feedback laser amplifiers combining the functions of amplifiers and channel filters

    Wang, Z.; Durhuus, T.; Mikkelsen, Benny;

    1994-01-01

    A dynamic model for distributed feedback amplifiers, including the mode coupled equations and the carrier rate equation, is established. The presented mode coupled equations have taken into account the interaction between fast changing optical signal and the waveguide with corrugations. By showin...... the possibility of amplifying 100 ps pulses without pulse broadening, we anticipate that a distributed feedback amplifier can be used as a combined amplifier and channel filter in high bit rate transmission systems....

  5. Ac Hybrid Charge Controller

    Shalini S. Durgam

    2015-03-01

    Full Text Available One of the primary needs for socio-economic development in any nation in the world is the provision of reliable electricity supply systems with lower carbon footprint levels. The purpose of this work is the development of a hybrid Power system that harnesses the renewable energy in sun and electricity to generate electricity. The working model can able to run on dual mode- solar and electricity. It can also be driven independently either by solar or electricity. The battery can be charge from solar panel (40W or by power supply. The household single phase A.C. power supply of 230V is converted into 12V D.C. using step down transformer and rectifying circuit. The working model can achieve energy saving, low carbon emission, environmental protection for the upcoming future of human life.

  6. A general-purpose pulse amplifier

    In the paper proposals are made for using the technique, known from analogue computation, for transforming nuclear pulses to the shape and size desired by the means of ''operational amplifiers''. By using this technique it is possible, by means of one fundamental amplifier but with different feedback networks, to have pre-amplifiers and head-amplifiers with different pulse-handling performances and optimized with respect to the parameter of greatest interest, such as linearity, stability or overloading characteristics. As this technique involves the use of parallel-feedback it is specially suited for pre-amplifiers since most detectors are current-generators. An amplifier fulfilling the requirements necessary for use as an operational amplifier is described. The most important specifications are: 90 db gain from DC-10 kHz, then falling approximately 20 db/decade until 15 MHz (30 db gain). Four tubes are used in the amplifier. For most pulse-handling applications a stabilized power-supply is unnecessary and the stability will depend solely on the stability of the feedback network used. (author)

  7. Self-pulsation in Raman fiber amplifiers

    Pedersen, Martin Erland Vestergaard; Ott, Johan Raunkjær; Rottwitt, Karsten

    2009-01-01

    Dynamic behavior caused by Brillouin scattering in Raman fiber amplifiers is studied. Modes of self-pulsation steady state oscillations are found. Their dependence on amplification scheme is demonstrated.......Dynamic behavior caused by Brillouin scattering in Raman fiber amplifiers is studied. Modes of self-pulsation steady state oscillations are found. Their dependence on amplification scheme is demonstrated....

  8. High efficiency, low magnetic field gyroklystron amplifiers

    The possibility of operating a gyroklystron amplifier at high efficiency and low magnetic field is considered. Two devices are discussed: A two cavity second harmonic TE02 gyroklystron amplifier operating at 19.7 GHz with subharmonic bunching, and a fundamental mode TE01 gyrotwistron at 16 GHz. The nonlinear efficiency is given for both devices

  9. BROADBAND TRAVELLING WAVE SEMICONDUCTOR OPTICAL AMPLIFIER

    2010-01-01

    Broadband travelling wave semiconductor optical amplifier (100, 200, 300, 400, 800) for amplification of light, wherein the amplifier (100, 200, 300, 400, 800) comprises a waveguide region (101, 201, 301, 401, 801) for providing confinement of the light in transverse directions and adapted for...

  10. Waveguide optical amplifier for telecom applications

    Taccheo, Stefano; Zannin, Marcelo; Ennser, Karin; Careglio, Davide; Solé Pareta, Josep; Aracil Rico, Javier

    2009-01-01

    In this paper we review progress in optical gain clamped waveguide amplifiers for applications to optical communications. We demonstrate that compact waveguide devices may offer advantages compared to standard fiber amplifiers. In particular we focus on the application of gain clamping and optical burst switching networks where physical impairments may occur due to variation of the input power. Peer Reviewed

  11. mm-wave solid state amplifiers

    Wolfert, P. H.; Crowley, J. D.; Fank, F. B.

    The development of mm-wave amplifiers using InP Gunn diodes is reviewed including a low-noise eight-stage amplifier for replacement of a Ka-band TWTA and a three-stage amplifier for the 42.5 to 44.5 range with an output power of 100 mW and 20 dB associated gain. A detailed description of a three-stage amplifier for the 54 to 58 GHz range is given with 100 mW output power and 15 dB associated gain, a small signal gain of 30 dB and an N.F. of 15.5 to 16.5 dB. The design of a broad band, low-loss V-band circulator, which was used in the amplifier, is described.

  12. Detection of Non-Amplified Genomic DNA

    Corradini, Roberto

    2012-01-01

    This book offers a state-of-the-art overview on non amplified DNA detection methods and provides chemists, biochemists, biotechnologists and material scientists with an introduction to these methods. In fact all these fields have dedicated resources to the problem of nucleic acid detection, each contributing with their own specific methods and concepts. This book will explain the basic principles of the different non amplified DNA detection methods available, highlighting their respective advantages and limitations. The importance of non-amplified DNA sequencing technologies will be also discussed. Non-amplified DNA detection can be achieved by adopting different techniques. Such techniques have allowed the commercialization of innovative platforms for DNA detection that are expected to break into the DNA diagnostics market. The enhanced sensitivity required for the detection of non amplified genomic DNA has prompted new strategies that can achieve ultrasensitivity by combining specific materials with specifi...

  13. Semiconductor quantum-dot lasers and amplifiers

    Hvam, Jørn Märcher; Borri, Paola; Ledentsov, N. N.;

    2002-01-01

    We have produced GaAs-based quantum-dot edge-emitting lasers operating at 1.16 mu m with record-low transparency current, high output power, and high internal quantum efficiencies. We have also realized GaAs-based quantum-dot lasers emitting at 1.3 mu m, both high-power edge emitters and low-power...... biased to positive net gain. We have further measured gain recovery times in quantum dot amplifiers that are significantly lower than in bulk and quantum-well semiconductor optical amplifiers. This is promising for future demonstration of quantum dot devices with high modulation bandwidth...... surface emitting VCSELs. We investigated the ultrafast dynamics of quantum-dot semiconductor optical amplifiers. The dephasing time at room temperature of the ground-state transition in semiconductor quantum dots is around 250 fs in an unbiased amplifier, decreasing to below 50 fs when the amplifier is...

  14. Radiation tolerant isolation amplifiers for temperature measurement

    This paper concentrates on the selection of radiation tolerant isolation amplifiers, which are suitable for the signal conditioners for cryogenic system in the Large Hadron Collider (LHC). The evolution and the results of different commercial isolation amplifiers' parameters under neutron and gamma radiation are presented. In most cases, the tested isolation amplifiers' input offset voltage, bias currents and output offset voltage hardly changed during the radiation. The DC gain in input stage was only affected for some isolation amplifiers with a small open loop gain. Transmission coefficient showed decrease for all the tested isolation amplifiers. Also, the DC output voltage increased and the ripple voltage decreased for all the build-in isolated regulators. In addition, results on 1B41 signal conditioner showed that it was tolerant to 7-8x1012 n/cm2, which was 50% higher than the expected dose in the LHC

  15. An Implantable CMOS Amplifier for Nerve Signals

    Nielsen, Jannik Hammel; Lehmann, Torsten

    2001-01-01

    In this paper, a low noise high gain CMOS amplifier for minute nerve signals is presented. By using a mixture of weak- and strong inversion transistors, optimal noise suppression in the amplifier is achieved. A continuous-time offset-compensation technique is utilized in order to minimize impact on...... the amplifier input nodes. The method for signal recovery from noisy nerve signals is presented. A prototype amplifier is realized in a standard digital 0.5 μm CMOS single poly, n-well process. The prototype amplifier features a gain of 80 dB over a 3.6 kHz bandwidth, a CMRR of more than 87 dB and a...

  16. Design and performance of the beamlet amplifiers

    Erlandson, A.C.; Rotter, M.D.; Frank, M.D.; McCracken, R.W.

    1996-06-01

    In future laser systems, such as the National Ignition Facility (NIF), multi-segment amplifiers (MSAs) will be used to amplify the laser beam to the required levels. As a prototype of such a laser architecture, the authors have designed, built, and tested flash-lamp-pumped, Nd:Glass, Brewster-angle slab MSAs for the Beamlet project. In this article, they review the fundamentals of Nd:Glass amplifiers, describe the MSA geometry, discuss parameters that are important in amplifier design, and present our results on the characterization of the Beamlet MSAs. In particular, gain and beam steering measurements show that the Beamlet amplifiers meet all optical performance specifications and perform close to model predictions.

  17. Qubit readout with a directional parametric amplifier

    Sliwa, K. M.; Abdo, B.; Narla, A.; Shankar, S.; Hatridge, M.; Frunzio, L.; Schoelkopf, R. J.; Devoret, M. H.

    2014-03-01

    Josephson junction based quantum limited parametric amplifiers play an essential role in superconducting qubit measurements. These measurements necessitate circulators and isolators between the amplifier and qubit to add directionality and/or isolation. Unfortunately, this extra hardware limits both quantum measurement efficiency and experimental scalability. Here we present a quantum-limited Josephson-junction-based directional amplifier (JDA) based on a novel coupling between two nominally identical Josephson parametric converters (JPCs). The device achieves a forward gain of 11 dB with a 15 MHz dynamical bandwidth, but higher gains are possible at the expense of bandwidth. We also present measurements of a transmon qubit made with the JDA, and show minimal measurement back-action despite the absence of any isolator or circulator before the amplifier. These results provide a first step toward realizing on-chip integration of qubits and parametric amplifiers. Work supported by: IARPA, ARO, and NSF.

  18. Design of an 1800nm Raman amplifier

    Svane, Ask Sebastian; Rottwitt, Karsten

    2013-01-01

    We present the experimental results for a Raman amplifier that operates at 1810 nm and is pumped by a Raman fiber laser at 1680 nm. Both the pump laser and the Raman amplifier is polarization maintaining. A challenge when scaling Raman amplifiers to longer wavelengths is the increase in...... transmission loss, but also the reduction in the Raman gain coefficient as the amplifier wavelength is increased. Both polarization components of the Raman gain is characterized, initially for linearly co-polarized signal and pump, subsequently linearly polarized orthogonal signal and pump. The noise...... performance of the amplifier is also investigated for both configurations. Our results show an on/off gain exceeding 20 dB at 1810 nm for which the obtained effective noise figure is below 3 dB....

  19. AcEST: BP920072 [AcEST

    Full Text Available YMU001_000132_F11 525 Adiantum capillus-veneris mRNA. clone: YMU001_000132_F11. BP920072 - Show ... YGMYGEGEKALETFADMEKSGIVPDSVVFIAII 617 Query: 139 NACSR SCLFHECHSYFEAMSTHHGIVPCLEHHSCVV 32 ACS S L E + FE M ... KLMTRDVVSWNTLIAGYAQVGQNEGLFCTFSDMLGQRVKPDLITFVIVLNACSR ... 125 VF+ + +D VSWN++I+GY Q G F M+ + D IT++++++ +R S ... YGVHGYGKKAIQIFEEMLANGASP 384 Query: 166 DLITFVIVLNACSR SCLFHECHSYFEAMSTHHGIVPCLEHHSCVV 32 +TFV VL ACS L E ... KLMTRDVVSWNTLIAGYAQVGQNEGLFCTFSDMLGQRVKPDLITFVIVLNACSR S 122 +VFDK R + WN L G E + + M V+ D T+ VL AC S Sbjc ...

  20. An upstream reach-extender for 10Gb/s PON applications based on an optimized semiconductor amplifier cascade.

    Porto, Stefano; Antony, Cleitus; Ossieur, Peter; Townsend, Paul D

    2012-01-01

    We present a reach-extender for the upstream transmission path of 10Gb/s passive optical networks based on an optimised cascade of two semiconductor optical amplifiers (SOAs). Through careful optimisation of the bias current of the second stage SOA, over 19dB input dynamic range and up to 12dB compression of the output dynamic range were achieved without any dynamic control. A reach of 70km and split up to 32 were demonstrated experimentally using an ac-coupled, continuous-mode receiver with a reduced 56ns ac-coupling constant. PMID:22274342

  1. Induction Motor Control through AC/DC/AC Converters

    Elfadili, Abderrahim; Giri, Fouad; Ouadi, Hamid; El Magri, Abdelmounime; Dugard, Luc; Abouloifa, Abdelmajid

    2010-01-01

    We consider the problem of controlling inductions motors driven through AC/DC rectifiers and DC/AC inverters. The control objectives are threefold: (i) forcing the motor speed to track a reference signal, (ii) regulating the DC Link voltage, (iii) assuring a satisfactory power factor correction (PFC) with respect to the power supply net. First, a nonlinear model of the whole controlled system is developed in the Park-coordinates. Then, a nonlinear multi-loop controller is synthesized using th...

  2. AcEST: BP920905 [AcEST

    Full Text Available EM + + D ++S L AC Sbjct: 374 NSAYKLFERMPKKNVVAWNAIISGYSQHGHPHEALALFIEMQAQGIKPDSFAIVSVLPAC 433 Query: 71 SHSSTLNDGKLIHFYILMNNFE...EM++ ++ + V + S L +C Sbjct: 255 SSERIFEKIAKKNAVSWTAMISSYNRGEFSEKALRSFSEMIKSGIEPNLVTLYSVLSSCG 314 Query: 68 HSSTLNDGKLIHFYILMNNFE...VVVMSCLKACS 69 ++ +F RRD VTW A+I GYA HG E A+ LF+ M+ EN+ + V +S L+AC+ Sbjct: 656 DSRLMFEKSLRRDFVTWNAMICGYAHHGKGEEAIQLFERMILEN...ELEKMHNKRLQEMCVSWNSIISGYVMKEQSEDAQMLFTRMME 596 Query: 122 ENVDTDGVVVMSCLKACSHSSTLNDGKLIHFYILMNNFE ...FCEADT-NVITWNAMIASYVHCEQSEKAIALFDRMVSENFKPSSITLVTLLMAC 543 Query: 71 SHSSTLNDGKLIHFYILMNNFEL 3 ++ +L G++

  3. AcEST: DK950147 [AcEST

    Full Text Available TST38A01NGRL0007_O05 706 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0007_O05. 5' end seq ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... OS=Medicago truncatula GN=MtrDRAFT_AC149576g3v2 PE ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... (Fragment) OS=Medicago truncatula GN=MtrDRAFT_AC14 ...

  4. AcEST: DK959344 [AcEST

    Full Text Available TST39A01NGRL0004_G23 714 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0004_G23. 5' end seq ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... OS=Medicago truncatula GN=MtrDRAFT_AC149576g3v2 PE ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... (Fragment) OS=Medicago truncatula GN=MtrDRAFT_AC14 ...

  5. AcEST: DK949716 [AcEST

    Full Text Available TST38A01NGRL0006_L20 613 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0006_L20. 5' end seq ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... OS=Medicago truncatula GN=MtrDRAFT_AC149576g3v2 PE ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... (Fragment) OS=Medicago truncatula GN=MtrDRAFT_AC14 ...

  6. The 60 GHz solid state power amplifier

    Mcclymonds, J.

    1991-01-01

    A new amplifier architecture was developed during this contract that is superior to any other solid state approach. The amplifier produced 6 watts with 4 percent efficiency over a 2 GHz band at 61.5 GHz. The unit was 7 x 9 x 3 inches in size, 5.5 pounds in weight, and the conduction cooling through the baseplate is suitable for use in space. The amplifier used high efficiency GaAs IMPATT diodes which were mounted in 1-diode circuits, called modules. Eighteen modules were used in the design, and power combining was accomplished with a proprietary passive component called a combiner plate.

  7. Laser Cooled High-Power Fiber Amplifier

    Nemova, Galina

    2009-01-01

    A theoretical model for laser cooled continuous-wave fiber amplifier is presented. The amplification process takes place in the Tm3+-doped core of the fluoride ZBLAN (ZrF4-BaF2-LaF3-AlF3-NaF) glass fiber. The cooling process takes place in the Yb3+:ZBLAN fiber cladding. It is shown that for each value of the pump power and the amplified signal there is a distribution of the concentration of the Tm3+ along the length of the fiber amplifier, which provides its athermal operation. The influence ...

  8. Effect of Soliton Propagation in Fiber Amplifiers

    2001-01-01

    The propagation of optical solitons in fiber amplifiers is discussed by considering a model that includes linear high order dispersion, two-photon absorption, nonlinear high-order dispersion, self-induced Ramam and five-order nonlinear effects. Based on travelling wave method, the solutions of the nonlinear Schrdinger equations, and the influence on soliton propagation as well as high-order effect in the fiber amplifier are discussed in detail. It is found that because of existing five-order nonlinear effect, the solution is not of secant hyperbola type, but shows high gain state of the fiber amplifier which is very favourable to the propagation of solitons.

  9. Fundamentals of RF and microwave transistor amplifiers

    Bahl, Inder J

    2009-01-01

    A Comprehensive and Up-to-Date Treatment of RF and Microwave Transistor Amplifiers This book provides state-of-the-art coverage of RF and microwave transistor amplifiers, including low-noise, narrowband, broadband, linear, high-power, high-efficiency, and high-voltage. Topics covered include modeling, analysis, design, packaging, and thermal and fabrication considerations. Through a unique integration of theory and practice, readers will learn to solve amplifier-related design problems ranging from matching networks to biasing and stability. More than 240 problems are included to help read

  10. AC drives for industrial plants. Plant kudoyo AC drive sochi

    Miyazaki, M.; Shibata, M.; Yamada, S. (Toshiba Corp., Tokyo (Japan))

    1992-08-01

    Features and product series of AC drives for industrial plants were outlined. Configurations and features of various types of AC drives were briefly discussed which are put into market to meet various requirements for industrial plants and wide ranges of output voltage and capacity. The following product series were outlined; the power bipolar transistor inverter for 3.5-600 kVA in output capacity, IGBT inverter for AC 400 V in output voltage and 1,000 kVA or less, GTO inverter for AC 600 V and 700-2,000 kVA, and cycloconverter for AC 1,000-3,000 V and 1,000 kW-20 MW. The following subjects were outlined as current technical trends of AC drives for industrial plants; increasing in capacity of voltage-source PWM inverters, downsizing of converters through highly efficient cooling and highly dense mounting, spreading of sensorless vector controls, and development of high-voltage large-capacity PWM inverters. 6 figs., 2 tabs.

  11. High Energy Single Frequency Resonant Amplifier Project

    National Aeronautics and Space Administration — This SBIR phase I project proposes a single frequency high energy resonant amplifier for remote sensing. Current state-of-art technologies can not provide all...

  12. Noise in phase-preserving linear amplifiers

    Pandey, Shashank; Jiang, Zhang; Combes, Joshua [Center for Quantum Information and Control, University of New Mexico, Albuquerque, NM 87131-0001 (United States); Caves, Carlton M. [Center for Quantum Information and Control, University of New Mexico, Albuquerque, NM 87131-0001, USA and Centre for Engineered Quantum Systems, School of Mathematics and Physics, University of Queensland, Brisbane, QLD 4072 (Australia)

    2014-12-04

    The purpose of a phase-preserving linear amplifier is to make a small signal larger, so that it can be perceived by instruments incapable of resolving the original signal, while sacrificing as little as possible in signal-to-noise. Quantum mechanics limits how well this can be done: the noise added by the amplifier, referred to the input, must be at least half a quantum at the operating frequency. This well-known quantum limit only constrains the second moments of the added noise. Here we provide the quantum constraints on the entire distribution of added noise: any phasepreserving linear amplifier is equivalent to a parametric amplifier with a physical state σ for the ancillary mode; σ determines the properties of the added noise.

  13. Noise in phase-preserving linear amplifiers

    Pandey, Shashank; Jiang, Zhang; Combes, Joshua; Caves, Carlton M.

    2014-12-01

    The purpose of a phase-preserving linear amplifier is to make a small signal larger, so that it can be perceived by instruments incapable of resolving the original signal, while sacrificing as little as possible in signal-to-noise. Quantum mechanics limits how well this can be done: the noise added by the amplifier, referred to the input, must be at least half a quantum at the operating frequency. This well-known quantum limit only constrains the second moments of the added noise. Here we provide the quantum constraints on the entire distribution of added noise: any phasepreserving linear amplifier is equivalent to a parametric amplifier with a physical state σ for the ancillary mode; σ determines the properties of the added noise.

  14. Cryogenic Amplifier Based Receivers at Submillimeter Wavelengths

    Chattopadhyay, Goutam; Reck, Theodore and; Schlecht, Erich; Lin, Robert; Deal, William

    2012-01-01

    The operating frequency of InP high electron mobility transistor (HEMT) based amplifiers has moved well in the submillimeter-wave frequencies over the last couple of years. Working amplifiers with usable gain in waveguide packages has been reported beyond 700 GHz. When cooled cryogenically, they have shown substantial improvement in their noise temperature. This has opened up the real possibility of cryogenic amplifier based heterodyne receivers at submillimeter wavelengths for ground-based, air-borne, and space-based instruments for astrophysics, planetary, and Earth science applications. This paper provides an overview of the science applications at submillimeter wavelengths that will benefit from this technology. It also describes the current state of the InP HEMT based cryogenic amplifier receivers at submillimeter wavelengths.

  15. Quantum cloning with an optical fiber amplifier

    Fasel, Sylvain; Gisin, Nicolas; Ribordy, Grégoire; Scarani, Valerio; Zbinden, Hugo

    2002-01-01

    It has been shown theoretically that a light amplifier working on the physical principle of stimulated emission should achieve optimal quantum cloning of the polarization state of light. We demonstrate close-to-optimal universal quantum cloning of polarization in a standard fiber amplifier for telecom wavelengths. For cloning 1 --> 2 we find a fidelity of 0.82, the optimal value being 5/6 = 0.83.

  16. V-band IMPATT power amplifier

    Schell, S. W.

    1985-09-01

    This program is the result of the continuing demand and future requirement for a high data rate 60-GHz communications link. A reliable solid-state transmitter which delivers the necessary power over a wide bandwidth using the present IMPATT diode technology required the development of combining techniques. The development of a 60-GHz IMPATT power combiner amplifier is detailed. The results form a basis from which future wideband, high-power IMPATT amplifiers may be developed. As a result, several state-of-the-art advancements in millimeter-wave components technology were achieved. Specific achievements for the amplifier integration were: development of a nonresonant divider/combiner circuit; reproducible multiple junction circulator assemblies; and reliable high power 60-GHz IMPATT diodes. The various design approaches and tradeoffs which lead to the final amplifier configuration are discussed. A detailed circuit design is presented for the various amplifier components, and the conical line combiner, radial line combiner, and circulator development are discussed. The performance of the amplifier, the overall achievement of the program, the implications of the results, and an assessment of future development needs and recommendations are examined.

  17. Multiple excitation regenerative amplifier inertial confinement system

    The invention relates to apparatus and methods for producing high intensity laser radiation generation which is achieved through an optical amplifier-storage ring design. One or two synchronized, counterpropagating laser pulses are injected into a regenerative amplifier cavity and amplified by gain media which are pumped repetitively by electrical or optical means. The gain media excitation pulses are tailored to efficiently amplify the laser pulses during each transit. After the laser pulses have been amplified to the desired intensity level, they are either switched out of the cavity by some switch means, as for example an electro-optical device, for any well known laser end uses, or a target means may be injected into the regenerative amplifier cavity in such a way as to intercept simultaneously the counterpropagating laser pulses. One such well known end uses to which this invention is intended is for production of high density and temperature plasmas suitable for generating neutrons, ions and x-rays and for studying matter heated by high intensity laser radiation

  18. A low-noise instrumentation amplifier with DC suppression for recording ENG signals.

    Paraskevopoulou, Sivylla E; Eftekhar, Amir; Kulasekeram, Nishanth; Toumazou, Christofer

    2015-08-01

    This paper presents an AC-coupled instrumentation amplifier for electroneurogram (ENG) activity recording. For this design, we evaluate gain and noise requirements based on interference sources (electrodes, power line, EMG). The circuit has been implemented in a commercially-available 0.35μm CMOS technology with total power consumption 460μW. The amplifier achieves CMRR 107 dB and integrated input referred noise 940 nV. The gain is 63 dB and the bandwidth is 0.5 Hz- 13 kHz. The chosen topology enables to minimise on-chip capacitance (only 27 pF), with a total chip area of 0.4mm2. PMID:26736847

  19. AcEST: DK955197 [AcEST

    Full Text Available TST39A01NGRL0022_H07 532 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0022_H07. 5' end seq ... KDEVTALPLLK 192 Query: 194 RFAFGIACELLMSRYEKEEQEMLEEPF TTMMKGILQLPIKLPGTRFSKAIVAANMLRARF 373 R+ F +AC+L S ... KDEVMALPLLK 192 Query: 194 RFAFGIACELLMSRYEKEEQEMLEEPF TTMMKGILQLPIKLPGTRFSKAIVAANMLRARF 373 R+ F +AC+L S ... KDEVKVLP 189 Query: 185 LMKRFAFGIACELLMSRYEKEEQEMLEEPF TTMMKGILQLPIKLPGTRFSKAIVAANMLR 364 L++ F IA L + +Q+ ... KDEATVLP 177 Query: 185 LMKRFAFGIACELLMSRYEKEEQEMLEEPF TTMMKGILQLPIKLPGTRFSKAIVAANMLR 364 L+K F +A L E+ QE ...

  20. AcEST: BP915640 [AcEST

    Full Text Available YMU001_000074_A01 462 Adiantum capillus-veneris mRNA. clone: YMU001_000074_A01. BP915640 CL3685C ... y: 462 GPLILRACLVYMQGAPVGSLAEDGIVSAATGKDMEQSTVGFRLMLAKI IHRLIAAFKEVG 283 G IL+AC YM+G +GSL +D V ++VGF+LMLAK ... : 1032 GYYILKACDAYMKGYLIGSLTKDASVIDERSS-ANSTSVGFKLMLAKI APKLFSALSEVG 1090 Query: 282 AYCDAYE 262 A C+ ++ Sb ... uery: 453 ILRACLVYMQGAPVGSLAEDGIVSAATGKDMEQSTVGFRLMLAKI IHRLIAAFKEVGAYC 274 +L AC YM+G PVGS A G ST GF++ML+K ... ame = -1 Query: 423 GAPVGSLAEDGIVSAATGKDMEQSTVGFRLMLAKI I----HRLIAAFKEVGAYCD 271 G P+ L D +S GK + S RL + L+ ...

  1. The OPTHER Project: Progress toward the THz Amplifier

    Paoloni, C; Brunetti, F; Di Carlo, A;

    2011-01-01

    This paper describes the status of the OPTHER (OPtically driven TeraHertz AmplifiERs) project and progress toward the THz amplifier realization. This project represents a considerable advancement in the field of high frequency amplification. The design and realization of a THz amplifier within th...

  2. Pulsed ti: sapphire laser power amplifier

    We have demonstrated an all solid state Ti:Sapphire laser system consisting of a power oscillator and single pass amplifier. The electrical-to-optical efficiency far exceeds that of the current CW systems. The pump lasers have lower capital and operating costs than the Argon-ion laser. In the future, we plan to scale the output power to higher levels by adding a fourth pump laser and improving the output power of the current pump lasers. Modeling results suggest that a large increase in efficiency can be realized by improving the beam quality of the pump lasers, even at the cost of reduced output power. We will explore this option by adding apertures to the cavity and/or reducing the rod diameter along with optimizing the resonator design. Other improvements in efficiency which will be investigated include double passing the amplifier for better extraction. To complete this work, the laser system will be converted into a two-stage amplifier. A narrow band, lower power oscillator currently under development will be injected in to the amplifier to study the extraction and efficiency characteristics of the amplifier throughout the tuning range of Ti:Sapphire. Detailed beam quality measurements will also be made. Other work will include doubling the narrow band output for materials processing applications

  3. Speed Control of DC Motor using AC/AC/DC Converter Based on Intelligent Techniques

    Rakan Kh Antar

    2013-05-01

    Full Text Available    This paper describes the application of ac/ac/dc and ac/dc converters to control the speed of a separately excited DC motor. Artificial neural network and PI controller are trained to select the desired values of firing angles for triggering thyristors of the ac/ac/dc and ac/dc bridge converters in order to control the speed of the dc motor at a desired value with constant and different load torques in order to obtain the best speed response. Simulation results show that the rising time for ac/dc and ac/ac/dc converters at 250rpm are reduced about 79% and 89% respectively, while delay time it reduced about 69% and 64% respectively. Therefore, speed response of the dc motor is more efficient for closed loop system compared with open loop also the response of ac/ac/dc converter is better than ac/dc converter.

  4. Single mode terahertz quantum cascade amplifier

    Ren, Y., E-mail: yr235@cam.ac.uk; Wallis, R.; Shah, Y. D.; Jessop, D. S.; Degl' Innocenti, R.; Klimont, A.; Kamboj, V.; Beere, H. E.; Ritchie, D. A. [Cavendish Laboratory, University of Cambridge, JJ Thomson Avenue, CB3 0HE Cambridge (United Kingdom)

    2014-10-06

    A terahertz (THz) optical amplifier based on a 2.9 THz quantum cascade laser (QCL) structure has been demonstrated. By depositing an antireflective coating on the QCL facet, the laser mirror losses are enhanced to fully suppress the lasing action, creating a THz quantum cascade (QC) amplifier. Terahertz radiation amplification has been obtained, by coupling a separate multi-mode THz QCL of the same active region design to the QC amplifier. A bare cavity gain is achieved and shows excellent agreement with the lasing spectrum from the original QCL without the antireflective coating. Furthermore, a maximum optical gain of ∼30 dB with single-mode radiation output is demonstrated.

  5. Ultrashort pulse amplification in cryogenically cooled amplifiers

    Backus, Sterling J.; Kapteyn, Henry C.; Murnane, Margaret Mary

    2004-10-12

    A laser amplifier system amplifies pulses in a single "stage" from .about.10.sup.-9 joules to more than 10.sup.-3 joules, with average power of 1-10 watts, and beam quality M.sup.2 <2. The laser medium is cooled substantially below room temperature, as a means to improve the optical and thermal characteristics of the medium. This is done with the medium inside a sealed, evacuated or purged cell to avoid moisture or other materials condensing on the surface. A "seed" pulse from a separate laser is passed through the laser medium, one or more times, in any of a variety of configurations including single-pass, multiple-pass, and regenerative amplifier configurations.

  6. Transistorized pulse amplifiers (A.I.T.)

    The two amplifiers whose design and operation are described in this report have been studied for neutron detection units used in piles. They are designed to allow an important reduction of the volume and of the weight of the detector and its amplifier, and to simplify the operation of the detection assembly. To these characteristics can be added the mechanical and electrical robustness and the very reduced micro-phony. The first transistorized amplifier (AIT.1) is simple, very robust, and can be used for radioprotection installations. The second (AIT.4) has a better performance and makes it possible to replace the APT.2 in most of its applications (it has even been used satisfactorily in an apparatus where the micro-phony and the sensitivity to interference of the APT.2 made this latter unusable). (author)

  7. An automated test facility for neutronic amplifiers

    Neutronic amplifiers are used at the Chalk River Laboratory in applications such as neutron flux monitoring and reactor control systems. Routine preventive maintenance of control and safety systems included annual calibration and characterization of the neutronic amplifiers. An investigation into the traditional methods of annual routine maintenance of amplifiers concluded that frequency and phase response measurements in particular were labour intensive and subject to non-repeatable errors. A decision was made to upgrade testing methods and facilities by using programmable test equipment under the control of a computer. In order to verify the results of the routine measurements, expressions for the transfer functions were derived from the circuit diagrams. Frequency and phase responses were then calculated and plotted thus providing a bench-mark to which the test results can be compared. (author)

  8. Nuclear structure of $^{231}$Ac

    Boutami, R; Mach, H; Kurcewicz, W; Fraile, L M; Gulda, K; Aas, A J; García-Raffi, L M; Løvhøiden, G; Martínez, T; Rubio, B; Taín, J L; Tengblad, O

    2008-01-01

    The low-energy structure of 231Ac has been investigated by means of gamma ray spectroscopy following the beta-decay of 231Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a mini-orange electron spectrometer. The decay scheme of 231Ra --> 231Ac has been constructed for the first time. The Advanced Time Delayed beta-gamma-gamma(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

  9. AcEST: BP920800 [AcEST

    Full Text Available DLNLALQVHSRMVRFGFNAEVEACGALINMYGKCGKVLYAQRVFDDT 298 Query: 206 RQQDVISWNDIISACAQRGHGTEALENFSQMLHEGIVPNSMTFTSVMQA---CNSIEGG...G L +A S F ++ +D+ISW +I +Q EA+ F Sbjct: 217 SEKNEATSNCLINGYMGLGNLEQAESLFNQMPVKDIISWTTMIKGYSQNKRYREAIAVFY 276 Query: 119 QMLHEG...EKAWRIFDGVSCKNLPSWNAIITGCVQGGLLEEAIDLYRHMK 281 Query: 110 HEGIVPNSMTFTSVMQAC---NSIEGGR 36 + + PN +T +V+ AC +...N IIS AQ G +EA+E ++ M Sbjct: 383 DITIGNAVVVMYAKLGLVDSARAVFNWLPNTDVISWNTIISGYAQNGFASEAIEMYNIME 442 Query: 110 HEG...EIDLGEQIHSLSVKTGFESDMYVSGVLIDMYSKYGWLEKARRVLEML 406 Query: 206 RQQDVISWNDIISACAQRGHGTEALENFSQMLHEGIVPNSMTFTSVMQACNSIEGG

  10. AcEST: DK945549 [AcEST

    Full Text Available AGGCGATTTCATCTTTTCTGAGAACCCTGATTTTGTGATTGTGTAATTACA ACTGTGGAACAGAAGGATGAGAAGTCTACTGACACAACAAGATATCTCTGGAGAGGAGA...A AATTGAGAAGGTTTGAGTTCTCAACAATGGGCTATGAGGCAATAATGGGAAGGCACCGAT TGTGGGCTTGTATAGGTTTTGAC...LCTG 239 L++R+LRR + + ++ G AC+ DP +P PLC+G Sbjct: 108 LQQRELRRKLLADSGALNTNSVNGPRNWKACVQQDPSSRPGTPLCSG 154 >sp|A6UUY8|RNZ_META3...49 Tissue type young leaves Developmental stage sporophyte Contig ID CL454Contig1 Sequence GATGAGCGA...CCACCTGTGCAACCGTCAGCGCCTTTGTGCACTGGTG CAATGTCCTGTGGTTACCTTGTTTGGAATCTTAATTGTTCTCATGTAT

  11. AcEST: BP917632 [AcEST

    Full Text Available YMU001_000103_D10 554 Adiantum capillus-veneris mRNA. clone: YMU001_000103_D10. BP917632 - Show ... YSKCKIHQKALELLVLML 154 Query: 466 KDSLEPDEVTYLNVLKACARE EDLKV 543 +D++ P+ TY +VL++C D+++ Sbjct: 155 RDNVRPN ... 185 Query: 415 GHSDSS--KEALKLLTQMRKDSLEPDEVTYLNVLKACARE EDLK 540 + EA KL +M+ ++ PDE+ N++ AC R +++ Sbjct: 18 ...

  12. AcEST: DK961189 [AcEST

    Full Text Available OS=A... 127 7e-29 sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS... 125 2e-28 sp|P00785|AC...IRNSWGLNWGDSGYVKLQRNIDDPFGKCGIAMMPSYP 347 >sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS=

  13. AcEST: DK946687 [AcEST

    Full Text Available YMU02A01NGRL0013_G11 544 Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0013_G11. 5' end seq ... + G P+ TY+ + AC+ E Sbjct: 97 YSFNYMIRGLTNTWN-------DHEA ---ALSLYRRMKFSGLKPDKFTYNFVFIACAKLE 146 Query: 214 A ... Sbjct: 71 LIPKAVELGDFNYSSFLFSVTEEPNHYSFNYMIRGLTNTWNDHEA ALSLYRRMKFSGLKP 130 Query: 469 DGATFSCVLRACGNVGALDV ...

  14. AcEST: DK949372 [AcEST

    Full Text Available TST38A01NGRL0005_N02 627 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0005_N02. 5' end seq ... 363 DQLREKTC-GVDKFDDIVMACXXXXXXXXXXXXXXXXXXKARVHAYGVCD DPEYFYDYVQ 539 Q++EK G+ FDDIV+AC KA+VHA+ VCD DP+YFYD ... 264 QQVQEKKVPGITFFDDIVVACGSGGSIAGLSLGSYLSNLKAKVHAFAVCD DPDYFYDYTQ 323 Query: 540 GLLDGMNANIASRDIVNVIDAKGLG ...

  15. Cryogenic cooling for high power laser amplifiers

    Perin J.P.; Millet F.; Divoky M.; Rus B.

    2013-01-01

    Using DPSSL (Diode Pumped Solid State Lasers) as pumping technology, PW-class lasers with enhanced repetition rates are developed. Each of the Yb YAG amplifiers will be diode-pumped at a wavelength of 940 nm. This is a prerequisite for achieving high repetition rates (light amplification duration 1 millisecond and repetition rate 10 Hz). The efficiency of DPSSL is inversely proportional to the temperature, for this reason the slab amplifier have to be cooled at a temperature in the range of 1...

