WorldWideScience

Sample records for ac amplifiers

  1. Noise reduction in AC-coupled amplifiers

    Serrano Finetti, Roberto Ernesto; Pallàs Areny, Ramon

    2014-01-01

    AC-coupled amplifiers are noisier than dc-coupled amplifiers because of the thermal noise of the resistor(s) in the ac-coupling network and the increased contribution of the amplifier input noise current i(n). Both contributions, however, diminish if the corner frequency f(c) of the high-pass filter observed by the signal is lowered, the cost being a longer transient response. At the same time, the presence of large resistors in the ac-coupling network suggests that the use of FET-input ampli...

  2. An improved AC-amplifier for electrophysiology

    Jorgovanović Nikola

    2009-01-01

    Full Text Available We present the design, simulation and test results of a new AC amplifier for electrophysiological measurements based on a three op-amp instrumentation amplifier (IA. The design target was to increase the common mode rejection ratio (CMRR, thereby improving the quality of the recorded physiological signals in a noisy environment. The new amplifier actively suppresses the DC component of the differential signal and actively reduces the common mode signal in the first stage of the IA. These functions increase the dynamic range of the amplifier's first stage of the differential signal. The next step was the realization of the amplifier in a single chip technology. The design and tests of the new AC amplifier with a differential gain of 79.2 dB, a CMRR of 130 dB at 50 Hz, a high-pass cutoff frequency at 0.01 Hz and common mode reduction in the first stage of the 49.8 dB are presented in this paper.

  3. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    Ljusev, P.; Andersen, Michael A.E.

    2005-07-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration. (au)

  4. Approaches to building single-stage AC/AC conversion switch-mode audio power amplifiers

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper discusses the possible topologies and promising approaches towards direct single-phase AC-AC conversion of the mains voltage for audio applications. When compared to standard Class-D switching audio power amplifiers with a separate power supply, it is expected that direct conversion...... will provide better efficiency and higher level of integration, leading to lower component count, volume and cost, but at the expense of a minor performance deterioration....

  5. A low-noise ac-bridge amplifier for ballistocardiogram measurement on an electronic weighing scale

    Ballistocardiography is a non-invasive technique for evaluating cardiovascular health. This note presents an ac-bridge amplifier for low-noise ballistocardiogram (BCG) recording from a modified weighing scale. The strain gauges in a commercial scale were excited by an ac source—square or sine wave—and the differential output voltage resulting from the BCG was amplified and demodulated synchronously with the excitation waveform. A standard BCG amplifier, with a simple dc-bridge excitation, was also built and the performance was compared to both the square- and sine-wave excited ac-bridge amplifiers. The total input-referred voltage noise (rms) integrated over the relevant BCG bandwidth of 0.3–10 Hz was found to be 30 nV (square wave source) or 25 nV (sine-wave source) for the ac-bridge amplifier and 52 nV for the standard amplifier: an improvement of 4.8 dB or 6 dB, respectively. These correspond to input-referred force noise (rms) values of 5 mN, 4 mN and 8.3 mN. The improvement in SNR was also observed in recorded waveforms from a seated subject whose BCG signal was measured with both dc- and ac-bridge circuits. (note)

  6. Design and technological peculiarities of making vacuum integrated circuit of a thermocathode-based AC amplifier

    Grigorishin, I. L.; Kotova, I. F.; Mukhurov, N. I.

    1997-02-01

    Despite promising prospects and comprehensive nature of contemporary studies aimed at developing autoemission cathodes, only thermoemitter-based vacuum integrated circuits (VIC) have been realized by now. Here, the results are presented of building and testing, in extreme environment, thermoemission VICs of a RF active oscillator and multivibrator. The microcircuits made have limited functional capabilities. To expand their capabilities the VIC of an AC amplifier was developed. This paper deals with circuit design aspects of making the AC amplifier based on the potentialities and specific features of the process of anodic oxidation of aluminium to form dielectric substrates of cathode-heating assemblies (CHA) and anode-grid assemblies (AGA). Design and technological methods are described that are used to make active (five vacuum microtriodes) and passive (resistors, capacitors, commutation) film elements. As compared to earlier devices, the AC amplifier VIC is more economical and has better characteristics in terms of miniaturization and integration. Its fundamental peculiarities are two-sided obtained through anodizing to form dielectric substrates with microrelief and superfine-structure grids of microtriodes. Some characteristics of the AC amplifier VIC are given and ways of improving them are discussed.

  7. A post-SQUID ac amplifier aimed for multiplexed detector readouts

    We have built a room temperature amplifier based on Si JFETs (junction field effect transistors) intended for ac-coupled SQUID (superconducting quantum interference device) readouts, such as in frequency-domain multiplexed transition-edge sensor systems. The amplifier operates at 5 MHz centre frequency where it has the measured noise temperature of 27 K for a 60 Ω load, which includes the noise from the active termination and the room temperature transformer. When it was driven from a SQUID with an on-chip matching transformer, flux noise of 0.45 μΦ0 Hz-1/2 was obtained. Additionally, we consider the potential of the recently introduced SiGe bipolar transistors for the same application. The dynamic range considerations for SQUID multiplexers, which require the use of an amplifier with a low noise temperature, are briefly discussed

  8. High power switch mode linear amplifiers for flexible ac transmission system

    Mwinyiwiwa, B.; Wolanski, Z.; Ooi, B.T. [McGill Univ., Montreal, Quebec (Canada). Dept. of Electrical Engineering

    1996-10-01

    The Pulse Width Modulation (PWM) technique has been proposed for the force-commutated Shunt and Series VAR Controllers and Unified Power Flow Controllers in Flexible AC Transmission Systems. The PWM converters can be operated as linear amplifiers of constant gain so that treasure trove of linear control system theory can be brought to bear more easily when applying feedback controls. For example, pole-placement and active filtering have been successfully applied in laboratory models. This paper is written as a tutorial describing the stages of signal processing: modulation, amplification and demodulation, without reference to power electronics since the solid-state switches are modelled as ON-OFF switches.

  9. Single conversion audio amplifier and DC-AC converters with high performance and low complexity control scheme

    Poulsen, Søren; Andersen, Michael Andreas E.

    2004-01-01

    This paper proposes a novel control topology for a mains isolated single conversion audio amplifier and DC-AC converters. The topology is made for use in audio applications, and differs from prior art in terms of significantly reduced distortion as well as lower system complexity. The topology ca...

  10. An AC modulated near infrared gain calibration system for a "Violin-Mode" transimpedance amplifier, intended for advanced LIGO suspensions.

    Lockerbie, N A; Tokmakov, K V

    2016-07-01

    The background to this work was a prototype shadow sensor, which was designed for retro-fitting to an advanced LIGO (Laser Interferometer Gravitational wave Observatory) test-mass/mirror suspension, in which a 40 kg test-mass/mirror is suspended by four approximately 600 mm long by 0.4 mm diameter fused-silica suspension fibres. The shadow sensor comprised a LED source of Near InfraRed (NIR) radiation, and a "tall-thin" rectangular silicon photodiode detector, which together were to bracket the fibre under test. The photodiode was positioned so as to be sensitive (primarily) to transverse "Violin-Mode" vibrations of such a fibre, via the oscillatory movement of the shadow cast by the fibre, as this moved across the face of the detector. In this prototype shadow sensing system the photodiode was interfaced to a purpose-built transimpedance amplifier, this having both AC and DC outputs. A quasi-static calibration was made of the sensor's DC responsivity, i.e., incremental rate of change of output voltage versus fibre position, by slowly scanning a fused-silica fibre sample transversely through the illuminating beam. The work reported here concerns the determination of the sensor's more important AC (Violin-Mode) responsivity. Recognition of the correspondence between direct AC modulation of the source, and actual Violin-Mode signals, and of the transformative role of the AC/DC gain ratio for the amplifier, at any modulation frequency, f, resulted in the construction of the AC/DC calibration source described here. A method for determining in practice the transimpedance AC/DC gain ratio of the photodiode and amplifier, using this source, is illustrated by a specific numerical example, and the gain ratio for the prototype sensing system is reported over the frequency range 1 Hz-300 kHz. In fact, a maximum DC responsivity of 1.26 kV.m(-1) was measured using the prototype photodiode sensor and amplifier discussed here. Therefore, the measured AC/DC transimpedance gain

  11. A chopper current-feedback instrumentation amplifier with a 1 mHz 1/f noise corner and an AC-coupled ripple reduction loop

    Wu, R; Makinwa, K.A.A.; Huijsing, J.H.