  16. Transportable setup for amplifier phase fidelity measurements

    Tröbs, M.; Bogan, C.; Barke, S.; Kühn, G.; Reiche, J.; Heinzel, G.; Danzmann, K.

    2015-05-01

    One possible laser source for the Laser Interferometer Space Antenna (LISA) consists of an Ytterbium-doped fiber amplifier originally developed for inter-satellite communication, seeded by the laser used for the technology demonstrator mission LISA Pathfinder. LISA needs to transmit clock information between its three spacecraft to correct for phase noise between the clocks on the individual spacecraft. For this purpose phase modulation sidebands at GHz frequencies will be imprinted on the laser beams between spacecraft. Differential phase noise between the carrier and a sideband introduced within the optical chain must be very low. We report on a transportable setup to measure the phase fidelity of optical amplifiers.

  17. Optimization of Pr3+:ZBLAN fiber amplifiers

    Pedersen, B.; Miniscalco, J. W.; Quimby, R. S.

    1992-01-01

    Experimental parameters have been measured and used in a quantitative model of Pr3+-doped fluorozirconate fiber amplifiers. The optimum cutoff wavelength was determined to be 800 nm and the gain for 400 mW of pump was found to increase from 12 to 34 dB if the NA was increased from 0.15 to 0.......25. Lengthening the metastable state lifetime from 110 to 300 μs would significantly improve amplifier performance while concentration quenching can appreciably degrade it...

  18. Beyond nonlinear saturation of backward Raman amplifiers

    Barth, Ido; Toroker, Zeev; Balakin, Alexey A.; Fisch, Nathaniel J.

    2016-06-01

    Backward Raman amplification is limited by relativistic nonlinear dephasing resulting in saturation of the leading spike of the amplified pulse. Pump detuning is employed to mitigate the relativistic phase mismatch and to overcome the associated saturation. The amplified pulse can then be reshaped into a monospike pulse with little precursory power ahead of it, with the maximum intensity increasing by a factor of two. This detuning can be employed advantageously both in regimes where the group velocity dispersion is unimportant and where the dispersion is important but small.

  19. Operational amplifier circuits analysis and design

    Nelson, J C C

    1995-01-01

    This book, a revised and updated version of the author's Basic Operational Amplifiers (Butterworths 1986), enables the non-specialist to make effective use of readily available integrated circuit operational amplifiers for a range of applications, including instrumentation, signal generation and processing.It is assumed the reader has a background in the basic techniques of circuit analysis, particularly the use of j notation for reactive circuits, with a corresponding level of mathematical ability. The underlying theory is explained with sufficient but not excessive, detail. A range of compu

  20. Energy saving in ac generators

    Nola, F. J.

    1980-01-01

    Circuit cuts no-load losses, without sacrificing full-load power. Phase-contro circuit includes gate-controlled semiconductor switch that cuts off applied voltage for most of ac cycle if generator idling. Switch "on" time increases when generator is in operation.

  1. Apuntes de Acústica

    Martín Domingo, Agustín

    2014-01-01

    Esta publicacion contiene unos apuntes para la parte de Acústica de las asignaturas de la ETSAM, junto con cierta cantidad de material adicional que excede el ámbito del curso. Aunque está lejos de ser completa y de estar libre de errores, el autor espera sea útil.

  2. SSTI Clark ACS Technology Demonstrations

    Freesland, Douglas

    1997-01-01

    SSTI Clark, one of two spacecraft built under NASA's Small Satellite Technology Initiative, includes seven ACS technology demonstrations. The technologies redefine the performance cost envelope, providing improved sensor and actuator performance at reduced costs. Six sensing technologies are being flown consisting of both hardware and algorithmic demonstrations: autonomous star tracker, hemispherical resonating gyro, GPS attitude determination, miniature horizon sensors, low cost course sun s...

  3. Ultra-low Voltage CMOS Cascode Amplifier

    Lehmann, Torsten; Cassia, Marco

    In this paper, we design a folded cascode operational transconductance amplifier in a standard CMOS process, which has a measured 69 dB DC gain, a 2 MHz bandwidth and compatible input- and output voltage levels at a 1 V power supply. This is done by a novel Current Driven Bulk (CDB) technique...

  4. Compensation techniques for operational amplifier bias current

    Two techniques are proposed for the compensation of the input current on operational amplifiers that can be used on inverting and non-inverting configurations. A qualitative analysis of temperature drift problems is made, and as a practical application, the construction of a voltage follower for high impedance measurements is presented. (Author)

  5. Stereoscopy Amplifies Emotions Elicited by Facial Expressions.

    Hakala, Jussi; Kätsyri, Jari; Häkkinen, Jukka

    2015-12-01

    Mediated facial expressions do not elicit emotions as strongly as real-life facial expressions, possibly due to the low fidelity of pictorial presentations in typical mediation technologies. In the present study, we investigated the extent to which stereoscopy amplifies emotions elicited by images of neutral, angry, and happy facial expressions. The emotional self-reports of positive and negative valence (which were evaluated separately) and arousal of 40 participants were recorded. The magnitude of perceived depth in the stereoscopic images was manipulated by varying the camera base at 15, 40, 65, 90, and 115 mm. The analyses controlled for participants' gender, gender match, emotional empathy, and trait alexithymia. The results indicated that stereoscopy significantly amplified the negative valence and arousal elicited by angry expressions at the most natural (65 mm) camera base, whereas stereoscopy amplified the positive valence elicited by happy expressions in both the narrowed and most natural (15-65 mm) base conditions. Overall, the results indicate that stereoscopy amplifies the emotions elicited by mediated emotional facial expressions when the depth geometry is close to natural. The findings highlight the sensitivity of the visual system to depth and its effect on emotions. PMID:27551358

  6. Predistortion of a Bidirectional Cuk Audio Amplifier

    Birch, Thomas Hagen; Nielsen, Dennis; Knott, Arnold;

    2014-01-01

    using predistortion. This paper suggests linearizing a nonlinear bidirectional Cuk audio amplifier using an analog predistortion approach. A prototype power stage was built and results show that a voltage gain of up to 9 dB and reduction in THD from 6% down to 3% was obtainable using this approach....

  7. AcEST: DK950895 [AcEST

    Full Text Available |A7SFA3|A7SFA3_NEMVE Predicted protein OS=Nematostella vectens... 210 5e-53 tr|Q0CVA9|Q0CVA9_ASPTN ATP-citrate synthase subunit...stX Result : Swiss-Prot sp_hit_id Q54YA0 Definition sp|Q54YA0|ACLY_DICDI Probable ATP-citrate synthase OS=Dictyos...PIDYSWAQELGLIRKPAAFISTI 404 >sp|Q8X097|ACL1_NEUCR Probable ATP-citrate synthase subunit 1 OS=Neurospora cras...IRKPASFMTSI 844 >sp|Q9P7W3|ACL1_SCHPO Probable ATP-citrate synthase subunit 1 OS=Schizosaccharomyces pombe G....done Score E Sequences producing significant alignments: (bits) Value sp|Q54YA0|ACLY_DICDI Probable ATP-citrate synthase OS=Dictyos

  8. Tunable microstrip SQUID amplifiers for the Gen 2 Axion Dark Matter eXperiment (ADMX)

    O'Kelley, Sean; Hilton, Gene; Clarke, John; ADMX Collaboration

    2016-03-01

    We present a series of tunable microstrip SQUID (Superconducting Quantum Interference Device) amplifiers (MSAs) for installation in ADMX. The axion dark matter candidate is detected via Primakoff conversion to a microwave photon in a high-Q (~100,000) tunable microwave cavity cooled with a dilution refrigerator in a 7-tesla magnetic field. The microwave photon frequency ν is a function of the unknown axion mass, so both the cavity and amplifier must be scanned over a wide frequency range. An MSA is a linear, phase-preserving amplifier consisting of a square washer loop, fabricated from a thin Nb film, incorporating two Josephson tunnel junctions with resistive shunts to prevent hysteresis. The input is coupled via a microstrip made from a square Nb coil deposited over the washer with an intervening insulating layer. Tunability is achieved by terminating the microstrip with GaAs varactors that operate below 100 mK. By varying the varactor capacitance with a bias voltage, the resonant frequency is varied by up to a factor of 2. We demonstrate several devices operating below 100 mK, matched to the discrete operating bands of ADMX at frequencies ranging from 560 MHz to 1 GHz. The MSAs exhibit gains exceeding 20 dB and the associated noise temperatures, measured with a hot/cold load, approach the standard quantum limit (hν/kB) . Supported by DOE Grants DE - FG02 - 97ER41029, DE - FG02 - 96ER40956, DE - AC52 - 07NA27344, DE - AC03 - 76SF00098, and the Livermore LDRD program.

  9. AcEST: BP914304 [AcEST

    Full Text Available IDEHTFVFTLRAC 4 V+ NA++ Y G+ E A++ + +M+ E++ + TF+ LRAC Sbjct: 670 VTWNAMICGYAHHGKGEEAIQLFERMILENIKPNHVTFISI...KSLRRDFVTWNAMICGYAHHGKGEEAIQLFERMILENIKPN 703 Query: 339 NLTYVSLFKACGNVLDFGQG-RTIHGEARANGFSSDRFICTTLI...TFVFTLRAC 4 +F + + V+ N ++ +YV A +++M + D TL+AC Sbjct: 484 QIFERMCDRDNVTWNTIIGSYVQDENESEAFDLFKRMNLCGIVSDGACL...K + A+Q+ + R + +W++MI++ +A + ++ M Sbjct: 93 LGNSLINFYSKFEDVASAEQVFRRMTLRDVVTWSSMIAAYAGNNHPAKAFDTFERMTDAN 152... + R + +W++MI++ +A + ++ M Sbjct: 93 LGNSLINFYSKFEDVASAEQVFRRMTLRDVVTWSSMIAAYAGNNHPAKAFDTFERM

  10. AcEST: BP911793 [AcEST

    Full Text Available + +VSWN +++ Y QHG + ++L+ M+AE T N + + A Sbjct: 58 EAKFVFERIQNKDVVSWNCIINGYSQHGPSGSSHVMELFQRMRAENTAPNAHTFAGVF... N + + A Sbjct: 58 EAKFVFERIQNKDVVSWNCIINGYSQHGPSGSSHVMELFQRMRAENTAPNAHTFAGVFTA 117 Query: 359 CIQTGNLELCKQM...D VT S+LSACSH G + +G YF Sbjct: 602 IIGGSAQHGRGQDALQLFERMKMEGVKPDIVTFVSLLSACSHAGLLEEGRRYF 654 Score = 115 bit...53 QTGNLELCKQMHFNIVSAGNELNPSLASSLIRTYGNCGSMLDAHAVFDSLPLPDIVSWNV 174 Q +E+ K++ F+++ N S +++I Y CG + +A +FD +P D VSW Sbjct: 324 QGERME... L+ M +E + I+LV +L AC+ TG+LE + +H Sbjct: 498 VITWNAMIASYVHCEQSEKAIALFDRMVSENFKPSSITLVTLLMACVNTGSLER

  11. AcEST: BP921649 [AcEST

    Full Text Available 40 + ++LV YAK L + ++ +P R W+ +I+ + + ++E AL+ + M+ G Sbjct: 144 VASSLVGMYAKFNLFENSLQVFDEMPERDVASWNTVISCFYQSGEAEKALELFGRME...LDCYKEM 52 ++L +GNALVD YAKCG L A ++ +R+ R V W+ +I Y + E A D +K M Sbjct: 461 KNLFVGNALVDMYAKCGALEDARQIFERMCDRDNVTWNTIIGSYVQDEN...RD+ WNA+I Sbjct: 237 LEQGKQIHCYAIRSG-IESDVLVVNGLVNMYAKCGNVNTAHKLFERMPIRDVASWNAIIG 295 Query: 411 GYVNHGRAEVALDCFGKME...SNDVV-GNALVNMYAKCGNVNSAYKLFERMPKKNVVAWNAIIS 396 Query: 411 GYVNHGRAEVALDCFGKME... HGR + AL F +M+ EG PD +TF +L AC G + + + + Sbjct: 603 IGGSAQHGRGQDALQLFERMKMEGVKPDIVTFVSLLSACSHAGLLEEGRRYFCSM

  12. AcEST: BP919669 [AcEST

    Full Text Available D + RDV SW ++S + + G+ ++F M G +P+ Sbjct: 148 LVGMYAKFNLFENSLQVFDEMPERDVASWNTVISCFYQSGEAEKALELFGRMESSGFEPN 20...+ +++AC L + +G+E+H + K+G EL V Sbjct: 190 EKALELFGRMESSGFEPNSVSLTVAISACSRLLWLERGKE...F Sbjct: 468 IY---VVNSLIDSYGKCSHVEDAERIFEECTIGDLVSFTSMITAYAQYGQGEEALKLFLE 524 Query: 226 MVGEGTKPDSISLLVVLRA-YNF...+ IR DV W +LMSGY+K D ++F ++ Sbjct: 44 SLINVYFTCKDHCSARHVFENFDIRSDVYIWNSLMSGYSKNSMFHDTLEVFKRLLNCSIC 103 Query: 208 KPDSISLLVVLRAYNF...KPD Sbjct: 261 VDMYAKCGCIETAVEVFEKLTRRNVFSWAALIGGYAAYGYAKKATTCLDRIEREDGIKPD 320 Query: 199 SISLLVVLRAYNFLGFP

  13. AcEST: DK957916 [AcEST

    Full Text Available PQKQPVPAVSHSPQKSSTPPTPAATKPKEEPSVPKEVPKLQQGKLEKT 967 Query: 577 --TTEASQGIPVEEG...G E+ P+ P Sbjct: 1974 QEQGRAPSQDQEAPSPEALPSPGQEPAAGASPRRGELRRGSSAESALPRAGP 2025 >sp|Q05175|BASP_RAT Brain ac... +P AP P Sbjct: 388 ERETAASAGPQG----AFPEPRPAQPSAGPEPRPAQPSAGPEPRPAQPSAAPEPRP---- 439 Query: 571 GQTTE... L ++ +A+ +E AP Sbjct: 406 IVTTPEPEGSGEEDVPKPDEIPEKEVTEEELIKVSTAAPAKASPEEEVVKATTLAPSEED 465 Query: 550 VSPYIASGQTTE... Query: 424 KGQAYEAIPDPHVDPAAGVHERLAQLQLGDEPEATKPKEAPG-VSPYI--ASGQTTEASQ 594 K A E P + + G E + E EA P A G +P

  14. AcEST: DK956923 [AcEST

    Full Text Available CCATAGTCTCAA CAGCGATAAGCAGGAAATGCATGCAGTGACCATGGGTAAGAAAAGGGTCATGGTGGGCGC CATTAACACGATACTTATCCTA...CTCCTCTTGCAGTTTATGAAGCAATGTTCTTCCTCTTC TAGTCATGATGATGATGGCGATGCCTTTGCGGATGACACTCTAAGCAGACGCAACGAT...AC GGTCGAGTCTGCTCCTCGACATTGGCCAAGGCGAATGCTGGGCAGCCAAGAACCTGCCTC CAACAAGACTTCATATGGTATTCCTGAT...H At1g73965 (CLE13 / CLAVATA3/ESR-Related 13) (CLE13) OS=Arabidopsis thaliana Align length 25 Sco...icant alignments: (bits) Value tr|Q6NMF0|Q6NMF0_ARATH At1g73965 (CLE13 / CLAVATA3/ESR-Related 1... 49 3e-04

  15. AcEST: BP921492 [AcEST

    Full Text Available + AL +G+ +H Sbjct: 286 DVASWNAIIGGYSLNSQHHEALAFFNRMQVRGIKPNSITMVSVLPACAHLFAL... ++ L +GK +H Sbjct: 178 NLVSWTAMVSGYAQGGFADEALRMFYEMQGEDVKANYVTVASVLPACAQLSDLQQGKEIH 237 Query: 153 AC...FDRMPEK 171 Query: 333 DVVSWSAMIAMYGQQGCGKEAFQLFQEMACEGGMPNRVTYVSILDACASVAALPEGKLVH 154 +V+W+++++ + Q G EA Q+F +M G P+ T+VS+L ACA...333 DVVSWSAMIAMYGQQGCGKEAFQLFQEMACE-GGMPNRVTYVSILDACASVAALPEGKLV 157 +V +W+AMI+ YG G G++A +LF +M + G +PN VT+V++L ACA...SKL 85 Query: 288 GCGKEAFQLFQEMACEGGMPNRVTYVSILDACASVAALPEGKLVHACFMESELELDVVVG 109 ++ M P+ T+ S++ +CA ++AL G

  16. Mutation of an aminopeptidase N gene is associated with Helicoverpa armigera resistance to Bacillus thuringiensis Cry1Ac toxin.

    Zhang, Shaoping; Cheng, Hongmei; Gao, Yulin; Wang, Guirong; Liang, Gemei; Wu, Kongming

    2009-07-01

    A Cry1Ac-resistant strain (Bt-R) of Helicoverpa armigera, with 2971-fold resistance, was derived by selection with Cry1Ac toxin for 75 generations. We used cDNA-amplified fragment length polymorphism analysis to identify those genes differentially expressed in the Cry1Ac-resistant and -susceptible strains, which revealed 212 differentially expressed transcripts among 2000 screened cDNAs. Among these transcript-derived fragments (TDFs), 37 showed some homology to known sequences, including Aminopeptidase N (APN), which is expressed in the midgut epithelium and has been implicated as a Cry1A subfamily receptor in several moths, including H. armigera. We confirmed the TDF by RT-PCR and identified a deletion mutation of apn1 in the Bt-R strain. We expressed the TDF in bacteria. The partial HaAPN1-96S wild-type protein, bound to Cry1Ac on ligand blots, whereas HaAPN1-BtR did not. This suggested that HaAPN1 is a receptor for Bt Cry1Ac and that its deletion mutation is associated with Cry1Ac resistance in H. armigera. The absence of one binding site is responsible for its resistance to Cry1Ac. We developed an allele-specific PCR to monitor whether the apn1 gene in an H. armigera field population produced a similar mutation. No deleted mutants were found in 2250 individuals collected from the field in 2006-2007. PMID:19376227

  17. Class D audio amplifier with 4th order output filter and self-oscillating full-state hysteresis based feedback driving capacitive transducers

    Nielsen, Dennis; Knott, Arnold; Andersen, Michael A. E.

    2014-01-01

    A practical solution is presented for the design of a non-isolated high voltage DC/AC power converter. The converter is intended to be used as a class D audio amplifier for a Dielectric Electro Active Polymer (DEAP) transducer. A simple and effective hysteretic control scheme for the converter (b...... (buck with fourth- order output filter) is developed and analyzed. The proposed design is verified experimentally by a 125 VAR prototype amplifier, capable of delivering a peak output voltage of 240 V within the frequency range of 100 Hz – 3.5 kHz. A peak efficiency of 87 % is reported....

  18. Investigation of the amplified spontaneous emission in Nd: glass disk laser amplifier

    A model program has been established to investigate the amplified spontaneous emission (ASE) in the Nd: glass disk amplifier with the Monte Carlo method and rays tracing. The distribution of ASE loading on the edge of a disk is firstly calculated. The effect of disk aspect radio on ASE gain reduction is also investigated. Allowance is made for the effect of different reflectivity under the condition of different incidence on two faces

  19. Control of AC133/CD133 and impact on human hematopoietic progenitor cells through nucleolin.

    Bhatia, S; Reister, S; Mahotka, C; Meisel, R; Borkhardt, A; Grinstein, E

    2015-11-01

    AC133 is a prominent surface marker of CD34+ and CD34- hematopoietic stem/progenitor cell (HSPC) subsets. AC133+ HSPCs contain high progenitor cell activity and are capable of hematopoietic reconstitution. Furthermore, AC133 is used for prospective isolation of tumor-initiating cells in several hematological malignancies. Nucleolin is a multifunctional factor of growing and cancer cells, which is aberrantly active in certain hematological neoplasms, and serves as a candidate molecular target for cancer therapy. Nucleolin is involved in gene transcription and RNA metabolism and is prevalently expressed in HSPCs, as opposed to differentiated hematopoietic tissue. The present study dissects nucleolin-mediated activation of surface AC133 and its cognate gene CD133, via specific interaction of nucleolin with the tissue-dependent CD133 promoter P1, as a mechanism that crucially contributes to AC133 expression in CD34+ HSPCs. In mobilized peripheral blood (MPB)-derived HSPCs, nucleolin elevates colony-forming unit (CFU) frequencies and enriches granulocyte-macrophage CFUs. Furthermore, nucleolin amplifies long-term culture-initiating cells and also promotes long-term, cytokine-dependent maintenance of hematopoietic progenitor cells. Active β-catenin, active Akt and Bcl-2 levels in MPB-derived HSPCs are nucleolin-dependent, and effects of nucleolin on these cells partially rely on β-catenin activity. The study provides new insights into molecular network relevant to stem/progenitor cells in normal and malignant hematopoiesis. PMID:26183533

  20. Performance of AC/graphite capacitors at high weight ratios of AC/graphite

    Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)

    2008-03-01

    The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)

  1. Simultaneous distribution of AC and DC power

    Polese, Luigi Gentile

    2015-09-15

    A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.

  2. Plasmonic amplifier of the evanescent field of free electrons

    So, J.-K.; Ou, J.Y.; Adamo, G.; García de Abajo, F. J.; MacDonald, K. F.; Zheludev, N.I.

    2013-01-01

    We show experimentally for the first time that free electron evanescent fields can be amplified by a plasmonic nanolayer in much that same way as optical evanescent fields are amplified in the poor-man's super-lens.

  3. Cryogenic cooling for high power laser amplifiers

    Using DPSSL (Diode Pumped Solid State Lasers) as pumping technology, PW-class lasers with enhanced repetition rates are developed. Each of the Yb YAG amplifiers will be diode-pumped at a wavelength of 940 nm. This is a prerequisite for achieving high repetition rates (light amplification duration 1 millisecond and repetition rate 10 Hz). The efficiency of DPSSL is inversely proportional to the temperature, for this reason the slab amplifier have to be cooled at a temperature in the range of 100 K-170 K with a heat flux of 1 MW*m-2. This paper describes the thermo-mechanical analysis for the design of the amplification laser head, presents a preliminary proposal for the required cryogenic cooling system and finally outlines the gain of cryogenic operation for the efficiency of high pulsed laser. (authors)

  4. Cryogenic cooling for high power laser amplifiers

    Perin, J. P.; Millet, F.; Divoky, M.; Rus, B.

    2013-11-01

    Using DPSSL (Diode Pumped Solid State Lasers) as pumping technology, PW-class lasers with enhanced repetition rates are developed. Each of the Yb YAG amplifiers will be diode-pumped at a wavelength of 940 nm. This is a prerequisite for achieving high repetition rates (light amplification duration 1 millisecond and repetition rate 10 Hz). The efficiency of DPSSL is inversely proportional to the temperature, for this reason the slab amplifier have to be cooled at a temperature in the range of 100 K-170 K with a heat flux of 1 MW*m-2. This paper describes the thermo-mechanical analysis for the design of the amplification laser head, presents a preliminary proposal for the required cryogenic cooling system and finally outlines the gain of cryogenic operation for the efficiency of high pulsed laser.

  5. Fundamentals of fiber lasers and fiber amplifiers

    Ter-Mikirtychev, Valerii (Vartan)

    2014-01-01

    This book covers the fundamental aspects of fiber lasers and fiber amplifiers, and includes a wide range of material from laser physics fundamentals to state-of-the-art topics in this rapidly growing field of quantum electronics. Emphasis is placed on the nonlinear processes taking place in fiber lasers and amplifiers, their similarities, differences to, and their advantages over other solid-state lasers. The reader will learn basic principles of solid-state physics and optical spectroscopy of laser active centers in fibers, main operational laser regimes, and practical recommendations and suggestions on fiber laser research, laser applications, and laser product development. The book will be useful for students, researchers, and professionals who work with lasers, in the optical communications, chemical and biological industries, etc.

  6. Cryogenic cooling for high power laser amplifiers

    Perin J.P.

    2013-11-01

    Full Text Available Using DPSSL (Diode Pumped Solid State Lasers as pumping technology, PW-class lasers with enhanced repetition rates are developed. Each of the Yb YAG amplifiers will be diode-pumped at a wavelength of 940 nm. This is a prerequisite for achieving high repetition rates (light amplification duration 1 millisecond and repetition rate 10 Hz. The efficiency of DPSSL is inversely proportional to the temperature, for this reason the slab amplifier have to be cooled at a temperature in the range of 100 K–170 K with a heat flux of 1 MW*m−2. This paper describes the thermo-mechanical analysis for the design of the amplification laser head, presents a preliminary proposal for the required cryogenic cooling system and finally outlines the gain of cryogenic operation for the efficiency of high pulsed laser.

  7. High power single-frequency Innoslab amplifier.

    Han, Ke-Zhen; Ning, Jian; Zhang, Bai-Tao; Wang, Yi-Ran; Zhang, Hai-Kun; Nie, Hong-Kun; Sun, Xiao-Li; He, Jing-Liang

    2016-07-10

    A laser diode array (LDA) end-pumped continuous-wave single-frequency Innoslab amplifier has been demonstrated. The Gaussian ray bundle method was used to model the light propagation in the Innoslab amplifier for the first time to the best of our knowledge. With discrete reflectors, the maximum output of 60 W with a linewidth of 44 MHz was achieved under the pump power of 245 W, corresponding to the optical-optical efficiency of 24.5%. The beam quality factor M2 at the output power of 51 W in the horizontal and vertical direction was measured to be 1.4 and 1.3, respectively. The long-term power instability in 2 h was less than 0.25%. PMID:27409308

  8. First lasing of the regenerative amplifier FEL

    The regenerative amplifier free-electron laser (RAFEL) is a high-gain RF-linac FEL capable of producing high optical power from a compact design. The combination of a high-gain and small optical feedback enables the FEL to reach saturation and produce a high optical power and high extraction efficiency without the risk of optical damage to the mirrors. This paper summarizes the first lasing of the regenerative amplifier FEL and describes recent experimental results. The highest optical energy achieved thus far at 16.3 μm is 1.7 J over a train of 900 micropulses. We infer pulse energy of 1.9 mJ in each 16 ps micropulse, corresponding to a peak power of 120 MW

  9. Noise Gain Features of Fiber Raman Amplifier

    Georgii S. Felinskyi

    2016-01-01

    Full Text Available The formation dynamics of the optical noise in a silica single mode fiber (SMF as function of the pump power variation in the counter pumped fiber Raman amplifier (FRA is experimentally studied. The ratio between the power of amplified spontaneous emission and the power of incoherent optical noise is quantitatively determined by detailed analysis of experimental data in the pump powers range of 100–300 mW within the full band of Stokes frequencies, including FRA working wavelengths over the C + L transparency windows. It is found out the maximum of Raman gain coefficient for optical noise does not exceed ~60% of corresponding peak at the gain profile maximum of coherent signal. It is shown that the real FRA noise figure may be considerably less than 3 dB over a wide wavelength range (100 nm at a pump power of several hundreds of mW.

  10. SINGLE CONVERSION ISOLATED IMPEDANCE TRANSFORMATION AMPLIFIER

    2003-01-01

    The invention relates to a switch mode power amplifier. A first and a second change-over switch are inserted between a DC voltage supply and a primary side of an isolation transformer. Two secondary windings are connected to a power output terminal. A first and a second secondary side power switch...... are adapted to connect the two secondary windings to the power connector of the power output terminal. The pulse width modulation means is adapted to generate control signals for the driver means of the first and the second change-over switch so as to cause every second pulse to be inverted. The pulse...... width modulation means is also adapted to generate a third and a fourth control signal for said driver means of the power switches of said first and said second secondary. The invention also relates to a method of controlling a switch mode power amplifier...

  11. Application module of universal amplifier in education process

    CHALOUPEK, Pavel

    2013-01-01

    This thesis deals with the teaching and implementation module for teaching in secondary schools and their role in education. Following the theory being discussed in relation to a valid educational program. Learning amplifier module implemented by the assignment to DPS. The activity of the amplifier module to simulate in Multisim simulation program. Next is made circuitry design in discrete amplifier module. There evaluated the feasibility and simulation of realizations amplifier module in sec...

  12. Noise and saturation properties of semiconductor quantum dot optical amplifiers

    Berg, Tommy Winther; Mørk, Jesper

    2002-01-01

    We present a detailed theoretical analysis of quantum dot optical amplifiers. Due to the presence of a reservoir of wetting layer states, the saturation and noise properties differ markedly from bulk or QW amplifiers and may be significantly improved.......We present a detailed theoretical analysis of quantum dot optical amplifiers. Due to the presence of a reservoir of wetting layer states, the saturation and noise properties differ markedly from bulk or QW amplifiers and may be significantly improved....

  13. Pump to signal noise transfer in parametric fiber amplifiers

    Lund-Hansen, Toke; Rottwitt, Karsten; Peucheret, Christophe; Lali-Dastjerdi, Zohreh; Rishøj, Lars Søgaard; Svane, Ask Sebastian; Andersen, Lasse Mejling; Cristofori, Valentina

    2010-01-01

    Fiber optic parametric amplifiers have been suggested due to their potential low spontaneous emission. However, by nature the parametric amplifier only work in a forward pumped configuration, which result in transfer of relative intensity noise in the pump to the signal.......Fiber optic parametric amplifiers have been suggested due to their potential low spontaneous emission. However, by nature the parametric amplifier only work in a forward pumped configuration, which result in transfer of relative intensity noise in the pump to the signal....

  14. Radiation and particle detector and amplifier

    Schmidt, K. C. (Inventor)

    1973-01-01

    A radiation or charged particle detector is described which incorporates a channel multiplier structure to amplify the detected rays or particles. The channel multiplier structure has a support multiplying element with a longitudinal slot along one side. The element supports a pair of plates positioned contiguous with the slot. The plates funnel the particles or rays to be detected into the slotted aperture and the element, thus creating an effectively wide aperture detector of the windowless type.

  15. Amplifying the Hawking Signal in BECs

    Roberto Balbinot

    2014-01-01

    Full Text Available We consider simple models of Bose-Einstein condensates to study analog pair-creation effects, namely, the Hawking effect from acoustic black holes and the dynamical Casimir effect in rapidly time-dependent backgrounds. We also focus on a proposal by Cornell to amplify the Hawking signal in density-density correlators by reducing the atoms’ interactions shortly before measurements are made.

  16. Design and simulation of a gyroklystron amplifier

    Chauhan, M. S., E-mail: mschauhan.rs.ece@iitbhu.ac.in; Swati, M. V.; Jain, P. K. [Centre of Research in Microwave Tubes, Department of Electronics Engineering, Indian Institute of Technology, Banaras Hindu University, Varanasi 221005 (India)

    2015-03-15

    In the present paper, a design methodology of the gyroklystron amplifier has been described and subsequently used for the design of a typically selected 200 kW, Ka-band, four-cavity gyroklystron amplifier. This conceptual device design has been validated through the 3D particle-in-cell (PIC) simulation and nonlinear analysis. Commercially available PIC simulation code “MAGIC” has been used for the electromagnetic study at the different location of the device RF interaction structure for the beam-absent case, i.e., eigenmode study as well as for the electron beam and RF wave interaction behaviour study in the beam present case of the gyroklystron. In addition, a practical problem of misalignment of the RF cavities with drift tubes within the tube has been also investigated and its effect on device performance studied. The analytical and simulation results confirmed the validity of the gyroklystron device design. The PIC simulation results of the present gyroklystron produced a stable RF output power of ∼218 kW for 0% velocity spread at 35 GHz, with ∼45 dB gain, 37% efficiency, and a bandwidth of 0.3% for a 70 kV, 8.2 A gyrating electron beam. The simulated values of RF output power have been found in agreement with the nonlinear analysis results within ∼5%. Further, the PIC simulation has been extended to study a practical problem of misalignment of the cavities axis and drift tube axis of the gyroklystron amplifier and found that the RF output power is more sensitive to misalignments in comparison to the device bandwidth. The present paper, gyroklystron device design, nonlinear analysis, and 3D PIC simulation using commercially available code had been systematically described would be of use to the high-power gyro-amplifier tube designers and research scientists.

  17. Design and simulation of a gyroklystron amplifier

    In the present paper, a design methodology of the gyroklystron amplifier has been described and subsequently used for the design of a typically selected 200 kW, Ka-band, four-cavity gyroklystron amplifier. This conceptual device design has been validated through the 3D particle-in-cell (PIC) simulation and nonlinear analysis. Commercially available PIC simulation code “MAGIC” has been used for the electromagnetic study at the different location of the device RF interaction structure for the beam-absent case, i.e., eigenmode study as well as for the electron beam and RF wave interaction behaviour study in the beam present case of the gyroklystron. In addition, a practical problem of misalignment of the RF cavities with drift tubes within the tube has been also investigated and its effect on device performance studied. The analytical and simulation results confirmed the validity of the gyroklystron device design. The PIC simulation results of the present gyroklystron produced a stable RF output power of ∼218 kW for 0% velocity spread at 35 GHz, with ∼45 dB gain, 37% efficiency, and a bandwidth of 0.3% for a 70 kV, 8.2 A gyrating electron beam. The simulated values of RF output power have been found in agreement with the nonlinear analysis results within ∼5%. Further, the PIC simulation has been extended to study a practical problem of misalignment of the cavities axis and drift tube axis of the gyroklystron amplifier and found that the RF output power is more sensitive to misalignments in comparison to the device bandwidth. The present paper, gyroklystron device design, nonlinear analysis, and 3D PIC simulation using commercially available code had been systematically described would be of use to the high-power gyro-amplifier tube designers and research scientists

  18. Design and simulation of a gyroklystron amplifier

    Chauhan, M. S.; Swati, M. V.; Jain, P. K.

    2015-03-01

    In the present paper, a design methodology of the gyroklystron amplifier has been described and subsequently used for the design of a typically selected 200 kW, Ka-band, four-cavity gyroklystron amplifier. This conceptual device design has been validated through the 3D particle-in-cell (PIC) simulation and nonlinear analysis. Commercially available PIC simulation code "MAGIC" has been used for the electromagnetic study at the different location of the device RF interaction structure for the beam-absent case, i.e., eigenmode study as well as for the electron beam and RF wave interaction behaviour study in the beam present case of the gyroklystron. In addition, a practical problem of misalignment of the RF cavities with drift tubes within the tube has been also investigated and its effect on device performance studied. The analytical and simulation results confirmed the validity of the gyroklystron device design. The PIC simulation results of the present gyroklystron produced a stable RF output power of ˜218 kW for 0% velocity spread at 35 GHz, with ˜45 dB gain, 37% efficiency, and a bandwidth of 0.3% for a 70 kV, 8.2 A gyrating electron beam. The simulated values of RF output power have been found in agreement with the nonlinear analysis results within ˜5%. Further, the PIC simulation has been extended to study a practical problem of misalignment of the cavities axis and drift tube axis of the gyroklystron amplifier and found that the RF output power is more sensitive to misalignments in comparison to the device bandwidth. The present paper, gyroklystron device design, nonlinear analysis, and 3D PIC simulation using commercially available code had been systematically described would be of use to the high-power gyro-amplifier tube designers and research scientists.

  19. Electrically Pumped Vertical-Cavity Amplifiers

    Greibe, Tine

    2007-01-01

    In this work, the design of electrically pumped vertical cavity semiconductor optical amplifiers (eVCAs) for use in a mode-locked external-cavity laser has been developed, investigated and analysed. Four different eVCAs, one top-emitting and three bottom emitting structures, have been designed and...... discussed. The thesis concludes with recommendations for further work towards the realisation of compact electrically pumped mode-locked vertical externalcavity surface emitting lasers....

  20. CMOS RF Power Amplifiers for Wireless Communications

    Fritzin, Jonas

    2011-01-01

    The wireless market has experienced a remarkable development and growth since the introduction of the first modern mobile phone systems, with a steady increase in the number of subscribers, new application areas, and higher data rates. As mobile phones and wireless connectivity have become consumer mass markets, the prime goal of the IC manufacturers is to provide low-cost solutions. The power amplifier (PA) is a key building block in all RF transmitters. To lower the costs and allow full int...

  1. Quantum noise in ideal operational amplifiers

    Courty, Jean-Michel; Grassia, Francesca; Reynaud, Serge

    1998-01-01

    We consider a model of quantum measurement built on an ideal operational amplifier operating in the limit of infinite gain, infinite input impedance and null output impedance and with a feddback loop. We evaluate the intensity and voltage noises which have to be added to the classical amplification equations in order to fulfill the requirements of quantum mechanics. We give a description of this measurement device as a quantum network scattering quantum fluctuations from input to output ports.

  2. Amplifying youth voices in the developing world.

    Fotenos, Saori; Rohatgi, Deepti

    2007-01-01

    Low-literacy youth in the slums of Brazil have been historically unequipped to share their ideas on how to improve their lives, because outside of the spoken word, it is difficult for them to express their thoughts persuasively. The Amplifying Voices afterschool video program piloted at Projeto Uerê in Rio de Janeiro shows that youth can leverage technological tools to voice their perspectives on social issues relevant to themselves and their communities. PMID:18271053

  3. X-band magnicon amplifier experiment

    The magnicon, a ''scanning beam'' microwave amplifier tube related to the gyrocon, is of interest as a possible replacement for klystron amplifiers in future linear accelerators. It consists of a multicavity deflection system, whose purpose is to spin up an electron beam to high transverse momentum (α ≡ υperpendicular / υz approx-gt 1), followed by an output cavity that employs a cyclotron resonant mechanism to extract principally the transverse beam momentum. The deflection cavities are designed to produce an electron beam whose entry point and guiding center rotate in space about the cavity axis at the drive frequency. The output cavity employs a synchronously rotating mode, making possible a highly efficient interaction. This paper presents an overview of magnicon theory and design considerations, and discusses the progress of an experimental program to develop a frequency-doubling magnicon amplifier at X-band. This magnicon will require a sequence of 3 or 4 deflection cavities, in order to generate the required transverse momentum, followed by an output cavity operating at twice the drive frequency. The initial experiment was designed to measure the gain between two such deflection cavities operating in the TM110 mode a 5.7 GHz. These cavities were powered by a 170A, 500 keV electron beam immersed in an 8.1 kG magnetic field. In low power amplifier experiments, a gain of ∼15 dB was observed in the preferred circular polarization, at a frequency shift of approximately -0.18%, and a gain of ∼3 dB in the opposite circular polarization, at a frequency shift of approximately +0.06%. These results are in good agreement with theory and numerical simulation. The complete magnicon experiment is presently under design, and will also be discussed

  4. Amplifier/compressor fiber Raman lasers.

    Islam, M N; Mollenauer, L F; Stolen, R H; Simpson, J R; Shang, H T

    1987-10-01

    We show that the chirp from cross-phase modulation (XPM) dominates the operation of fiber Raman lasers (FRL's). Thus a FRL in the anomalous group-velocity regime is best described as a XPM-chirped Raman amplifier followed by a linear fiber compressor. While the output of such a laser is generally a narrow pulse with a broad pedestal, we show both experimentally and by computer simulation that negligible background is achievable. PMID:19741882

  5. Gyro-amplifiers modeling with MAGY

    Levush, Baruch; Nguyen, Khanh; Botton, Moti; Vlasov Antonsen, Alexander, Jr.

    1999-11-01

    Recent modeling results of several experiments on gyroklystron amplifier at the Naval Research Laboratory are presented. Modeling was performed using the quasi three-dimensional, self-consistent code MAGY[1] . Amplifiers in both Ka- and W-bands have been studied [2,3]. Using known experimental input parameters, code-predicted salient amplifier performance characteristics, e.g. efficiency, bandwidth, drive curve, have been found to be in good agreement with experimental results. Self-consistent phenomena, such as effects of window reflections on bandwidth and higher-order-mode interaction in uptaper, will also be presented. MAGY has also been used to design gyro-TWTs. The code has been successfully benchmarked against linear theory. Issues such as absolute instability, backward-wave oscillations, and effect of reflection in gyro-TWTs have been investigated. Detailed results of design trade-off studies for a Ka-band gyro-TWT will also be presented and discussed. [1] M. Botton, et al.,IEEE Trans. Plasma Sci.,Vol.26(1998) [3] J.P. Calame, et al.,Phys. of Plasmas,Vol.6(1999) [4] M. Blank, et al.,Submitted to Phys. of Plasmas (1999)

  6. High Power 35GHz Gyroklystron Amplifiers

    Choi, Jin; McCurdy, A.; Wood, F.; Kyser, R.; Danly, B.; Levush, B.; Parker, R.

    1997-05-01

    High power coherent radiation sources at 35GHz are attractive for next generation high gradient particle accelerators. A multi-cavity gyroklystron amplifier is considered a promising candidate for high power millimeter wave generation. Experiments on two-cavity and three cavity gyroklystron amplifiers are underway to demonstrate a 140kW, 35GHz coherent radiation amplification. Though this power is low compared with that needed for colliders, many of the issues associated with the bandwidth of such devices can be addressed in the present experiments. High bandwidth is important to permit the rapid phase shifts required for RF pulse compression schemes presently under investigation. Large signal calculations (P.E. Latham, W. Lawson, V. Irwin, IEEE Trans. Plasma Sci., Vol. 22, No. 5, pp. 804-817, 1994.) predict that the two-cavity gyroklystron produces a peak power of 140kW, corresponding to 33% efficiency. Calculations also show that a stagger tuned three cavity circuit increases a bandwidth to more than 0.7%. Experimental results of the amplifier will be presented and compared with the theory.

  7. The development of DUV chemically amplified resists

    Thackeray, J.W.; Fedynyshyn, T.H.; Small, R.D. [Shipley Co. Inc., Marlboro, MA (United States)

    1993-12-31

    The development of deep ultraviolet (DUV) resists has necessitated the introduction of new concepts in resist materials and chemistry. Successful DUV resist systems now employ the concept of chemical amplification. This catalytic reaction leads to a substantial enhancement in the imaging dose. Another benefit of chemical amplified resists is that they allow the design of materials which can be transparent to DUV exposure wavelengths, yet they can still have high sensitivity. Commercial and prototype positive- and negative-tone resists are now readily available and these resists have been used in pilot production to make the most advanced integrated circuits with {le}0.35 {mu}m design rules. At Shipley, we have undertaken to develop both negative- and positive-tone chemically amplified resists for DUV lithography. These resists are capable of high resolution (0.3 {mu}m), fast photospeed ({le}30 mJ/sq. cm), and excellent etch resistance. This presentation will discuss the chemical and lithographic properties of the Shipley negative- and positive-tone DUV chemically amplified resists. General discussion of the importance of activation energy for the catalytic process, catalytic chain length, and environmental stability will be given.

  8. Charge sensitive amplifies. The state of arts

    Mori, Kunishiro [Clear Pulse Co., Tokyo (Japan)

    1996-07-01

    In the radiation detectors, signals are essentially brought with charges produced by radiation, then it is naturally the best way to use a charge sensitive amplifier (CSA) system to extract those signals. The CSA is thought to be the best amplifier suitable to almost all the radiation detectors, if neglecting economical points of view. The CSA has been only applied to special fields like radiation detection because the concept of `charges` is not so universal against the concepts of `voltage` and `current`. The CSA, however, is low in noise and a high speed amplifier and may be applicable not only to radiation measurement but also piezoelectric devices and also bolometers. In this article, noise in the CSA, basic circuit on the CSA, concepts of `equivalent noise charge` (ENC), a method for the ENC, and importance of the `open-loop gain` in the CSA to achieve better performance of it and how to realize in a practical CSA were described. And, characteristics on a counting rate of the CSA, various circuit used in the CSA, and CSAs which are commercially available at present and special purpose CSAs were also introduced. (G.K.)

  9. Polarization of Tapered Semiconductor Travelling-Wave Amplifiers

    Huang Dexiu; Li Hong

    2001-01-01

    The polarization of a tapered semi-conductor travelling-wave amplifier has been investigated with the transfer matrix method based on convective equation. It is shown that the apparent polarization mode competition exists, and polarization-independent tapered semiconductor travellingwave amplifiers can be obtained through the optimization of amplifier parameters.

  10. Digital system provides superregulation of nanosecond amplifier-discriminator circuit

    Forges, K. G.

    1966-01-01

    Feedback system employing a digital logic comparator to detect and correct amplifier drift provides stable gain characteristics for nanosecond amplifiers used in counting applications. Additional anticoincidence logic enables application of the regulation circuit to the amplifier and discriminator while they are mounted in an operable circuit.

  11. AcEST: DK948526 [AcEST

    Full Text Available TST38A01NGRL0003_I19 675 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0003_I19. 5' end seq ... IAMVRTTTPVYV 214 Query: 542 ALALFNQARVSSLPIIDDNGSLIDIY ARSDITALARDDTY 661 AL +F Q RVS+LP++D+ G ++DIY ++ D+ ... LA + TY Sbjct: 215 ALGIFVQHRVSALPVVDEKGRVVDIY SKFDVINLAAEKTY 254 >sp|Q09138|AAKG1_PIG 5'-AMP-acti ... IAMVRTTTPVYV 215 Query: 542 ALALFNQARVSSLPIIDDNGSLIDIY ARSDITALARDDTY 661 AL +F Q RVS+LP++D+ G ++DIY ++ D+ ... LA + TY Sbjct: 216 ALGIFVQHRVSALPVVDEKGRVVDIY SKFDVINLAAEKTY 255 >sp|O54950|AAKG1_MOUSE 5'-AMP-ac ...

  12. AcEST: DK962916 [AcEST

    Full Text Available TST39A01NGRL0015_C06 596 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0015_C06. 5' end seq ... NA. clone: TST39A01NGRL0015_C06. 5' end sequence. Acce ssion DK962916 Tissue type prothallia with plantlet ... 2 Query: 317 MPKSKEPCSQEACDIQTCLVKNNFITERCFPVIEALQACCE K 442 MP+ K+PC ++AC+IQ CL NN++ +C VI+ L+ CC + Sbjct ... me = +2 Query: 335 PCSQEACDIQTCLVKNNFITERCFPVIEALQACCE K 442 PC +EAC IQ CL+ + + +C VI+ L CC K Sbjct: 4 PCQ ... = +2 Query: 326 SKEPCSQEACDIQTCLVKNNFITERCFPVIEALQACCE KCNSK 454 + E C+ CD +TC +K F +C AL CCE KC K Sbjct: 4 ...

  13. AcEST: DK955705 [AcEST

    Full Text Available TST39A01NGRL0023_N02 635 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0023_N02. 5' end seq ... NA. clone: TST39A01NGRL0023_N02. 5' end sequence. Acce ssion DK955705 Tissue type prothallia with plantlet ... 2 Query: 296 MPKSKEPCSQEACDIQTCLVKNNFITERCFPVIEALQACCE K 421 MP+ K+PC ++AC+IQ CL NN++ +C VI+ L+ CC + Sbjct ... me = +2 Query: 314 PCSQEACDIQTCLVKNNFITERCFPVIEALQACCE K 421 PC +EAC IQ CL+ + + +C VI+ L CC K Sbjct: 4 PCQ ... = +2 Query: 305 SKEPCSQEACDIQTCLVKNNFITERCFPVIEALQACCE KCNSK 433 + E C+ CD +TC +K F +C AL CCE KC K Sbjct: 4 ...

  14. AcEST: DK961330 [AcEST

    Full Text Available FWVPCMHTPIKQEKHTHA 405 +AR P W +++PI+ ++C++ P + AK+ PL DVTH+F+V + +QE Sbjct: 61 VARRTRP-SWHEDNPINYVQCDISDPDD...+IL +D PGGPWKVYG Sbjct: 4 WWAGAIGAAKKKLEEDDAPPKHS---SVALIVGVTGIIGNSLAEILPLADTPGGP...AWHEDNPINYIQCDISDPDDSLAKLSPLTDVTHVFYVTCANR--STEPENCE 117 Query: 406 MATHMFENIIGVLLTHAPNLQHVCMQTSDKHY-... : Swiss-Prot sp_hit_id Q7MXT7 Definition sp|Q7MXT7|LPXD_PORGI UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac...lue sp|Q7MXT7|LPXD_PORGI UDP-3-O-[3-hydroxymyristoyl] glucosamine N-... 34 0.62 sp|P60369|KR103_HUMAN Kerati

  15. AcEST: BP913772 [AcEST

    Full Text Available N VT V L C+ G G+ H Sbjct: 350 NVVTWSAVIAGYAQRGLGFEALDVFRQMRLCGSEPNVVTLVSLLSGCALAGTLLHGKETH 409 Query: 376 IEIER--RGLLEVDP-...VFNKLSVQDIVSW 236 + + A ++G+++H I RRGL + PV+ + LV MY R G L Q VF+++ +D+VSW Sbjct: 296 ASLAALEQGKLIHGYILRRGLDSILPVI-S... TF M+ +PN+VT V VL+AC+ + Q + Sbjct: 250 SWSAMIACYAKNGKAFEALRTFREMMRETKDSSPNSVTMVSVLQACASLA...MIEGGVAPNAVTFVVVLRACSQTGSYSQSQTFFEAMSKNF 50 + G A G + F+ M + GV PNAVTFV VLR CS G + Q F++M F Sbjct: 312 ALNGLAMNGFGEKCLELFSL...L YA G + + +F++ D+ +TA + + Sbjct: 48 IHAAILRHNLLLHPRYPVLNLKLHRAYASHGKIRHSLALFHQTIDP

  16. AcEST: DK952954 [AcEST

    Full Text Available TST38A01NGRL0015_H21 616 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0015_H21. 5' end seq ... LIHAHIVCSCNDVDNFVRSTLVNLYSKCGSIEDAHNVFAKLATRRSVDWSMMIS ... 541 ++ Q K +HA I + D + V + L+++Y+KCGSI DA F +++T+ ... LIHAHIVCSCNDVDNFVRSTLVNLYSKCGSIEDAHNVFAKLATRRSVDWSMMIS GS 547 + + IHA S D ++ LV LYS+CG IE+++ F + ++ W+ ++S ... LIHAHIVCSCNDVDNFVRSTLVNLYSKCGSIEDAHNVFAKLATRRSVDWSMMIS ... 541 DL + IH+ I+ + ++ +V S L+++Y+K G ++ A ++ + A + ... EA+ LF +M G+ P + + L AC Sbjct: 243 RVFDGLRLKDHSSWVAMIS GLSKNECEAEAIRLFCDMYVLGIMPTPYAFSSVLSACKKIE 302 Query ...

  17. AcEST: BP912540 [AcEST

    Full Text Available YMU001_000020_B03 501 Adiantum capillus-veneris mRNA. clone: YMU001_000020_B03. BP912540 - Show ... 2 EELTVHHTASVGDVEALKALLAEGADKDEKDSEGRTALHFACGYGEVMCAE VLLEAGVAV 181 EE VH TAS+GDVE LKA LA G +KDE+DSEGRTAL ... ry: 14 VHHTASVGDVEALKALLAEGADKDEKDSEGRTALHFACGYGEVMCAE VLLEAGVAVDAVD 193 +H A V ++ LL GAD KD G LH AC YG AE ... uery: 26 ASVGDVEALKALLAEGADKDEKDSEGR--TALHFACGYGEVMCAE VLLEAGVAVDAVDKN 199 + GD+E +K L + + + +D EGR T LHFA ... ry: 14 VHHTASVGDVEALKALLAEGADKDEKDSEGRTALHFACGYGEVMCAE VLLEAGVAVDAVD 193 +H A ++E + LL GAD + +D G LH A YG ...

  18. Analysis of multipass laser amplifier systems for storage laser media

    The performance characteristics of single pass and multipass storage laser amplifiers are presented and compared. The effects of the multipass amplifier parameters on the extraction characteristics are examined. For a wide range of conditions the multipass amplifier is found to provide high energy gain and high efficiency simultaneously. This is a significant advantage over the single pass laser amplifier. Finally, three specific storage laser amplifier systems, flashlamp pumped V:MgF2, XeF laser pumped Tm:Glass, and photolytically pumped Selenium, are examined. The performance characteristics for each of the three systems are calculated and compared

  19. Analysis of multipass laser amplifier systems for storage laser media

    Harvey, J.F.

    1980-03-25

    The performance characteristics of single pass and multipass storage laser amplifiers are presented and compared. The effects of the multipass amplifier parameters on the extraction characteristics are examined. For a wide range of conditions the multipass amplifier is found to provide high energy gain and high efficiency simultaneously. This is a significant advantage over the single pass laser amplifier. Finally, three specific storage laser amplifier systems, flashlamp pumped V:MgF/sub 2/, XeF laser pumped Tm:Glass, and photolytically pumped Selenium, are examined. The performance characteristics for each of the three systems are calculated and compared.

  20. Characterization of a Common-Gate Amplifier Using Ferroelectric Transistors

    Hunt, Mitchell; Sayyah, Rana; MacLeod, Todd C.; Ho, Fat D.

    2011-01-01

    In this paper, the empirical data collected through experiments performed using a FeFET in the common-gate amplifier circuit is presented. The FeFET common-gate amplifier was characterized by varying all parameters in the circuit, such as load resistance, biasing of the transistor, and input voltages. Due to the polarization of the ferroelectric layer, the particular behavior of the FeFET common-gate amplifier presents interesting results. Furthermore, the differences between a FeFET common-gate amplifier and a MOSFET common-gate amplifier are examined.

  1. Characterization of a Common-Source Amplifier Using Ferroelectric Transistors

    Hunt, Mitchell; Sayyah, Rana; MacLeond, Todd C.; Ho, Pat D.

    2010-01-01

    This paper presents empirical data that was collected through experiments using a FeFET in the established common-source amplifier circuit. The unique behavior of the FeFET lends itself to interesting and useful operation in this widely used common-source amplifier. The paper examines the effect of using a ferroelectric transistor for the amplifier. It also examines the effects of varying load resistance, biasing, and input voltages on the output signal and gives several examples of the output of the amplifier for a given input. The difference between a commonsource amplifier using a ferroelectric transistor and that using a MOSFET is addressed.

  2. Speed Control of DC Motor using AC/AC/DC Converter Based on Intelligent Techniques

    Rakan Kh Antar

    2013-01-01

       This paper describes the application of ac/ac/dc and ac/dc converters to control the speed of a separately excited DC motor. Artificial neural network and PI controller are trained to select the desired values of firing angles for triggering thyristors of the ac/ac/dc and ac/dc bridge converters in order to control the speed of the dc motor at a desired value with constant and different load torques in order to obtain the best speed response. Simulation results show that the rising time fo...

  3. Increased long-flight activity triggered in beet armyworm by larval feeding on diet containing Cry1Ac protoxin.

    Jiang, Xing Fu; Chen, Jian; Zhang, Lei; Sappington, Thomas W; Luo, Li Zhi

    2013-01-01

    Evaluating ecological safety and conducting pest risk analysis for transgenic crops are vitally important before their commercial planting. The beet armyworm, Spodoptera exigua, a long-distance migratory insect pest, is not a direct target of transgenic Cry1Ac-expressing cotton in China, but nevertheless it has recently become an important pest. Migrants leaving their natal field arrive in other appropriate habitat far away in a short time, often followed by larval outbreaks. S. exigua has low susceptibility to Cry1Ac. However, our results from laboratory experiments identified (i) sublethal effects of Cry1Ac protoxin on larval development rate, larval and pupal weight, and adult lifetime fecundity, and (ii) increased long-flight behavior triggered by Cry1Ac which may contribute to larval outbreaks elsewhere. No significant differences in larval mortality, pupation rate, adult emergence rate, longevity, pre-oviposition period, or oviposition period were observed between controls and larvae fed on artificial diet incorporating a low concentration of Cry1Ac protoxin. The negative sublethal effects on some developmental and reproductive traits and lack of effect on others suggest they do not contribute to the observed severity of S. exigua outbreaks after feeding on Cry1Ac cotton. Interestingly, the percentage of long fliers increased significantly when larvae were reared on diet containing either of two low-dose treatments of Cry1Ac, suggesting a possible increased propensity to disperse long distances triggered by Cry1Ac. We hypothesize that negative effects on development and reproduction caused by Cry1Ac in the diet are offset by increased flight propensity triggered by the poor food conditions, thereby improving the chances of escaping adverse local conditions before oviposition. Increased long-flight propensity in turn may amplify the area damaged by outbreak populations. This phenomenon might be common in other migratory insect pests receiving sublethal doses

  4. Increased long-flight activity triggered in beet armyworm by larval feeding on diet containing Cry1Ac protoxin.

    Xing Fu Jiang

    Full Text Available Evaluating ecological safety and conducting pest risk analysis for transgenic crops are vitally important before their commercial planting. The beet armyworm, Spodoptera exigua, a long-distance migratory insect pest, is not a direct target of transgenic Cry1Ac-expressing cotton in China, but nevertheless it has recently become an important pest. Migrants leaving their natal field arrive in other appropriate habitat far away in a short time, often followed by larval outbreaks. S. exigua has low susceptibility to Cry1Ac. However, our results from laboratory experiments identified (i sublethal effects of Cry1Ac protoxin on larval development rate, larval and pupal weight, and adult lifetime fecundity, and (ii increased long-flight behavior triggered by Cry1Ac which may contribute to larval outbreaks elsewhere. No significant differences in larval mortality, pupation rate, adult emergence rate, longevity, pre-oviposition period, or oviposition period were observed between controls and larvae fed on artificial diet incorporating a low concentration of Cry1Ac protoxin. The negative sublethal effects on some developmental and reproductive traits and lack of effect on others suggest they do not contribute to the observed severity of S. exigua outbreaks after feeding on Cry1Ac cotton. Interestingly, the percentage of long fliers increased significantly when larvae were reared on diet containing either of two low-dose treatments of Cry1Ac, suggesting a possible increased propensity to disperse long distances triggered by Cry1Ac. We hypothesize that negative effects on development and reproduction caused by Cry1Ac in the diet are offset by increased flight propensity triggered by the poor food conditions, thereby improving the chances of escaping adverse local conditions before oviposition. Increased long-flight propensity in turn may amplify the area damaged by outbreak populations. This phenomenon might be common in other migratory insect pests receiving

  5. Low noise amplifier for ZnS(Ag) scintillation chamber

    A new pulse amplifier that can be used with standard photomultiplier tubes coupled with Zn(Ag) scintillation chamber is presented. The amplifier based on an IC operational amplifier LF 356N consists of a low-noise charge sensitive preamplifier and pulse shaping circuits for optimization of signal to noise ratio. Temperature instability is ≤ 0.05%/oC. Dynamic range for linear output signals is equal +7 V. The presented amplifier is used in a measuring head for 0.17 L Lucas chambers developed in Department of Nuclear Instruments and Methods of the INCT in laboratory investigations aimed to develop methods and instruments for measurement of radon concentration in the air. The amplifier can also be employed for measurement of ionizing radiation by means of other scintillators coupled to PM tube. The amplifier is followed by a pulse discriminator with adjustable discrimination level. The amplifier output signal and discriminator output pulses are fed to external devices. (author)

  6. A cryo-amplifier working in a double loop-flux locked loop scheme for SQUID readout of TES detectors

    Torrioli, Guido; Bastia, Paolo; Piro, Luigi; Macculi, Claudio; Colasanti, Luca

    2010-07-01

    In this paper we report on a novel SQUID readout scheme, called Double Loop-Flux Locked loop (DL-FLL), that we are investigating in the frame of ASI and ESA technological development contracts. This scheme is based on the realization of a cryogenic amplifier which is used in order to readout TES detectors in the Frequency Division Multiplexing technique, where high loop-gain is required up to few MHz. Loop-gain in feedback systems is, usually, limited by the propagation delay of the signals traveling in the loop because of the distance between the feedback loop elements. This problem is particularly evident in the case of SQUID systems, where the elements of the feedback loop are placed both at cryogenic and room temperature. To solve this issue we propose a low power dissipation cryo-amplifier capable to work at cryogenic temperatures so that it can be placed close to the SQUID realizing a local cryogenic loop. The adoption of the DL-FLL scheme allows to simplify considerably the cryo-amplifier which, being AC-coupled, don't require the features of a precision DC-coupled amplifier and can be made with a limited number of electronic components and with a consequent reduction of power dissipation.

  7. Universality of ac conduction in disordered solids

    Dyre, Jeppe; Schrøder, Thomas

    2000-01-01

    non-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally......The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual...

  8. Time amplifying techniques towards atomic time resolution

    2009-01-01

    High speed imaging technology has opened applications in many fields,such as collision,detonating, high voltage discharge,disintegration and transfer of phonon and exciton in solid,photosynthesis primitive reaction,and electron dynamics inside atom shell.In principle,all of the transient processes need to be explained theoretically and,at the same time,the time amplifying technique is required for observations of these processes.The present review concerns the atomic time amplifying mechanism of optical information and the extremely-high speed imaging methods,which are expressed in terms of the short time amplifying techniques.It is well-known that for extremely-high speed imaging with the converter tube,the temporal resolution is in the order of sub-picosecond of the streak imaging,and the imaging frequency is 6×10 8 ―5×10 9 fps(frame per second)of the frame imaging.On the other hand,for the tubeless extremely-high speed imaging,the imaging frequency is 10 7 ―10 14 fps,and its mechanism of forming high speed and framing could involve a lot of factors of the light under investigation,for instance,light speed,light parallelism,the parameters of light wave such as amplitude,phase,polari- zation and wavelength,and even quantum properties of photon.In the cascaded system of electro- magnetic wave and particle wave,it is possible to simultaneously realize extremely-high resolution in time and space,which is higher than a kite resolution.Then it would be possible to break the limit of the Heisenberg uncertainty relation of the optical frequency band.

  9. Time amplifying techniques towards atomic time resolution

    LI JingZhen

    2009-01-01

    High speed imaging technology has opened applications in many fields,such as collision,detonating,high voltage discharge,disintegration and transfer of phonon and exciton in solid,photosynthesis primitive reaction,and electron dynamics inside atom shell.In principle,all of the transient processes need to be explained theoretically and,st the same time,the time amplifying technique is required for observations of these processes.The present review concerns the atomic time amplifying mechanism of optical information and the extremely-high speed imaging methods,which are expressed in terms of the short time amplifying techniques.It is well-known that for extremely-high speed imaging with the converter tube,the temporal resolution is in the order of sub-picosecond of the streak imaging,and the imaging frequency is 6×10~8-5×10~9 fps(frame per second)of the frame imaging.On the other hand,for the tubeless extremely-high speed imaging,the imaging frequency is 10~7-10~(14) fps,and its mechanism of forming high speed and framing could involve a lot of factors of the light under investigation,for instance,light speed,light parallelism,the parameters of light wave such as amplitude,phase,polarization and wavelength,and even quantum properties of photon.In the cascaded system of electromagnetic wave and particle wave,it is possible to simultaneously realize extremely-high resolution in time and space,which is higher than a kite resolution.Then it would be possible to break the limit of the Heisenberg uncertainty relation of the optical frequency band.

  10. High sensitivity amplifier/discriminator for PWC's

    The facility support group at Fermilab is designing and building a general purpose beam chamber for use in several locations at the laboratory. This pwc has 128 wires per plane spaced 1 mm apart. An initial production of 25 signal planes is anticipated. In proportional chambers, the size of the signal depends exponentially on the charge stored per unit of length along the anode wire. As the wire spacing decreases, the capacitance per unit length decreases, thereby requiring increased applied voltage to restore the necessary charge per unit length. In practical terms, this phenomenon is responsible for difficulties in constructing chambers with less than 2 mm wire spacing. 1 mm chambers, therefore, are frequently operated very near to their breakdown point and/or a high gain gas containing organic compounds such as magic gas is used. This argon/iso-butane mixture has three drawbacks: it is explosive when exposed to the air, it leaves a residue on the wires after extended use and is costly. An amplifier with higher sensitivity would reduce the problems associated with operating chambers with small wire spacings and allow them to be run a safe margin below their breakdown voltage even with an inorganic gas mixture such as argon/CO2, this eliminating the need to use magic gas. Described here is a low cost amplifier with a usable threshold of less than 0.5 μA. Data on the performance of this amplifier/discriminator in operation on a prototype beam chamber are given. This data shows the advantages of the high sensitivity of this design

  11. Feedback analysis of transimpedance operational amplifier circuits

    Bruun, Erik

    1993-01-01

    The transimpedance or current feedback operational amplifier (CFB op-amp) is reviewed and compared to a conventional voltage mode op-amp using an analysis emphasizing the basic feedback characteristics of the circuit. With this approach the paradox of the constant bandwidth obtained from CFB op......-amps is explained. It is demonstrated in a simple manner that the constant gain-bandwidth product of the conventional op-amp and the constant bandwidth of the CFB op-amp are both in accordance with basic feedback theory and that the differences between the traditional op-amp and the CFB op-amp are due to...

  12. Undulations from amplified low frequency surface waves

    We study the linear scattering of gravity waves in longitudinal inhomogeneous stationary flows. When the flow becomes supercritical, it is known that counterflow propagating shallow waves are blocked and converted into deep waves. Here we show that in the zero-frequency limit, the reflected waves are amplified in such a way that the free surface develops an undulation, i.e., a zero-frequency wave of large amplitude with nodes located at specific places. This amplification involves negative energy waves and implies that flat surfaces are unstable against incoming perturbations of arbitrary small amplitude. The relation between this instability and black hole radiation (the Hawking effect) is established

  13. Undulations from amplified low frequency surface waves

    Coutant, Antonin

    2012-01-01

    We study the scattering of gravity waves in longitudinal stationary flows. When the flow velocity becomes supercritical, counterflow propagating waves are amplified in such a way that, in the zero-frequency limit, the free surface develops an undu- lation, i.e., a zero-frequency wave of large amplitude with nodes located at specific places. From this, we show that the unperturbed flat surface is unstable against perturbations of arbitrary small amplitude. We then show that this instability also appears when treating low frequency waves by a stochastic ensemble. The relation between the generation of undulations and black hole radiation (the Hawking effect) is discussed.

  14. Envelope tracking power amplifiers for wireless communications

    Wang, Zhancang

    2014-01-01

    Envelope tracking technology is seen as the most promising efficiency enhancement technology for RF power amplifiers for 4G and beyond wireless communications. More and more organizations are investing and researching on this topic with huge potential in academic and commercial areas.This is the first book on the market to offer complete introduction, theory, and design considerations on envelope tracking for wireless communications. This resource presents you with a full introduction to the subject and covers underlying theory and practical design considerations.

  15. Short term dynamic aperture with AC dipoles

    Mönig, Saskia; Persson, Tobias Hakan Bjorn; Coello De Portugal, Jaime; Langner, Andy; Tomas, Rogelio; CERN. Geneva. ATS Department

    2015-01-01

    The dynamic aperture of an accelerator is determined by its non-linear components and errors. Control of the dynamic aperture is important for a good understanding and operation of the accelerator. The AC dipole, installed in the LHC for the diagnostic of linear and non-linear optics, could serve as a tool for the determination of the dynamic aperture. However, since the AC dipole itself modifies the non-linear dynamics, the dynamic aperture with and without AC dipole are expected to differ. The effect of the AC dipole on the dynamic aperture is studied within this note.

  16. ac electroosmosis in rectangular microchannels.

    Campisi, Michele; Accoto, Dino; Dario, Paolo

    2005-11-22

    Motivated by the growing interest in ac electroosmosis as a reliable no moving parts strategy to control fluid motion in microfluidic devices for biomedical applications, such as lab-on-a-chip, we study transient and steady-state electrokinetic phenomena (electroosmosis and streaming currents) in infinitely extended rectangular charged microchannels. With the aid of Fourier series and Laplace transforms we provide a general formal solution of the problem, which is used to study the time-dependent response to sudden ac applied voltage differences in case of finite electric double layer. The Debye-Huckel approximation has been adopted to allow for an algebraic solution of the Poisson-Boltzmann problem in Fourier space. We obtain the expressions of flow velocity profiles, flow rates, streaming currents, as well as expressions of the complex hydraulic and electrokinetic conductances. We analyze in detail the dependence of the electrokinetic conductance on the extension of linear dimensions relative to the Debye length, with an eye on finite electric double layer effects. PMID:16351310

  17. DESARROLLO RURAL A.C.

    Alfredo Aguilar Valdés

    2015-01-01

    Full Text Available El objetivo de este trabajo fue analizar el diagnostico situacional de una Empresa de Servicios Profesionales en el caso de: Instituto de Promoción Para el Desarrollo Rural A.C., a través de la Metodología “UALAE” así como la oportunidad que como empresa presenta. Este estudio se realizó en el municipio de Saltillo, Coahuila, México. Adoptó esta Metodología UALAE y se difundió su opinión. El Instituto de Promoción Para el Desarrollo Rural A.C., está formado por profesionistas y productores cuya finalidad es la de contribuir al desarrollo del medio rural con proyectos de viabilidad técnica, económica y social, sobre la base de necesidades reales y al aprovechamiento sustentable del potencial de los recursos naturales. Su buen funcionamiento es indispensable e importante para el desarrollo de los productores agropecuarios principalmente, debido a que se ven muy beneficiados con todos los servicios que se les brinda, se han logrado buenos proyectos, buenas capacitaciones y un gran crecimiento de sus productos. Mediante el proceso de asistencia técnica a organizaciones de productores, se induce la formulación adecuada de proyectos viables desde el punto visto del mercado, la rentabilidad económica, las tecnologías disponibles y de la organización social.

  18. Development of 3 kW at 325 MHz solid-state RF power amplifier using four power amplifier modules

    Ramarao, B. V.; Sonal, S.; Mishra, J. K.; Pande, M.; Singh, P.; Kumar, G.; Mukherjee, J.

    2014-01-01

    A high power solid-state RF power amplifier of 3 kW at 325 MHz has been developed using only four RF power amplifier modules of 850 W power output each. The design and characterization of RF power modules have been presented. A four way Wilkinson power combiner adds the output of four power amplifier modules with a total transmission loss of less than 6%. The combined power amplifier has a power gain of 20.2 dB at 1-dB compression point, and the corresponding output power is 2.8 kW at 325 MHz. The drain efficiency of the power amplifier is 65.3% at 3 kW. All the harmonics of this amplifier are below -40 dBc. The amplifier has better characteristics like fewer numbers of active devices per kilo watt, high efficiency, high gain, and ruggedness etc for RF accelerator applications.

  19. AcEST: BP920845 [AcEST

    Full Text Available 45|Adiantum capillus-veneris mRNA, clone: YMU001_000142_D08. (514 letters) Database: uniprot_sprot.fasta 412,525 seq...P7 OS=Magnapor... 33 1.0 sp|Q7VF68|SYH_HELHP Histidyl-tRNA synthetase OS=Helicobacter hep... 31 3.8 sp|P1305...90 FTGFLVLHSEPRQQPQVDL 1608 >sp|A4QX49|DBP7_MAGGR ATP-dependent RNA helicase DBP7 OS=Magnaporthe grise...T PT VT+H + T+ AC+ A+TT+ H H Sbjct: 481 PPKETKPTK------PVTNHTESTVGKACYITSAANTTITLHKLH 519 >sp|Q7VF68|SYH_HELHP His...rot_trembl.fasta 7,341,751 sequences; 2,391,615,440 total letters Searching.................................

  20. AcEST: DK960083 [AcEST

    Full Text Available ome P450 71D7 OS=Solanum chacoense ... 96 1e-19 sp|Q9SAB6|C71AI_ARATH Cytochrome ...... 96 2e-19 sp|P93530|C71D6_SOLCH Cytochrome P450 71D6 OS=Solanum chacoense ... 94 5e-19 sp|Q9T0K2|C71AK_AR... paten... 176 1e-42 tr|Q9AXP9|Q9AXP9_POPJC Cinnamate 4-hydroxylase OS=Populus jackii... 176 2e-42 tr|Q40907|Q40907_POPKI Cinnamic ac...8 KVVQQSRGAWEDEALRVIQDLKA 160 >tr|Q9AXP9|Q9AXP9_POPJC Cinnamate 4-hydroxylase OS=Populus jackii GN=C4H PE=2 ...e-42 tr|A9PBZ7|A9PBZ7_POPTR Putative uncharacterized protein OS=Popul... 176 2e-4

  1. AcEST: DK955376 [AcEST

    Full Text Available TST39A01NGRL0022_O23 611 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0022_O23. 5' end seq ... LMDETRAAGIKL 210 Query: 602 AIC 610 A+C Sbjct: 211 AVC ... 213 >tr|A9SM81|A9SM81_PHYPA Predicted protein OS=P ... C 610 VLELMD A+ KGLKVA+C Sbjct: 196 VLELMDAAREKGLKVAVC ... 213 >tr|Q8L7U1|Q8L7U1_ARATH AT4g39970/T5J17_140 OS ... LKVAIC 610 LMDEA+A G K+A+C Sbjct: 182 RLMDEAKAAGKKLAVC ... 197 >tr|Q680K2|Q680K2_ARATH MRNA, complete cds, cl ... LKVAIC 610 LMDEA+A G K+A+C Sbjct: 182 RLMDEAKAAGKKLAVC ... 197 >tr|Q8LAS1|Q8LAS1_ARATH Putative uncharacteriz ...