    2009-01-01

    This paper presents a chopper instrumentation amplifier for interfacing precision thermistor bridges. For high CMRR and DC gain, the amplifier employs a three-stage current-feedback topology with nested-Miller compensation. By chopping both the input and intermediate stages of the amplifier, a 1 mHz 1/f noise corner was achieved at an input-referred noise power spectral density (PSD) of 15 nV/¿Hz. To reduce chopper ripple, the amplifier employs a continuous-time AC-coupled ripple reduction l...

  12. Fast switching, modular high-voltage DC/AC-power supplies for RF-Amplifiers and other applications

    A new kind of high voltage high-power Pulse-Step Modulator (PSM) for broadcast transmitters, accelerator sources, for NBI (Neutral Beam Injection for Plasma Heating), gyrotrons and klystrons has been developed. Since its first introduction in 1984 for broadcast transmitters, more than 100 high-power sound broadcast transmitters had been equipped with the first generation of the PSM modulators, using Gate Turn-Off Thyristors (GTOs) as switching elements. Recently, due to faster switching elements and making use of the latest DSP technologies (Digital Signal Processing), the performance data and areas of application could be extended further. In 1994, a precision high voltage source for MW gyrotrons was installed at CRPP in Lausanne. Supplementary very low cost solutions for lower powers but high voltages had been developed. Hence, today, a large area of applications can be satisfied with the family of solutions. The paper describes the principle of operation, the related control systems and refers to some particular applications of the PSM amplifiers, especially the newest developments and corresponding field results

  13. A wideband dc-coupled amplifier

    A method is described whereby an ac-coupled high-frequency amplifier and a dc-coupled low-frequency amplifier are connected in parallel in order to obtain a dc-coupled wideband amplifier. By using an operational amplifier which compares the output voltage with the input voltage, the low-frequency amplifier contributes to the overall gain only when the gain of the ac-coupled amplifier droops at low frequencies. Thus, no frequency splitting networks are necessary and the excellent low-frequency features of an operational amplifier are added to those of the ac-coupled wideband amplifier. As an example, a low noise amplifier is described which exhibits a hundredfold gain, a bandwidth from dc to 550 MHz, an input bias current of less than 1 nA, and an output voltage range of ±1 V

  14. Semiconductor DC amplifier AEP 1487

    A semiconductor dc amplifier has been designed with the object of achieving low drift without component selection or special temperature-balancing adjustments. Modulator and ac-amplifier techniques have been adopted in order to avoid the drifts that occur when transistors are directly coupled. The diode-ring modulator described in CREL-902 has been used as the input chopper. (author)

  15. Operational amplifiers

    Dostal, Jiri

    1993-01-01

    This book provides the reader with the practical knowledge necessary to select and use operational amplifier devices. It presents an extensive treatment of applications and a practically oriented, unified theory of operational circuits.Provides the reader with practical knowledge necessary to select and use operational amplifier devices. Presents an extensive treatment of applications and a practically oriented, unified theory of operational circuits

  16. Low cost instrumentation amplifier

    Sturman, J. C.

    1974-01-01

    Amplifier can be used for many applications requiring high input impedance and common mode rejection, low drift, and gain accuracy on order of one percent. Performance of inexpensive amplifier approaches that of some commercial instrumentation amplifiers in many specifications.

  17. Switching-mode Audio Power Amplifiers with Direct Energy Conversion

    Ljusev, Petar; Andersen, Michael Andreas E.

    2005-01-01

    This paper presents a new class of switching-mode audio power amplifiers, which are capable of direct energy conversion from the AC mains to the audio output. They represent an ultimate integration of a switching-mode power supply and a Class D audio power amplifier, where the intermediate DC bus...... component count, volume and cost....

  18. Gain ranging amplifier

    A gain ranging amplifier system is provided for use in the acquisition of data. Voltage offset compensation is utilized to correct errors in the gain ranging amplifier system caused by thermal drift and temperature dependent voltage offsets, both of which are associated with amplifiers in the gain ranging amplifier system

  19. Amplified Quantum Transforms

    Cornwell, David

    2014-01-01

    In this thesis we investigate two new Amplified Quantum Transforms. In particular we create and analyze the Amplified Quantum Fourier Transform (Amplified-QFT) and the Amplified-Haar Wavelet Transform. First, we provide a brief history of quantum mechanics and quantum computing. Second, we examine the Amplified-QFT in detail and compare it against the Quantum Fourier Transform (QFT) and Quantum Hidden Subgroup (QHS) algorithms for solving the Local Period Problem. We calculate the probabiliti...

  20. Portable musical instrument amplifier

    Christian, David E. (Danbury, CT)

    1990-07-24

    The present invention relates to a musical instrument amplifier which is particularly useful for electric guitars. The amplifier has a rigid body for housing both the electronic system for amplifying and processing signals from the guitar and the system's power supply. An input plug connected to and projecting from the body is electrically coupled to the signal amplifying and processing system. When the plug is inserted into an output jack for an electric guitar, the body is rigidly carried by the guitar, and the guitar is operatively connected to the electrical amplifying and signal processing system without use of a loose interconnection cable. The amplifier is provided with an output jack, into which headphones are plugged to receive amplified signals from the guitar. By eliminating the conventional interconnection cable, the amplifier of the present invention can be used by musicians with increased flexibility and greater freedom of movement.

  1. Amplifier for nuclear spectrometry

    The spectroscopy amplifier model AE-020 is designed to adjust suitable the pulses coming from nuclear radiation detectors. Due to is capacity and specifications, the amplifier can be used together with high and medium resolution spectroscopy system

  2. High voltage distributed amplifier

    Willems, D.; Bahl, I.; Wirsing, K.

    1991-12-01

    A high-voltage distributed amplifier implemented in GaAs MMIC technology has demonstrated good circuit performance over at least two octave bandwidth. This technique allows for very broadband amplifier operation with good efficiency in satellite, active-aperture radar, and battery-powered systems. Also, by increasing the number of FETs, the amplifier can be designed to match different voltage rails. The circuit does require a small amount of additional chip size over conventional distributed amplifiers but does not require power dividers or additional matching networks. This circuit configuration should find great use in broadband power amplifier design.

  3. Single conversion stage amplifier - SICAM

    Ljusev, P.

    2005-12-15

    This Ph.D. thesis presents a thorough analysis of the so called SICAM - SIngle Converter stage AMplifier approach to building direct energy conversion audio power amplifiers. The mainstream approach for building isolated audio power amplifiers today consists of isolated DC power supply and Class D amplifier, which essentially represents a two stage solution, where each of the components can be viewed as separate and independent part. The proposed SICAM solution strives for direct energy conversion from the mains to the audio output, by dedicating the operation of the components one to another and integrating their functions, so that the final audio power amplifier represents a single-stage topology with higher efficiency, lower volume, less board space, lower component count and subsequently lower cost. The SICAM approach is both applicable to non-isolated and isolated audio power amplifiers, but the problems encountered in these two cases are different. Non-isolated SICAM solutions are intended for both AC mains-connected and battery-powered devices. In non-isolated mains-connected SICAMs the main idea is to simplify the power supply or even provide integrated power factor correction (PFC) functions, while still maintaining low component stress and good audio performance by generally decreasing the input voltage level to the Class D audio power amplifier. On the other hand, non-isolated battery-powered SICAMs have to cope with the ever changing battery voltage and provide output voltage levels which are both lower and higher than the battery voltage, while still being simple and single-stage energy conversion solutions. In isolated SICAMs the isolation transformer adjusts the voltage level on the secondary side to the desired level, so the main challenges here are decreasing the size of the magnetic core and reducing the number and size of bulky reactive components as much as possible. The main focus of this thesis is directed towards the isolated SICAMs and

  4. Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

    Ljusev, Petar; Andersen, Michael Andreas E.