  2. AcEST: BP913416 [AcEST

    Full Text Available GCATGTAGTTTGGA CAGAGATG ■■Homology search results ■■ - Swiss-Prot (release 56.9) Link to BlastX Result : Swi...AC_BACFN Uronate isomerase OS=Bacteroides fragilis (... 30 4.5 sp|Q3ITT7|SYA_NATPD Alanyl-tRNA synthetase OS=Natronomonas phar...C++ N IP+ M C Sbjct: 417 LSYPRHEYFRRTLCNLLGCDVENGEIPLSEMERVC 451 >sp|Q3ITT7|SYA_NATPD Alanyl-tRNA synthetase OS=Natronomonas phar...ng, Webb Miller, and David J. Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database searc...148,809,765 total letters Searching..................................................done Score E Sequences

  3. AcEST: DK947388 [AcEST

    Full Text Available Lipman (1997), Gapped BLAST and PSI-BLAST: a new generation of protein database search programs, Nucleic Ac...ids Res. 25:3389-3402. Query= DK947388|Adiantum capillus-veneris mRNA, clone: YMU02A01NGRL0015_L18, 5' (587 letters) Databa... generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= DK947388|Adiantum c...apillus-veneris mRNA, clone: YMU02A01NGRL0015_L18, 5' (587 letters) Database: uniprot_trembl.fasta...-ribosylation factor 1 OS=Salix bakko GN... 268 1e-71 sp|P49076|ARF_MAIZE ADP-ribosylation factor OS=Zea may

  4. AcEST: BP916217 [AcEST

    Full Text Available inase kinase 7-interacting protein 3 OS=Mus musculus Align length 119 Score (bit) 35.0 E-value 0.16 Report B...visiae GN... 30 6.8 >sp|Q571K4|TAB3_MOUSE Mitogen-activated protein kinase kinase kinase 7-interacting protein 3 OS=Mus musculus...protein kinase kinase kinase 7 interacting protein 3 OS=Mus musculus GN=Map3k7ip3 PE=2 SV=1 Length = 716 Sco...(3)malignant brain tumor-like 2 prot... 31 2.3 sp|P33234|ADIY_ECOLI HTH-type transcriptional regulator adiY ...ZZC3_PSEU2 Membrane protein, putative OS=Pseudomonas... 35 2.5 tr|Q5U7D5|Q5U7D5_9BACI OpuAC OS=Halobacillus trueperi GN=opu

  5. AcEST: DK953324 [AcEST

    Full Text Available |LSRR_PHOLL Transcriptional regulator lsrR OS=Photorhab... 30 6.1 sp|A0JY64|ATPB_ARTS2 ATP synthase subunit beta OS=Arthroba...cter s... 30 6.1 sp|A1R7V3|ATPB_ARTAT ATP synthase subunit beta OS=Arthroba...ATP synthase subunit beta OS=Arthrobacter sp. (strain FB24) GN=atpD PE=3 SV=1 Len...KD 372 Query: 311 HLHFTHRGKQRL 346 H + R KQ L Sbjct: 373 HYNTAVRVKQIL 384 >sp|A1R7V3|ATPB_ARTAT ATP synthase subunit beta OS=Arthroba...T and PSI-BLAST: a new generation of protein database search programs, Nucleic Ac

  6. AcEST: DK945049 [AcEST

    Full Text Available R 148 >sp|Q9X5X3|ATCU_SINMW Copper-transporting P-type ATPase OS=Sinorhizobium medicae (strain WSM419) GN=ac...|Q4EPP8|Q4EPP8_LISMO Heavy metal-binding protein OS=Listeria m... 34 3.2 tr|A6AST1|A6AST1_VIBHA Copper-trans..... 31 2.7 sp|Q4X0S7|DPH1_ASPFU Diphthamide biosynthesis protein 1 OS=Asper... 30 4.5 sp|A2VDJ0|T131L_HUMAN Transmembran...P58342|ATCU2_RHIME Copper-transporting ATPase 2 OS=Rhizobium meliloti Align length 75 Score (bit) 34.7 E-val...sophila ... 30 7.8 >sp|P58342|ATCU2_RHIME Copper-transporting ATPase 2 OS=Rhizobium me

  7. Silicon on Insulator MESFETs for RF Amplifiers.

    Wilk, Seth J; Balijepalli, Asha; Ervin, Joseph; Lepkowski, William; Thornton, Trevor J

    2010-03-01

    CMOS compatible, high voltage SOI MESFETs have been fabricated using a standard 3.3V CMOS process without any changes to the process flow. A 0.6μm gate length device operates with a cut-off frequency of 7.3GHz and a maximum oscillation frequency of 21GHz. There is no degradation in device performance up to its breakdown voltage, which greatly exceeds that of CMOS devices on the same process. Other figures of merit of relevance to RF front-end design are presented, including the maximum stable gain and noise figure. An accurate representation of the device in SPICE has been developed using the commercially available TOM3 model. Using the SOI MESFET model, a source degenerated low noise RF amplifier targeting operation near 1GHz has been designed. The amplifier was fabricated on a PCB board and operates at 940MHz with a minimum NF of 3.8dB and RF gain of 9.9dB while only consuming 5mW of DC power. PMID:20657816

  8. 35 GHz gyroklystron amplifier development at NRL

    Choi, J.J. [Science Applications International Corp., McLean, VA (United States); Ganguly, A.K. [Omega-P, Inc., New Haven, CT (United States); Blank, M. [Naval Research Lab., Washington, DC (United States). Vacuum Electronics Branch] [and others

    1996-12-31

    Experiments on a two-cavity gyroklystron are underway to demonstrate a 140 kW, 35 GHz gyroklystron amplifier, operating at a fundamental beam cyclotron mode and a TE{sub 011} cylindrical cavity mode. A high power electron beam of 70 kV, 6.6A is produced from a magnetron-injection-gun which is optimally designed for the TE{sub 01} mode at 35 GHz. Drift tubes consisting of lossy ceramic rings (80% BeO, 20% SiC) are designed to suppress undesired oscillations. A drive power is injected into the first cavity through a multi-hole coaxial coupler. A capacitive probe is placed directly before the input cavity to measure the beam velocity ratio. Large signal nonlinear calculations predict a peak efficiency of 30% (extracted power = 140 kW) and a saturated gain of 20dB over a 0.3% bandwidth at {alpha} = 1.5, {Delta}v{sub z}/v{sub z} = 20% at 13.3 kG and Q{sub 1} = Q{sub 2} = 200. Design parameters and initial hot-test results of the amplifier will be presented.

  9. 35 GHz, 4-Cavity Gyroklystron Amplifier Experiment

    Garven, M.; Calame, J. P.; Danly, B. G.; Levush, B.; Wood, F.

    1998-11-01

    Gyroklystron amplifiers operating in the Ka-band are attractive sources for the next generation of millimeter wave radars and are currently under investigation at the Naval Research Laboratory (NRL). A four-cavity, 35 GHz gyroklystron experiment has been designed to demonstrate higher saturated gain (50dB) than previous experiments at NRL( J. J. Choi et al, IEEE Trans. Plasma Sci. 26(3), 416, 1998.). Non-linear, time-dependent simulations of the 4-cavity gyroklystron amplifier design using MAGYKL(P. E. Latham et al IEEE Trans. Plasma Sci. 22, 804, 1994.) predict 35% efficiency, 225 kW peak power, 50 dB saturated gain and a -3 dB bandwidth of 0.6%. For this four-cavity gyroklystron, the interaction between the TE_01 mode and a 70 kV, 9 A electron beam was studied with α=1.3 and an rms perpendicular velocity spread of 9%. Initial studies have shown that variations in magnetic field and voltage affect the trade-offs between power, bandwidth and efficiency. Theoretical design studies and experimental progress will be presented.

  10. Ultrastable low-noise current amplifier

    Drung, Dietmar; Becker, Ulrich; Scherer, Hansjörg; Ahlers, Franz Josef

    2014-01-01

    An ultrastable low-noise current amplifier (ULCA) is presented. The ULCA is a non-cryogenic instrument based on specially designed operational amplifiers and resistor networks. It involves two stages, the first providing a 1000-fold current gain and the second performing a current-to-voltage conversion via an internal 1 MOhm reference resistor or, optionally, an external standard resistor. The ULCA's transfer coefficient is extremely stable versus time, temperature and current amplitude within the full dynamic range of +/-5 nA. A low noise level of 2.4 fA/sqrt(Hz) helps to keep averaging times low at small input currents. A cryogenic current comparator is used to calibrate both input current gain and output transresistance, providing traceability to the quantum Hall effect. Typically, within one day after calibration, the uncertainty contribution from short-term fluctuations of the transresistance is below one part in 10^7. The long-term stability is expected to be better than one part in 10^5 over a year. A ...

  11. Improved tunable microstrip SQUID amplifiers for the Axion Dark Matter eXperiment

    O'Kelley, Sean; Hansen, Jørn; Hilton, Gene; Mol, Jan-Michael; Clarke, John; ADMX Collaboration

    2015-04-01

    We describe a series of tunable microstrip SQUID (Superconducting QUantum Interference Device) amplifiers (MSAs) used as the photon detector in the Axion Dark Matter eXperiment (ADMX). Cooled to 100mK or lower, an optimized MSA approaches the quantum limit of detection. The axion dark matter candidate would be detected via Primakoff conversion to a microwave photon in a high-Q (~ 105) tunable microwave cavity, cooled to 1.6 K or lower, in the presence of a 7-tesla magnetic field. The MSA consists of a square loop of thin Nb film, incorporating two resistively shunted Josephson tunnel junctions biased to the voltage state, flux-coupled to a resonant microstrip. The photon frequency is determined by the unknown axion mass, so the cavity and amplifier must be tunable over a broad frequency range. MSA tunability is achieved by terminating the microstrip with a GaAs varactor diode that operates at cryogenic temperatures. This voltage-controlled capacitance enables us to vary the resonant microstrip mode from nearly λ/2 to λ/4. We demonstrate gains exceeding 20 dB, at frequencies above 900 MHz. With proper design of the microwave environment, a noise temperature of 1/2 to 1/4 of the physical temperature is demonstrated. Supported by DOE Grants DE-FG02-97ER41029, DE-FG02-96ER40956, DE- AC52-07NA27344, DE-AC03-76SF00098, NSF Grant 1067242, and the Livermore LDRD program.

  12. A tunable microstrip SQUID amplifier for the Axion Dark Matter eXperiment (ADMX)

    O'Kelley, Sean; Hansen, Jorn; Weingarten, Elan; Mueck, Michael; Hilton, Gene; Clarke, John

    2014-03-01

    We describe a microstrip SQUID (Superconducting QUantum Interference Device) amplifier (MSA) used as the photon detector in the Axion Dark Matter eXperiment (ADMX). Cooled to 100 mK or lower, an optimized MSA approaches the quantum limit of detection. The axion dark matter is detected via Primakoff conversion to a microwave photon in a high-Q (~ 105) tunable microwave cavity, currently cooled to about 1.6 K, in the presence of a 7-tesla magnetic field. The MSA consists of a square loop of thin Nb film, incorporating two Josephson tunnel junctions with resistive shunts to prevent hysteresis in the current-voltage characteristic. The microstrip is a square Nb coil deposited over an intervening insulating layer. Since the photon frequency is determined by the unknown axion mass, the cavity and amplifier must be tunable over a broad frequency range. Tunability is achieved by terminating the microstrip with a GaAs varactor diode with a voltage-controlled capacitance that enables us to vary the resonance from nearly 1/2 to 1/4 of a wavelength. With the SQUID current-biased in the voltage state, we demonstrate a gain of typically 20 dB over nearly one octave, 415 MHz to 800 MHz. Supported by DOE Grants DE-FG02-97ER41029, DE-FG02-96ER40956, DE-AC52-07NA27344, DE-AC03-76SF00098, NSF grants PHY-1067242 and PHY-1306729, and the Livermore LDRD program.

  13. Design and development of switch mode power supply for 3.0 kW solid state RF amplifier

    A 3 kW Solid State Amplifier (SSA) has been indigenously designed and developed for a 37.8 MHz re- buncher of The Rare Ion Beam (RIB) facility at VECC. This power amplifier of 3.0 kW at 37.8 MHz has been designed and developed with combining of four amplifier modules of 800 W. The maximum requirement of voltage and current to drive the each amplifier module is 50 V and 30 A. A DC power supply (rated 55V/150A) has been designed and developed indigenously at VECC Kolkata for biasing of this amplifier system. This is current/voltage controlled (cv/cc) switched mode power supply, it works on the principle of pulse width modulation technique using buck converter topology and regulated by using PI controller with require phase and gain margin. In this power supply three phase line voltage (415V, 50Hz.) is fed to three phase step down transformer to achieve 55 volt AC, this AC voltage rectified with 3-phase full wave rectifier and filtered with LC filter to get around 74V DC. The rectified output is switched at high frequency (20 KHz) by buck converter circuit by using IGBT as a switching element to get pulsating DC. LC filter is used for smoothing the pulsating DC to obtain 55V DC at output. The voltage regulation is achieved by comparing the sampled output voltage with stable reference voltage. The error signal is fed to the built in error amplifier of PWM IC (SG 3525) which in terms varies the duty cycle depending upon error signal, which drive IGBT through Opto-isolator (TLP 250). For current control a shunt resistance is used as a feedback in series with the load. The simulation is performed in MATLAB and PSIM both in order to utilize the high end computational mechanics from MATLAB and special power electronics featured of PSIM. The experimental result is presented for the verification of mathematical analysis. In this paper, circuit topology, function of system components, key system specifications and experimental result of power supply are discussed. (author)

  14. ANALYSIS OF INTERNALLY GENERATED NOISE OF BIOELECTRIC AMPLIFIERS

    Mashhour Mustafa; Bani Amer

    2003-01-01

    This paper deals with internally generated noise of bioelectric amplifiers that are usually used for processing of bioelectric events. The main purpose of this paper is to present a procedure for analysis of the effects of internal noise generated by the active circuits and to evaluate the output noise of the author's new designed bioelectric amplifier that caused by internal effects to the amplifier circuit itself in order to compare it with the noise generated by conventional amplifiers. The obtained analysis results of internally generated noise showed that the total output noise of bioelectric active circuits does not increase when some of their resistors have a larger value. This behavior is caused by the different transfer functions for the signal and the respective noise sources associated with these resistors. Moreover, the new designed bioelectric amplifier has an output noise less than that for conventional amplifiers. The obtained analysis results were also experimentally verified and the final conclusions were drawn.

  15. Gender Differences on the Use of Amplifiers in Academic Writings

    申利芬

    2012-01-01

      This study aims to investigate the use of amplifiers in term of gender and disciplinary groups in academic research arti⁃cles, which is based on the British Academic Written English Corpus (BAWE).18 amplifiers were examined across two dimen⁃sions:gender and disciplinary groups. The results show amplifiers are more common in males’ academic writings than in those of females in general, amplifiers are used more often in AH discipline. However, not all amplifiers show significant gender differ⁃ences between men and women. Six words show a significant difference between male and female writers:pretty, by far, perfect⁃ly, quite, a great deal, totally, which are used more often by males. However, the interesting is in LS discipline, most amplifiers are used more often by female than male writers and males tend to use by far more frequently than females.

  16. Self-bias technique improves amplifier gain and noise figure

    Fithian, Michael J.

    1988-05-01

    A nover self-bias technique, which provides optimum amplifier performance from low-noise GaAs FET amplifiers, is described. The self-bias scheme employs small thin-film substrates to mount packaged FETs to amplifier's main microstrip substrates. The substrates, which feature high dielectric constant, are placed under each FET source lead. The use of self-biased amplifiers results in several benefits. Thus, with a single bias supply, proper bias sequencing is not requried among amplifier stages; in a self-bias layout, the active devices are not damaged by a bias-supply failure; finally, proper self-biasing is not complex, requiring only two resistors per stage. The results of an experimental testing of the self-bias technique, evaluated for a 5.0 to 5.6 GHz low-noise amplifier with the aid of commercially available CAD software, are presented.

  17. Measurement of microdosimetric spectra using an amplifier with logarithmic response

    A 3-1/2 decade logarithmic pulse amplifier was developed for use in microdosimetry. A block diagram of the instrument is given. The input shaping amplifier is designed to accept output pulses from a charge sensitive preamplifier with a maximum full scale amplitude of 8 volts. Output of the shaping amplifier is a bipolar, positive lobe leading RC shaped pulse with a maximum linear range approximately 200 millivolts. Following the logarithmic converter is a voltage amplifier which is used to increase the signal level before it is applied through the linear gate to the output buffer-amplifier. The signal at the output connector is a positive pulse compatible with most conventional pulse height analyzers. The gain of the linear amplifier is adjustable over 10 to 1 range by means of front panel controls

  18. Acid evaporation property in chemically amplified resists

    Hashimoto, Shuichi; Itani, Toshiro; Yoshino, Hiroshi; Yamana, Mitsuharu; Samoto, Norihiko; Kasama, Kunihiko

    1997-07-01

    The lithographic performance of a chemically amplified resist system very much depends on the photo-generated acid structure. In a previous paper, we reported the molecular structure dependence of two typical photo-generated acids (aromatic sulfonic acid and alkyl sulfonic acid) from the viewpoints of lithographic performance and acid characteristics such as acid generation efficiency, acid diffusion behavior and acid evaporation property. In this paper, we evaluate the effect of the remaining solvent in a resist film on the acid evaporation property. Four types of two-component chemically amplified positive KrF resists were prepared consisting of tert-butoxycarbonyl (t-BOC) protected polyhydroxystyrene and sulfonic acid derivative photo-acid generator (PAG). Here, a different combination of two types of PAGs [2,4-dimethylbenzenesulfonic acid (aromatic sulfonic acid) derivative PAG and cyclohexanesulfonic acid (alkyl sulfonic acid) derivative PAG] and two types of solvents (propylene glycol monomethyl ether acetate; PGMEA and ethyl lactate; EL) were evaluated. The aromatic sulfonic acid was able to evaporate easily during post exposure bake (PEB) treatment, but the alkyl sulfonic acid was not. The higher evaporation property of aromatic sulfonic acid might be due to the higher vapor pressure and the longer acid diffusion length. Furthermore, the amount of aromatic sulfonic acid in the PGMEA resist was reduced by more than that in the EL resist. The amount of acid loss also became smaller at a higher prebake temperature. The concentration of the remaining solvent in the resist film decreased with the increasing prebake temperature. We think that the acid evaporation property was affected by the remaining solvent in the resist, film; the large amount of remaining solvent promoted the acid diffusion and eventually accelerated the acid evaporation from the resist film surface in the PGMEA resist. In summary, the acid evaporation property depends on both the acid

  19. Direct coupled amplifiers using field effect transistors

    The concept of the uni-polar field effect transistor (P.E.T.) was known before the invention of the bi-polar transistor but it is only recently that they have been made commercially. Being produced as yet only in small quantities, their price imposes a restriction on use to circuits where their peculiar properties can be exploited to the full. One such application is described here where the combination of low voltage drift and relatively low input leakage current are necessarily used together. One of the instruments used to control nuclear reactors has a logarithmic response to the mean output current from a polarised ionisation chamber. The logarithmic signal is then differentiated electrically, the result being displayed on a meter calibrated to show the reactor divergence or doubling time. If displayed in doubling time the scale is calibrated reciprocally. Because of the wide range obtained in the logarithmic section and the limited supply voltage, an output of 1 volt per decade change in ionisation current is used. Differentiating this gives a current of 1.5 x 10-8 A for p.s.D. (20 sec. doubling time) in the differentiating amplifier. To overcome some of the problems of noise due to statistical variations in input current, the circuit design necessitates a resistive path to ground at the amplifier input of 20 M.ohms. A schematic diagram is shown. 1. It is evident that a zero drift of 1% can be caused by a leakage current of 1.5 x 10-10 A or an offset voltage of 3 mV at the amplifier input. Although the presently used electrometer valve is satisfactory from the point of view of grid current, there have been sudden changes in grid to grid voltage (the valve is a double triode) of up to 10 m.V. It has been found that a pair of F.E.T's. can be used to replace the electrometer valve so long as care is taken in correct balance of the two devices. An investigation has been made into the characteristics of some fourteen devices to see whether those with very different

  20. Thermodynamic indistinguishability and field state fingerprint of quantum optical amplifiers

    Perl, Yossi; Band, Yehuda B.; Boukobza, Erez

    2016-01-01

    Dissipation tends to wash out dynamical features observed at early evolution times. In this paper we analyze a resonant single--atom two--photon quantum optical amplifier both dynamically and thermodynamically. A detailed thermodynamic balance shows that the non--linear amplifier is thermodynamically equivalent to the linear amplifier discussed in (Phys. Rev. A, 74 (2006), 063822). However, by calculating the Wigner quasi--probability distribution for various initial field states, we show tha...

  1. A high performance switching audio amplifier using sliding mode control

    Pillonnet, Gael; Cellier, Rémy; Abouchi, Nacer; Chiollaz, Monique

    2008-01-01

    International audience The switching audio amplifiers are widely used in various portable and consumer electronics due to their high efficiency, but suffers from low audio performances due to inherent nonlinearity. This paper presents an integrated class D audio amplifier with low consumption and high audio performances. It includes a power stage and an efficient control based on sliding mode technique. This monolithic class D amplifier is capable of delivering up to 1W into 8Ω load at les...

  2. Design and experimental investigation of charge amplifiers for ultrasonic transducers

    Hansen, Svein Kristian Esp

    2014-01-01

    Amplifiers are used in all types of electrical circuits to boost signal and there is a huge variety in designs used for different applications. For ultrasonic applications our group has previously used commercial available transimpedance amplifiers that converts a current to a voltage, but these amplifiers have a linear response over its frequency range. To preserve as much information as possible for lower frequencies a flat frequency response is preferable. The main goa...

  3. Modeling and design techniques for RF power amplifiers

    Raghavan, Arvind; Laskar, Joy

    2008-01-01

    The book covers RF power amplifier design, from device and modeling considerations to advanced circuit design architectures and techniques. It focuses on recent developments and advanced topics in this area, including numerous practical designs to back the theoretical considerations. It presents the challenges in designing power amplifiers in silicon and helps the reader improve the efficiency of linear power amplifiers, and design more accurate compact device models, with faster extraction routines, to create cost effective and reliable circuits.

  4. A Review of High Voltage Drive Amplifiers for Capacitive Actuators

    Huang, Lina; Zhang, Zhe; Andersen, Michael A. E.

    2012-01-01

    This paper gives an overview of the high voltage amplifiers, which are used to drive capacitive actuators. The amplifiers for both piezoelectric and DEAP (dielectric electroactive polymer) actuator are discussed. The suitable topologies for driving capacitive actuators are illustrated in detail......, including linear as well as switched mode amplifiers. In the past much attention has been paid on the driver for piezoelectric actuator. As DEAP is a type of new material, there is not much literature reference for it....

  5. Design of a Broadband Amplifier for High Speed Applications

    Camargo, E.; Virk, R.S.; Hajji, R.; Parker, S; Ohnishi, H

    2002-01-01

    This paper provides comprehensive insight into the design approach followed for an amplifier dedicated to high speed base band signals. To demonstrate the methodology, an amplifier consisting of nine PHEMT cascode cells within a distributed amplifier topology was designed. The resulting frequency response is 40 GHz at the 3-dB point, and the output voltage for a 43 Gbps eye diagram is 7.3 Vpp at the chip terminal.

  6. InP Heterojunction Bipolar Transistor Amplifiers to 255 GHz

    Radisic, Vesna; Sawdai, Donald; Scott, Dennis; Deal, William; Dang, Linh; Li, Danny; Cavus, Abdullah; To, Richard; Lai, Richard

    2009-01-01

    Two single-stage InP heterojunction bipolar transistor (HBT) amplifiers operate at 184 and 255 GHz, using Northrop Grumman Corporation s InP HBT MMIC (monolithic microwave integrated circuit) technology. At the time of this reporting, these are reported to be the highest HBT amplifiers ever created. The purpose of the amplifier design is to evaluate the technology capability for high-frequency designs and verify the model for future development work.

  7. The spectacular human nose: An amplifier of individual quality?

    Åse Kristine Rognmo Mikalsen; Ivar Folstad; Nigel Gilles Yoccoz; Bruno Laeng

    2014-01-01

    Amplifiers are signals that improve the perception of underlying differences in quality. They are cost free and advantageous to high quality individuals, but disadvantageous to low quality individuals, as poor quality is easier perceived because of the amplifier. For an amplifier to evolve, the average fitness benefit to the high quality individuals should be higher than the average cost for the low quality individuals. The human nose is, compared to the nose of most other primates, extraordi...

  8. [Construction of mammalian cell expression vector for pAcGFP-bFADD fusion protein and its expression in CHO-K1 cell].

    Yang, Runjun; Xu, Shangzhong; Zhang, Lupei; Li, Junya; Gao, Xue

    2008-11-01

    Fas-associated death domain (FADD) is a signal connection protein in Fas/FasL apoptotic path which might play a key role on apoptosis by transferring apoptotic signal. To reveal the intracellular signal transduction molecules involved in the procedure of follicular development in bovine ovary, we cloned FADD gene in bovine ovary tissue with RT-PCR, deleted the termination codon in its cDNA and directionally cloned the amplified FADD gene into eukaryotic expression vector pAcGFP-N1 including AcGFP, successfully constructed the fusion protein recombinant plasmid. After identifying by restrictive enzyme Bgl II/EcoR I and sequencing, transfected pAcGFP-bFADD into CHO-K1 cell mediated by Lipofectamine 2000, observed the expression of AcGFP and detected the transcription and expression of FADD by RT-PCR and Western blotting. The results showed that the cattle FADD was successfully cloned, the pAcGFP-bFADD fusion protein recombinant plasmid was successfully constructed by introducing Bgl II, EcoR I cloning site at two ends of FADD open reading frame and inserting a Kozak sequence before start codon. AcGFP expression was detected as early as 24 h after transfection. The percentage of AcGFP positive cells reached about 65% after 24 h. A 654 bp transcription was amplified by RT-PCR, and 51.4 kD target protein was detected by Western blotting. Construction of pAcGFP-bFADD recombinant plasmid should be helpful for further understanding the mechanism of regulation of FADD on bovine oocytes formation and development. PMID:19256333

  9. The solid-state Ku-band power amplifier

    Geller, B. D.

    1975-01-01

    A survey of IMPATT diodes and negative resistance amplifiers is presented. The first phase of the amplifier effort is discussed in which a single diode reflection amplifier delivering 0.5 watt at 15 GHz with 10-dB gain over a 1-GHz band was developed. The design of a dominant mode resonant combiner is described along with the characterization of the IMPATT diodes. Results are given on the complete amplifier and on the thermal and graceful failure characteristics of the unit.

  10. Pulse-distortion in a quantum-dot optical amplifier

    Romstad, Francis Pascal; Borri, Paola; Mørk, Jesper; Hvam, Jørn Märcher; Heinrichsdorff, F.; Mao, M.-H.; Bimberg, Dieter

    2000-01-01

    Distortion of a -150fs optical pulse after propagation through an InAs/InGaAs quantum-dot optical amplifier is measured for different input energies an bias currents. Pulse distortion is observed and compared with results on a bulk amplifier.......Distortion of a -150fs optical pulse after propagation through an InAs/InGaAs quantum-dot optical amplifier is measured for different input energies an bias currents. Pulse distortion is observed and compared with results on a bulk amplifier....

  11. Parametric Amplifiers for Microwave Kinectic Inductance Detector (MKID) Readout Project

    National Aeronautics and Space Administration — Find numerical solutions to the non-linear partial differential equations describing our amplifier transmission lines. Optimize periodic choke structure to block...

  12. Multi Carrier Modulation Audio Power Amplifier with Programmable Logic

    Christiansen, Theis; Andersen, Toke Meyer; Knott, Arnold;

    2009-01-01

    amplifiers while keeping the performance measures to excellent levels is therefore of high interest. In this paper a class D audio amplifier utilising Multi Carrier Modulation (MCM) will be analysed, and a prototype Master-Slave Multi Carrier Modulated (MS MCM) amplifier has been constructed and measured for...... performance and out of band spectral amplitudes. The basic principle in MCM is to use programmable logic to combine two or more Pulse Width Modulated (PWM) audio signals at different switching frequencies. In this way the out of band spectrum will be lowered compared with conventional class D amplifiers...

  13. Design of Class-E Radio Frequency Power Amplifier

    Al-Shahrani, Saad Mohammed

    2000-01-01

    Power amplifiers (PA) are typically the most power-consuming building blocks of RF transceivers. Therefore, the design of a high-efficiency radio frequency power amplifier is the most obvious solution to overcoming the battery lifetime limitation in the portable communication systems. A power amplifierà ­s classes (A, AB, B, C, F, E, etc), and design techniques (Load-pull and large-signal S-parameters techniques) are presented. The design accuracy of class-A power amplifier based on the s...

  14. Modeling a Common-Source Amplifier Using a Ferroelectric Transistor

    Sayyah, Rana; Hunt, Mitchell; MacLeond, Todd C.; Ho, Fat D.

    2010-01-01

    This paper presents a mathematical model characterizing the behavior of a common-source amplifier using a FeFET. The model is based on empirical data and incorporates several variables that affect the output, including frequency, load resistance, and gate-to-source voltage. Since the common-source amplifier is the most widely used amplifier in MOS technology, understanding and modeling the behavior of the FeFET-based common-source amplifier will help in the integration of FeFETs into many circuits.

  15. Controlling the dynamic range of a Josephson parametric amplifier

    One of the central challenges in the development of parametric amplifiers is the control of the dynamic range relative to its gain and bandwidth, which typically limits quantum limited amplification to signals which contain only a few photons per inverse bandwidth. Here, we discuss the control of the dynamic range of Josephson parametric amplifiers by using Josephson junction arrays. We discuss gain, bandwidth, noise, and dynamic range properties of both a transmission line and a lumped element based parametric amplifier. Based on these investigations we derive useful design criteria, which may find broad application in the development of practical parametric amplifiers. (orig.)

  16. Operational characteristics of the NRL gyroklystron amplifier

    The high-energy physics community is considering the development of 1 TeV accelerators. Size and cost of such devices can be greatly reduced by operating at 10 GHz. Present tube technology seems incapable of meeting the power requirements at this frequency. A strong candidate for a drive tube to meet these requirements is a gyroklystron amplifier (GKA) due to its high gain, efficiency and power capabilities. The Naval Research Laboratory (NRL) is presently conducting GKA research to evaluate their performance characteristics. Operation of a 54 kW, 30% efficient, 4.5 GHz 3-cavity GKA is described. Experiments to evaluate the effects on the output phase of varying drive voltage, beam current, magnetic field and drive power and to examine phase-locked oscillator performance are discussed. The results of present GKA experiments serve to emphasize the applicability of the GKA to the next generation of linear accelerators

  17. CARM-klystron amplifier for accelerator applications

    Gold, Steven H.; Fliflet, Arne W.

    2001-05-01

    We consider the possibility of a cyclotron-autoresonance-maser (CARM) klystron configuration for accelerator applications as an alternative to the gyroklystron amplifier. The potential advantages, compared to gyroklystrons, include: 1) comparable efficiencies at lower values of the electron beam pitch ratio α, which should improve the beam quality and make the device substantially more stable against the excitation of parasitic mode, 2) operation far from cutoff, which should reduce the fields at cavity walls, allowing higher power operation, and 3) operation at lower magnetic fields for the same cyclotron harmonic number. However, there are two significant issues associated with the design of efficient, high-power CARMs. First, because of the higher value of kZ, compared to gyroklystrons, CARMs are substantially more sensitive to parallel velocity spread (pitch-angle spread). Second, conventional cavities support a variety of near-cutoff modes, which can compete with the CARM interaction. Therefore, one must consider either Bragg resonators or quasioptical cavity configurations.

  18. Gain Characteristics of Fiber Optical Parametric Amplifier

    高明义; 姜淳; 胡卫生

    2004-01-01

    The theory model of fiber optical parametric amplifier (FOPA) was introduced, which is based on optical nonlinear effect. And then numerical simulation was done to analyze and discuss the gain spectral characteristics of one-pump and two-pump FOPA. The results show that for one-pump FOPA, when pump wavelength is near to fiber zero-dispersion wavelength(ZDW), the gain flatness is better, and with the increase of the pump power, fiber length and its nonlinear coefficient, the gain value will increase while the gain bandwidth will become narrow. For two-pump FOPA, when the pump central wavelength is near to fiber ZDW, the gain flatness is better. Moreover, by decreasing the space of two pumps wavelength, the gain flatness can be improved. Finally, some problems existing in FOPA were addressed.

  19. New developments in relativistic klystron amplifiers

    A relativistic klystron amplifier that employed cavities with inductively loaded wide gaps and a novel converter has achieved 50% energy efficiency, a significant advance over the previous state of the art of 20%. The new device was immersed in a 3 kG magnetic field and contained two innovations: (1) Wide gaps which include an inductively loaded return current structure that was opaque to the unmodulated beam space charge but transparent to the RF field. (2) A novel converter that was made of a 'leaky' cavity with a radially-converging inductively-loaded structure that was inserted in the output wide-gap. This structure reduced the potential energy residing in the electron beam and maximized RF output energy. (author). 4 figs., 13 refs

  20. Current feedback operational amplifiers and their applications

    Senani, Raj; Singh, A K; Singh, V K

    2013-01-01

    This book describes a variety of current feedback operational amplifier (CFOA) architectures and their applications in analog signal processing/generation. Coverage includes a comprehensive survey of commercially available, off-the-shelf integrated circuit CFOAs, as well as recent advances made on the design of CFOAs, including design innovations for bipolar and CMOS CFOAs.  This book serves as a single-source reference to the topic, as well as a catalog of over 200 application circuits which would be useful not only for students, educators and researchers in apprising them about the recent developments in the area but would also serve as a comprehensive repertoire of useful circuits for practicing engineers who might be interested in choosing an appropriate CFOA-based topology for use in a given application.

  1. High-energy regenerative thin disk amplifier

    Chyla, Michal; Smrž, Martin; Mocek, Tomáš

    Melville: AIP, 2012 - (Osvay, K.; Dombi, P.; Fülöp, J.; Varjú, K.), s. 84-87. (AIP Conference Proceedings. 1462). ISBN 978-0-7354-1066-4. ISSN 0094-243X. [Light at Extreme Intensities 2011. Szeged (HU), 14.11.2011-18.11.2011] R&D Projects: GA MŠk ED1.1.00/02.0061; GA MŠk ED2.1.00/01.0027 Grant ostatní: ELI Beamlines(XE) CZ.1.05/1.1.00/02.0061; HILASE(XE) CZ.1.05/2.1.00/01.0027 Institutional support: RVO:68378271 Keywords : Yb: YAG * thin-disk * regenerative amplifier * high energy * picosecond pulses * CPA Subject RIV: BH - Optics, Masers, Lasers

  2. Cryogenic cooling for high power laser amplifiers

    The Extreme Light Infrastructure (ELI) will be a new scientific European infrastructure devoted to scientific research in lasers field, dedicated to the investigation and applications of laser-matter interaction at the highest intensity level (more than 6 orders of magnitude higher than today’s laser intensity). The ELI project, a collaboration of 13 European countries, will comprise three branches: Ultra High Field Science that will explore laser-matter interaction, attosecond Laser Science designed to conduct temporal investigation of electron dynamics in atoms, molecules, plasmas and solids at attosecond scale, High Energy Beam Science devoted to the development and usage o f dedicated beam lines with ultra short pulses of high energy radiation. Using DPSSL (Diode Pumped Solid State Lasers) as pumping technology, PW-cIass lasers with enhanced repetition rates are developed. Each of the Yb YaG amplifiers will be diode-pumped at a wavelength of 940 nm. This is a prerequisite for achieving high repetition rates (light amplification duration 1 millisecond and repetition rate 10 Hz), The efficiency of DPSSL is inversely proportional to the temperature, for this reason the slab amplifier have to be cooled at a temperature in the range of 100K-170K with a heat flux of 1 MW*m-2. This paper describes the thermo-mechanical analysis for the design of the amplification laser head, presents a preliminary proposal for the required cryogenic cooling system and finally outlines the gain of cryogenic operation for the efficiency of high pulsed laser. (author)

  3. Cryogenic cooling for high power laser amplifiers

    The Extreme Light Infrastructure (ELI) will be a new scientific European infrastructure devoted to scientific research in lasers field, dedicated to the investigation and applications of laser-matter interaction at the highest intensity level (more than 6 orders of magnitude higher than today's laser intensity). The ELI project, a collaboration of 13 European countries, will comprise three branches: Ultra High Field Science that will explore laser-matter interaction, atto-second Laser Science designed to conduct temporal investigation of electron dynamics in atoms, molecules, plasmas and solids at atto-second scale, High Energy Beam Science devoted to the development and usage of dedicated beam lines with ultra short pulses of high energy radiation. Using DPSSL (Diode Pumped Solid State Lasers) as pumping technology, PW-class lasers with enhanced repetition rates are developed. Each of the Yb YaG amplifiers will be diode-pumped at a wavelength of 940 nm. This is a prerequisite for achieving high repetition rates (light amplification duration 1 millisecond and repetition rate 10 Hz). The efficiency of DPSSL is inversely proportional to the temperature, for this reason the slab amplifier have to be cooled at a temperature in the range of 100 K-170 K with a heat flux of 1 MW.m-2. This paper describes the thermo-mechanical analysis for the design of the amplification laser head, presents a preliminary proposal for the required cryogenic cooling system and finally outlines the gain of cryogenic operation for the efficiency of high pulsed laser. (authors)

  4. SINGLE PHASE HIGH FREQUENCY AC CONVERTER FOR INDUCTION HEATING APPLICATION

    M.A INAYATHULLAAH,; Dr. R. Anita

    2010-01-01

    The proposed topology reduces the total harmonic distortion (THD) of a high frequency AC/AC Converter well below the acceptable limit. This paper deals with a novel single phase AC/DC/AC soft switching utility frequency AC to high frequency AC converter. In this paper a single phase full bridge inverter with Vienna rectifier as front end is used instead of conventional diode bridge rectifier to provide continuous sinusoidal input current with nearly unity power factor at the source side with ...

  5. Development of 3 kW at 325 MHz solid-state RF power amplifier using four power amplifier modules

    A high power solid-state RF power amplifier of 3 kW at 325 MHz has been developed using only four RF power amplifier modules of 850 W power output each. The design and characterization of RF power modules have been presented. A four way Wilkinson power combiner adds the output of four power amplifier modules with a total transmission loss of less than 6%. The combined power amplifier has a power gain of 20.2 dB at 1-dB compression point, and the corresponding output power is 2.8 kW at 325 MHz. The drain efficiency of the power amplifier is 65.3% at 3 kW. All the harmonics of this amplifier are below −40 dBc. The amplifier has better characteristics like fewer numbers of active devices per kilo watt, high efficiency, high gain, and ruggedness etc for RF accelerator applications. -- Highlights: • High gain power amplifier, power gain at 20 dB. • High efficiency amplifier, efficiency >65%. • Minimum number of modules per kilo watt power output. • Heat sink with modules on both side, high density

  6. X-Band, 17-Watt Solid-State Power Amplifier

    Mittskus, Anthony; Stone, Ernest; Boger, William; Burgess, David; Honda, Richard; Nuckolls, Carl

    2005-01-01

    An advanced solid-state power amplifier that can generate an output power of as much as 17 W at a design operating frequency of 8.4 GHz has been designed and constructed as a smaller, lighter, less expensive alternative to traveling-wave-tube X-band amplifiers and to prior solid-state X-band power amplifiers of equivalent output power. This amplifier comprises a monolithic microwave integrated circuit (MMIC) amplifier module and a power-converter module integrated into a compact package (see Figure 1). The amplifier module contains an input variable-gain amplifier (VGA), an intermediate driver stage, a final power stage, and input and output power monitors (see Figure 2). The VGA and the driver amplifier are 0.5-m GaAs-based metal semiconductor field-effect transistors (MESFETs). The final power stage contains four parallel high-efficiency, GaAs-based pseudomorphic high-electron-mobility transistors (PHEMTs). The gain of the VGA is voltage-variable over a range of 10 to 24 dB. To provide for temperature compensation of the overall amplifier gain, the gain-control voltage is generated by an operational-amplifier circuit that includes a resistor/thermistor temperature-sensing network. The driver amplifier provides a gain of 14 dB to an output power of 27 dBm to drive the four parallel output PHEMTs, each of which is nominally capable of putting out as much as 5 W. The driver output is sent to the input terminals of the four parallel PHEMTs through microstrip power dividers; the outputs of these PHEMTs are combined by microstrip power combiners (which are similar to the microstrip power dividers) to obtain the final output power of 17 W.

  7. AC Read-Out Circuits for Single Pixel Characterization of TES Microcalorimeters and Bolometers

    Gottardi, L.; van de Kuur, J.; Bandler, S.; Bruijn, M.; de Korte, P.; Gao, J. R.; den Hartog, R.; Hijmering, R. A.; Hoevers, H.; Koshropanah, P.; Kilbourne, C.; Lindemann, M. A.; Parra Borderias, M.; Ridder, M.

    2011-01-01

    SRON is developing Frequency Domain Multiplexing (FDM) for the read-out of transition edge sensor (TES) soft x-ray microcalorimeters for the XMS instrument of the International X-ray Observatory and far-infrared bolometers for the SAFARI instrument on the Japanese mission SPICA. In FDM the TESs are AC voltage biased at frequencies from 0.5 to 6 MHz in a superconducting LC resonant circuit and the signal is read-out by low noise and high dynamic range SQUIDs amplifiers. The TES works as an amplitude modulator. We report on several AC bias experiments performed on different detectors. In particular, we discuss the results on the characterization of Goddard Space Flight Center x-ray pixels and SRON bolometers. The paper focuses on the analysis of different read-out configurations developed to optimize the noise and the impedance matching between the detectors and the SQUID amplifier. A novel feedback network electronics has been developed to keep the SQUID in flux locked loop, when coupled to superconducting high Q circuits, and to optimally tune the resonant bias circuit. The achieved detector performances are discussed in view of the instrument requirement for the two space missions.

  8. Characterization of AcMNPV with a deletion of ac69 gene

    Jianhao Ke

    2011-07-01

    Full Text Available ORF69 (Ac69 of Autographa californica multiple nucleopolyhedrovirus (AcMNPV is conserved in some baculovirus genomes. Although it has been shown that Ac69 has cap 0-dependent methyltransferase activity and is not required for budded virus production in Spodoptera frugiperda Sf-9 cells, its role in occlusion-derived virus synthesis and virus oral infectivity is not known. This paper describes generation of an ac69 knockout AcMNPV bacmid mutant and analyses of the influence of ac69 deletion on the viral infectivity in Sf-9 cells and Trichoplusia ni larvae so as to investigate the role of ac69 in the viral life cycle. Results indicated that ac69 deletion has little effect on the production rates and morphogenesis of budded virus and occlusion-derived virus in Sf-9 cells. In addition, animal experiment revealed that the deletion mutant did not affect AcMNPV infectivity for Trichoplusia ni larvae in LD50 and LT50 bioassay when administered orally. These results suggest that ac69 may be dispensable for viral infectivity both in vitro and in vivo.

  9. Externally pumped millimeter-wave Josephson-junction parametric amplifier

    Levinsen, M.T; Pedersen, Niels Falsig; Sørensen, Ole;

    1980-01-01

    A unified theory of the singly and doubly degenerate Josephson-junction parametric amplifier is presented. Experiments with single junctions on both amplifier modes at frequencies 10, 35, and 70 GHz are discussed. Low-noise temperature (∼100 K, single sideband (SSB)) and reasonable gain (∼8 dB) w...

  10. Solid-State Power Amplifier For 61.5 GHz

    Powers, Michael K.; Mcclymonds, James; Vye, David; Arthur, Thomas

    1992-01-01

    Power amplifiers based on impact-avalanche-transit-time (IMPATT) diodes developed for operation in communication systems at frequencies near 60 GHz. Built in seven modular stages, power transferred through sections of waveguide and isolator/circulator assemblies. Intended as replacements for bulkier and heavier traveling-wave-tube amplifiers.

  11. CARM and harmonic gyro-amplifier experiments at 17 GHz

    Menninger, W.L.; Danly, B.G.; Alberti, S.; Chen, C.; Rullier, J.L.; Temkin, R.J. [Massachusetts Inst. of Technology, Cambridge, MA (United States). Plasma Fusion Center; Giguet, E. [Massachusetts Inst. of Technology, Cambridge, MA (United States). Plasma Fusion Center]|[Thomson Tubes Electroniques, Velizy (France)

    1993-11-01

    Cyclotron resonance maser amplifiers are possible sources for applications such as electron cyclotron resonance heating of fusion plasmas and driving high-gradient rf linear accelerators. For accelerator drivers, amplifiers or phase locked-oscillators are required. A 17 GHz cyclotron autoresonance maser (CARM) amplifier experiment and a 17 GHz third harmonic gyro-amplifier experiment are presently underway at the MIT Plasma Fusion Center. Using the SRL/MIT SNOMAD II introduction accelerator to provide a 380 kV, 180 A, 30 ns flat top electron beam, the gyro-amplifier experiment has produced 5 MW of rf power with over 50 dB of gain at 17 GHz. The gyro-amplifier operates in the TE{sub 31} mode using a third harmonic interaction. Because of its high power output, the gyro-amplifier will be used as the rf source for a photocathode rf electron gun experiment also taking place at MIT. Preliminary gyro-amplifier results are presented, including measurement of rf power, gain versus interaction length, and the far-field pattern. A CARM experiment designed to operate in the TE{sub 11} mode is also discussed.

  12. Phase Sensitive Amplifier Based on Ultrashort Pump Pulses

    Gershikov, Alexander

    2016-01-01

    We demonstrate a narrow band phase sensitive amplifier in the pump degenerate configuration which employs ps pump pulses. Control of the amplifier bandwidth is achieved via changes of the pump spectral width. A phase sensitive gain between -6 and 6 decibels, with an overall system gain of 28dB was demonstrated.

  13. Design of vortex fluid amplifiers with asymmetrical flow fields.

    Lawley, T. J.; Price, D. C.

    1972-01-01

    Variation of geometric parameters, including supply area, control area, chamber length, and outlet diameter, of a large scale, modular design vortex fluid amplifier with single supply and control jets, has confirmed and extended a previously published design method, developed for vortex amplifiers with symmetric flow fields. This allows application of the method to devices which are more representative of practical, production type components.

  14. Gain characteristics of a saturated fiber optic parametric amplifier

    Rottwitt, Karsten; Lorenzen, Michael Rodas; Noordegraaf, Danny;

    2008-01-01

    In this work we discuss saturation performance of a fiber optic parametric amplifier. A simple numerical model is described and applied to specific cases. A system experiment using a saturated amplifier illustrates a 4 dB improvement in required signal to noise ratio for a fixed bit error ratio....

  15. Optically amplifying planar glass waveguides: Laser on a chip

    Guldberg-Kjær, Søren Andreas

    The objective of this work was to devlop optically amplifying planar wavguides, using erbium-doped germano-silicate glass films deposited by PECVD (Plasma Enhanced Chemical Vapour Deposition). The waveguides should exhibit enough gain to be useful as optical amplifiers in integrated planar lightw...

  16. Band-Pass Amplifier Without Discrete Reactance Elements

    Kleinberg, L.

    1984-01-01

    Inherent or "natural" device capacitance exploited. Band-Pass Circuit has input impedance of equivalent circuit at frequencies much greater than operational-amplifier rolloff frequency. Apparent inductance and capacitance arise from combined effects of feedback and reactive component of amplifier gain in frequency range.

  17. A high performance electrometer amplifier of hybrid design

    A high performance, reliable, electrometer amplifier of hybrid design for low current measurements in mass spectrometers has been developed. The short term instability with a 5 x 1011 ohms input resistor is less than 1 x 10sup(-15) Amp. The drift is better than 1 mV/hour. The design steps are illustrated with a typical amplifier performance details. (auth.)

  18. Saturation and noise properties of quantum-dot optical amplifiers

    Berg, Tommy Winther; Mørk, Jesper

    2004-01-01

    Based on extensive numerical calculations, quantum-dot (QD) amplifiers are predicted to offer higher output power and lower noise figure compared to bulk as well as quantum well amplifiers. The underlying physical mechanisms are analyzed in detail, leading to the identification of a few key...

  19. Ultrafast Dynamics of Quantum-Dot Semiconductor Optical Amplifiers

    Poel, Mike van der; Hvam, Jørn Märcher

    2007-01-01

    We report on a series of experiments on the dynamical properties of quantum-dot semiconductor optical amplifiers. We show how the amplifier responds to one or several ultrafast (170 fs) pulses in rapid succession and our results demonstrate applicability and ultimate limitations to application of...

  20. Subjective test of class D amplifiers without output filter

    Agerkvist, Finn T.; Fenger, Lars M.

    2004-01-01

    This paper presents the results of subjective listening tests designed to determine whether the output filter on class D amplifiers used in active loudspeakers can be omitted without audible errors occurring. The frequency range of the amplifiers was limited to 0-3 kHz corresponding to a woofer...

  1. Advances in Solid Core Photonic Bandgap Fiber Amplifiers

    Alkeskjold, Thomas Tanggaard; Laurila, Marko; Petersen, Sidsel Rübner;

    2012-01-01

    We present recent development of photonic crystal fiber amplifiers containing photonic bandgap structures for enhanced spectral and modal filtering functionality.......We present recent development of photonic crystal fiber amplifiers containing photonic bandgap structures for enhanced spectral and modal filtering functionality....

  2. Models of reduced-noise, probabilistic linear amplifiers

    Combes, Joshua; Walk, Nathan; Lund, A. P.; Ralph, T. C.; Caves, Carlton M.

    2016-05-01

    We construct an amplifier that interpolates between a nondeterministic, immaculate linear amplifier and a deterministic, ideal linear amplifier and beyond to nonideal linear amplifiers. The construction involves cascading an immaculate linear amplifier that has amplitude gain g1 with a (possibly) nonideal linear amplifier that has gain g2. With respect to normally ordered moments, the device has output noise μ2(G2-1 ) where G =g1g2 is the overall amplitude gain and μ2 is a noise parameter. When μ2≥1 , our devices realize ideal (μ2=1 ) and nonideal (μ2>1 ) linear amplifiers. When 0 ≤μ2devices work effectively only over a restricted region of phase space and with some subunity success probability p✓. We investigate the performance of our μ2 amplifiers in terms of a gain-corrected probability-fidelity product and the ratio of input to output signal-to-noise ratios corrected for success probability.

  3. Ferroelectric Field-Effect Transistor Differential Amplifier Circuit Analysis

    Phillips, Thomas A.; MacLeod, Todd C.; Ho, Fat D.

    2008-01-01

    There has been considerable research investigating the Ferroelectric Field-Effect Transistor (FeFET) in memory circuits. However, very little research has been performed in applying the FeFET to analog circuits. This paper investigates the use of FeFETs in a common analog circuit, the differential amplifier. The two input Metal-Oxide-Semiconductor (MOS) transistors in a general MOS differential amplifier circuit are replaced with FeFETs. Resistors are used in place of the other three MOS transistors. The FeFET model used in the analysis has been previously reported and was based on experimental device data. Because of the FeFET hysteresis, the FeFET differential amplifier has four different operating modes depending on whether the FeFETs are positively or negatively polarized. The FeFET differential amplifier operation in the different modes was analyzed by calculating the amplifier voltage transfer and gain characteristics shown in figures 2 through 5. Comparisons were made between the FeFET differential amplifier and the standard MOS differential amplifier. Possible applications and benefits of the FeFET differential amplifier are discussed.

  4. A NIM module for efficient amplifier pile-up rejection

    A NIM standard module containing four individual circuits for detecting an amplifier pile-up condition is described. Each circuit can be adjusted to match a wide range of amplifier shaping time-constants. Output with a variable delay are provided for signaling a pile-up reject to the data acquisition system

  5. Frequency-Offset Cartesian Feedback Based on Polyphase Difference Amplifiers

    Zanchi, Marta G.; Pauly, John M.; Scott, Greig C

    2010-01-01

    A modified Cartesian feedback method called “frequency-offset Cartesian feedback” and based on polyphase difference amplifiers is described that significantly reduces the problems associated with quadrature errors and DC-offsets in classic Cartesian feedback power amplifier control systems.

  6. CARM and harmonic gyro-amplifier experiments at 17 GHz

    Cyclotron resonance maser amplifiers are possible sources for applications such as electron cyclotron resonance heating of fusion plasmas and driving high-gradient rf linear accelerators. For accelerator drivers, amplifiers or phase locked-oscillators are required. A 17 GHz cyclotron autoresonance maser (CARM) amplifier experiment and a 17 GHz third harmonic gyro-amplifier experiment are presently underway at the MIT Plasma Fusion Center. Using the SRL/MIT SNOMAD II introduction accelerator to provide a 380 kV, 180 A, 30 ns flat top electron beam, the gyro-amplifier experiment has produced 5 MW of rf power with over 50 dB of gain at 17 GHz. The gyro-amplifier operates in the TE31 mode using a third harmonic interaction. Because of its high power output, the gyro-amplifier will be used as the rf source for a photocathode rf electron gun experiment also taking place at MIT. Preliminary gyro-amplifier results are presented, including measurement of rf power, gain versus interaction length, and the far-field pattern. A CARM experiment designed to operate in the TE11 mode is also discussed

  7. Experimental demonstration of high power millimeter wave gyro-amplifiers

    Blank, M.; Garven, M.; Calame, J. P.; Choi, J. J.; Danly, B. G.; Levush, B.; Nguyen, K.; Pershing, D. E.

    1999-05-01

    The Naval Research Laboratory is currently investigating gyro-amplifiers as high power, broadband sources for millimeter wave radars. A three-cavity Ka-band gyroklystron achieved 225 kW peak output power with 0.82% bandwidth. At W-band, several multi-cavity gyro-amplifiers have been experimentally demonstrated. A four-cavity gyroklystron amplifier has achieved 84 kW peak output power at 34% efficiency with 370 MHz bandwidth. A five-cavity gyroklystron demonstrated 72 kW peak output power with 410 MHz bandwidth and 50 dB saturated gain. For applications requiring greater bandwidth, gyrotwystron amplifiers are also under study. A four section W-band gyrotwystron demonstrated 50 kW peak output power at 925 MHz bandwidth. The results of recent Ka-band and W-band gyro-amplifier experiments and comparisons of measured data with predictions of theory are presented.

  8. A 12 GHz solid state power amplifier, phase 1B

    Bestwick, P. R.

    1986-05-01

    Attempts to develop a balanced amplifier developing 4 W power output at 12.6 GHz, with a gain of 3.5 dB are summarized. Calculation of the device large-signal conjugate match points, measurement of the points, design and tuning of single-ended amplifier, modules, and a bias insertion network are described. A Lange coupler and a termination for it are presented. The performance of the balanced amplifier, and that of a competing Fujitsu amplifier, are analyzed. The differences in device structure between the PRCL 4820 device and the Fujitsu device are assessed. The amplifier developed gives (at 1 dB gain compression) a gain of 2.4 dB and a power output of 3.2 dB. Difficulties stem from the use of the double-cell 4820 device, and of the Lange type quadrature couplers.

  9. Improving Students' Understanding of Lock-In Amplifiers

    DeVore, Seth; Levy, Jeremy; Singh, Chandralekha

    2016-01-01

    The lock-in amplifier is a versatile instrument frequently used in physics research. However, many students struggle with the basic operating principles of a lock-in amplifier which can lead to a variety of difficulties. To improve students' understanding, we have been developing and evaluating a research-based tutorial which makes use of a computer simulation of a lock-in amplifier. The tutorial allows students to realize their conceptual difficulties by comparing their predictions about how a lock-in amplifier will behave with the outcome of simulated experiments. After being confronted with discrepancies between their predictions and the lock-in amplifier results, the tutorial targets the common difficulties that students have and leads them to develop a deeper understanding of the principles of lock-in amplification.

  10. Coupled Lines Filters for Broadband Impedance Matching of Microwave Amplifiers

    Mohammed Lahsaini

    2014-08-01

    Full Text Available In this paper we present a broadband matching technique for the design of low noise amplifiers. This technique is based on the use of coupled lines filters and quarter wave transformers for the adaptation and stabilization of these amplifiers, presenting the theory and the design process of these circuits. The type of transistors used for modeling this amplifier is the HEMT of Alpha Industries®. The results we found show that this amplifier is unconditionally stable with a satisfactory gain of about 20 dB and good impedance matching across the band of interest [10-12] GHz. The amplifier modeled in this work can be integrated in satellite receiving systems and radar systems.

  11. Implementation of envelope tracking for RF solid state amplifiers

    Larter, Thomas Leigh

    The Facility for Rare Isotope Beams (FRIB) is currently in its development stages at Michigan State University. The facility uses a large linear accelerator system to accelerate ionized particles which are then collided with other particles in the hopes of finding rare isotopes of elements. This accelerating action depends on several systems to function, with one of the major systems being superconducting cavity structures. These cavities are driven by high-power RF amplifiers which account for a large portion of the accelerator's power consumption. It is important to maximize the efficiency of these amplifiers in order to keep energy costs for the facility low. One of the ways to increase efficiency is to choose an amplifier topology that is highly efficient. A study was done for FRIB testing the prospect of using amplifiers with the envelope tracking (ET) topology. An amplifier's efficiency relies on its output power and the power supplied to it, which are in turn directly related to the output signal voltage and supply rail voltage. In an ET RF amplifier, the supply voltage is made to closely follow the envelope of the output signal voltage. This tracking action allows the RF amplifier to operate with much improved efficiency at low power levels and nearly constant efficiency at high power levels. The ET tests performed for FRIB attempted to verify the validity of ET efficiency gains for RF amplifiers. These tests included the characterization of an RF amplifier, development and verification of an ET control algorithm, and implementation of an ET test bench using FRIB equipment. These tests should attest to the purported increase in efficiency possible with ET and prove that the power consumption budget for the FRIB will benefit from the use of such amplifiers.

  12. Eddy Current Rail Inspection Using AC Bridge Techniques.

    Liu, Ze; Koffman, Andrew D; Waltrip, Bryan C; Wang, Yicheng

    2013-01-01

    AC bridge techniques commonly used for precision impedance measurements have been adapted to develop an eddy current sensor for rail defect detection. By using two detection coils instead of just one as in a conventional sensor, we can balance out the large baseline signals corresponding to a normal rail. We have significantly enhanced the detection sensitivity of the eddy current method by detecting and demodulating the differential signal of the two coils induced by rail defects, using a digital lock-in amplifier algorithm. We have also explored compensating for the lift-off effect of the eddy current sensor due to vibrations by using the summing signal of the detection coils to measure the lift-off distance. The dominant component of the summing signal is a constant resulting from direct coupling from the excitation coil, which can be experimentally determined. The remainder of the summing signal, which decreases as the lift-off distance increases, is induced by the secondary eddy current. This dependence on the lift-off distance is used to calibrate the differential signal, allowing for a more accurate characterization of the defects. Simulated experiments on a sample rail have been performed using a computer controlled X-Y moving table with the X-axis mimicking the train's motion and the Y-axis mimicking the train's vibrational bumping. Experimental results demonstrate the effectiveness of the new detection method. PMID:26401427

  13. A solid hydraulically amplified piezoelectric microvalve

    We report a piezoelectrically driven and hydraulically amplified axial polymer microvalve. The microvalve is normally open and is assembled primarily with stereolithographically fabricated polymer components. An incompressible elastomer is used as a solid hydraulic medium to convert the small axial displacement of a piezoelectric actuator into a large valve head stroke while maintaining a large blocking force. Also, the axial design of the microvalve enables densely packed valve arrays. One application of this microvalve is in pneumatic tactile displays, which operates against gas pressure up to approximately 90 kPa and switching speed between 1 and 200 Hz. The current valve design has a maximum static hydraulic amplification ratio of 5 at 30 V driving voltage and a maximum valve head stroke of 37 µm at 150 V. Under a 94.4 kPa differential pressure, the flow rate of the valve and the closing voltage measure are 785 mL min−1 and 150 V, respectively. The function of the microvalve as an on–off switch for a pneumatic microbubble tactile actuator is demonstrated

  14. Efficient and Compact Optical Amplifier Using EYDF

    Sulaiman Wadi Harun

    2010-09-01

    Full Text Available An efficient Erbium/Ytterbium doped fiber amplifier (EYDFA is demonstrated using a 1058nm pumping wavelength, where the amplification is assisted by energy transfer between Yb and Er ions. The energy transfer increases the limit of erbium doping concentration that is imposed by concentration quenching in Erbium-doped fiber (EDF. Therefore, the gain and noise figure are severely degraded with 1480 nm pumping, where the energy transfer cannot be achieved. The use of optical isolator improves the small signal gain and noise figure by about 4.8 dB and 1.6 dB, respectively. By employing a double-pass configuration, a higher gain can be obtained with an expense of a noise figure penalty. The gain improvement of 17.0 dB is obtained at 20 mW and -50 dBm of pump and input signal powers. This shows that the double-pass configuration is an important aspect to consider when designing an efficient EYDFA.

  15. Single Ion Quantum Lock-In Amplifier

    Kotler, Shlomi; Glickman, Yinnon; Keselman, Anna; Ozeri, Roee

    2011-01-01

    We report on the implementation of a quantum analog to the classical lock-in amplifier. All the lock-in operations: modulation, detection and mixing, are performed via the application of non-commuting quantum operators on the electronic spin state of a single trapped Sr+ ion. We significantly increase its sensitivity to external fields while extending phase coherence by three orders of magnitude, to more than one second. With this technique we measure magnetic fields with sensitivity of 25 pT/sqrt(Hz) and light shifts with an uncertainty below 140 mHz after 1320 seconds of averaging. These sensitivities are limited by quantum projection noise and, to our knowledge, are more than two orders of magnitude better than with other single-spin probe technologies. In fact, our reported sensitivity is sufficient for the measurement of parity non-conservation, as well as the detection of the magnetic field of a single electronic-spin one micrometer from an ion-detector with nanometer resolution. As a first application ...

  16. Amplification uncertainty relation for probabilistic amplifiers

    Namiki, Ryo

    2015-09-01

    Traditionally, quantum amplification limit refers to the property of inevitable noise addition on canonical variables when the field amplitude of an unknown state is linearly transformed through a quantum channel. Recent theoretical studies have determined amplification limits for cases of probabilistic quantum channels or general quantum operations by specifying a set of input states or a state ensemble. However, it remains open how much excess noise on canonical variables is unavoidable and whether there exists a fundamental trade-off relation between the canonical pair in a general amplification process. In this paper we present an uncertainty-product form of amplification limits for general quantum operations by assuming an input ensemble of Gaussian-distributed coherent states. It can be derived as a straightforward consequence of canonical uncertainty relations and retrieves basic properties of the traditional amplification limit. In addition, our amplification limit turns out to give a physical limitation on probabilistic reduction of an Einstein-Podolsky-Rosen uncertainty. In this regard, we find a condition that probabilistic amplifiers can be regarded as local filtering operations to distill entanglement. This condition establishes a clear benchmark to verify an advantage of non-Gaussian operations beyond Gaussian operations with a feasible input set of coherent states and standard homodyne measurements.

  17. Status Report on the Energy Amplifier

    Rubbia, Carlo

    1994-01-01

    0ne year after its first presentation,the Energy Amplifier (EA) Project holds its promises for a environmentally acceptable form of energy extraction from nuclei, namely to eliminate or at least greatly reduce(i) the environmental impact of the long-lived highly radioactive waste;(ii) the possibility of diversions toward military applications;(iii) the risks of an accidental divergence related to the critical operation of the chain reaction and (iv) make a more efficient use of a fuel which is less radio-toxic to extract and more abundant on Earth than Uranium. In these respects the EA (or equivalent scenarios from Los Alamos and elsewhere) is comparable in performance to Thermonuclear Fusion. Bot h approches offer pratically unl;imited fuel resources: the energetic content of Lithium on the Earth's crust needed by Fusion is estimated to be seven times the one of Thorium and they are both adequate for millions of years of very intensived utilisation.However the EA can be built economically,in a variety of siz...

  18. Novel photoacid generators for chemically amplified resists

    Yamato, Hitoshi; Asakura, Toshikage; Matsumoto, Akira; Ohwa, Masaki

    2002-07-01

    Recently we have developed new class of non-ionic oxime sulfonate PAG. The compounds generate various kinds of sulfonic acids, such as n-propane, n-octane, camphor and p-toluene sulfonic acid under Deep-UV exposure and are applicable for chemically amplified (CA) photoresists. The application-relevant properties of the compounds such as solubility in propylene glycol monomethyl ether acetate (PGMEA), ethyl lactate, ethyl 3-ethoxypropionate, and 2-heptanone, UV absorption, thermal stability with or without poly(4-hydroxystyrene) (PHS), storage stability in a neat form or in PGMEA solution with or without additives, sensitivity in a model resist formulation, dissolution inhibition efficiency during the development process and volatility were evaluated. The compounds exhibit good solubility in PGMEA, high sensitivity in positive tone CA resist formulations, with Deep-UV exposure, and no significant volatility. Especially it was found that the compounds are superior in terms of thermal stability and storage stability, i.e., high thermal stability up to 188 degree(s)C in a phenolic matrix, and no change during storage in PGMEA at 60 degree(s)C for 5 months.

  19. Gold Nanoparticle Labels Amplify Ellipsometric Signals

    Venkatasubbarao, Srivatsa

    2008-01-01

    The ellipsometric method reported in the immediately preceding article was developed in conjunction with a method of using gold nanoparticles as labels on biomolecules that one seeks to detect. The purpose of the labeling is to exploit the optical properties of the gold nanoparticles in order to amplify the measurable ellipsometric effects and thereby to enable ultrasensitive detection of the labeled biomolecules without need to develop more-complex ellipsometric instrumentation. The colorimetric, polarization, light-scattering, and other optical properties of nanoparticles depend on their sizes and shapes. In the present method, these size-and-shape-dependent properties are used to magnify the polarization of scattered light and the diattenuation and retardance of signals derived from ellipsometry. The size-and-shape-dependent optical properties of the nanoparticles make it possible to interrogate the nanoparticles by use of light of various wavelengths, as appropriate, to optimally detect particles of a specific type at high sensitivity. Hence, by incorporating gold nanoparticles bound to biomolecules as primary or secondary labels, the performance of ellipsometry as a means of detecting the biomolecules can be improved. The use of gold nanoparticles as labels in ellipsometry has been found to afford sensitivity that equals or exceeds the sensitivity achieved by use of fluorescence-based methods. Potential applications for ellipsometric detection of gold nanoparticle-labeled biomolecules include monitoring molecules of interest in biological samples, in-vitro diagnostics, process monitoring, general environmental monitoring, and detection of biohazards.

  20. Fishing amplifies forage fish population collapses

    Essington, Timothy E.; Moriarty, Pamela E.; Froehlich, Halley E.; Hodgson, Emma E.; Koehn, Laura E.; Oken, Kiva L.; Siple, Margaret C.; Stawitz, Christine C.

    2015-01-01

    Forage fish support the largest fisheries in the world but also play key roles in marine food webs by transferring energy from plankton to upper trophic-level predators, such as large fish, seabirds, and marine mammals. Fishing can, thereby, have far reaching consequences on marine food webs unless safeguards are in place to avoid depleting forage fish to dangerously low levels, where dependent predators are most vulnerable. However, disentangling the contributions of fishing vs. natural processes on population dynamics has been difficult because of the sensitivity of these stocks to environmental conditions. Here, we overcome this difficulty by collating population time series for forage fish populations that account for nearly two-thirds of global catch of forage fish to identify the fingerprint of fisheries on their population dynamics. Forage fish population collapses shared a set of common and unique characteristics: high fishing pressure for several years before collapse, a sharp drop in natural population productivity, and a lagged response to reduce fishing pressure. Lagged response to natural productivity declines can sharply amplify the magnitude of naturally occurring population fluctuations. Finally, we show that the magnitude and frequency of collapses are greater than expected from natural productivity characteristics and therefore, likely attributed to fishing. The durations of collapses, however, were not different from those expected based on natural productivity shifts. A risk-based management scheme that reduces fishing when populations become scarce would protect forage fish and their predators from collapse with little effect on long-term average catches. PMID:25848018

  1. A highly linear power amplifier for WLAN

    Jie, Jin; Jia, Shi; Baoli, Ai; Xuguang, Zhang

    2016-02-01

    A three-stage power amplifier (PA) for WLAN application in 2.4-2.5 GHz is presented. The proposed PA employs an adaptive bias circuit to adjust the operating point of the PA to improve the linearity of the PA. Two methods to short the 2nd harmonic circuit are compared in the area of efficiency and gain of the PA. The PA is taped out in the process of 2 μm InGaP/GaAs HBT and is tested by the evaluation board. The measured results show that 31.5 dB power gain and 29.3 dBm P1dB with an associated 40.4% power added efficiency (PAE) under the single tone stimulus. Up to 26.5 dBm output power can be achieved with an error vector magnitude (EVM) of lower than 3% under the 64QAM/OFDM WLAN stimulus. Project supported by the National Natural Science Foundation of China (No. 61201244) and the Natural Science Fund of SUES (No. E1-0501-14-0168).

  2. The Effect of the Feedback Controller on Superconducting Tokamak AC Losses + AC-CRPP user manual

    Superconducting coils in a Tokamak are subject to AC losses when the field transverse to the coil current varies. A simple model to evaluate the AC losses has been derived and benchmarked against a complete model used in the ITER design procedure. The influence of the feedback control strategy on the AC losses is examined using this model. An improved controller is proposed, based on this study. (author)

  3. Guiding Principles in Selecting AC To DC Converters For Power Factor Corrections in AC Transmission System

    Ibekwe B.E

    2014-10-01

    Full Text Available The ac to dc converters’ power factors correction in ac transmission system were investigated. The studies include: phase-controlled converter; pulse width modulated (PWM converter and ac input current shaped converter. Using Fourier series, power factors of these converters were calculated and simulated using MATLAB. The resulting curves are displayed in the hard copies for practical guides in the choice of converters; and comparatively, current shaped type is the best.

  4. A Simple Load Power Estimator For Quasi-Direct AC-AC Converter System

    Marian GAICEANU; Emil ROSU

    2003-01-01

    In this paper a simple load power estimator for the three-phase quasi-direct acac converter system is reported. Since the ac-ac converter control by means of pulsewidth modulation (PWM) is based on the power balance concept, its load power should be known. Two control boards, based on the dSMC (digital Smart Motion Controller) 30 MIPS 32-bit fixed-point digital signal processor (DSP), were involved in the ac-ac system driving. By using the power balance control, the DC link voltage variation ...

  5. An energy-efficient micropower neural recording amplifier.

    Wattanapanitch, W; Fee, M; Sarpeshkar, R

    2007-06-01

    This paper describes an ultralow-power neural recording amplifier. The amplifier appears to be the lowest power and most energy-efficient neural recording amplifier reported to date. We describe low-noise design techniques that help the neural amplifier achieve input-referred noise that is near the theoretical limit of any amplifier using a differential pair as an input stage. Since neural amplifiers must include differential input pairs in practice to allow robust rejection of common-mode and power supply noise, our design appears to be near the optimum allowed by theory. The bandwidth of the amplifier can be adjusted for recording either neural spikes or local field potentials (LFPs). When configured for recording neural spikes, the amplifier yielded a midband gain of 40.8 dB and a -3-dB bandwidth from 45 Hz to 5.32 kHz; the amplifier's input-referred noise was measured to be 3.06 muVrms while consuming 7.56 muW of power from a 2.8-V supply corresponding to a noise efficiency factor (NEF) of 2.67 with the theoretical limit being 2.02. When configured for recording LFPs, the amplifier achieved a midband gain of 40.9 dB and a -3-dB bandwidth from 392 mHz to 295 Hz; the input-referred noise was 1.66 muVrms while consuming 2.08 muW from a 2.8-V supply corresponding to an NEF of 3.21. The amplifier was fabricated in AMI's 0.5-mum CMOS process and occupies 0.16 mm(2) of chip area. We obtained successful recordings of action potentials from the robust nucleus of the arcopallium (RA) of an anesthesized zebra finch brain with the amplifier. Our experimental measurements of the amplifier's performance including its noise were in good accord with theory and circuit simulations. PMID:23851668

  6. Transport AC losses in YBCO coated conductors

    Majoros, M [Ohio State University, Columbus, OH 43210 (United States); Ye, L [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Velichko, A V [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Coombs, T A [IRC in Superconductivity, University of Cambridge, Madingley Road, Cambridge CB3 0HE (United Kingdom); Sumption, M D [Ohio State University, Columbus, OH 43210 (United States); Collings, E W [Ohio State University, Columbus, OH 43210 (United States)

    2007-09-15

    Transport AC loss measurements have been made on YBCO-coated conductors prepared on two different substrate templates-RABiTS (rolling-assisted biaxially textured substrate) and IBAD (ion-beam-assisted deposition). RABiTS samples show higher losses compared with the theoretical values obtained from the critical state model, with constant critical current density, at currents lower than the critical current. An origin of this extra AC loss was demonstrated experimentally by comparison of the AC loss of two samples with different I-V curves. Despite a difference in I-V curves and in the critical currents, their measured losses, as well as the normalized losses, were practically the same. However, the functional dependence of the losses was affected by the ferromagnetic substrate. An influence of the presence of a ferromagnetic substrate on transport AC losses in YBCO film was calculated numerically by the finite element method. The presence of a ferromagnetic substrate increases transport AC losses in YBCO films depending on its relative magnetic permeability. The two loss contributions-transport AC loss in YBCO films and ferromagnetic loss in the substrate-cannot be considered as mutually independent.

  7. A modular positive feedback-based gene amplifier

    Bhalerao Kaustubh D

    2010-02-01

    Full Text Available Abstract Background Positive feedback is a common mechanism used in the regulation of many gene circuits as it can amplify the response to inducers and also generate binary outputs and hysteresis. In the context of electrical circuit design, positive feedback is often considered in the design of amplifiers. Similar approaches, therefore, may be used for the design of amplifiers in synthetic gene circuits with applications, for example, in cell-based sensors. Results We developed a modular positive feedback circuit that can function as a genetic signal amplifier, heightening the sensitivity to inducer signals as well as increasing maximum expression levels without the need for an external cofactor. The design utilizes a constitutively active, autoinducer-independent variant of the quorum-sensing regulator LuxR. We experimentally tested the ability of the positive feedback module to separately amplify the output of a one-component tetracycline sensor and a two-component aspartate sensor. In each case, the positive feedback module amplified the response to the respective inducers, both with regards to the dynamic range and sensitivity. Conclusions The advantage of our design is that the actual feedback mechanism depends only on a single gene and does not require any other modulation. Furthermore, this circuit can amplify any transcriptional signal, not just one encoded within the circuit or tuned by an external inducer. As our design is modular, it can potentially be used as a component in the design of more complex synthetic gene circuits.