    2004-01-01

    This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach it is not...

  5. RF Power Amplifier Analysis

    M. Lokay; K. Pelikan

    1993-01-01

    The special program is presented for the demonstration of RF power transistor amplifiers for the purposes of the high-school education in courses of radio transmitters. The program is written in Turbo Pascal 6. 0 and enables to study the waveforms in selected points of the amplifier and to draw the trajectories of the working point in a plot of output transistor characteristics.

  6. Amplifier improvement circuit

    Sturman, J.

    1968-01-01

    Stable input stage was designed for the use with a integrated circuit operational amplifier to provide improved performance as an instrumentation-type amplifier. The circuit provides high input impedance, stable gain, good common mode rejection, very low drift, and low output impedance.

  7. Semiconductor optical amplifiers

    Dutta, Niloy K

    2013-01-01

    This invaluable look provides a comprehensive treatment of design and applications of semiconductor optical amplifiers (SOA). SOA is an important component for optical communication systems. It has applications as in-line amplifiers and as functional devices in evolving optical networks. The functional applications of SOAs were first studied in the early 1990's, since then the diversity and scope of such applications have been steadily growing. This is the second edition of a book on Semiconductor Optical Amplifiers first published in 2006 by the same authors. Several chapters and sections rep

  8. A broadband dc SQUID based rf amplifier: experimental basics and development concept

    Prokopenko, G.V.; Shitov, S.V.; Mygind, Jesper

    2002-01-01

    We present a concept of a broadband IF amplifier based on experimental results obtained with a dc SQUID rf amplifier (SQA). The frequency range is broadened by using several SQAs, each one tuned to its own central frequency at both input and output; the numerical simulations are presented. A.......(C) 2002 Elsevier Science B.V. All rights reserved....

  9. Noise in Optical Amplifiers

    Jeppesen, Palle

    1997-01-01

    Noise in optical amplifiers is discussed on the basis of photons and electromagntic fields. Formulas for quantum noise from spontaneous emission, signal-spontaneous beat noise and spontaneous-spontaneous beat noise are derived.......Noise in optical amplifiers is discussed on the basis of photons and electromagntic fields. Formulas for quantum noise from spontaneous emission, signal-spontaneous beat noise and spontaneous-spontaneous beat noise are derived....

  10. Charge-sensitive amplifier

    Startsev V. I.; Yampolsky Ju. S.

    2008-01-01

    The authors consider design and circuit design techniques of reduction of the influence of the pyroelectric effect on operation of the charge sensitive amplifiers. The presented experimental results confirm the validity of the measures taken to reduce the impact of pyroelectric currents. Pyroelectric currents are caused by the influence of the temperature gradient on the piezoelectric sensor and on the output voltage of charge sensitive amplifiers.

  11. RF Power Amplifier Analysis

    M. Lokay

    1993-04-01

    Full Text Available The special program is presented for the demonstration of RF power transistor amplifiers for the purposes of the high-school education in courses of radio transmitters. The program is written in Turbo Pascal 6. 0 and enables to study the waveforms in selected points of the amplifier and to draw the trajectories of the working point in a plot of output transistor characteristics.

  12. Electrospun Amplified Fiber Optics

    Morello, Giovanni; Camposeo, Andrea; Moffa, Maria; Pisignano, Dario

    2015-01-01

    A lot of research is focused on all-optical signal processing, aiming to obtain effective alternatives to existing data transmission platforms. Amplification of light in fiber optics, such as in Erbium-doped fiber amplifiers, is especially important for an efficient signal transmission. However, the complex fabrication methods, involving high-temperature processes performed in highly pure environment, slow down the fabrication and make amplified components expensive with respect to an ideal, ...

  13. E-537 MWPC amplifier

    The design of a fast MWPC amplifier for the beam chambers and the absorber chamber is completed and all parts are on order. A prototype 16 channel board has been built and satisfactorily tested. Artwork is completed for the board and out to be photographed. The board fabrication contract has been let. Listed below is a summary of the amplifier characteristics as well as test results obtained with the prototype

  14. A vircator amplifier

    A cavity vircator has demonstrated that formation of a virtual cathode in a cavity can improve microwave production efficiency and narrow the radiation bandwidth. When the virtual cathode radiates the microwave fields grow from noise. For each cavity, there is only one or a limited number of allowable modes for a given frequency. In this paper, a novel device - a vircator amplifier is described. The device consists of a relativistic magnetron and a cavity vircator with both devices powered by a 1 MeV, 3 Ω, 65 ns FWHM pulser. The idea is to inject a signal from the magnetron before and during virtual cathode formation in a cavity. The injected signal should lock the frequency and enhance electron bunching and therefore improve efficiency further. Experiments underway to evaluate the amplifier operating characteristics are discussed. The applicability of vircator amplifiers to the next generation of high-power microwave devices are addressed

  15. A micropower electrocardiogram amplifier.

    Fay, L; Misra, V; Sarpeshkar, R

    2009-10-01

    We introduce an electrocardiogram (EKG) preamplifier with a power consumption of 2.8 muW, 8.1 muVrms input-referred noise, and a common-mode rejection ratio of 90 dB. Compared to previously reported work, this amplifier represents a significant reduction in power with little compromise in signal quality. The improvement in performance may be attributed to many optimizations throughout the design including the use of subthreshold transistor operation to improve noise efficiency, gain-setting capacitors versus resistors, half-rail operation wherever possible, optimal power allocations among amplifier blocks, and the sizing of devices to improve matching and reduce noise. We envision that the micropower amplifier can be used as part of a wireless EKG monitoring system powered by rectified radio-frequency energy or other forms of energy harvesting like body vibration and body heat. PMID:23853270

  16. STABILIZED TRANSISTOR AMPLIFIER

    Noe, J.B.

    1963-05-01

    A temperature stabilized transistor amplifier having a pair of transistors coupled in cascade relation that are capable of providing amplification through a temperature range of - 100 un. Concent 85% F to 400 un. Concent 85% F described. The stabilization of the amplifier is attained by coupling a feedback signal taken from the emitter of second transistor at a junction between two serially arranged biasing resistances in the circuit of the emitter of the second transistor to the base of the first transistor. Thus, a change in the emitter current of the second transistor is automatically corrected by the feedback adjustment of the base-emitter potential of the first transistor and by a corresponding change in the base-emitter potential of the second transistor. (AEC)

  17. Principal modes in fiber amplifiers

    Fridman, Moti; Dubinskii, Mark; Friesem, Asher A; Davidson, Nir

    2010-01-01

    The dynamics of the state of polarization in single mode and multimode fiber amplifiers are presented. The experimental results reveal that although the state of polarizations at the output can vary over a large range when changing the temperatures of the fiber amplifiers, the variations are significantly reduced when resorting to the principal states of polarization in single mode fiber amplifiers and principal modes in multimode fiber amplifiers.

  18. Helical Fiber Amplifier

    Koplow, Jeffrey P.; Kliner, Dahy; Goldberg, Lew

    2002-12-17

    A multi-mode gain fiber is provided which affords substantial improvements in the maximum pulse energy, peak power handling capabilities, average output power, and/or pumping efficiency of fiber amplifier and laser sources while maintaining good beam quality (comparable to that of a conventional single-mode fiber source). These benefits are realized by coiling the multimode gain fiber to induce significant bend loss for all but the lowest-order mode(s).

  19. Safe-commutation principle for direct single-phase AC-AC converters for use in audio power amplification

    Ljusev, P.; Andersen, Michael A.E.