  8. Ambient temperature cadmium zinc telluride radiation detector and amplifier circuit

    A low noise, low power consumption, compact, ambient temperature signal amplifier for a Cadmium Zinc Telluride (CZT) radiation detector is disclosed. The amplifier can be used within a larger system (e.g., including a multi-channel analyzer) to allow isotopic analysis of radionuclides in the field. In one embodiment, the circuit stages of the low power, low noise amplifier are constructed using integrated circuit (IC) amplifiers , rather than discrete components, and include a very low noise, high gain, high bandwidth dual part preamplification stage, an amplification stage, and an filter stage. The low noise, low power consumption, compact, ambient temperature amplifier enables the CZT detector to achieve both the efficiency required to determine the presence of radionuclides and the resolution necessary to perform isotopic analysis to perform nuclear material identification. The present low noise, low power, compact, ambient temperature amplifier enables a CZT detector to achieve resolution of less than 3% full width at half maximum at 122 keV for a Cobalt-57 isotope source. By using IC circuits and using only a single 12 volt supply and ground, the novel amplifier provides significant power savings and is well suited for prolonged portable in-field use and does not require heavy, bulky power supply components. 9 figs

  9. Direct solar-pumped iodine laser amplifier

    Han, Kwang S.; Hwang, In Heon; Kim, Khong Hon; Stock, Larry V.

    1988-01-01

    A XeCl laser pumped iodine laser oscillator was developed which will be incorporated into the Master Oscillator Power Amplifier (MOPA) system. The developed XeCl laser produces output energy of about 60 mJ per pulse. The pulse duration was about 10 nsec. The kinetic model for the solar-pumped laser was refined and the algorithm for the calculation of a set of rate equations was improved to increase the accuracy and the efficiency of the calculation. The improved algorithm was applied to explain the existing experimental data taken from a flashlamp pumped iodine laser for three kinds of lasants, i-C3F7I, n-C4F9I, and t-C4F9I. Various solid laser materials were evaluated for solar-pumping. The materials studied were Nd:YAG, Nd:YLF, and Cr:Nd:GSGG crystals. The slope efficiency of 0.17 percent was measured for the Nd:YLF near the threshold pump intensity which was 211 solar constants (29W/sq cm). The threshold pump intensity of the Nd:YAG was measured to be 236 solar constants (32W/sq cm) and the near-threshold slope efficiency was 0.12 percent. True CW laser operation of Cr:Nd:GSGG was possible only at pump intensities less than or equal to 1,500 solar constants (203 W/sq cm). This fact was attributed to the high thermal focusing effect of the Cr:Nd:GSGG rod.

  10. An Adaptive Amplifier System for Wireless Sensor Network Applications

    Carlos Marqués; Eduardo Romero; Mónica Lovay; Gabriela Peretti

    2012-01-01

    This paper presents an adaptive amplifier that is part of a sensor node in a wireless sensor network. The system presents a target gain that has to be maintained without direct human intervention despite the presence of faults. In addition, its bandwidth must be as large as possible. The system is composed of a software-based built-in self-test scheme implemented in the node that checks all the available gains in the amplifiers, a reconfigurable amplifier, and a genetic algorithm (GA) for rec...

  11. Experimental demonstration of a W-band gyroklystron amplifier

    Blank, M.; Danly, B.; Levush, B.; Latham, P; Pershing, D.

    1997-01-01

    The experimental demonstration of a four cavity W-band (93 GHz) gyroklystron amplifier is reported. The gyroklystron has produced 67 kW peak output power and 28% efficiency in the TE011 mode using a 55 kV, 4.3 A electron beam. The full width at half maximum instantaneous bandwidth is greater than 460 MHz, a significant increase over the bandwidth demonstrated in previous W-band gyroklystron amplifier experiments. The amplifier is unconditionally stable at this operating point. Experimental re...

  12. Experimental Demonstration of a W-Band Gyroklystron Amplifier

    Blank, M.; Danly, B. G.; Levush, B.; Latham, P. E.; Pershing, D. E.

    1997-12-01

    The experimental demonstration of a four cavity W-band (93 GHz) gyroklystron amplifier is reported. The gyroklystron has produced 67 kW peak output power and 28% efficiency in the TE011 mode using a 55 kV, 4.3 A electron beam. The full width at half maximum instantaneous bandwidth is greater than 460 MHz, a significant increase over the bandwidth demonstrated in previous W-band gyroklystron amplifier experiments. The amplifier is unconditionally stable at this operating point. Experimental results are in good agreement with theoretical predictions.

  13. Introduction to RF power amplifier design and simulation

    Eroglu, Abdullah

    2015-01-01

    Introduction to RF Power Amplifier Design and Simulation fills a gap in the existing literature by providing step-by-step guidance for the design of radio frequency (RF) power amplifiers, from analytical formulation to simulation, implementation, and measurement. Featuring numerous illustrations and examples of real-world engineering applications, this book:Gives an overview of intermodulation and elaborates on the difference between linear and nonlinear amplifiersDescribes the high-frequency model and transient characteristics of metal-oxide-semiconductor field-effect transistorsDetails activ

  14. Fast amplifier associated with the Saturne II detection systems

    This research thesis concerns the nuclear spectroscopy station which is beside the Saturne synchrotron in Saclay, and more particularly the design of the large bandwidth amplifier which aims at bringing the anode signal to a sufficient value to trigger an amplitude discriminator or a coincidence circuit. This amplifier must have a very short rise time in order not to introduce a hold, and its output base line must be as little sensitive as possible to the counting frequency, which implies a continuous link. The author describes in detail the rationale for the use of such an amplifier, and reports the calculated and measured assessment of its different characteristics

  15. MMIC DHBT Common-Base Amplifier for 172 GHz

    Paidi, Vamsi; Griffith, Zack; Wei, Yun; Dahlstrom, Mttias; Urteaga, Miguel; Rodwell, Mark; Samoska, Lorene; Fung, King Man; Schlecht, Erich

    2006-01-01

    Figure 1 shows a single-stage monolithic microwave integrated circuit (MMIC) power amplifier in which the gain element is a double-heterojunction bipolar transistor (DHBT) connected in common-base configuration. This amplifier, which has been demonstrated to function well at a frequency of 172 GHz, is part of a continuing effort to develop compact, efficient amplifiers for scientific instrumentation, wide-band communication systems, and radar systems that will operate at frequencies up to and beyond 180 GHz. The transistor is fabricated from a layered structure formed by molecular beam epitaxy in the InP/InGaAs material system. A highly doped InGaAs base layer and a collector layer are fabricated from the layered structure in a triple mesa process. The transistor includes two separate emitter fingers, each having dimensions of 0.8 by 12 m. The common-base configuration was chosen for its high maximum stable gain in the frequency band of interest. The input-matching network is designed for high bandwidth. The output of the transistor is matched to a load line for maximum saturated output power under large-signal conditions, rather than being matched for maximum gain under small-signal conditions. In a test at a frequency of 172 GHz, the amplifier was found to generate an output power of 7.5 mW, with approximately 5 dB of large-signal gain (see Figure 2). Moreover, the amplifier exhibited a peak small-signal gain of 7 dB at a frequency of 176 GHz. This performance of this MMIC single-stage amplifier containing only a single transistor represents a significant advance in the state of the art, in that it rivals the 170-GHz performance of a prior MMIC three-stage, four-transistor amplifier. [The prior amplifier was reported in "MMIC HEMT Power Amplifier for 140 to 170 GHz" (NPO-30127), NASA Tech Briefs, Vol. 27, No. 11 (November 2003), page 49.] This amplifier is the first heterojunction- bipolar-transistor (HBT) amplifier built for medium power operation in this

  16. The Dynamics of Semiconductor Optical Amplifiers – Modeling and Applications

    Mørk, Jesper; Nielsen, Mads Lønstrup; Berg, Tommy Winther

    2003-01-01

    The importance of semiconductor optical amplifiers is discussed. A semiconductor optical amplifier (SOA) is a semiconductor laser with anti-reflection coated facets that amplifies an injected light signal by means of stimulated emission. SOAs have a number of unique properties that open up...... significant opportunities in the area of fast, all-optical signal processing. Integrated SOA-based devices are considered suitable for future all-optical systems because of their compact size, low optical and electrical power consumption, polarization independence and high speed....

  17. FDML swept source at 1060 nm using a tapered amplifier

    Marschall, Sebastian; Klein, Thomas; Wieser, Wolfgang;

    2010-01-01

    We present a novel frequency-swept light source working at 1060nm that utilizes a tapered amplifier as gain medium. These devices feature significantly higher saturation power than conventional semiconductor optical amplifiers and can thus improve the limited output power of swept sources in this...... wavelength range. We demonstrate that a tapered amplifier can be integrated into a fiber-based swept source and allows for high-speed FDML operation. The developed light source operates at a sweep rate of 116kHz with an effective average output power in excess of 30mW. With a total sweep range of 70 nm an...

  18. Recovery of solitons with nonlinear amplifying loop mirrors

    Gabitov, Ildar; Holm, Darryl D.; Luce, Benjamin P.; Mattheus, Arnold

    1995-12-01

    We study the use of nonlinear amplifying loop mirrors to recover soliton pulses nonadiabatically deformed by losses. We approach this problem as a mapping problem of input pulse to output pulse, for segments of fiber followed by a combination of linear and nonlinear amplification. For a wide range of amplifier spacings, we find numerically that a single optimal input pulse of soliton shape exists for each amplifier spacing, which is well recovered at output. The recovered output pulses contain only \\similar 3% continuous radiation.

  19. Class-D audio amplifiers with negative feedback

    Cox, Stephen M.; Candy, B. H.

    2006-01-01

    There are many different designs for audio amplifiers. Class-D, or switching, amplifiers generate their output signal in the form of a high-frequency square wave of variable duty cycle (ratio of on time to off time). The square-wave nature of the output allows a particularly efficient output stage, with minimal losses. The output is ultimately filtered to remove components of the spectrum above the audio range. Mathematical models are derived here for a variety of related class-D amplifier d...

  20. 120 nm Bandwidth Erbium-doped Fiber Amplifier

    姜淳; 曾庆济; 肖石林

    2002-01-01

    A new dual band erbium-doped fiber amplifier configuration that provides 120 nm of optical bandwidth is simulated. This configuration employs a split-band architecture in which optical signals are splitted using a 1550/1610 nm port filter into two independent sub-bands which then pass in parallel through separate branches of the optical amplifier. Each branch may be optimized for the sub-band that traverses it. The independent sub-bands are combined and flattened before output, resulting in a 120 nm bandwidth gain-flattened optical amplifier.

  1. Efficient performance simulation of class D amplifier output stages

    Nyboe, Flemming; Risbo, Lars; Andreani, Pietro

    Straightforward simulation of amplifier distortion involves transient simulation of operation on a sine wave input signal, and a subsequent FFT of the output voltage. This approach is very slow on class D amplifiers, since the switching behavior forces simulation time steps that are many orders o...... magnitude smaller than the duration of one period of an audio sine wave. This work presents a method of simulating the amplifier transfer characteristic using a minimum amount of simulation time, and then deriving THD from the results....

  2. A hybrid copper/gold laser pumped dye amplifier

    Ainsworth, M. D.; Piper, J. A.

    1989-01-01

    The design and operating characteristics of a high average power copper vapour laser pumped dye amplifier which is injected with the 627.8 nm output of a gold vapour laser are reported. In these experiments both the CVL pump and GVL injection signals are obtained from a modified CVL plasma tube. Amplifier gain and efficiency as functions of both the pump and injection power, for a number of dyes and dye mixtures, were investigated. Amplifier efficiencies of 25% are reported for CVL pump powers of 4 W and GVL injection powers of only 50 mW.

  3. Influence of mode competition on beam quality of fiber amplifier

    Theoretical and experimental studies of the influence of the mode competition on the output beam quality of fiber amplifiers are presented. Rate equations and modal decomposition method are used in the theoretical model. In the experiment, the output beam-quality factor of a fiber amplifier, which is based on a Yb-doped double-clad large mode area fiber as a function of the seed beam quality and the pump power of the amplifier, is measured. The experimental results are consistent with the theoretical analysis. (electromagnetism, optics, acoustics, heat transfer, classical mechanics, and fluid dynamics)

  4. Fiber optical parametric amplifiers in optical communication systems

    Marhic, Michel E.; Andrekson, Peter A.; Petropoulos, Periklis;

    2015-01-01

    The prospects for using fiber optical parametric amplifiers (OPAs) in optical communication systems are reviewed. Phase-insensitive amplifiers (PIAs) and phase-sensitive amplifiers (PSAs) are considered. Low-penalty amplification at/or near 1 Tb/s has been achieved, for both wavelength- and time...... excess of 14,000 Tb/s x km in realistic wavelength-division multiplexed long-haul networks. Technical challenges remaining to be addressed in order for fiber OPAs to become useful for long-haul communication networks are discussed....

  5. Design procedure for optimizing CMOS low noise operational amplifiers

    Li Zhiyuan; Ye Yizheng; Ma Jianguo

    2009-01-01

    This paper presents and experimentally verifies an optimized design procedure for a CMOS low noise operational amplifier.The design procedure focuses on the noise performance,which is the key requirement for low noise operational amplifiers.Based on the noise level and other specifications such as bandwidth,signal swing,slew rate,and power consumption,the device sizes and the biasing conditions are derived.In order to verify the proposed design procedure,a three-stage operational amplifier has been designed.The device parameters obtained from the proposed design procedure closely agree with the simulated results obtained by using HSPICE.

  6. The Sloan Lens ACS Survey. V. The full ACS strong-lens sample

    Bolton, Adam S.; Burles, Scott; Koopmans, Leon V. E.; Treu, Tommaso; Gavazzi, Raphael; Moustakas, Leonidas A.; Wayth, Randall; Schlegel, David J.

    2008-01-01

    We present the definitive data for the full sample of 131 strong gravitational lens candidates observed with the Advanced Camera for Surveys (ACS) aboard the Hubble Space Telescope by the Sloan Lens ACS (SLACS) Survey. All targets were selected for higher redshift emission lines and lower redshift c

  7. Hearing Aids and Personal Sound Amplifiers: Know the Difference

    ... For Consumers Home For Consumers Consumer Updates Hearing Aids and Personal Sound Amplifiers: Know the Difference Share ... or use them as substitutes—for approved hearing aids. "Hearing aids and personal sound amplification products (PSAPS) ...

  8. Experiments of High Power 35GHz Gyro-Klystron Amplifiers

    Choi, Jin; McCurdy, A.; Wood, F.; Kyser, R.; Danly, B.; Levush, B.; Calame, J.; Parker, R.

    1997-11-01

    Experiments on a two-cavity gyroklystron amplifier operating at 35GHz were successfully carried out. The amplifier produced a saturated radiation power of 210kW which corresponds to an efficiency of 37% and a gain of 23.6dB. The experimental results are in good agreement with predicted performance from non-linear gyroklystron codes, MAGYKL and MAGY. Experiments on a staggered tuned three-cavity gyroklystron amplifier is currently underway to demonstrate a high gain and wideband rf amplification. Simulations on the three-cavity gyroklystron circuit predict an instantaneous bandwidth of 0.9% and a gain of 35dB. Experimental results of the amplifiers will be presented.

  9. Development of High Power Microwave and Millimeter Wave Gyroklystron Amplifiers

    Han, W. K.; Baik, S. W.; Lee, S. H.; Choi, J. J.; Park, D. M.; Oh, J. H.; Yang, J. G.; Hwang, S. M.; Temkin, R.

    1999-11-01

    A design study of a 28GHz gyroklystron amplifier for application of ECR plasma heating at Hanbit has been completed. Numerical simulation codes predict that a stable amplifier radiation of 200kW is produced with a 54dB saturated gain and an electronic efficiency of 35 percent from a 70kV and 8.2A high power electron beam. Major experimental equipments including a high power modulator, a 2 Tesla superconducting magnet, and a double-anode magnetro-injection-gun have been procured and are expected to set up in laboratory by this fall. Fabrication of tube components is currently underway. Cold-tests of the rf components are presented. In addition, experiments on a 10GHz gyroklystron amplifier which is a scale-down version of 28GHz gyroklystron amplifier are planned in the near future.

  10. 1.55 Micron High Peak Power Fiber Amplifier Project

    National Aeronautics and Space Administration — In this proposal, we propose to demonstrate and build a 1.55 micron single frequency high energy and high peak power fiber amplifier by developing an innovative...

  11. Apparatus and methods for a human de-amplifier system

    A human de-amplifier system is described for interfacing a human operator and a physical object through a physical plant, wherein the physical object has dimensions in the range of 1 micrometer to 1 mm. The human de-amplifier system uses an inner-feedback loop to increase the equivalent damping of the operating system to stabilize the system when it contacts with the environment and reduces the impact of the environment variation by utilizing a high feedback gain, determined by a root locus sketch. Because the stability of the human de-amplifier system of the present invention is greatly enhanced over that of the prior art, the de-amplifier system is able to manipulate the physical object having dimensions in the range of 1 micrometer to 1 mm with high stability and accuracy. The system also has a monitoring device to monitor the motion of the physical object under manipulation

  12. Gain Variation with Raman Amplifier Parameters and Its Restoration

    2003-01-01

    We demonstrate that gain profile of a distributed Raman amplifier is sensitive to its parameter variation, such as loss/gain coefficients change or partial pump failure. Gain flatness can be restored by adjusting power of pump lasers.

  13. Real burst traffic amplification in optically gain clamped amplifier

    Ennser, Karin; Taccheo, Stefano; Careglio, Davide; Solé Pareta, Josep; Aracil Rico, Javier

    2008-01-01

    Optical burst amplification in a gain-stabilized amplifier is theoretically investigated using real burst traffic data. The results show that excellent performance are obtained for WDM transmission with negligible interplay due to burst arrival statistics.

  14. Class D audio amplifiers for high voltage capacitive transducers

    Nielsen, Dennis

    implications of driving the non-linear transducer of the DEAP. 2-level modulated high voltage amplifiers driving the capacitive load of the DEAP transducer are addressed in chapter 4. An amplifier with fourth order output filter and full-state self-oscillating hysteresis based control loop is proposed...... on a silicone film. As a consequence a capacitive transducer emerges, which can be shaped into the loudspeaker membrane itself, rolled up into a transducer driving a membrane or being part of an active suspension system for the membrane. In order to document the full potential of the DEAP transducer, suitable....... Due to the similarities between the electrostatic loudspeaker and the DEAP transducer, the state-of-the-art has a special focus on amplifiers for electrostatic loudspeakers. Amplifiers for other type of capacitive transducers like piezoelectric ones are also considered. Finally the current state...

  15. High current density nanofilament cathodes for microwave amplifiers

    Schnell, J-P.; Minoux, E.; Gangloff, L.; Vincent, P.; Legagneux, P.; Dieumegard, D.; David, J.-F.; Peauger, F.; Hudanski, L.; Teo, K.B.K.; Lacerda, R.; Chhowalla, M.; Hasko, D.G.; Ahmed, H.; Amaratunga, G.A.J.; Milne, W.I.; Vila, L.; Dauginet-De Pra, L.; Demoustier-Champagne, S.; Ferain, E.; Legras, R.; Piraux, L.; Gröening, O.; Raedt, H. De; Michielsen, K.

    2004-01-01

    We study high current density nanofilament cathodes for microwave amplifiers. Two different types of aligned nanofilament array have been studied: first, metallic nanowires grown by electrodeposition into nanoporous templates at very low temperature (T

  16. Quantum Dot Semiconductor Optical Amplifiers - Physics and Applications

    Berg, Tommy Winther

    2004-01-01

    This thesis describes the physics and applications of quantum dot semiconductor optical amplifiers based on numerical simulations. These devices possess a number of unique properties compared with other types of semiconductor amplifiers, which should allow enhanced performance of semiconductor...... and QW devices and to experiments on quantum dot amplifiers. These comparisons outline the qualitative differences between the different types of amplifiers. In all cases focus is put on the physical processes responsible the differences....... devices in communication systems in the future. The basic properties of quantum dot devices are investigated, especially regarding the potential of realizing amplification and signal processing without introducing pattern dependence. Also the gain recovery of a single short pulse is modeled...

  17. Linear and nonlinear analysis of high-power rf amplifiers

    After a survey of the state variable analysis method the final amplifier for the CBA is analyzed taking into account the real beam waveshape. An empirical method for checking the stability of a non-linear system is also considered

  18. Compression of chirp pulses from a femtosecond fiber based amplifier

    Ito, Rumi; Takiuchi, Ken-ichi; Tei, Kazuyoku; Yamaguchi, Shigeru; Enokidani, Jyun; Sumida, Shin

    2015-03-01

    We demonstrate a single mode fiber based master oscillator power amplifier (MOPA) with a single polarization and a fully monolithic design. We have built a passive mode-locked polarization maintaining Yb doped fiber as the master oscillator contains a semiconductor saturable absorber mirror and a chirped fiber Bragg grating for the dispersion management. The net intracavity dispersion was managed to be slightly anomalous. The oscillator generates the 150 fs (sech2) pulses at the center wavelength of 1065 nm, and the repetition rate of 42 MHz. The oscillator output was amplified to 1.4 W from 80 mW in the single stage fiber amplifier which results in pulse shape distortion. The pulse shaping with a band pass filter and a compressor was applied to the amplified pulses. The shaping pulses have the pulse width of 90 fs and the pulse energy of 16 nJ.

  19. Fast terahertz imaging using a quantum cascade amplifier

    A terahertz (THz) imaging scheme based on the effect of self-mixing in a 2.9 THz quantum cascade (QC) amplifier has been demonstrated. By coupling an antireflective-coated silicon lens to the facet of a QC laser, with no external optical feedback, the laser mirror losses are enhanced to fully suppress lasing action, creating a THz QC amplifier. The addition of reflection from an external target to the amplifier creates enough optical feedback to initiate lasing action and the resulting emission enhances photon-assisted transport, which in turn reduces the voltage across the device. At the peak gain point, the maximum photon density coupled back leads to a prominent self-mixing effect in the QC amplifier, leading to a high sensitivity, with a signal to noise ratio up to 55 dB, along with a fast data acquisition speed of 20 000 points per second

  20. Compensation of flicker noise in weak-signal amplifiers

    A. S. Makarenko; Tertychny, G. N.

    2007-01-01

    The paper considers the block diagram of a weak-signal low-frequency amplifier, describes its principle of operation, and presents results of the theoretical and experimental investigation in compensation of flicker noise in the new device.

  1. Development of SPND amplifier using hybrid micro circuit

    Self-Powered Neutron Detector (SPND) is an in-core neutron detector of compact size, rugged construction and long life with a very simple associated signal processing electronics due to absence of high voltage bias. Because of the reasons mentioned above, the SPNDs are being used in large numbers for all types of nuclear reactors. The paper describes the development of SPND amplifier using low power components and hybrid microcircuit with advanced features like on-line detector health monitoring and buffered output among others. This development will be reduced the mechanical size and power requirement of SPND amplifier considerably as compared with earlier developed SPND amplifier using discrete components. The present amplifier design is compact and accommodates two SPND channels in the existing 1 width module. (author)

  2. AC losses in filamentary YBCO/hastelloy

    Full text: The AC hysteresis loss of a long YBCO thin-film superconducting strip in a perpendicular AC magnetic field can be reduced by subdividing the film into narrow parallel strips (filaments). The hysteresis loss depends on the film critical current density Jc, the film thickness d, the filament width 2a and the lateral spacing L between filaments as well as on the AC magnetic field amplitude Hm. In addition, if the film is deposited onto a YSZ/hastelloy substrate to form a flexible tape, eddy current loss occurs in the hastelloy metal. The eddy current loss depends on the resistivity p of the hastelloy, the width 2w and thickness dm of the hastelloy substrate as well as on the frequency f and amplitude Hm. We have calculated the hysteresis and eddy current losses as a function of Jc, d, 2a, L, p, w, dm, f, and Hm to find optimal design parameters for a YBCO/hastelloy tape. As the AC loss is related to the loss component X'' of the AC susceptibility, we have measured X'' at different frequencies f and amplitudes Hm for several filamentary designs of YBCO/hastelloy tapes and compared our experimental results with our model calculations

  3. Distributed Mode Filtering Rod Fiber Amplifier With Improved Mode Stability

    Laurila, Marko; Alkeskjold, Thomas Tanggaard; Broeng, Jes;

    2012-01-01

    We report 216W of average output power from a photonic crystal rod fiber amplifier. We demonstrate 44% power improvement before onset of the mode instability by operating the rod fiber in a leaky guiding regime.......We report 216W of average output power from a photonic crystal rod fiber amplifier. We demonstrate 44% power improvement before onset of the mode instability by operating the rod fiber in a leaky guiding regime....

  4. Dynamics of Continuously Pumped Solid-State Regenerative Amplifiers

    Grishin, Mikhail; Michailovas, Andrejus

    2010-01-01

    Continuously pumped regenerative amplifiers are subject to energy instability at high pulse repetition rates due to period doubling bifurcation. Theoretical concepts representing a generalized picture of operation features have been in-detail worked out in order to differentiate and understand instability effects. Experimental data for Nd:YVO4 regenerative amplifier have been presented; and possible techniques for performance optimization have been analyzed. An increase in the seed pulse ener...

  5. Gas cooled disk amplifier approach to solid state average power

    Disk amplifiers have been used on almost all solid state laser systems of high energy, and, in principle, one simply has to cool the device to operate it at average power. To achieve the desired waste heat removal, gas is flowed across the disk surface. The authors show the basic gas flow geometry. They computationally and experimentally characterize the flow and its optical implications over regimes which far exceed the envisioned operating requirements of a working amplifier

  6. Efficient development of highly linear MMIC power amplifiers

    Bignamini, M.; Favre, G.; Meazza, A.; Pagani, M.; Palomba, F.; Sivverini, G.

    2001-01-01

    Highly linear power amplifiers are key components of high capacity radio transmitters. This paper describes the complete procedure we established to develop a family of new MMIC power amplifiers aimed at achieving state-of-the-art performance as needed for a new M-QAM microwave radio. A cost effective approach dedicated to volume production has been addressed. The most important experimental characteristics for each of the developed MMIC PAs are also reported in order to demostrate the effect...

  7. Ultrafast optical signal processing using semiconductor quantum dot amplifiers

    Berg, Tommy Winther; Mørk, Jesper

    2002-01-01

    The linear and nonlinear properties of quantum dot amplifiers are discussed on the basis of an extensive theoretical model. These devices show great potential for linear amplification as well as ultrafast signal processing.......The linear and nonlinear properties of quantum dot amplifiers are discussed on the basis of an extensive theoretical model. These devices show great potential for linear amplification as well as ultrafast signal processing....

  8. Amplifying ribbon extensometer for measuring film and fabric strain

    Alley, V. L., Jr.; Mchatton, A. D.

    1975-01-01

    Variations of a low-cost amplifying linear threshold extensometer are presented in detail for high or low strain applications. Derivations of scale relationships and extraction forces are included with experimental correlations and analyses given on performance, attachment problems, gain selection, gage and base material compatibility, and zero setting techniques. Flight applications of unamplified gages on parawing deployment tests are noted. The amplified gages perform accurately in laboratory tests and further experience is needed on performance under dynamic environments.

  9. On the effect of time delays in negative feedback amplifiers

    Alves, L. N.; Aguiar, R. L.

    2005-01-01

    Time delays are intrinsic to all existing devices and circuits. For the majority of applications, time delays are so small that their effects can be disregarded. However, when considering feedback amplifiers, depending on open-loop poles and loop gain, the effect of a small time delay inside the feedback path may turn to be of considerable importance. This paper analyzes the frequency response effects associated with time delays in feedback amplifiers, exploiting these effects to achieve band...

  10. DESIGN OF SEQUENTIALLY FED BALANCED AMPLIFYING ANTENNA FOR CIRCULAR POLARIZATION

    S. K. Behera; D. R. Poddar; Mishra, R K

    2010-01-01

    This paper presents a sequentially fed balanced amplifying antenna that exhibits circularly polarized radiation. The inherent benefits of good isolation between input and output ports as well as improved matching capabilities of balanced amplifiers provide overall system gain of 8 dBi at frequency 2.36GHz. The planar arrangement of the patch antenna elements are considered to form an array. The phase of the feeding in the array increases progressively from 00 to 2700.Each element in the array...

  11. Analysis and Investigation of Noise Figure of Fiber Raman Amplifier

    Ramanpreet Kaur; Kirandeep Kaur

    2012-01-01

    Raman amplifiers are widely used for high capacity long haul communication systems. One of the main reason for which it can be used is its improved noise figure. In this paper noise figure of Raman amplifiers is studied and analysed for different pumping schemes. The main sources of noise and their effects on the noise figure are discussed and the methods to reduce the noise figure are proposed.

  12. Characterization of a multimode coplanar waveguide parametric amplifier

    We characterize a Josephson parametric amplifier based on a flux-tunable quarter-wavelength resonator. The fundamental resonance frequency is ∼1 GHz, but we use higher modes of the resonator for our measurements. An on-chip tuning line allows for magnetic flux pumping of the amplifier. We investigate and compare degenerate parametric amplification, involving a single mode, and nondegenerate parametric amplification, using a pair of modes. We show that we reach quantum-limited noise performance in both cases

  13. HFSS Simulation of Vacuum Tube RF Power Amplifiers

    Zviagintsev, Vladimir

    2005-01-01

    Development and upgrade of rf power amplifiers require comprehensive calculations to predict and optimize various parameters of the system before hardware modifications are applied. ANSOFT HFSS code provides a powerful tool for 3D EM simulation of the amplifier output resonator comprising a vacuum tube as a passive element. Two examples of this kind of simulation applied for upgrade of the TRIUMF Cyclotron rf system are presented in this paper.

  14. A high-power compact regenerative amplifier FEL

    The Regenerative Amplifier FEL (RAFEL) is a new FEL approach aimed at achieving the highest optical power from a compact rf-linac FEL. The key idea is to feed back a small fraction (5 in single pass) wiggler to enable the FEL to reach saturation in a few passes. This paper summarizes the design of a high-power compact regenerative amplifier FEL and describes the first experimental demonstration of the RAFEL concept

  15. An amplifier for VUV photomultiplier operating in cryogenic environment

    Arneodo, F.; Benabderrahmane, M. L.; Dahal, S.; Di Giovanni, A.; d`Inzeo, M.; Franchi, G.; Pazos Clemens, L.

    2016-07-01

    We present the characterisation of an amplifier potentially interesting for noble liquid detectors. The design has been conceived considering the requirements of low power consumption (less than 30 mW), low noise, amplification factor of 10 at 100 MHz and use of commercial components. The amplifier has been integrated onto an electronic board with a voltage divider to operate an Hamamatsu R11410 photomultiplier tube (used in XENON1T, Aprile et al. (2014) [1] dark matter experiment).

  16. Behavioral modeling and linearization of RF power amplifiers

    Wood, John

    2014-01-01

    Wireless voice and data communications have made great improvements, with connectivity now virtually ubiquitous. Users are demanding essentially perfect transmission and reception of voice and data. The infrastructure that supports this wide connectivity and nearly error-free delivery of information is complex, costly, and continually being improved.This resource describes the mathematical methods and practical implementations of linearization techniques for RF power amplifiers for mobile communications. This includes a review of RF power amplifier design for high efficiency operation. Readers

  17. Resonantly phase-matched Josephson junction traveling wave parametric amplifier

    O'Brien, Kevin; Macklin, Chris; Siddiqi, Irfan; Zhang, Xiang

    2014-01-01

    We develop a technique to overcome phase-mismatch in Josephson-junction traveling wave parametric amplifiers in order to achieve high gain over a broad bandwidth. Using "resonant phase matching," we design a compact superconducting device consisting of a transmission line with subwavelength resonant inclusions that simultaneously achieves a gain of 20 dB, an instantaneous bandwidth of 3 GHz, and a saturation power of -98 dBm. Such an amplifier is well-suited to cryogenic broadband microwave m...

  18. Design of low noise transimpedance amplifier for intravascular ultrasound

    Reda, Dina

    2009-11-01

    In this paper, we study transimpedance amplifiers for capacitive sensing applications with a focus on Intravascular Ultra Sound (IVUS). We employ RF noise cancellation technique on capacitive feedback based transimpedance amplifiers. This technique eliminates the input-referred noise of TIAs completely and enhances the dynamic range of front-end electronics. Simulation results verify the proposed technique used in two different TIA topologies employing shunt-shunt feedback. ©2009 IEEE.

  19. On the dual symmetry between absorbing and amplifying random media

    S Anantha Ramakrishna

    2004-06-01

    We re-examine the dual symmetry between absorbing and amplifying random media. By analysing the physically allowed choice of the sign of the square root to determine the complex wave vector in a medium, we draw a broad set of conclusions that enables us to resolve the apparent paradox of the dual symmetry and also to anticipate the large local electromagnetic field enhancements in amplifying random media.

  20. Yb:YAG single crystal fiber image amplifier

    Wan, Peng; Liu, Jian; Yang, Lih-Mei; Bai, Shuang

    2014-02-01

    In the paper, a Yb:YAG single crystal fiber is used for the first time to amplify week image signal. It was longitudinally pumped by a fiber-coupled laser diode with a maximum power of 150W at 940 nm. The image amplifier provided low noise and high gain amplification. A spatially uniform amplification gain of up to 10.2 dB at wavelength of 1030 nm was obtained.

  1. ANALYSIS OF INTERNALLY GENERATED NOISE OF BIOELECTRIC AMPLIFIERS

    MashhourMustafaBaniAmer

    2003-01-01

    This papenr deals with internally generated noise of bioelectric amplifiers that are usually used for processing of bioelectric events.The main purpose of this paper is to present a procedure for analysis of the effects of internal noise generated by the active circuits and to evaluate the output noise of the author's new designed bioelectric amplifier that caused by internal effects to the amplifier circuit itself in order to compare it with the noise generated by conventional amplifiers.The obtained analysis results of internally generated noise showed that the total output noise of bioelectric active circuits does not increase when some of their resitors have a larger value.This behavior is caused by the different transfer functions for the signal and the respective noise sources associated with these resistors.Moreover,the new designed bioelectric amplifier haws an output noise less than that for conventional amplifiers.The obtained analysis results were also experimentally verified and the final conclusions were drawn.

  2. Status of solid-state power amplifiers development in BARC

    Various solid-state power amplifiers have been developed to meet the requirements of accelerator needs for BARC and its collaboration projects. These are mainly 352 and 325 MHz RF power amplifiers. The 352 MHz, RF power amplifier have been developed to feed the buncher cavity of the Low Energy High Intensity Proton Accelerator (LEHIPA). Whereas 325 MHz 3 kW and 7 kW solid- state power amplifiers have been designed under the IIFC-Fermilab collaboration. The same technologies will also be used for 200 MeV superconducting accelerator of ADS program. The paper present the technology details of the power amplifier modules, power combiners, dividers and sensors etc. The developed SSPAs are of 3 kW, 325 MHz and 10 kW 352 MHz. Both the power amplifiers have been tested on a 50 ohm load. The 3 kW SSPA has the drain efficiency of 65.3%. The four modules have the power output of 850 W each. This SSPA has the figure of merit of SSPAs (number of modules per kW) is 1.2. The 10 kW SSPA is mainly required to feed the buncher cavity of the LEHIPA. It is combination of 16 power modules of 800 W each at 352 MHz. (author)

  3. Frequency-Offset Cartesian Feedback Based on Polyphase Difference Amplifiers.

    Zanchi, Marta G; Pauly, John M; Scott, Greig C

    2010-05-01

    A modified Cartesian feedback method called "frequency-offset Cartesian feedback" and based on polyphase difference amplifiers is described that significantly reduces the problems associated with quadrature errors and DC-offsets in classic Cartesian feedback power amplifier control systems.In this method, the reference input and feedback signals are down-converted and compared at a low intermediate frequency (IF) instead of at DC. The polyphase difference amplifiers create a complex control bandwidth centered at this low IF, which is typically offset from DC by 200-1500 kHz. Consequently, the loop gain peak does not overlap DC where voltage offsets, drift, and local oscillator leakage create errors. Moreover, quadrature mismatch errors are significantly attenuated in the control bandwidth. Since the polyphase amplifiers selectively amplify the complex signals characterized by a +90° phase relationship representing positive frequency signals, the control system operates somewhat like single sideband (SSB) modulation. However, the approach still allows the same modulation bandwidth control as classic Cartesian feedback.In this paper, the behavior of the polyphase difference amplifier is described through both the results of simulations, based on a theoretical analysis of their architecture, and experiments. We then describe our first printed circuit board prototype of a frequency-offset Cartesian feedback transmitter and its performance in open and closed loop configuration. This approach should be especially useful in magnetic resonance imaging transmit array systems. PMID:20814450

  4. Power Amplifier Design for E-band Wireless System Communications

    Hadziabdic, Dzenan; Krozer, Viktor; Johansen, Tom Keinicke

    2008-01-01

    E-band wireless communications will become important as the microwave backhaul for high-speed data transmission. One of the most critical components is the front-end power amplifier in this system. The paper analyzes different technologies with potential in the E-band frequency range and present a...... power amplifier design satisfying the E-band system specifications. The designed power amplifier achieves a maximum output power of ges 20 dBm with a state-of-the-art power-added efficiency of 15%. The power is realized using InP DHBT technology. To the best of our knowledge it is the highest output...... power and efficiency reported for an InP HBT power amplifier in this frequency range. The predicted power-added efficiency is higher than that of power amplifiers based on SiGe HBT and GaAs pHEMT technologies. The design shows the capabilities of InP DHBT for power amplifier applications as an...

  5. Quantum noise in Josephson-junction parametric amplifiers

    Crossover between thermal and quantum noise in the externally-pumped Josephson-junction parametric amplifiers is theoretically followed. Two different approaches are used for the analysis: Josephson junction is replaced with its RSJ model with the equilibrium source of fluctuations; microscopic theory of the tunnel junctions is used, which takes into account not only thermal and quantum but also shot noise. Because of inconvenience of the noise temperature T /SUB N/ for the amplifier sensitivity characterization in the quantum limit, the authors express their results in terms of the figure theta /SUB N/ which is essentially the amplifier output noise energy, reduced to its input (in the classical limit, theta /SUB N/ =k /SUB B/ T /SUB N/). For the nondegenerate amplifier, the minimum value of theta /SUB N/ equals hω/2 and is due to quantum noise (zeropoint oscillations) in the idle-frequency resonator of the amplifier. For the degenerate amplifier, sensitive to only one quadrature component of the input signal, theta /SUB N/ can be made much less than the above ''quantum limit'' even at operation temperatures much higher than hω/k /SUB B/, if the Josephson junction characteristic frequency ω /SUB c/ is high enough, hω /SUB c/ k /SUB B/ T. An analysis of the experimental situation shows that the values theta /SUB N/ < can be achieved using two-dimensional arrays of a large number (N approx. = 100) single-tunnel-junction interferometers with low inductances, inductively coupled to a microwave cavity

  6. Improving Students' Understanding of Lock-In Amplifiers

    DeVore, Seth; Gauthier, Alexandre; Levy, Jeremy; Chandralekha, Singh

    2014-03-01

    A lock-in amplifier is a versatile instrument frequently used in physics research. However, many students struggle with the basic operating principles of a lock-in amplifier which can lead to a variety of difficulties. To improve students' understanding, we have been developing and evaluating a research-based tutorial which makes use of a computer simulation of a lock-in amplifier. The tutorial is based on a field-tested approach in which students realize their difficulties after predicting the outcome of simulated experiments involving a lock-in amplifier and check their predictions using the simulated lock-in amplifier. Then, the tutorial guides and helps students develop a coherent understanding of the basics of a lock-in amplifier. The tutorial development involved interviews with physics faculty members and graduate students and iteration of many versions of the tutorial with professors and graduate students. The student difficulties and the development and assessment of the research-based tutorial are discussed. We thank National Science Foundation for award NSF-1124131.

  7. Improving Students' Understanding of Lock-in Amplifiers

    DeVore, Seth; Levy, Jeremy; Singh, Chandralekha

    2016-01-01

    A lock-in amplifier is a versatile instrument frequently used in physics research. However, many students struggle with the basic operating principles of a lock-in amplifier which can lead to a variety of difficulties. To improve students' understanding, we have been developing and evaluating a research-based tutorial which makes use of a computer simulation of a lock-in amplifier. The tutorial is based on a field-tested approach in which students realize their difficulties after predicting the outcome of simulated experiments involving a lock-in amplifier and check their predictions using the simulated lock-in amplifier. Then, the tutorial guides and helps students develop a coherent understanding of the basics of a lock-in amplifier. The tutorial development involved interviews with physics faculty members and graduate students and iteration of many versions of the tutorial with professors and graduate students. The student difficulties and the development and assessment of the research-based tutorial are d...

  8. Recovery of slow potentials in AC-coupled electrocorticography: application to spreading depolarizations in rat and human cerebral cortex

    Hartings, Jed A; Watanabe, Tomas; Dreier, Jens P;

    2009-01-01

    Cortical spreading depolarizations (spreading depressions and peri-infarct depolarizations) are a pathology intrinsic to acute brain injury, generating large negative extracellular slow potential changes (SPCs) that, lasting on the order of minutes, are studied with DC-coupled recordings in animals....... The spreading SPCs of depolarization waves are observed in human cortex with AC-coupled electrocorticography (ECoG), although SPC morphology is distorted by the high-pass filter stage of the amplifiers. Here, we present a signal processing method to reverse these distortions and recover approximate...

  9. AC loss performance of CS insert coil

    The ITER Central Solenoid (CS) model coil and the CS insert coil were fabricated, and the test was carried out. The AC loss measurement of the coil is one of the most important tests to determine coil performance. The AC loss of a short sample conductor for the CS insert coil was measured by using the calorimetric method, and the coupling time constants of the conductor were estimated to be 30 ms and 20 ms for pulse and discharge tests, respectively. The AC loss of the CS insert coil was measured by using the calorimetric method for pulse and discharge tests. The coupling time constant estimated from the result of the pulse tests was 34 ms and almost equal to that of the short sample. The coupling time constant for the discharge test was estimated to be 140 ms and about 4 times that of the pulse test. (author)

  10. ac propulsion system for an electric vehicle

    Geppert, S.

    1980-01-01

    It is pointed out that dc drives will be the logical choice for current production electric vehicles (EV). However, by the mid-80's, there is a good chance that the price and reliability of suitable high-power semiconductors will allow for a competitive ac system. The driving force behind the ac approach is the induction motor, which has specific advantages relative to a dc shunt or series traction motor. These advantages would be an important factor in the case of a vehicle for which low maintenance characteristics are of primary importance. A description of an EV ac propulsion system is provided, taking into account the logic controller, the inverter, the motor, and a two-speed transmission-differential-axle assembly. The main barrier to the employment of the considered propulsion system in EV is not any technical problem, but inverter transistor cost.

  11. Optimization of the Diode-Pumped Solid State Nd:YLF Amplifier Chain for the 263 nm Drive Laser at the FAST Facility

    Gillis, Julie M.; Corcovilos, Theodore A.; Edstrom, Dean R., Jr.; Ruan, Jinhao; Santucci, James K.

    The RF photoinjector of the 50 MeV superconducting electron linear accelerator at the Fermilab Accelerator Science and Technology (FAST) Facility is driven by a phase-locked laser system. The neodymium-doped yttrium-lithium fluoride (Nd:YLF) seed laser provides short (3 ps) infrared (1053 nm) pulses to an amplifier chain before conversion to ultraviolet (263 nm) through two frequency-doubling BBO crystals. The amplification section consists of seven diode-pumped solid state (DPSS) amplifiers, which increase the pulse energy of the seed laser using optically end-pumped Nd:YLF crystals. To maximize the total gain of the amplifier chain, each stage must be properly tuned with optimized optics, alignment, and laser beam characterization. In this paper we report on one of the single-pass amplifier improvements to achieve a consistent gain of 4.83 with stabilized output pulse trains for up to 1500 seed pulses. The final ultraviolet pulses imaged onto the Cs2Te photocathode of the RF electron gun have been doubled in energy to 10.2 μJ per pulse as a result of these alterations. Operated by Fermi Research Alliance, LLC under Contract No. De-AC02-07CH11359 with the United States Department of Energy.

  12. I-V curve of Bi-2223/Ag tapes in overload conditions determined from AC transport data

    The influence of dynamics on the dissipation at electrical charge transport in superconductors can be investigated by comparing the resistive part of AC transport loss with the prediction deduced from DC I-V curve. The complication is that in the AC regime a hysteretic loss is present, generating a voltage that is similar to that produced by the I-V curve. We present how the signal due to hysteresis loss can be eliminated from the total voltage measured with AC transport current, and the DC I-V curve deduced from its fundamental and higher harmonics can be constructed. The experiments were performed on two samples prepared from the same tape. The voltage was monitored using contact as well as contact-less method. Its harmonics (up to 7th) were decomposed to the parts that are out of phase and in phase with transport current, using a lock-in amplifier. The experiments were focused on the over critical current regime up to AC currents with amplitudes 3 times exceeding the tape critical current. We show how from these data the basic parameters characterising the I-V curve of the composite tape, i.e. its critical current, the slope and the normal state resistivity, can be determined

  13. AC loss in superconducting tapes and cables

    Oomen, Marijn Pieter

    High-temperature superconductors are developed for use in power-transmission cables, transformers and motors. The alternating magnetic field in these devices causes AC loss, which is a critical factor in the design. The study focuses on multi-filament Bi-2223/Ag tapes exposed to a 50-Hz magnetic field at 77 K. The AC loss is measured with magnetic, electric and calorimetric methods. The results are compared to theoretical predictions based mainly on the Critical-State Model. The loss in high- temperature superconductors is affected by their characteristic properties: increased flux creep, high aspect ratio and inhomogeneties. Filament intergrowths and a low matrix resistivity cause a high coupling-current loss especially when the filaments are fully coupled. When the wide side of the tape is parallel to the external magnetic field, the filaments are decoupled by twisting. In a perpendicular field the filaments can be decoupled only by combining a short twist pitch with a transverse resistivity much higher than that of silver. The arrangement of the inner filaments determines the transverse resistivity. Ceramic barriers around the filaments cause partial decoupling in perpendicular magnetic fields at power frequencies. The resultant decrease in AC loss is greater than the accompanying decrease in critical current. With direct transport current in alternating magnetic field, the transport-current loss is well described with a new model for the dynamic resistance. The Critical- State Model describes well the magnetisation and total AC loss in parallel magnetic fields, at transport currents up to 0.7 times the critical current. When tapes are stacked face-to-face in a winding, the AC-loss density in perpendicular fields is greatly decreased due to the mutual shielding of the tapes. Coupling currents between the tapes in a cable cause an extra AC loss, which is reduced by a careful cable design. The total AC loss in complex devices with many tapes is generally well

  14. ACS air bearing test-bed design

    Glitt, Sascha

    2010-01-01

    This thesis is about the construction and design of a new air bearing test-bed to verify the programmed ACS attitude control algorithm and to validate the ACS MATLAB/SimuLink¬ model of NPSAT1, the second small satellite currently under development at the Naval Postgraduate School Space Systems Academic Group. The software was already verified and validated using a comparable air bearing test-bed. But due to changes in hardware from commercial magnetic torque rods to custom, NPS-built, magneti...

  15. The Effective AC Response of Nonlinear Composites

    WEI En-Bo; GU Guo-Qing

    2001-01-01

    A perturbative approach is used to study the AC response of nonlinear composite media, which obey a current-field relation of the form J = σ E + χ|E|2 E with components having nonlinear response at finite frequencies. For a sinusoidal applied field, we extend the local potential in terms of sinusoidal components at fundamental frequency and high-order harmonic frequencies to treat the nonlinear composites. For nonlinear composite media vith a low concentrations of spherical inclusions, we give the formulae of the nonlinear effective AC susceptibility χ*3ω at the third harmonic frequency.

  16. YBCO thin films in ac and dc films

    Shahzada, S

    2001-01-01

    We report studies on the dc magnetization of YBCO thin films in simultaneously applied dc and ac fields. The effect of the ac fields is to decrease the irreversible magnetization drastically leading to complete collapse of the hysteresis loops for relatively small ac fields (250e). The magnitude of the decrease depends on the component of the ac field parallel to the c-axis. The decrease is non-linear with ac amplitude and is explained in the framework of the critical state response of ultra thin films in perpendicular geometry. The ac fields increase the relaxation rapidly at short times while the long time response appears unaffected. (author)

  17. SINGLE PHASE HIGH FREQUENCY AC CONVERTER FOR INDUCTION HEATING APPLICATION

    M.A INAYATHULLAAH,

    2010-12-01

    Full Text Available The proposed topology reduces the total harmonic distortion (THD of a high frequency AC/AC Converter well below the acceptable limit. This paper deals with a novel single phase AC/DC/AC soft switching utility frequency AC to high frequency AC converter. In this paper a single phase full bridge inverter with Vienna rectifier as front end is used instead of conventional diode bridge rectifier to provide continuous sinusoidal input current with nearly unity power factor at the source side with extremely low distortion.. This power converter is more suitable and acceptable for cost effective high frequency (HF consumer induction heating applications.

  18. AcsA-AcsB: The core of the cellulose synthase complex from Gluconacetobacter hansenii ATCC23769.

    McManus, John B; Deng, Ying; Nagachar, Nivedita; Kao, Teh-hui; Tien, Ming

    2016-01-01

    The gram-negative bacterium, Gluconacetobacter hansenii, produces cellulose of exceptionally high crystallinity in comparison to the cellulose of higher plants. This bacterial cellulose is synthesized and extruded into the extracellular medium by the cellulose synthase complex (CSC). The catalytic component of this complex is encoded by the gene AcsAB. However, several other genes are known to encode proteins critical to cellulose synthesis and are likely components of the bacterial CSC. We have purified an active heterodimer AcsA-AcsB from G. hansenii ATCC23769 to homogeneity by two different methods. With the purified protein, we have determined how it is post-translationally processed, forming the active heterodimer AcsA-AcsB. Additionally, we have performed steady-state kinetic studies on the AcsA-AcsB complex. Finally through mutagenesis studies, we have explored the roles of the postulated CSC proteins AcsC, AcsD, and CcpAx. PMID:26672449

  19. Long-term preservation of antibody-dependent cellular cytotoxicity (ADCC) of natural killer cells amplified in vitro from the peripheral blood of breast cancer patients after chemotherapy.

    Clémenceau, Béatrice; Gallot, Géraldine; Vivien, Régine; Gaschet, Joëlle; Campone, Mario; Vié, Henri

    2006-01-01

    Twenty percent of breast cancer adenocarcinomas overexpress the oncogene c-erb-2 that is recognized by the humanized anti-Her2/neu monoclonal antibody Herceptin. Results from clinical studies suggest that antibody-dependent cellular cytotoxicity (ADCC) is involved in the clinical response of Herceptin-treated patients. The purpose of the current study was to evaluate the possibility of amplifying in vitro the CD3-/CD16+ natural killer (NK) cell subset that mediates ADCC from breast cancer patients after chemotherapy. Peripheral blood mononuclear cells from six breast cancer patients taken 2 months after chemotherapy completion were co-cultured with an autologous irradiated Epstein-Barr virus-transformed B-lymphoblastoid cell line (LCL) in the presence of interleukin-2 (IL-2) for 4-6 weeks. These LCL + IL2 activated cultures (ACs) were tested for ADCC potential, and their CD3/CD16 NK proportion was quantified. Among the ACs, the proportion of CD3-/CD16+ NK cells increased up to 64% over the first 2 weeks of culture and the ACs continued to expand for 1 month thereafter. Control and patient ACs displayed ADCC activity (tested in the presence of Rituximab against the autologous LCL to take into account any possible effect of inhibitory NK receptors) as well as against the MCF-7(Her2/neu) breast cancer cell line in the presence of Herceptin. This ADCC activity was maintained during the entire culture period. In conclusion, chemotherapy in breast cancer patients does not obviate the possibility of amplifying in vitro the NK cell subset that mediates ADCC. Consequently, adoptive transfer of lymphocytes mediating ADCC can be considered using this protocol to test its benefit in patients under Herceptin treatment. PMID:16365600

  20. VizieR Online Data Catalog: Grism Lens-Amplified Survey from Space (GLASS). I. (Treu+, 2015)

    Treu, T.; Schmidt, K. B.; Brammer, G. B.; Vulcani, B.; Wang, X.; Bradac, M.; Dijkstra, M.; Dressler, A.; Fontana, A.; Gavazzi, R.; Henry, A. L.; Hoag, A.; Huang, K.-H.; Jones, T. A.; Kelly, P. L.; Malkan, M. A.; Mason, C.; Pentericci, L.; Poggianti, B.; Stiavelli, M.; Trenti, M.; von der Linden, A.

    2016-02-01

    In this paper we give an overview of Grism Lens Amplified Survey from Space (GLASS; PI Treu; GO 13459) and we present the first release of the data for MACS J0717.5+3745, the first cluster targeted by the survey. Spectra for 1151 galaxies down to magnitude HAB=24 (F140W) have been visually inspected by members of our team to ensure quality control. GLASS is a cycle-21 large program with the Hubble Space Telescope (HST), targeting 10 massive clusters, including the 6 Frontier Fields, using the WFC3 and ACS grisms. The program consists of 140 primary orbits (with the G102 and G141 grisms; range 0.81-1.69μm) and 140 parallel orbits (with the G800L grism). (2 data files).

  1. The Grism Lens-Amplified Survey from Space (GLASS): Dissecting reionization, z~2 galaxies, and dense environments

    Treu, Tommaso; GLASS Team

    2016-01-01

    The Grism Lens-Amplified Survey from Space (GLASS) is a large HST cycle-21 program targeting 10 massive galaxy clusters with extensive HST imaging from CLASH and the Frontier Field Initiative. The program consists of 140 primary and 140 parallel orbits of near-infrared WCF3 and optical ACS grism observations, which result in spatially resolved spectroscopy of thousands of galaxies. GLASS has three primary science drivers although a wide variety of other science investigations are possible with the public GLASS data (e.g. SN 'Refsdal'). The key science goals of GLASS are to: 1) shed light on the epoch of reionization, by measuring the lyman alpha optical depth at z>6 2) Study gas accretion, star formation, and outflows by spatially mapping resolved star formation and determine metallicity gradients from emission lines of galaxies at 1.3https://archive.stsci.edu/prepds/glass/GlASS is support by NASA through HST program GO-13459

  2. AC power generation from microbial fuel cells

    Lobo, Fernanda Leite; Wang, Heming; Forrestal, Casey; Ren, Zhiyong Jason

    2015-11-01

    Microbial fuel cells (MFCs) directly convert biodegradable substrates to electricity and carry good potential for energy-positive wastewater treatment. However, the low and direct current (DC) output from MFC is not usable for general electronics except small sensors, yet commercial DC-AC converters or inverters used in solar systems cannot be directly applied to MFCs. This study presents a new DC-AC converter system for MFCs that can generate alternating voltage in any desired frequency. Results show that AC power can be easily achieved in three different frequencies tested (1, 10, 60 Hz), and no energy storage layer such as capacitors was needed. The DC-AC converter efficiency was higher than 95% when powered by either individual MFCs or simple MFC stacks. Total harmonic distortion (THD) was used to investigate the quality of the energy, and it showed that the energy could be directly usable for linear electronic loads. This study shows that through electrical conversion MFCs can be potentially used in household electronics for decentralized off-grid communities.

  3. Performance of Halbach magnetized brushless AC motors

    Zhu, Z.Q.; Xia, Z.P.; Shi, Y.F.; Howe, D.; Pride, A.; X. J. Chen

    2003-01-01

    The steady-state performance of Halbach magnetized brushless ac machines when operated in constant torque and flux-weakening modes is investigated both theoretically and experimentally, with particular emphasis on the influence of cross-coupling magnetic saturation on the torque capability.

  4. Ac-dc converter firing error detection

    Each of the twelve Booster Main Magnet Power Supply modules consist of two three-phase, full-wave rectifier bridges in series to provide a 560 VDC maximum output. The harmonic contents of the twelve-pulse ac-dc converter output are multiples of the 60 Hz ac power input, with a predominant 720 Hz signal greater than 14 dB in magnitude above the closest harmonic components at maximum output. The 720 Hz harmonic is typically greater than 20 dB below the 500 VDC output signal under normal operation. Extracting specific harmonics from the rectifier output signal of a 6, 12, or 24 pulse ac-dc converter allows the detection of SCR firing angle errors or complete misfires. A bandpass filter provides the input signal to a frequency-to-voltage converter. Comparing the output of the frequency-to-voltage converter to a reference voltage level provides an indication of the magnitude of the harmonics in the ac-dc converter output signal

  5. AC loss in superconducting tapes and cables

    Oomen, Marijn Pieter

    2000-01-01

    The present study discusses the AC loss in high-temperature superconductors. Superconducting materials with a relatively high critical temperature were discovered in 1986. They are presently developed for use in large-scale power-engineering devices such as power-transmission cables, transformers an

  6. Design and development of 1 KW solid state RF amplifier

    Since low power tube based RF amplifiers are complicated, occupy a large space and are bulky, the efforts are on to develop indigenously 1 KW solid state technology based RF Power amplifier. A power level of 1KW is chosen for the initial design because RF power Mosfets upto 250 watt are easily available and by clubbing 3-4 stages the power level of 1 KW can be made. Presently design and testing of 100-watt stage is in progress. The first 2 stages are designed to give 5 Watt RF power using bipolar transistors and are operated in CE, Class A to provide low noise level at the output of the system. The 3rd stage will be MOSFET based MRF 174, which is ideally suited for class A operation and is designed for 100 Watt RF power. The last stage will be MOSFET based ARF446 power MOSFET in TO-247 plastic package. This amplifier will be used in the classical push- pull configuration. This paper describes the design aspects as well as the test results of 100 watt amplifier on 50 Ohm dummy load along with the specifications, design criteria, circuit used, operating parameters of 1 KW Solid State RF power amplifier to be used as driver for 91.2 MHz, 1.5 MW stage for ICRH experiments on SST-1 tokamak .

  7. Spectroscopic amplifier for pin diode; Amplificador espectroscopico para diodo Pin

    Alonso M, M. S.; Hernandez D, V. M.; Vega C, H. R., E-mail: bebe.luna_s@hotmail.com [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas (Mexico)

    2014-10-15

    The photodiode remains the basic choice for the photo-detection and is widely used in optical communications, medical diagnostics and field of corpuscular radiation. In detecting radiation it has been used for monitoring radon and its progeny and inexpensive spectrometric systems. The development of a spectroscopic amplifier for Pin diode is presented which has the following characteristics: canceler Pole-Zero (P/Z) with a time constant of 8 μs; constant gain of 57, suitable for the acquisition system; 4th integrator Gaussian order to waveform change of exponential input to semi-Gaussian output and finally a stage of baseline restorer which prevents Dc signal contribution to the next stage. The operational amplifier used is the TLE2074 of BiFET technology of Texas Instruments with 10 MHz bandwidth, 25 V/μs of slew rate and a noise floor of 17 nv/(Hz)1/2. The integrated circuit has 4 operational amplifiers and in is contained the total of spectroscopic amplifier that is the goal of electronic design. The results show like the exponential input signal is converted to semi-Gaussian, modifying only the amplitude according to the specifications in the design. The total system is formed by the detector, which is the Pin diode, a sensitive preamplifier to the load, the spectroscopic amplifier that is what is presented and finally a pulse height analyzer (Mca) which is where the spectrum is shown. (Author)

  8. Design of A Microwave Amplifier for Wireless Application

    M. H. Ullah

    2012-01-01

    Full Text Available Problem statement: Low-Noise Amplifiers (LNA are very indispensable components in the design of numerous types of communication receivers employed in microwave technology. This paper is presents the design and development of low bias(Vce = 8v, Ic =10 mA single stage low noise microwave amplifier operating in 1.5GHZ frequency range, Gain 13dB ± 0.5dB, input/output return loss Approach: The principal design target is to obtain a minimum noise figure while concomitantly achieving a maximum gain by presenting the optimum noise impedance (Zopt which is characteristically implemented by adding a matching circuit between the source and the input of the amplifier. Results: The proposed low-noise amplifier for microwave wireless application is designed, simulated and optimized using Serenade Harmonica (by Ansoft Corporation and Advance Design System (ADS software by Agilent. Conclusion: In this paper a low-noise amplifier operated at 1.5 GHz. is designed because of the significant roles played in the field of microwave communication technology, which includes the application in the output stage of a transmitter where the signals needs to be strengthen before transmission.

  9. Digital model for harmonic interactions in AC/DC/AC systems

    Guarini, A.P.; Rangel, R.D.; Pilotto, L.A.S.; Pinto, R.J.; Passos Junior, R. [Centro de Pesquisas de Energia Eletrica (CEPEL), Rio de Janeiro, RJ (Brazil)

    1994-12-31

    The main purpose of this paper is to present a model for calculation of HVdc converter harmonics taking into account the influence of the harmonic interactions between the ac systems in dc link transmissions. The ideas and methodologies used in the model development take into account the dc current ripple and ac voltage distortion in the ac systems. The theory of switching functions is applied to contemplate for the frequency conversions between the ac and dc sides, in an iterative process. It is possible then to obtain, even in balanced situations, non-characteristic harmonics that are produced by frequencies originated in the other terminal, which can be significant in a strongly coupled system, such as back-to-back configuration. (author) 9 refs., 3 figs.

  10. A Comparison Between Two Average Modelling Techniques of AC-AC Power Converters

    Pawel Szczesniak

    2015-03-01

    Full Text Available In this paper, a comparative evaluation of two modelling tools for switching AC-AC power converters is presented. Both of them are based on average modelling techniques. The first approach is based on the circuit averaging technique and consists in the topological manipulations, applied to a converters states. The second approach makes use of state-space averaged model of the converter and is based on analytical manipulations using the different state representations of a converter. The two modelling techniques are applied to a same AC-AC converter called matrix-reactance frequency converter based on buck-boost topology. These techniques are compared on the basis of their rapidity, quantity of calculations and transformations and its limitations.

  11. High voltage AC/AC electrochemical capacitor operating at low temperature in salt aqueous electrolyte

    Abbas, Qamar; Béguin, François

    2016-06-01

    We demonstrate that an activated carbon (AC)-based electrochemical capacitor implementing aqueous lithium sulfate electrolyte in 7:3 vol:vol water/methanol mixture can operate down to -40 °C with good electrochemical performance. Three-electrode cell investigations show that the faradaic contributions related with hydrogen chemisorption in the negative AC electrode are thermodynamically unfavored at -40 °C, enabling the system to work as a typical electrical double-layer (EDL) capacitor. After prolonged floating of the AC/AC capacitor at 1.6 V and -40°C, the capacitance, equivalent series resistance and efficiency remain constant, demonstrating the absence of ageing related with side redox reactions at this temperature. Interestingly, when temperature is increased back to 24 °C, the redox behavior due to hydrogen storage reappears and the system behaves as a freshly prepared one.

  12. Rapid cycling synchrotron magnet with separate ac and dc circuit

    In present rapid cycling synchrotron magnets ac and dc currents flow in the same coil to give the desired field. The circuit reactance is made zero at dc and the operating frequency by running the magnet in series with an external parallel resonant LC current. We propose to return the ac flux in a gap next to the synchrotron. The dc coil encloses the ac magnetic circuit and thus links no ac flux. A shorted turn between the dc coil and ac flux enhances the separation of the two circuits. Several interesting developments are possible. The dc coil could be a stable superconductor to save power. The ac flux return gap could be identical with the synchrotron gap and contain a second synchrotron. This would double the output of the system. If the return flux gap were used for a booster, the ac coil power could be greatly reduced or radiation hardening of the ac coil could be simplified

  13. Detection and characterization of cry1Ac transgene construct in Bt cotton: multiple polymerase chain reaction approach.

    Singh, Chandra K; Ojha, Abhishek; Kachru, Devendra N

    2007-01-01

    To comply with international labeling regulations for genetically modified (GM) crops and food, and to enable proper identification of GM organisms (GMOs), effective methodologies and reliable approaches are needed. The spurious and unapproved GM planting has contributed to crop failures and commercial losses. To ensure effective and genuine GM cultivation, a methodology is needed to detect and identify the trait of interest and concurrently evaluate the structural and functional stability of the transgene insert. A multiple polymerase chain reaction (PCR) approach was developed for detection, identification, and gene stability confirmation of cry1Ac transgene construct in Bt cotton. As many as 9 samples of Bt cotton hybrid seeds comprising 3 approved Bt hybrids, MECH-12Bt, MECH-162Bt, MECH-184Bt, and a batch of 6 nonapproved Bt hybrids were tested. Initially, single standard PCR assays were run to amplify predominant GM DNA sequences (CaMV 35S promoter, nos terminator, and npt-II marker gene); a housekeeping gene, Gossypium hirsutum fiber-specific acyl carrier protein gene (acp1); a trait-specific transgene (cry1Ac); and a sequence of 7S 3' transcription terminator which specifically borders with 3' region of cry1Ac transgene cassette. The concurrent amplification of all sequences of the entire cassette was performed by 3 assays, duplex, triplex, and quadruplex multiplex PCR assays, under common assay conditions. The identity of amplicons was reconfirmed by restriction endonuclease digestion profile. The 2 distinct transgene cassettes, cry1Ac and npt-II, of the Bt cotton were amplified using the respective forward primer of promoter and reverse primer of terminator. The resultant amplicons were excised, eluted, and purified. The purified amplicons served as template for nested PCR assays. The nested PCR runs confirmed the transgene construct orientation and identity. The limit of detection as established by our assay for GM trait (cry1Ac) was 0.1%. This approach

  14. Design of Three Phase Matrix Converter AC-AC Utility Power Supply using SPWM Technique

    Sagar.S.Pawar; Prakash.T.Patil

    2015-01-01

    This paper describes the control analysis and design of an three phase matrix AC-AC utility power supply .The SPWM modulation techniques is used to control the desired output voltage and gives the control output voltage and reduced input harmonic distortions .In this Matrix converter Input is directly connected to output no DC link components is required. Simulation had been done using mat lab simulink and Simulated results are observed

  15. Design of Three Phase Matrix Converter AC-AC Utility Power Supply using SPWM Technique

    Sagar. S. Pawar

    2015-04-01

    Full Text Available This paper describes the control analysis and design of an three phase matrix AC-AC utility power supply .The SPWM modulation techniques is used to control the desired output voltage and gives the control output voltage and reduced input harmonic distortions .In this Matrix converter Input is directly connected to output no DC link components is required. Simulation had been done using mat lab simulink and Simulated results are observed

  16. A Comparison Between Two Average Modelling Techniques of AC-AC Power Converters

    Pawel Szczesniak

    2015-01-01

    In this paper, a comparative evaluation of two modelling tools for switching AC-AC power converters is presented. Both of them are based on average modelling techniques. The first approach is based on the circuit averaging technique and consists in the topological manipulations, applied to a converters states. The second approach makes use of state-space averaged model of the converter and is based on analytical manipulations using the different state representations of a converter. The two m...

  17. Implementation of Low Frequency Ac to High Frequency Ac with Single Stage Zvs-Pwm Inverter

    S. Arumugam S. Ramareddy M. Sridhar

    2011-01-01

    This paper presents a novel soft-switching pulse width modulation (PWM) utility frequency AC to high frequency (HF) AC power conversion circuit incorporating boost-active clamp single stage inverter topology. This power converter is more suitable and acceptable for cost effective HF consumer induction heating applications. Its operating principle is presented. The operating performances of this high frequency inverter using the latest insulated gate bipolar transistors are illustrated, which ...

  18. Adaptive Nonlinear Control of Induction Motors through AC/DC/AC Converters

    Elfadili, Abderrahim; Giri, Fouad; El Magri, Abdelmounime; Dugard, Luc; Chaoui, Fatima Zara

    2012-01-01

    The problem of controlling induction motors, together with associated AC/DC rectifiers and DC/AC inverters, is addressed. The control objectives are threefold: (i) the motor speed should track any reference signal despite mechanical parameter uncertainties and variations; (ii) the DC Link voltage must be tightly regulated; (iii) the power factor correction (PFC) w.r.t. the power supply net must be performed in a satisfactory way. First, a nonlinear model of the whole controlled system is deve...

  19. Robust control of synchronous motors through AC/DC/AC converters

    El Magri, Abdelmounime; Giri, Fouad; Abouloifa, Abdelmajid; Chaoui, Fatima Zara

    2010-01-01

    The problem of controlling synchronous motors, driven through AC/DC rectifiers and DC/AC inverters is addressed. The control objectives are three fold: (i) forcing the motor speed to track a varying reference signal in presence of motor parameter uncertainties;(ii) regulating the DC Link voltage; (iii )assuring a satisfactory power factor correction (PFC) with respect to the power supply net .First, a nonlinear model of the whole controlled system is developed in the Park-coordinates. Then, a...

  20. A new class of hybrid AC/AC direct power converters

    Klumpner, Christian; Wijekoon, Thiwanka; Wheeler, Patrick

    2005-01-01

    Variable voltage and variable frequency conversion of electrical energy from an AC source to an AC load is done in traditional power converters via a DC-link where an energy storage element (electrolytic capacitors) is situated. Despite its well-known benefits, it has the disadvantage of being bulky and to limit the converter lifetime. On the other hand, Direct Power Conversion (DPC) is an attractive concept, which doesn’t need an energy storage buffer, but has two main disadvantages: reduced...

  1. AC losses in a HTS coil carrying DC current in AC external magnetic field

    We electrically measured AC losses in a Bi2223/Ag-sheathed pancake coil excited by a DC current in AC external magnetic field. Losses in the coil contain two kinds of loss components that are the magnetization losses and dynamic resistance losses. In the measurement, current leads to supply a current to the coil were specially arranged to suppress electromagnetic coupling between the coil current and the AC external magnetic field. A double pick-up coils method was used to suppress a large inductive voltage component contained in voltage signal for measuring the magnetization losses. It was observed that the magnetization losses were dependent on the coil current and that a peak of a curve of the loss factor vs. amplitude of the AC external magnetic field shifted to lower amplitude of the AC magnetic field as the coil current increased. This result suggests the full penetration magnetic field of the coil tape decreases as the coil current increases. The dynamic resistance losses were measured by measuring a DC voltage appearing between the coil terminals. It was observed that the DC voltage appearing in the coil subject to the AC external magnetic field was much larger than that in the coil subject to DC magnetic field

  2. Using MEMS Capacitive Switches in Tunable RF Amplifiers

    Danson John

    2006-01-01

    Full Text Available A MEMS capacitive switch suitable for use in tunable RF amplifiers is described. A MEMS switch is designed, fabricated, and characterized with physical and RF measurements for inclusion in simulations. Using the MEMS switch models, a dual-band low-noise amplifier (LNA operating at GHz and GHz, and a tunable power amplifier (PA at GHz are simulated in m CMOS. MEMS switches allow the LNA to operate with 11 dB of isolation between the two bands while maintaining dB of gain and sub- dB noise figure. MEMS switches are used to implement a variable matching network that allows the PA to realize up to 37% PAE improvement at low input powers.

  3. Cooling of solid-state amplifiers with supercritical hydrogen

    This study addresses the thermal management of microwave solid-state amplifiers which are potential candidates for power systems at 425 and 850 MHz. Researchers at Los Alamos National Laboratory have investigated the cooling of extremely high density packaging of RF amplifier modules with a heat removal requirement of about 200 W/cm2. The technique uses water as a coolant which flows into the microchannels directly imbedded in the chips. The microchannel concept was first proposed by Tuckerman and Pease in 1981 and is capable of removing up to 1 kW/cm2 from silicon integrated circuits using water as the coolant. Previous studies, have demonstrated that on-board supercritical hydrogen can be used to cool solid-state amplifiers. Even though the heat transfer coefficient is lower for hydrogen compared to water, this deficiency is recouped by having a colder heat sink which is hydrogen at cryogenic temperatures

  4. Frequency-shifted feedback amplifier for broadband laser cooling

    Lim, Michael; van Kooy, Alexander; Yanakas, Michael

    2014-03-01

    We have developed a compact, all-solid state laser amplifier for generating asymmetric sidebands with controlled number and spacing of optical frequencies. The gain element is a tapered semiconductor amplifier, used in conjunction with an acousto-optic modulator that generates red-detuned feedback frequencies. This results in asymmetric sidebands that are all lower in optical frequency than the narrowband seed laser frequency. The output laser spectrum has a well-defined edge (the input laser frequency) and multiple sidebands whose number, frequency spacing, and power are fully controlled by the seed laser characteristics and a single radio frequency input. The number of sidebands can be varied in a controlled way, and the output optical power is variable up to the Watt level of the amplifier chip. The system will be used for broadband laser cooling.

  5. Two-qubit parametric amplifier: large amplification of weak signals

    Savel'ev, S; Rakhmanov, A L; Omelyanchouk, A N; Washington, Z; Nori, Franco

    2012-01-01

    Using numerical simulations, we show that two coupled qubits can amplify a weak signal about hundredfold. This can be achieved if the two qubits are biased simultaneously by this weak signal and a strong pump signal, both of which having frequencies close to the inter-level transitions in the system. The weak signal strongly affects the spectrum generated by the strong pumping drive by producing and controlling mixed harmonics with amplitudes of the order of the main harmonic of the strong drive. We show that the amplification is robust with respect to noise, with an intensity of the order of the weak signal. When deviating from the optimal regime (corresponding to strong qubit coupling and a weak-signal frequency equal to the inter-level transition frequency) the proposed amplifier becomes less efficient, but it can still considerably enhance a weak signal (by several tens). We therefore propose to use coupled qubits as a combined parametric amplifier and frequency shifter.

  6. Theoretical Analysis of Rayleigh Backscattering Noise in Fiber Raman Amplifiers

    2005-01-01

    In this paper, a new theoretical model for Rayleigh backscattering (RB) analysis of fiber Raman amplifiers is proposed. The model includes all the interactions among the pumps, signals, and all orders of RB. The results show that the higher order RB has a negligible influence on the performance of the amplifier. The co-propagating and counterpropagating RB power of the signal grow quadratically with the net-gain of the amplifier. The signal to double Rayleigh backscattering noise ratio (OSNRDRB ) of backward-pumped FRAs is better than that of the forward-pumped ones at high net-gain level (> 13 dB), while at low net-gain level the OSNRDrb of the forward-pumped FRAs is slightly better than that of the backward-pumped ones.

  7. Josephson traveling-wave parametric amplifier for superconducting qubit readout

    Macklin, Chris; Slichter, D. H.; Yaakobi, O.; Friedland, L.; Bolkhovsky, V.; Braje, D. A.; Fitch, G.; Oliver, W. D.; Siddiqi, I.