    2005-07-01

    This paper presents an alternative safe commutation principle for a single phase bidirectional bridge, for use in the new generation of direct single-stage AC-AC audio power amplifiers. As compared with the bridge commutation with load current or source voltage sensing, in this approach it is not required to do any measurements, thus making it more reliable. Initial testing made on the prototype prove the feasibility of the approach. (au)

  20. Radio Frequency Solid State Amplifiers

    Jacob, J

    2015-01-01

    Solid state amplifiers are being increasingly used instead of electronic vacuum tubes to feed accelerating cavities with radio frequency power in the 100 kW range. Power is obtained from the combination of hundreds of transistor amplifier modules. This paper summarizes a one hour lecture on solid state amplifiers for accelerator applications.

  1. Simplified design of IC amplifiers

    Lenk, John

    1996-01-01

    Simplified Design of IC Amplifiers has something for everyone involved in electronics. No matter what skill level, this book shows how to design and experiment with IC amplifiers. For experimenters, students, and serious hobbyists, this book provides sufficient information to design and build IC amplifier circuits from 'scratch'. For working engineers who design amplifier circuits or select IC amplifiers, the book provides a variety of circuit configurations to make designing easier.Provides basics for all phases of practical design.Covers the most popular forms for amplif

  2. Electronic amplifiers for automatic compensators

    Polonnikov, D Ye

    1965-01-01

    Electronic Amplifiers for Automatic Compensators presents the design and operation of electronic amplifiers for use in automatic control and measuring systems. This book is composed of eight chapters that consider the problems of constructing input and output circuits of amplifiers, suppression of interference and ensuring high sensitivity.This work begins with a survey of the operating principles of electronic amplifiers in automatic compensator systems. The succeeding chapters deal with circuit selection and the calculation and determination of the principal characteristics of amplifiers, as

  3. Building valve amplifiers

    Jones, Morgan

    2013-01-01

    Building Valve Amplifiers is a unique hands-on guide for anyone working with tube audio equipment--as an electronics hobbyist, audiophile or audio engineer. This 2nd Edition builds on the success of the first with technology and technique revisions throughout and, significantly, a major new self-build project, worked through step-by-step, which puts into practice the principles and techniques introduced throughout the book. Particular attention has been paid to answering questions commonly asked by newcomers to the world of the valve, whether audio enthusiasts tackling their first build or

  4. REGENERATIVE TRANSISTOR AMPLIFIER

    Kabell, L.J.

    1958-11-25

    Electrical circults for use in computers and the like are described. particularly a regenerative bistable transistor amplifler which is iurned on by a clock signal when an information signal permits and is turned off by the clock signal. The amplifier porforms the above function with reduced power requirements for the clock signal and circuit operation. The power requirements are reduced in one way by employing transformer coupling which increases the collector circuit efficiency by eliminating the loss of power in the collector load resistor.

  5. Quantum entanglement degrees amplifier

    Wu, Xiang-Yao; Liu, Xiao-Jing; Liang, Yu; Meng, Xiang-Dong; Li, Hong; Zhang, Si-Qi

    2015-01-01

    The quantum entangled degrees of entangled states become smaller with the transmission distance increasing, how to keep the purity of quantum entangled states is the puzzle in quantum communication. In the paper, we have designed a new type entanglement degrees amplifier by one-dimensional photonic crystal, which is similar as the relay station of classical electromagnetic communication. We find when the entangled states of two-photon and three-photon pass through photonic crystal, their entanglement degrees can be magnified, which make the entanglement states can be long range propagation and the quantum communication can be really realized.

  6. Wideband amplifier design

    Hollister, Allen L

    2007-01-01

    In this book, the theory needed to understand wideband amplifier design using the simplest models possible will be developed. This theory will be used to develop algebraic equations that describe particular circuits used in high frequency design so that the reader develops a ""gut level"" understanding of the process and circuit. SPICE and Genesys simulations will be performed to show the accuracy of the algebraic models. By looking at differences between the algebraic equations and the simulations, new algebraic models will be developed that include parameters originally left out of the model

  7. DIAMOND AMPLIFIED PHOTOCATHODES.

    SMEDLEY,J.; BEN-ZVI, I.; BOHON, J.; CHANG, X.; GROVER, R.; ISAKOVIC, A.; RAO, T.; WU, Q.

    2007-11-26

    High-average-current linear electron accelerators require photoinjectors capable of delivering tens to hundreds of mA average current, with peak currents of hundreds of amps. Standard photocathodes face significant challenges in meeting these requirements, and often have short operational lifetimes in an accelerator environment. We report on recent progress toward development of secondary emission amplifiers for photocathodes, which are intended to increase the achievable average current while protecting the cathode from the accelerator. The amplifier is a thin diamond wafer which converts energetic (few keV) primary electrons into hundreds of electron-hole pairs via secondary electron emission. The electrons drift through the diamond under an external bias and are emitted into vacuum via a hydrogen-terminated surface with negative electron affinity (NEA). Secondary emission gain of over 200 has been achieved. Two methods of patterning diamond, laser ablation and reactive-ion etching (RIE), are being developed to produce the required geometry. A variety of diagnostic techniques, including FTIR, SEM and AFM, have been used to characterize the diamonds.

  8. Universal Signal Conditioning Amplifier

    Kinney, Frank

    1997-01-01

    The Technological Research and Development Authority (TRDA) and NASA-KSC entered into a cooperative agreement in March of 1994 to achieve the utilization and commercialization of a technology development for benefiting both the Space Program and U.S. industry on a "dual-use basis". The technology involved in this transfer is a new, unique Universal Conditioning Amplifier (USCA) used in connection with various types of transducers. The project was initiated in partnership with I-Net Corporation, Lockheed Martin Telemetry & Instrumentation (formerly Loral Test and Information Systems) and Brevard Community College. The project consists of designing, miniaturizing, manufacturing, and testing an existing prototype of USCA that was developed for NASA-KSC by the I-Net Corporation. The USCA is a rugged and field-installable self (or remotely)- programmable amplifier that works in combination with a tag random access memory (RAM) attached to various types of transducers. This summary report comprises performance evaluations, TRDA partnership tasks, a project summary, project milestones and results.

  9. A fast large dynamic range shaping amplifier for particle detector front-end

    Rivetti, Angelo; Delaurenti, Paolo

    2007-03-01

    The paper describes a fast shaping amplifier with rail-to-rail output swing. The circuit is based on a CMOS operational amplifier with a class AB output stage. A baseline holder, incorporating a closed-loop unity gain buffer with slew rate limitation, performs the AC coupling with the preamplifier and guarantees a baseline shift smaller than 3 mV for unipolar output pulses of 3 V and 10 MHz rate.

  10. A fast large dynamic range shaping amplifier for particle detector front-end

    The paper describes a fast shaping amplifier with rail-to-rail output swing. The circuit is based on a CMOS operational amplifier with a class AB output stage. A baseline holder, incorporating a closed-loop unity gain buffer with slew rate limitation, performs the AC coupling with the preamplifier and guarantees a baseline shift smaller than 3 mV for unipolar output pulses of 3 V and 10 MHz rate

  11. Characterisation Of Low Noise Amplifier

    MAULIK B.PATEL; ABHISEK CHOBEY; SUNIL B.PATEL

    2012-01-01

    Amplification is one of the most basic and prevalent microwave circuit functions inmodern RF and microwave systems. Early microwave amplifiers relied on tubes, such asklystrons and traveling-wave tubes, or solid-state reflection amplifiers based on thenegative resistance characteristics of tunnel or varactor diodes. But due to the dramaticimprovements and innovations in solid-state technology that have occurred since the1970s, most RF and microwave amplifiers today use transistor devices such...

  12. Water calorimetry with thermistor bridge operated in DC and AC mode: comparative results

    An experimental study was carried out to find out the optimal conditions for measuring the output signal in a water calorimeter. To this end the thermistor bridge of the calorimeter was operated in AC and in DC mode, respectively. A comparative analysis of these two alternative methods was the made. In the AC mode measurement a lock-in amplifier based experimental assembly was used and compared to the more conventional system based on a high-sensitivty DC amplifier. The AC system resulted to be preferable as far as the short term and long term reproducibility is concerned. (orig.)

  13. Water calorimetry with thermistor bridge operated in DC and AC mode: comparative results

    Guerra, A.S.; Laitano, R.F.; Petrocchi, A. [Ist. Nazionale di Metrologia delle Radiazioni Ionizzanti, ENEA, Roma (Italy)

    1997-09-01

    An experimental study was carried out to find out the optimal conditions for measuring the output signal in a water calorimeter. To this end the thermistor bridge of the calorimeter was operated in AC and in DC mode, respectively. A comparative analysis of these two alternative methods was the made. In the AC mode measurement a lock-in amplifier based experimental assembly was used and compared to the more conventional system based on a high-sensitivty DC amplifier. The AC system resulted to be preferable as far as the short term and long term reproducibility is concerned. (orig.)

  14. Modeling of semiconductor optical amplifiers

    Mørk, Jesper; Bischoff, Svend; Berg, Tommy Winther;

    We discuss the modelling of semiconductor optical amplifiers with emphasis on their high-speed properties. Applications in linear amplification as well as ultrafast optical signal processing are reviewed. Finally, the possible role of quantum-dot based optical amplifiers is discussed.......We discuss the modelling of semiconductor optical amplifiers with emphasis on their high-speed properties. Applications in linear amplification as well as ultrafast optical signal processing are reviewed. Finally, the possible role of quantum-dot based optical amplifiers is discussed....

  15. Amplified leak detection

    Mahony, James

    2011-12-15

    Leaks are one of the major concerns for oil and gas producers. But recently, a Calgary-based company developed a tool that can find natural gas leaks in wellbores. This has relieved the oil and gas producers because the optics of finding downhole leaks just got a little brighter. Since then, there have been continuous efforts to broaden and refine fiber optics based methods. This paper presents amplified leak detection using fiber optics to identify even the smallest liquid leaks downhole. At high volumes, detection of downhole leaks in liquids is not a problem but at lower flow rates, the leaks become harder to detect, and at very low flow rates, they might not be detected at all. Hifi Engineering Inc. has developed the LeakSonar fiber optic acoustic sensor array that is specifically designed to detect and locate fluid migration in wellbores, even through multiple strings of casing.

  16. Metatronic transistor amplifier

    Chettiar, Uday K.; Engheta, Nader

    2015-10-01

    Utilizing the notion of metamaterials, in recent years the concept of a circuit and lumped circuit elements have been extended to the optical domains, providing the paradigm of optical metatronics, i.e., metamaterial-inspired optical nanocircuitry, as a powerful tool for design and study of more complex systems at the nanoscale. In this paper we present a design for a new metatronic element, namely, a metatronic transistor that functions as an amplifier. As shown by our analytical and numerical paper here, this metatronic transistor provides gain as well as isolation between the input and output ports of such two-port device. The cascadability and fan-out aspects of this element are also explored.

  17. ACAC Converters for UPS

    Rusalin Lucian R. Păun

    2008-05-01

    Full Text Available This paper propose a new control technique forsingle – phase ACAC converters used for a on-line UPSwith a good dynamic response, a reduced-partscomponents, a good output characteristic, a good powerfactorcorrection(PFC. This converter no needs anisolation transformer. A power factor correction rectifierand an inverter with the proposed control scheme has beendesigned and simulated using Caspoc2007, validating theconcept.

  18. A Low-Drift Solid-State d.c. Amplifier

    This paper describes a solid-state d.c. amplifier developed for low-level current measurement and discusses the design of this system consisting of a parametric modulator, a carrier oscillator, an a.c. amplifier, a demodulator, and an output amplifier. The parametric modulator employing silicon diodes is suitable for amplification of low -level d.c. current, since the input resistance is generally high and the conversion noise is small; In this system, base-emitter junctions of silicon planer transistors are used as parametric diodes, and the modulating frequency and amplitude chosen are 100 kc/s and 100 mV. A conversion gain of this modulator is about 90 dB in current. A crystal oscillator is employed for carrier generation. The a.c. amplifier consists of a directly-coupled a.c. amplifier whose transfer impedance is 1 x 108 Ω, a band-pass amplifier whose voltage gain is about 50 dB, and an emitter follower circuit. A normally connected transistor chopper as the demodulator is followed by a direct-coupled amplifier of low-output impedance hiving gain of 30 dB in order to provide wide dynamic range. Over-all d. c. negative feedback is provided by the feedback resistor. The complete system gives an open-loop transfer impedance of 3 x 1016 Ω and maximum output of ± 15 V. Current drift and voltage drift referred to input are less than 1 x 10-15 A and 0.2 mV respectively in the range of 10 - 35°C, and fluctuation or short-term drift is less than 2 x 10-16 A. This d.c. amplifier can be applied to the picoammeter, the log-N amplifier and various other scientific instruments. (author)

  19. Circuits for differential signal extraction in the lock-in amplifiers

    Baranov, P.; Bukrina, T.

    2014-10-01

    Confirmation of the metrological characteristics of measuring transducers provides maximum accuracy of the method of comparison with the standard instrument. Practical application of this technique is impossible without accurate instruments. As a measurement instrument to ensure the resolution of the order of several nanovolts when comparing two AC signals over a wide dynamic range, widely used lock-in amplifier with a differential input. The paper presents the results of the analysis of circuits based on operational amplifiers for comparing two signals and extraction differential signal in lock-in amplifier with a differential input. Common-mode rejection ratio for each of the circuits was estimated.

  20. Small signal microwave amplifier design

    Grosch, Theodore

    2000-01-01

    This book explains techniques and examples for designing stable amplifiers for high-frequency applications in which the signal is small and the amplifier circuit is linear. An in-depth discussion of linear network theory provides the foundation needed to develop actual designs. Examples throughout the book will show you how to apply the knowledge gained in each chapter leading to the complex design of low noise amplifiers. Many exercises at the end of each chapter will help students to practice their skills. The solutions to these design problems are available in an accompanying solutions book

  1. International Standardization Activities for Optical Amplifiers

    Haruo Okamura

    2003-01-01

    International standardization activities for Optical Amplifiers at IECTC86 and ITU-T SG15 are reviewed. Current discussions include Optical Amplifier safety guideline, Reliability standard, Rest methods of Noise and PMD, Definitions of Raman amplifier parameters and OA classification.

  2. AC power supply systems

    An ac power supply system includes a rectifier fed by a normal ac supply, and an inverter connected to the rectifier by a dc link, the inverter being effective to invert the dc output of the receiver at a required frequency to provide an ac output. A dc backup power supply of lower voltage than the normal dc output of the rectifier is connected across the dc link such that the ac output of the rectifier is derived from the backup supply if the voltage of the output of the inverter falls below that of the backup supply. The dc backup power may be derived from a backup ac supply. Use in pumping coolant in nuclear reactor is envisaged. (author)

  3. A Transformer Class E Amplifier

    Mikolajewski Miroslaw

    2014-12-01

    Full Text Available In a high-efficiency Class E ZVS resonant amplifier a matching and isolation transformer can replace some or even all inductive components of the amplifier thus simplifying the circuit and reducing its cost. In the paper a theoretical analysis, a design example and its experimental verification for a transformer Class E amplifier are presented. In the experimental amplifier with a transformer as the only inductive component in the circuit high efficiency ηMAX = 0.95 was achieved for supply voltage VI = 36 V, maximum output power POMAX = 100 W and the switching frequency f = 300 kHz. Measured parameters and waveforms showed a good agreement with theoretical predictions. Moreover, the relative bandwidth of the switching frequency was only 19% to obtain output power control from 4.8 W to POMAX with efficiency not less than 0.9 in the regulation range.

  4. TARC: Carlo Rubbia's Energy Amplifier

    Laurent Guiraud

    1997-01-01

    Transmutation by Adiabatic Resonance Crossing (TARC) is Carlo Rubbia's energy amplifier. This CERN experiment demonstrated that long-lived fission fragments, such as 99-TC, can be efficiently destroyed.