    2014-03-01

    Superconducting parametric amplifiers (paramps) have successfully demonstrated near quantum limited sensitivity, enabling single-shot qubit readout, feedback, and state tracking. However, these amplifiers are commonly limited to narrow bandwidth and modest dynamic range, and most require microwave circulators to separate input and output modes. These limitations stem from the use of a resonant non-linearity to achieve mixing between a signal and pump mode. Our traveling-wave parametric amplifier (TWPA) is based on a superconducting nonlinear Josephson junction transmission line, thereby inherently sidestepping the limitations associated with a cavity structure. We present theoretical predictions and experimental results, including improved gain and noise performance. We discuss transmon qubit readout in the circuit QED architecture using a TWPA. We also comment on promising architectures for chip-level integration and multiplexing. Work supported by IARPA.

  8. Spectrally tailored supercontinuum generation from single-mode-fiber amplifiers

    Spectral filtering of an all-normal-dispersion Yb-doped fiber laser was demonstrated effective for broadband supercontinuum generation in the picosecond time region. The picosecond pump pulses were tailored in spectrum with 1 nm band-pass filter installed between two single-mode fiber amplifiers. By tuning the spectral filter around 1028 nm, four-wave mixing was initiated in a photonic crystal fiber spliced with single-mode fiber, as manifested by the simultaneous generation of Stokes wave at 1076 nm and anti-Stokes wave at 984 nm. Four-wave mixing took place in cascade with the influence of stimulated Raman scattering and eventually extended the output spectrum more than 900 nm of 10 dB bandwidth. This technique allows smooth octave supercontinuum generation by using simple single-mode fiber amplifiers rather than complicated multistage large-mode-area fiber amplifiers.

  9. Embedded control system for high power RF amplifiers

    RF power devices are usually very sensitive to overheat and reflected RF power; hence a protective interlock system is required to be embedded with high power solid state RF amplifiers. The solid state RF amplifiers have salient features of graceful degradation and very low mean time to repair (MTTR). In order to exploit these features in favour of lowest system downtime, a real-time control system is embedded with high power RF amplifiers. The control system is developed with the features of monitoring, measurement and network publishing of various parameters, historical data logging, alarm generation, displaying data to the operator and tripping the system in case of any interlock failure. This paper discusses the design philosophy, features, functions and implementation details of the embedded control system. (author)

  10. Short-pulse propagation in fiber optical parametric amplifiers

    Cristofori, Valentina

    Fiber optical parametric amplifiers (FOPAs) are attractive because they can provide large gain over a broad range of central wavelengths, depending only on the availability of a suitable pump laser. In addition, FOPAs are suitable for the realization of all-optical signal processing functionalities...... and can operate with a potentially low noise figure with respect to erbium-doped fiber amplifiers and Raman amplifiers, when working in phase-sensitive configurations. A characterization of the signal distortion mechanisms introduced by FOPAs is relevant for investigating the applicability of FOPAs...... pulses fiber laser source is implemented to obtain an all-fiber system. The advantages of all fiber-systems are related to their reliability, long-term stability and compactness. Fiber optical parametric chirped pulse amplification is promising for the amplification of such signals thanks to the inherent...

  11. Spectrally tailored supercontinuum generation from single-mode-fiber amplifiers

    Hao, Qiang; Guo, Zhengru; Zhang, Qingshan [Shanghai Key Laboratory of Modern Optical System, Engineering Research Center of Optical Instrument and System (Ministry of Education), School of Optical-Electrical and Computer Engineering, University of Shanghai for Science and Technology, 516 Jungong Road, Shanghai 200093 (China); Liu, Yang; Li, Wenxue [State Key Laboratory of Precision Spectroscopy, East China Normal University, 3663 Zhongshan North Road, Shanghai 200062 (China); Zeng, Heping, E-mail: hpzeng@phy.ecnu.edu.cn [Shanghai Key Laboratory of Modern Optical System, Engineering Research Center of Optical Instrument and System (Ministry of Education), School of Optical-Electrical and Computer Engineering, University of Shanghai for Science and Technology, 516 Jungong Road, Shanghai 200093 (China); State Key Laboratory of Precision Spectroscopy, East China Normal University, 3663 Zhongshan North Road, Shanghai 200062 (China)

    2014-05-19

    Spectral filtering of an all-normal-dispersion Yb-doped fiber laser was demonstrated effective for broadband supercontinuum generation in the picosecond time region. The picosecond pump pulses were tailored in spectrum with 1 nm band-pass filter installed between two single-mode fiber amplifiers. By tuning the spectral filter around 1028 nm, four-wave mixing was initiated in a photonic crystal fiber spliced with single-mode fiber, as manifested by the simultaneous generation of Stokes wave at 1076 nm and anti-Stokes wave at 984 nm. Four-wave mixing took place in cascade with the influence of stimulated Raman scattering and eventually extended the output spectrum more than 900 nm of 10 dB bandwidth. This technique allows smooth octave supercontinuum generation by using simple single-mode fiber amplifiers rather than complicated multistage large-mode-area fiber amplifiers.

  12. Efficiency Optimization in Class-D Audio Amplifiers

    Yamauchi, Akira; Knott, Arnold; Jørgensen, Ivan Harald Holger;

    2015-01-01

    This paper presents a new power efficiency optimization routine for designing Class-D audio amplifiers. The proposed optimization procedure finds design parameters for the power stage and the output filter, and the optimum switching frequency such that the weighted power losses are minimized under...... the given constraints. The optimization routine is applied to minimize the power losses in a 130 W class-D audio amplifier based on consumer behavior investigations, where the amplifier operates at idle and low power levels most of the time. Experimental results demonstrate that the optimization...... method can lead to around 30 % of efficiency improvement at 1.3 W output power without significant effects on both audio performance and the efficiency at high power levels....

  13. 400W Yb:YAG Innoslab fs-Amplifier.

    Russbueldt, P; Mans, T; Rotarius, G; Weitenberg, J; Hoffmann, H D; Poprawe, R

    2009-07-20

    The Innoslab design, already established for neodymium doped laser crystals, was applied to ytterbium doped laser materials. Recent progresses in brightness of high power diode lasers facilitate efficient pumping of quasi-three-level laser materials. Innoslab amplifiers are compared to competing thin-disk and fiber fs-amplifiers. A compact diode-pumped Yb:YAG Innoslab fs-oscillator-amplifier system, scalable to the kilowatt range, was realized. Numerical simulations result in conditions for high efficiency and beam quality. Nearly transform and diffraction limited 680 fs pulses at 400 W average output power and 76 MHz repetition rate without using CPA technology have been achieved at room temperature so far. PMID:19654625

  14. 21 CFR 880.5500 - AC-powered patient lift.

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false AC-powered patient lift. 880.5500 Section 880.5500... Devices § 880.5500 AC-powered patient lift. (a) Identification. An AC-powered lift is an electrically powered device either fixed or mobile, used to lift and transport patients in the horizontal or...

  15. AC LED的研究现状与发展%Current research and development of AC LED

    满瑞; 李秋俊

    2012-01-01

    介绍了AC LED的特征及其工作原理,分析了AC LED相比于DC LED的优缺点,概述了AC LED在国内外的研究进展及其应用现状,讨论了AC LED技术发展过程中面临的挑战,并展望了其发展趋势.%The characteristics and operation principles of AC LED were presented.The advantages and disadvantages of AC LED compared with the DC LED were analyzed.The development and the latest application of AC LED were described.The challenges of the competition with the traditional light source were discussed,as well as the development trend of AC LED.

  16. Design of Low Noise Microwave Amplifiers Using Particle Swarm Optimization

    Sadık Ülker

    2012-07-01

    Full Text Available This short paper presents a work on the design of low noise microwave amplifiers using particle swarm optimization (PSO technique. Particle Swarm Optimization is used as a method that is applied to a single stage amplifier circuit to meet two criteria: desired gain and desired low noise. The aim is to get the best optimized design using the predefined constraints for gain and low noise values. The code is written to apply the algorithm to meet the desired goals and the obtained results are verified using different simulators. The results obtained show that PSO can be applied very efficiently for this kind of design problems with multiple constraints.

  17. Investigation of accelerator's characteristics used for an energy amplifier

    The sub-critical reactor of the energy amplifier is a kind of swimming pool reactors, operates by fast neutron and uses ThO2 + 0.1U233 as fuel. The long cylindrical fuel bars are arranged in constant steps according to a hexagonal configuration. The two fuel assemblies are with the 12.43 mm and 11.38 mm fuel bar steps. The cell group parameters and effective neutron multiplication coefficient of the energy amplifier including two neutron energy groups are defined by the WIMS-D homogenization code. Their calculating results are presented. (NHA)

  18. Solid-state microwave high-power amplifiers

    Sechi, Franco

    2009-01-01

    This practical resource offers expert guidance on the most critical aspects of microwave power amplifier design. This comprehensive book provides descriptions of all the major active devices, discusses large signal characterization, explains all the key circuit design procedures. Moreover you gain keen insight on the link between design parameters and technological implementation, helping you achieve optimal solutions with the most efficient utilization of available technologies. The book covers a broad range of essential topics, from requirements for high-power amplifiers, device models, phas

  19. Tapered amplifier laser with frequency-shifted feedback

    Bayerle, A; Vlaar, P; Pasquiou, B; Schreck, F

    2016-01-01

    We present a frequency-shifted feedback (FSF) laser based on a tapered amplifier. The laser operates as a coherent broadband source with up to 370GHz spectral width and 2.3us coherence time. If the FSF laser is seeded by a continuous-wave laser a frequency comb spanning the output spectrum appears in addition to the broadband emission. The laser has an output power of 280mW and a center wavelength of 780nm. The ease and flexibility of use of tapered amplifiers makes our FSF laser attractive for a wide range of applications, especially in metrology.

  20. Resonant Phase Matching of Josephson Junction Traveling Wave Parametric Amplifiers

    O'Brien, Kevin; Macklin, Chris; Siddiqi, Irfan; Zhang, Xiang

    2014-10-01

    We propose a technique to overcome phase mismatch in Josephson-junction traveling wave parametric amplifiers in order to achieve high gain over a broad bandwidth. Using "resonant phase matching," we design a compact superconducting device consisting of a transmission line with subwavelength resonant inclusions that simultaneously achieves a gain of 20 dB, an instantaneous bandwidth of 3 GHz, and a saturation power of -98 dBm. Such an amplifier is well suited to cryogenic broadband microwave measurements such as the multiplexed readout of quantum coherent circuits based on superconducting, semiconducting, or nanomechanical elements, as well as traditional astronomical detectors.

  1. Rare-Earth Doped Photonic Crystal Fibre Lasers and Amplifiers

    Hougaard, Kristian G.

    2005-01-01

    In this thesis, a theoretical and numerical study of the use of rare-earthdoped photonic crystal fibres as optical amplifiers and lasers, has been performed. Photonic crystal fibres or microstructured optical fibres is a new kind of optical fibre in which the cladding region typically consist of a....... The thesis also presents the basic properties of optical amplification, and describes the numerical model developed to model the behaviour of lasers and amplifiers based on photonic crystal fibres. The developed numerical tools are then used to investigate specific applications of photonic crystal...

  2. Design of Low Noise Microwave Amplifiers Using Particle Swarm Optimization

    Sadık Ulker

    2012-08-01

    Full Text Available This short paper presents a work on the design of low noise microwave amplifiers using particle swarmoptimization (PSO technique. Particle Swarm Optimization is used as a method that is applied to a singlestage amplifier circuit to meet two criteria: desired gain and desired low noise. The aim is to get the bestoptimized design using the predefined constraints for gain and low noise values. The code is written toapply the algorithm to meet the desired goals and the obtained results are verified using differentsimulators. The results obtained show that PSO can be applied very efficiently for this kind of designproblems with multiple constraints.

  3. Dispersion-Engineered Traveling Wave Kinetic Inductance Parametric Amplifier

    Zmuidzinas, Jonas (Inventor); Day, Peter K. (Inventor)

    2014-01-01

    A traveling wave kinetic inductance parametric amplifier comprises a superconducting transmission line and a dispersion control element. The transmission line can include periodic variations of its dimension along its length. The superconducting material can include a high normal state resistivity material. In some instances the high normal state resistivity material includes nitrogen and a metal selected from the group consisting of titanium, niobium and vanadium. The traveling wave kinetic inductance parametric amplifier is expected to exhibit a noise temperature below 100 mK/GHz.

  4. Processing of Communication Signal Using Operational Transconductance Amplifier

    Roy, A; Mondal, S; Ray, B N

    2010-01-01

    This paper proposes a signal processing methodology of communication system and realized that circuits using operational transconductance amplifier (OTA). Two important classes of communication circuit, delta modulator and compander have been designed using that procedure. In the first implementation coded pulse modulation system is demonstrated which employ sampling, quantizing and coding to convert analog waveforms to digital signals while the second gives data compression and expansion in digital communication system. The proposed compander circuit is realized with operational transconductance amplifier and diode. Required power supply to operate the circuit is 3.5V. Performance of the circuits realized with OTAs has been demonstrated through SPICE simulation.

  5. Microwave photonic interference mitigation filter based on semiconductor optical amplifier

    Xu, Enming; Zhang, Xinliang; Zhou, Lina; Zhang, Yu; Yu, Yuan; Wang, Fei; Huang, Dexiu

    2009-11-01

    A microwave photonic interference mitigation filter is proposed and experimentally demonstrated. The structure is based on a recirculating delay line loop comprising a semiconductor optical amplifier (SOA) and a tunable narrowband optical filter. Converted signal used as negative tap is generated through wavelength conversion employing cross-gain modulation of amplified spontaneous emission spectrum of the SOA. The converted signal circulating in the RDL loop realizes a high quality factor (Q) response after photo-detection. A bandpass response with negative coefficients combined with a broadband allpass response achieves a notch response with flat passband.

  6. Low-noise FET amplifier for dc SQUID

    We report on the design, characterization, and operation of a low-noise FET-input differential amplifier, which is used as second stage for a dc SQUID in the electronic instrumentation of the gravitational wave detector of the Rome group at CERN. The 3-dB bandwidth of the amplifier is from 10 kHz to 1.5 MHz. At the SQUID modulation frequency of 70 kHz the voltage noise is 0.5 nV/(Hz)1/2, the current noise is 35 fA/(Hz)1/2

  7. Genome profiling of ERBB2-amplified breast cancers

    Around 20% of breast cancers (BC) show ERBB2 gene amplification and overexpression of the ERBB2 tyrosine kinase receptor. They are associated with a poor prognosis but can benefit from targeted therapy. A better knowledge of these BCs, genomically and biologically heterogeneous, may help understand their behavior and design new therapeutic strategies. We defined the high resolution genome and gene expression profiles of 54 ERBB2-amplified BCs using 244K oligonucleotide array-comparative genomic hybridization and whole-genome DNA microarrays. Expression of ERBB2, phosphorylated ERBB2, EGFR, IGF1R and FOXA1 proteins was assessed by immunohistochemistry to evaluate the functional ERBB2 status and identify co-expressions. First, we identified the ERBB2-C17orf37-GRB7 genomic segment as the minimal common 17q12-q21 amplicon, and CRKRS and IKZF3 as the most frequent centromeric and telomeric amplicon borders, respectively. Second, GISTIC analysis identified 17 other genome regions affected by copy number aberration (CNA) (amplifications, gains, losses). The expression of 37 genes of these regions was deregulated. Third, two types of heterogeneity were observed in ERBB2-amplified BCs. The genomic profiles of estrogen receptor-postive (ER+) and negative (ER-) ERBB2-amplified BCs were different. The WNT/β-catenin signaling pathway was involved in ER- ERBB2-amplified BCs, and PVT1 and TRPS1 were candidate oncogenes associated with ER+ ERBB2-amplified BCs. The size of the ERBB2 amplicon was different in inflammatory (IBC) and non-inflammatory BCs. ERBB2-amplified IBCs were characterized by the downregulated and upregulated mRNA expression of ten and two genes in proportion to CNA, respectively. IHC results showed (i) a linear relationship between ERBB2 gene amplification and its gene and protein expressions with a good correlation between ERBB2 expression and phosphorylation status; (ii) a potential signaling cross-talk between EGFR or IGF1R and ERBB2, which could influence

  8. Traveling-Wave Tube Amplifier for THz Frequencies

    Kotiranta, Mikko; Krozer, Viktor; Zhurbenko, Vitaliy

    tubes and gas lasers, but the ones available are too expensive or large for many applications. This work is related to the European project OPTHER (Optically driven terahertz amplifiers) which aims to realise a compact, powerful and efficient vacuum tube amplifier for the frequency range of 0.3 – 2......The lack of a compact and powerful terahertz source has been hindering the application of terahertz radiation in many fields. Frequency multipliers can be used in conjunction with an electronic solid-state source to obtain power levels up to around 1 mW. A higher power may be generated with vacuum...

  9. A Method To ModifyCorrect The Performance Of Amplifiers

    Rohith Krishnan R

    2015-01-01

    Full Text Available Abstract The actual response of the amplifier may vary with the replacement of some aged or damaged components and this method is to compensate that problem. Here we use op-amp Fixator as the design tool. The tool helps us to isolate the selected circuit component from rest of the circuit adjust its operating point to correct the performance deviations and to modify the circuit without changing other parts of the circuit. A method to modifycorrect the performance of amplifiers by properly redesign the circuit is presented in this paper.

  10. In-amplifier mid-infrared supercontinuum generation.

    Gauthier, Jean-Christophe; Fortin, Vincent; Duval, Simon; Vallée, Réal; Bernier, Martin

    2015-11-15

    Mid-infrared supercontinuum (SC) generation from 2.6 to 4.1 μm is demonstrated in a single-mode erbium-doped fluoride glass fiber amplifier pumped at 976 nm and seeded by an optical parametric generation (OPG) source emitting 400 ps pulses at 2.75 μm. Up to 82% of the SC power is generated beyond 3 μm. This novel and simple in-amplifier SC generation approach is promising for the development of compact and efficient sources operating in the mid-infrared, especially in the 3-5 μm band. PMID:26565846

  11. DC SQUID amplifier for NMR experiments on small samples

    Low noise preamplifiers are required for the detection of the magnetic resonance of small size samples or at low magnetic fields. According to calculations based on the en, in model. SQUID based amplifiers are more suitable to NMR experiments on small samples than semiconductor amplifiers. We propose an amplification method by frequency transposition using a DC SQUID. Such a system can be run over a broad range of frequency as the noise impedance of the stages subsequent to the SQUID is continually optimised. The measurements are in good agreement with our theoretical model, based on a simplified voltage to flux SQUID characteristic. (orig.)

  12. Current-Driven Switch-Mode Audio Power Amplifiers

    Knott, Arnold; Buhl, Niels Christian; Andersen, Michael A. E.

    2012-01-01

    The conversion of electrical energy into sound waves by electromechanical transducers is proportional to the current through the coil of the transducer. However virtually all audio power amplifiers provide a controlled voltage through the interface to the transducer. This paper is presenting a...... switch-mode audio power amplifier not only providing controlled current but also being supplied by current. This results in an output filter size reduction by a factor of 6. The implemented prototype shows decent audio performance with THD + N below 0.1 %....

  13. Resonant phase matching of Josephson junction traveling wave parametric amplifiers.

    O'Brien, Kevin; Macklin, Chris; Siddiqi, Irfan; Zhang, Xiang

    2014-10-10

    We propose a technique to overcome phase mismatch in Josephson-junction traveling wave parametric amplifiers in order to achieve high gain over a broad bandwidth. Using "resonant phase matching," we design a compact superconducting device consisting of a transmission line with subwavelength resonant inclusions that simultaneously achieves a gain of 20 dB, an instantaneous bandwidth of 3 GHz, and a saturation power of -98 dBm. Such an amplifier is well suited to cryogenic broadband microwave measurements such as the multiplexed readout of quantum coherent circuits based on superconducting, semiconducting, or nanomechanical elements, as well as traditional astronomical detectors. PMID:25375734

  14. High-power phase locking of a fiber amplifier array

    Shay, T. M.; Baker, J. T.; Sanchez, A. D.; Robin, C. A.; Vergien, C. L.; Zeringue, C.; Gallant, D.; Lu, Chunte A.; Pulford, Benjamin; Bronder, T. J.; Lucero, Arthur

    2009-02-01

    We report high power phase locked fiber amplifier array using the Self-Synchronous Locking of Optical Coherence by Single-detector Electronic-frequency Tagging technique. We report the first experimental results for a five element amplifier array with a total locked power of more than 725-W. We will report on experimental measurements of the phase fluctuations versus time when the control loop is closed. The rms phase error was measured to be λ/60. Recent results will be reported. To the best of the authors' knowledge this is the highest fiber laser power to be coherently combined.

  15. An autozeroing amplifier using PFET hot-electron injection

    Hasler, Paul; Minch, Bradley A.; Diorio, Chris; Mead, Carver

    1996-01-01

    We have developed an amplifier which removes its “off-set” as a natural part of its operation by modifying the charge on a floating gate. The charge on the floating gate is adapted by a combination of electron tunneling and hot-electron injection, resulting in a nonlinear high-pass filter with a cutoff frequency less than 1 Hz. We show experimental data from this autozeroing amplifier for various input waveforms, and an analytical model which fits the output waveforms. This autozeroing amplif...

  16. PHEMT Distributed Power Amplifier Adopting Broadband Impedance Transformer

    Narendra, K.; Limiti, E.; Paoloni, C.; Zhurbenko, Vitaliy

    2013-01-01

    A non-uniform drain line distributed power amplifier (DPA) employing a broadband impedance transformer is presented. The DPA is based on GaAs PHEMT technology. The impedance transformer employs asymmetric coupled lines and transforms a low output impedance of the amplifier to a standard 50 Ω...... transmission line. The output power of approximately 600 mW, with an associated gain of 9 dB and PAE greater than 30 percent, is demonstrated in the frequency range from 10 to 1800 MHz....

  17. Spatial and spectral imaging of LMA photonic crystal fiber amplifiers

    Laurila, Marko; Lægsgaard, Jesper; Alkeskjold, Thomas Tanggaard; Broeng, Jes

    2011-01-01

    We demonstrate modal characterization using spatial and spectral resolved (S2) imaging, on an Ytterbium-doped large-mode-area photonic crystal fiber (PCF) amplifier and compare results with conventional cut-off methods. We apply numerical simulations and step-index fiber experiments to calibrate...... our mathematical and experimental routines of our S2 imaging system. We systematically analyze higher order mode (HOM) content of a polarizing 40μm core double-clad PCF amplifier with various launching and coiling configurations. We demonstrate a HOM suppression of more than -24dB with variance of 2...

  18. Improving student understanding of lock-in amplifiers

    DeVore, Seth; Gauthier, Alexandre; Levy, Jeremy; Singh, Chandralekha

    2016-01-01

    The lock-in amplifier is a versatile instrument frequently used in physics research. We find that students tend to struggle with its basic operating principles, leading to a variety of difficulties. To improve their understanding, we have developed a research-based tutorial that makes use of a computer simulated lock-in amplifier. The tutorial allows students to realize their conceptual difficulties by comparing their predictions with the outcome of the simulations, hopefully leading them to a better understanding of the process of lock-in amplification.

  19. Theory of the singly quasidegenerate Josephson junction parametric amplifier

    Sørensen, O.H.; Dueholm, B.; Mygind, Jesper;

    1980-01-01

    as incident thermal radiation is included in the discussion. It is shown that the noise temperature is virtually independent of noise injected from external sources and that minimum noise temperature is automatically achieved if the amplifier is tuned to maximize the gain-bandwidth product. The analytical...... that the performance of the amplifier characterized by properties such as gain-bandwidth product, noise temperature, and saturation depends strongly on the embedding microwave circuit. In particular any uncompensated series reactance may deteriorate the overall performance. Internal shot and Johnson noise as well...

  20. Thin-rod Yb:YAG regenerative laser amplifier

    Maruko, A.; Nishio, M.; Matsubara, S.; Tanaka, M.; Takama, M.; Yoshida, T.; Kyomoto, K.; Okunishi, H.; Kato, K.; Shimabayashi, K.; Morioka, M.; Inayoshi, S.; Yamagata, S.; Kawato, S.

    2014-09-01

    High-average-power, high-repetition-rates picosecond-pulsed regenerative ytterbium-doped yttrium aluminum garnet (Yb:YAG) laser amplifiers were developed. The architecture used in the amplifiers, which are named as thin-rod, has a unique cooling scheme like slab lasers and also has a unique pumping scheme like photonic crystal fiber lasers, is suitable for high-average power Ytterbium lasers. This architecture also has high gain characteristics which is appropriate for the regenerative spectral and pulse shaping on high-repetition-rate, ultrashort-pulse amplifications.

  1. Dicty_cDB: FCL-AC08 [Dicty_cDB

    Full Text Available FCL (Link to library) FCL-AC08 (Link to dictyBase) - - - Contig-U15080-1 FCL-AC08P ...(Link to Original site) FCL-AC08F 616 FCL-AC08Z 291 FCL-AC08P 907 - - Show FCL-AC08 Library FCL (Link to library) Clone ID FCL-...-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FCL/FCL-AC/FCL-AC08Q....Seq.d/ Representative seq. ID FCL-AC08P (Link to Original site) Representative DNA sequence >FCL-AC08 (FCL-AC08Q) /CSM/FCL/FCL-...ignificant alignments: (bits) Value FCL-AC08 (FCL-AC08Q) /CSM/FCL/FCL-AC/FCL-AC08Q.Seq.d/ 1322 0.0 SFA226 (S

  2. Characteristics of GaAs complementary heterojunction FETs (C-HFETs) and C-HFET based amplifiers exposed to high neutron fluences

    This paper discusses the electrical properties of complementary GaAs heterojunction FETs and of amplifiers based on these devices before and after irradiation with neutrons for a total fluence of 1.1x1015 n/cm2. Measurements were made on the threshold voltage, the transconductance, the saturation drain current and the gate leakage current of the discrete transistors. For the preamplifiers, DC and AC characteristics as well as their input referred noise were measured. All devices remained fully functional after irradiation, with no anomalous behaviour. The overall change in transistor parameters after irradiation was typically 10%. The DC and AC characteristics of the amplifiers were found to remain stable after neutron irradiation. There is a slight increase in 1/f noise: For a total input capacitance of 1 pF and a shaping time of 50 ns an increase in the total ENC from 150 electrons before to 180 electrons after irradiation was measured for a preamplifier with 330 μm input FET. (orig.)

  3. Fractional ac Josephson effect in unconventional superconductors

    For certain orientations of Josephson junctions between two px-wave or two d-wave superconductors, the subgap Andreev bound states produce a 4π-periodic relation between the Josephson current I and the phase difference ψ: I propor to sin(ψ/2) . Consequently, the ac Josephson current has the fractional frequency eV/h where V is the dc voltage. In the tunneling limit, the Josephson current is proportional to the first power (not square) of the electron tunneling amplitude. Thus, the Josephson current between unconventional superconductors is carried by single electrons, rather than by Cooper pairs. The fractional ac Josephson effect can be observed experimentally by measuring frequency spectrum of microwave radiation from the junction

  4. AC motor drive system for electric cars

    Morohoshi, Yukinobu; Yoshinori, Naoto; Naito, Hironobu (Fuji Electric Co., Ltd., Tokyo, (Japan))

    1989-08-10

    Various main circuit equipment with large capacity GTO thyristors are outlined for AC and DC electric cars. The configuration of a PWM converter system is presented for the AC main motor drive system of the Shinkansen trains, and its following features are described: the high power factor control capable of keeping a power factor 100% constantly, energy saving by power regenerative braking, the small triple structure with large capacity reverse-conducting GTO thyristors of 4,500V/3,000A, and the reduction of equivalent interfering current and harmonic current by three phase-triple phase difference operation. Furthermore, a control logic equipment with 16 bit MPU and a main transformer are outlined, and the verification test results of the control logic equipment by an analog model simulation and the combinational test results of the commercial equipment are reported. Prototype VVVF inverter system for DC electric cars is also presented. 6 refs., 13 figs., 3 tabs.

  5. β-delayed fission from 230Ac

    ThO2 is irradiated with 60 MeV/u 18O beams. 230Ra is produced via the multi-nucleon transfer and dissipative fragmentation reactions of the target. 230Ra is radio-chemical separated from ThO2 and the other reaction products. The thin Ra sources are prepared. The mica fission track detectors are exposed to the Ra sources. γ-rays of Ra decay in the sources are measured by a HPGe detector. The mica foil is etched in HF solution. The etched mica foil is scanned with an optical microscope. The fission tracks that should come from β-delayed fission of 230Ac are observed. The β-delayed fission probability of 230Ac is determined to be (1.19 +- 0.85) x 10-8

  6. Spectral hole-burning and carrier-heating dynamics in quantum-dot amplifiers: Comparison with bulk amplifiers

    Borri, P.; Langbein, W.; Hvam, Jørn Märcher;

    2001-01-01

    The ultrafast gain dynamics in an electrically pumped InAs/InGaAs/GaAs quantum-dot amplifier are measured at room temperature with femtosecond resolution, and compared with results on an InGaAsP bulk amplifier. The role of spectral hole burning and carrier heating in the recovery of the gain...... compression is investigated. Reduced carrier heating for both gain and refractive index dynamics of the quantum-dot device is found, which is a promising prerequisite for high-speed applications....

  7. AC Dielectrophoresis Using Elliptic Electrode Geometry

    S. M. Rezaul Hasan; Aanan Khurma

    2011-01-01

    This paper presents negative AC dielectrophoretic investigations using elliptic electrode geometry. Simulations of the electric field gradient variation using various ratios of the semimajor and the semiminor axis were carried out to determine the optimum elliptic geometry for the dielectrophoretic electrokinetics of specimen in an assay with laminar (low Reynolds number) fluid flow. Experimental setup of the elliptic electrode assembly using PCB fabrication and electrokinetic accumulation of...

  8. Lazy AC-Pattern Matching for Rewriting

    Belkhir, Walid; 10.4204/EPTCS.82.3

    2012-01-01

    We define a lazy pattern-matching mechanism modulo associativity and commutativity. The solutions of a pattern-matching problem are stored in a lazy list composed of a first substitution at the head and a non-evaluated object that encodes the remaining computations. We integrate the lazy AC-matching in a strategy language: rewriting rule and strategy application produce a lazy list of terms.

  9. Entropy production in ac-calorimetry

    Garden, Jean-Luc; Richard, Jacques

    2007-01-01

    In calorimetry and particularly in heat capacity measurements, different characteristic relaxation time constants may perturb the experiment which cannot be considered at thermodynamic equilibrium. In this case, thermodynamics of irreversible processes has to be taken into account and the calorimetric measurements must be considered as dynamic. In a temperature modulated experiment, such as ac-calorimetry, these non-equilibrium experiments give rise to the notion of frequency dependent comple...

  10. An Adaptive Amplifier System for Wireless Sensor Network Applications

    Mónica Lovay

    2012-01-01

    Full Text Available This paper presents an adaptive amplifier that is part of a sensor node in a wireless sensor network. The system presents a target gain that has to be maintained without direct human intervention despite the presence of faults. In addition, its bandwidth must be as large as possible. The system is composed of a software-based built-in self-test scheme implemented in the node that checks all the available gains in the amplifiers, a reconfigurable amplifier, and a genetic algorithm (GA for reconfiguring the node resources that runs on a host computer. We adopt a PSoC device from Cypress for the node implementation. The performance evaluation of the scheme presented is made by adopting four different types of fault models in the amplifier gains. The fault simulation results show that GA finds the target gain with low error, maintains the bandwidth above the minimum tolerable bandwidth, and presents a runtime lower than exhaustive search method.

  11. Fiber amplifiers under thermal loads leading to transverse mode instability

    Johansen, Mette Marie; Hansen, Kristian Rymann; Alkeskjold, Thomas Tanggaard;

    2014-01-01

    Transverse mode instability (TMI) in rare-earth doped fiber amplifiers operating above an average power threshold is caused by intermodal stimulated thermal Rayleigh scattering due to quantum defect heating. We investigate thermally induced longitudinal waveguide perturbations causing power...... operation stability at higher average powers....

  12. A European Project on Vacuum Tube Amplifiers for THz Amplification

    Paoloni, Claudio; Di Carlo, Aldo; Brunetti, Francesca;

    2012-01-01

    The OPTHER (Optically Driven THz amplifier) project supported by the European Commission within the Seventh Framework Program (FP7) represents the first joint European attempt to realize vacuum electron devices in THz range. The target of the project was to design and realize the first 1 THz vacuum...

  13. RF radiation measurement on the indigenously developed solid state amplifier

    A Solid State Radio Frequency (RF) Power Amplifier module for 300 W has been developed indigenously around 350 MHz centre frequency. A shielding enclosure for the amplifier has been designed to confine the non- ionizing - radiated and conducted emissions inside the enclosure. This design has been simulated in CST microwave studio and E fields and H fields were monitored around the enclosed amplifier. These simulated results for radiated and conducted fields have been presented here. Then the enclosure has been assembled with the amplifier. For this enclosed assembly, RF radiated and conducted field emissions were monitored outside the enclosure. In this paper, measurement methodology for the radiated and conducted field has been described. These measurements have been done according to established standards for the operating frequency range. Measurements have been carried out using an omenidirectional, frequency selective electromagnetic field measuring instrument. Measured field levels for this assembly have been compared with the ICNIRP defined safety limits for personal and occupational safety hazards. This paper describes in detail, all the measurements and their analysis. (author)

  14. The auditory organ: active amplifier and highly sensitive measuring system

    The present paper provides a brief review on topical issues of auditory physiology. Recent data on transduction mechanism and adaptation in hair cells as well as on the possible role of outer hair cells in amplifying basilar membrane motion are presented. Strategies of present physiological research in dealing with sensorineural deafness are discussed. (orig.)

  15. Multilevel inverter based class D audio amplifier for capacitive transducers

    Nielsen, Dennis; Knott, Arnold; Andersen, Michael A. E.

    2014-01-01

    The reduced semiconductor voltage stress makes the multilevel inverters especially interesting, when driving capacitive transducers for audio applications. A ± 300 V flying capacitor class D audio amplifier driving a 100 nF load in the midrange region of 0.1-3.5 kHz with Total Harmonic Distortion...

  16. Entanglement-based linear-optical qubit amplifier

    Meyer-Scott, E.; Bula, M.; Bartkiewicz, K.; Černoch, Antonín; Soubusta, Jan; Jennewein, T.; Lemr, Karel

    2013-01-01

    Roč. 87, č. 1 (2013), "012327-1"-"012327-7". ISSN 1050-2947 R&D Projects: GA ČR GAP205/12/0382 Institutional support: RVO:68378271 Keywords : quantum physics * photonics qubits * qubit amplifier Subject RIV: BH - Optics, Masers, Lasers Impact factor: 2.991, year: 2013

  17. Optimizing bandwidth and dynamic range of lumped Josephson parametric amplifiers

    Eddins, A.; Vijay, R.; Macklin, C.; Minev, Z.; Siddiqi, I.

    2013-03-01

    Superconducting parametric amplifiers have revolutionized the field of quantum measurement by providing high gain, ultra-low noise amplification. They have been used successfully for high-fidelity qubit state measurements, probing nano-mechanical resonators, quantum feedback, and for microwave quantum optics experiments. Though several designs exist, a simple and robust architecture is the Lumped Josephson Parametric Amplifier (LJPA). This device consists of a capacitively shunted SQUID directly coupled to a transmission line to form a low quality factor (Q) nonlinear resonator. We discuss amplifiers which can be tuned over the full 4-8 GHz band with 20-25 dB of gain and 10 - 50 MHz of signal bandwidth. However, similar to other parametric amplifiers employing a resonant circuit, the LJPA suffers from low dynamic range and has a -1 dB gain compression point of order -130 dBm. We explore new designs comprised of an array of SQUIDs to improve the dynamic range. We will present the results of numerical simulations and preliminary experiments. We will also briefly discuss improvements obtained from different biasing methods and packaging. This research was supported by the Army Research Office under a QCT grant.

  18. Optimum design of Nd-doped fiber optical amplifiers

    Rasmussen, Thomas; Bjarklev, Anders Overgaard; Lumholt, Ole;

    1992-01-01

    The waveguide parameters for a Nd-doped fluoride (Nd:ZBLANP) fiber amplifier have been optimized for small-signal and booster operation using an accurate numerical model. The optimum cutoff wavelength is shown to be 800 nm and the numerical aperture should be made as large as possible. Around 80...

  19. Asymmetric gain-saturated spectrum in fiber optical parametric amplifiers

    Lali-Dastjerdi, Zohreh; Rottwitt, Karsten; Galili, Michael;

    2012-01-01

    We demonstrate experimentally and numerically an unexpected spectral asymmetry in the saturated-gain spectrum of single-pump fiber optical parametric amplifiers. The interaction between higher-order four-wave mixing products and dispersive waves radiated as an effect of third-order dispersion...

  20. Amplified fragment length polymorphism and virulence polymorphism in Puccinia hordei

    Puccinia hordei is the causal agent of barley leaf rust. To study the genetic diversity in P. hordei, 45 isolates with diverse virulence patterns and geographical origins were analyzed using amplified fragment length polymorphism markers. Two pathotypes of Puccinia graminis f. sp. tritici and one is...