  5. New Packaging for Amplifier Slabs

    Riley, M. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Thorsness, C. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Suratwala, T. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Steele, R. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Rogowski, G. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2015-03-18

    The following memo provides a discussion and detailed procedure for a new finished amplifier slab shipping and storage container. The new package is designed to maintain an environment of <5% RH to minimize weathering.

  6. A KIND OF NEW AMPLIFIER

    YIN XUN-HE; FENG RU-PENG; REN YONG

    2000-01-01

    Chaotic characteristics in the iteration of logistic map (one-dimensional discrete dynamic system) are simulatedand analyzed. The circuit implementation of a kind of chaotic amplifier model is based on the chaotic characteristicsthat chaos is sensitively dependent on its initial conditions, and the circuit simulation result is given using simulationprogram with integrated circuit emphasis for personal computer (PSPICE), and is compared with linear amplifier.Advantages and disadvantages of such a model are indicated.

  7. Transistor oscillator and amplifier grids

    Weikle, Robert M., II; Kim, Moonil; Hacker, Jonathan B.; De Lisio, Michael P.; Popvić, Zoya B.; Rutledge, David B.

    1992-01-01

    Although quasi-optical techniques are applicable to a large variety of solid-state devices, special attention is given to transistors, which are attractive because they can be used as either amplifiers or oscillators. Experimental results for MESFET bar-grid and planar grid oscillators are presented. A MESFET grid amplifier that receives only vertically polarized waves at the input and radiates horizontally polarized waves at the output is discussed. These planar grids can be scaled for opera...

  8. Casimir force on amplifying bodies

    Sambale, Agnes; Welsch, Dirk-Gunnar; Buhmann, Stefan Yoshi; Dung, Ho Trung

    2009-01-01

    Based on a unified approach to macroscopic QED that allows for the inclusion of amplification in a limited space and frequency range, we study the Casimir force as a Lorentz force on an arbitrary partially amplifying system of linearly locally responding (isotropic) magnetoelectric bodies. We demonstrate that the force on a weakly polarisable/magnetisable amplifying object in the presence of a purely absorbing environment can be expressed as a sum over the Casimir--Polder forces on the excite...

  9. Development of three channel linear bipolar high voltage amplifier (±2 KV) for electrostatic steerer

    Electrostatic steerers and scanners are planned for low energy ion beam facilities at IUAC to steer and scan the ion beam on target. The power supplies for electrostatic steerers are high voltage bipolar DC amplifiers and for scanners are bipolar AC amplifiers. To fulfil the requirements a common unit has been designed and assembled for AC and DC applications. It can be used with electrostatic devices in scanning, steering and sweeping of low energy ion beams at high frequencies to attain uniform implantation. The unit consist of three independent limited bandwidth high voltage, linear bipolar amplifiers (for X-axis, Y-axis and Y1-dog leg plates). The unit has been provided with both local and remote control. (author)

  10. AcEST: DK950971 [AcEST

    Full Text Available optera acutorost... 37 0.66 tr|B1ACS6|B1ACS6_BALBN DMP1 (Fragment) OS=Balaenoptera ...bonaerens... 37 0.66 tr|B1ACS5|B1ACS5_BALED DMP1 (Fragment) OS=Balaenoptera edeni... GN=... 37 0.66 tr|B1ACS4|B1ACS4_BALBO DMP1 (Fragment) OS=Balaenoptera borealis ... 37 0.66 tr|B1ACS3|B1ACS3..._BALMU DMP1 (Fragment) OS=Balaenoptera musculus ... 37 0.86 tr|B1ACS1|B1ACS1_MEGNO DMP1 (Fragment) OS=Megapt...1ACS2_BALPH DMP1 (Fragment) OS=Balaenoptera physalus ... 37 1.1 tr|B1ACT6|B1ACT6_MESPE DMP1 (Fragment) OS=Me

  11. Computer Aided Design and Analysis of a 2-4 GHz Broadband Balanced Microstrip Amplifier

    S. H. Ibrahim

    2012-07-01

    Full Text Available In this paper, a computer-aided design and analysis of a 2-4 GHz broadband balanced microstrip amplifier using a full computer simulation program developed by the author and others is presented. A short and efficient CAD procedure for broadband amplifier design is introduced. The first step is to design an initial narrow-band high gain microstrip amplifier at 3-GHz central frequency. The second step is to optimize the initial lengths and widths of the input and output microstrip-matching circuits to get the broadband amplifier over the range 2-4 GHz. The analysis of both narrow and broadband amplifiers is investigated. In addition, with the design and analysis of a low-pass microstrip filter, the paper introduces the design and analysis of a Lange coupler. The final AC schematic diagram of the designed amplifier with the lengths and widths of microstrip lines is presented.Key Words: Computer-Aided Design and Analysis, Microstrip Amplifier, Microwave Amplifier.

  12. Low-Noise Band-Pass Amplifier

    Kleinberg, L.

    1982-01-01

    Circuit uses standard components to overcome common limitation of JFET amplifiers. Low-noise band-pass amplifier employs JFET and operational amplifier. High gain and band-pass characteristics are achieved with suitable choice of resistances and capacitances. Circuit should find use as low-noise amplifier, for example as first stage instrumentation systems.

  13. EMI-resilient amplifier circuits

    van der Horst, Marcel J; Linnenbank, André C

    2014-01-01

    This book enables circuit designers to reduce the errors introduced by the fundamental limitations and electromagnetic interference (EMI) in negative-feedback amplifiers.  The authors describe a systematic design approach for application specific negative-feedback amplifiers, with specified signal-to-error ratio (SER).  This approach enables designers to calculate noise, bandwidth, EMI, and the required bias parameters of the transistors used in  application specific amplifiers in order to meet the SER requirements.   ·         Describes design methods that incorporate electromagnetic interference (EMI) in the design of application specific negative-feedback amplifiers; ·         Provides designers with a structured methodology to avoid the use of trial and error in meeting signal-to-error ratio (SER) requirements; ·         Equips designers to increase EMI immunity of the amplifier itself, thus avoiding filtering at the input, reducing the number of components and avoiding detr...

  14. Spectroscopic amplifier for pin diode

    The photodiode remains the basic choice for the photo-detection and is widely used in optical communications, medical diagnostics and field of corpuscular radiation. In detecting radiation it has been used for monitoring radon and its progeny and inexpensive spectrometric systems. The development of a spectroscopic amplifier for Pin diode is presented which has the following characteristics: canceler Pole-Zero (P/Z) with a time constant of 8 μs; constant gain of 57, suitable for the acquisition system; 4th integrator Gaussian order to waveform change of exponential input to semi-Gaussian output and finally a stage of baseline restorer which prevents Dc signal contribution to the next stage. The operational amplifier used is the TLE2074 of BiFET technology of Texas Instruments with 10 MHz bandwidth, 25 V/μs of slew rate and a noise floor of 17 nv/(Hz)1/2. The integrated circuit has 4 operational amplifiers and in is contained the total of spectroscopic amplifier that is the goal of electronic design. The results show like the exponential input signal is converted to semi-Gaussian, modifying only the amplitude according to the specifications in the design. The total system is formed by the detector, which is the Pin diode, a sensitive preamplifier to the load, the spectroscopic amplifier that is what is presented and finally a pulse height analyzer (Mca) which is where the spectrum is shown. (Author)

  15. AC1 Wing

    Adrian DOBRE

    2010-03-01

    Full Text Available The AC1 wing replaces the old wing of the wind tunnel model AEROTAXI, which has been made at scale 1:9. The new wing is part of CESAR program and improves the aerodynamic characteristics of the old one. The geometry of the whole wing was given by FOI Sweden and position of AC1 wing must coincide with the structure of the AEROTAXI model.

  16. AC1 Wing

    Adrian DOBRE

    2010-01-01

    The AC1 wing replaces the old wing of the wind tunnel model AEROTAXI, which has been made at scale 1:9. The new wing is part of CESAR program and improves the aerodynamic characteristics of the old one. The geometry of the whole wing was given by FOI Sweden and position of AC1 wing must coincide with the structure of the AEROTAXI model.

  17. Gaussian amplifier for nuclear spectrometry

    One of the major goals of nuclear spectrometry is the determination of the energy spectrum of a radioactive source. To measure this spectrum with electronic instrumentation one need to use a nuclear spectrometry chain of which the amplifier is part of, and whose filter shaping considerably influences the final energy resolution achieved. The amplifier released accomplishes a 7th order Gaussian filter shape with Taylor series approximation synthesized by the Shifted Companion Form and mounted using only electronic components availablein Brazil. The final version has been tested and the results showed a very good performance and the energy resolution achieved was equivalent to the imported models. (Author)

  18. Diagnostics of the Fermilab Tevatron using an AC dipole

    Miyamoto, Ryoichi; /Texas U.

    2008-08-01

    The Fermilab Tevatron is currently the world's highest energy colliding beam facility. Its counter-rotating proton and antiproton beams collide at 2 TeV center-of-mass. Delivery of such intense beam fluxes to experiments has required improved knowledge of the Tevatron's beam optical lattice. An oscillating dipole magnet, referred to as an AC dipole, is one of such a tool to non-destructively assess the optical properties of the synchrotron. We discusses development of an AC dipole system for the Tevatron, a fast-oscillating (f {approx} 20 kHz) dipole magnet which can be adiabatically turned on and off to establish sustained coherent oscillations of the beam particles without affecting the transverse emittance. By utilizing an existing magnet and a higher power audio amplifier, the cost of the Tevatron AC dipole system became relatively inexpensive. We discuss corrections which must be applied to the driven oscillation measurements to obtain the proper interpretation of beam optical parameters from AC dipole studies. After successful operations of the Tevatron AC dipole system, AC dipole systems, similar to that in the Tevatron, will be build for the CERN LHC. We present several measurements of linear optical parameters (beta function and phase advance) for the Tevatron, as well as studies of non-linear perturbations from sextupole and octupole elements.

  19. Characterisation Of Low Noise Amplifier

    MAULIK B.PATEL

    2012-08-01

    Full Text Available Amplification is one of the most basic and prevalent microwave circuit functions inmodern RF and microwave systems. Early microwave amplifiers relied on tubes, such asklystrons and traveling-wave tubes, or solid-state reflection amplifiers based on thenegative resistance characteristics of tunnel or varactor diodes. But due to the dramaticimprovements and innovations in solid-state technology that have occurred since the1970s, most RF and microwave amplifiers today use transistor devices such as Si or SiGeBJTs, GaAs HBTs, GaAs or InP FETs, or GaAs HEMTs. Microwave transistor amplifiersare rugged, low-cost, reliable, and can be easily integrated in both hybrid andmonolithic integrated circuitry. Transistor amplifiers can be used at frequencies inexcess of 100 GHz in a wide range of applications requiring small size, low-noise figure,broad bandwidth, and low to medium power capacity. Although microwave tubes are stillrequired for very high power and/or very high frequency applications, continuingimprovement in the performance of microwave transistors is steadily reducing the needfor microwave tubes

  20. Dielectric waveguide amplifiers and lasers

    Pollnau, M.

    2014-01-01

    The performance of semiconductor amplifiers and lasers has made them the preferred choice for optical gain on a micro-chip. In the past few years, we have demonstrated that also rare-earth-ion-doped dielectric waveguides show remarkable performance, ranging from a small-signal gain per unit length o

  1. ac bidirectional motor controller

    Schreiner, K.

    1988-01-01

    Test data are presented and the design of a high-efficiency motor/generator controller at NASA-Lewis for use with the Space Station power system testbed is described. The bidirectional motor driver is a 20 kHz to variable frequency three-phase ac converter that operates from the high-frequency ac bus being designed for the Space Station. A zero-voltage-switching pulse-density-modulation technique is used in the converter to shape the low-frequency output waveform.

  2. High-speed thyristor power amplifier control for the JT-60 poloidal field

    In undertaking basic research into a high power thyristor amplifier system for the JT-60, we have developed direct computer control employing modern control theory, and have experimented on a small model system. This paper describes how to attain the required high speed and accuracy and the hardware. To simulate the actual system, a model system composed of a flywheel driven a-c generator, a computer-controlled thyristor amplifier and three coupled magnetic field coils was used. From the experimental results, 0.2% static accuracy, 0.5% dynamic accuracy and 3 msec control delay were obtained. (author)

  3. Low Cost RF Amplifier for Community TV

    Ch, Syafaruddin; Sasongko, Sudi Mariyanto Al; Made Budi Suksmadana, I.; Mustiko Okta Muvianto, Cahyo; Ariessaputra, Suthami

    2016-01-01

    he capability of television to deliver audio video makes this media become the most effective method to spread information. This paper presents an experiment of RF amplifier design having low-cost design and providing sufficient RF power particularly for community television. The RF amplifier consists of two stages of amplifier. The first stage amplifier was used to leverage output of TV modulator from 11dBm to enable to drive next stage amplifier. CAD simulation and fabrication were run to reach optimum RF amplifier design circuit. The associated circuit was made by determining stability circle, stability gain, and matching impedance. Hence, the average power of first stage RF amplifier was 24.68dBm achieved. The second stage used RF modules which was ready match to 50 ohm for both input and output port. The experiment results show that the RF amplifier may operate at frequency ranging from 174 to 230MHz. The average output power of the 2nd stage amplifier was 33.38 Watt with the overall gain of 20.54dB. The proposed RF amplifier is a cheap way to have a stable RF amplifier for community TV. The total budget for the designed RF amplifier is only a 1/5 compared to local design of final TV amplifier.

  4. Amplifying the evanescent field of free electrons

    So, J.-K.; Ou, J.-Y.; Adamo, G.; García de Abajo, F. J.; MacDonald, K. F.; Zheludev, N.I.

    2013-01-01

    We provide the first experimental demonstration that the evanescent field of free electrons can be amplified by a plasmonic nanolayer in much that same way as optical evanescent fields are amplified in the ‘poor-man’s superlens’.

  5. Amplifying free-electron evanescent fields

    So, J.-K.; Ou, J.-Y.; Adamo, G.; García de Abajo, F. J.; MacDonald, K. F.; Zheludev, N.I.

    2013-01-01

    We show experimentally for the first time that free-electron evanescent fields can be amplified by a plasmonic nanolayer in a manner analogous to the way in which optical fields are amplified in the poor-man's superlens.

  6. Analog circuit design designing high performance amplifiers

    Feucht, Dennis

    2010-01-01

    The third volume Designing High Performance Amplifiers applies the concepts from the first two volumes. It is an advanced treatment of amplifier design/analysis emphasizing both wideband and precision amplification.

  7. Compact dual channel spectroscopy amplifier cum discriminator

    A single width NIM module having two channels of spectroscopy amplifier cum discriminator has been developed for Nuclear Physics experiments at IUAC. Each channel contains a shaping amplifier along with logic circuits to generate the energy and timing information respectively

  8. AC/RF Superconductivity

    Ciovati, G.

    2015-01-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  9. AC/RF Superconductivity

    Ciovati, Gianluigi [JLAB

    2015-02-01

    This contribution provides a brief introduction to AC/RF superconductivity, with an emphasis on application to accelerators. The topics covered include the surface impedance of normal conductors and superconductors, the residual resistance, the field dependence of the surface resistance, and the superheating field.

  10. European Research on THz Vacuum Amplifiers

    Brunetti, F.; Cojocarua, C.-S.; de Rossi, A.; Di Carlo, A.; Dispenza, M.; Dolfi, D.; Durand, A.; Fiorello, A.; Gohier, A.; Guiset, P.; Korantia, M.; Krozer, V.; Legagneux, P.; Marchesin, R.; Megtert, S.; Bouamrane, F.; Mineo, M.; Paoloni, C.; Pham, K.; Schnell, J.P.; Secchi, A.; Tamburri, E.; Terranova, M.L.; Ulisse, G.; Zhurbenko, Vitaliy

    The OPTHER (OPtically Driven TeraHertz AmplifiERs) project represents a considerable advancement in the field of high frequency amplification. The design and realization of a THz amplifier within this project is a consolidation of efforts at the international level from the main players of the Eu...... European research, academy and industry in vacuum electronics. This paper describes the status of the project and progress towards the THz amplifier realization....

  11. Improved charge amplifier using hybrid hysteresis compensation

    Amin-Shahidi, Darya; Trumper, David L.

    2013-08-01

    We present a novel charge amplifier, with a robust feedback circuit and a method for compensating piezoelectric actuator's hysteresis at low frequencies. The amplifier uses a modified feedback circuit which improves robustness to the addition of series load impedance such as in cabling. We also describe a hybrid hysteresis compensation method for enabling the charge amplifier to reduce hysteresis at low frequencies. Experimental results demonstrate the utility of the new amplifier design.

  12. Quantum Theory of Laser Amplifiers.

    Mander, Gillian Linda

    Available from UMI in association with The British Library. Requires signed TDF. We calculate the input-output characteristics of a below threshold laser amplifier. Expressions are derived for the output second- and fourth-order spectral and temporal correlation functions in terms of the corresponding input quantities, and for the photocount first and second factorial moments for both homodyne and direct detection. The general results are applied to several cases of practical interest, including specific non-classical input states. We show that a maximum of twofold amplification is permitted if squeezing in the input is to survive at the output. Similarly, for preservation of photon antibunching in amplification we show that only very small gains are allowed. The model treated here provides a detailed example of the amplifier noise limitations imposed by quantum mechanics. In particular, we show that minimum noise occurs in a cavity that is asymmetric with respect to the mirror reflectivities. The latter part of this work treats the above threshold laser amplifier. The laser output is back-scattered from a moving target to provide a weak Doppler-shifted signal which re-enters the laser cavity and is amplified. We show that the three-level atomic lasing medium is equivalent to a two-level medium pumped by an inverted bath. We use the methods of quantum statistical analysis to obtain time -evolution equations for the c-number amplitudes of the laser and signal fields. We show that the results may be applied to the below threshold regime for appropriate values of the pump parameter. By considering the amplitude differential gain we show explicitly that the behaviour of the laser around threshold is characteristic of a second -order phase transition. We calculate the output intensity gain appropriate to a heterodyne detection process, and find good agreement between the predicted gain profiles and measured data for both carbon dioxide and argon-ion lasers.

  13. Compact, harmonic multiplying gyrotron amplifiers

    Guo, H.Z.; Granatstein, V.L.; Antonsen, T.M. Jr.; Levush, B.; Tate, J.; Chen, S.H. [Univ. of Maryland, College Park, MD (United States). Inst. for Plasma Research

    1995-12-31

    A compact, harmonic multiplying gyrotron traveling wave amplifier is being developed. The device is a three-stage tube with the output section running as a fourth harmonic gyro-TWT, the input section running as a fundamental gyro-TWT, and the middle operating at the second harmonic of the cyclotron frequency. Radiation is suppressed by servers between the sections. The operating beam of the tube is produced by a magnetron injection gun (MIG). A TE{sub 0n} mode selective interaction circuit consisting of mode converters and a filter waveguide is employed for both input and output sections to solve the mode competition problem, which is pervasive in gyro-TWT operation. The input section has an input coupler designed as a TE{sub 0n} mode launcher. It excites a signal at the fundamental cyclotron frequency (17.5 GHz), which is amplified in the first TWT interaction region. So far the device is similar to a two-stage harmonic gyro-TWT. The distinction is that in the three-stage device the second section will be optimized not for output power but for fourth harmonic bunching of the beam. A gyroklystron amplifier has also been designed. The configuration is similar to the gyro-TWT but with the traveling wave interaction structures replaced by mode selective special complex cavities. Cold test results of the wideband input coupler and the TE{sub 0n} mode selective interaction circuit have been obtained.

  14. SPS RF System Amplifier plant

    1977-01-01

    The picture shows a 2 MW, 200 MHz amplifier plant with feeder lines. The main RF-system of the SPS comprises four cavities: two of 20 m length and two of 16.5 m length. They are all installed in one long straight section (LSS 3). These cavities are of the travelling-wave type operating at a centre frequency of 200.2 MHz. They are wideband, filling time about 700 ns and untuned. The power amplifiers, using tetrodes are installed in a surface building 200 m from the cavities. Initially only two cavities were installed, a third cavity was installed in 1978 and a forth one in 1979. The number of power amplifiers was also increased: to the first 2 MW plant a second 2 MW plant was added and by end 1979 there were 8 500 kW units combined in pairs to feed each of the 4 cavities with up to about 1 MW RF power, resulting in a total accelerating voltage of about 8 MV. See also 7412016X, 7412017X, 7411048X.

  15. European Research on THz Vacuum Amplifiers

    Brunetti, F.; Cojocarua, C.-S.; de Rossi, A.;

    2010-01-01

    The OPTHER (OPtically Driven TeraHertz AmplifiERs) project represents a considerable advancement in the field of high frequency amplification. The design and realization of a THz amplifier within this project is a consolidation of efforts at the international level from the main players of the Eu...

  16. NASA developments in solid state power amplifiers

    Leonard, Regis F.

    1990-01-01

    Over the last ten years, NASA has undertaken an extensive program aimed at development of solid state power amplifiers for space applications. Historically, the program may be divided into three phases. The first efforts were carried out in support of the advanced communications technology satellite (ACTS) program, which is developing an experimental version of a Ka-band commercial communications system. These first amplifiers attempted to use hybrid technology. The second phase was still targeted at ACTS frequencies, but concentrated on monolithic implementations, while the current, third phase, is a monolithic effort that focusses on frequencies appropriate for other NASA programs and stresses amplifier efficiency. The topics covered include: (1) 20 GHz hybrid amplifiers; (2) 20 GHz monolithic MESFET power amplifiers; (3) Texas Instruments' (TI) 20 GHz variable power amplifier; (4) TI 20 GHz high power amplifier; (5) high efficiency monolithic power amplifiers; (6) GHz high efficiency variable power amplifier; (7) TI 32 GHz monolithic power amplifier performance; (8) design goals for Hughes' 32 GHz variable power amplifier; and (9) performance goals for Hughes' pseudomorphic 60 GHz power amplifier.

  17. Solid state, S-band, power amplifier

    Digrindakis, M.

    1973-01-01

    The final design and specifications for a solid state, S-band, power amplifier is reported. Modifications from a previously proposed design were incorporated to improve efficiency and meet input overdrive and noise floor requirements. Reports on the system design, driver amplifier, power amplifier, and voltage and current limiter are included along with a discussion of the testing program.

  18. Solid state ku-band power amplifier

    Bowers, H. C.; Lockyear, W. H.

    1972-01-01

    The design, fabrication, and testing of two types of IMPATT diode reflection amplifiers and a transmission amplifier are given. The Ku-band IMPATT diode development is discussed. Circuitry and electrical performance of the final version of the Ku-band amplifier is described. Construction details and an outline and mounting drawing are presented.

  19. low pump power photonic crystal fibre amplifiers

    Hougaard, Kristian G.; Broeng, Jes; Bjarklev, Anders Overgaard

    2003-01-01

    Designs of low pump power optical amplifiers, based on photonic crystal fibres are presented. The potential of these fibre amplifiers is investigated, and it is demonstrated that such amplifiers may deliver gains of more than 15 dB at 1550 nm with less than 1 mW of optical pump power....

  20. NIF/LMJ prototype amplifier mechanical design

    Amplifier prototypes for the National Ignition Facility and the Laser Megajoule will be tested at Lawrence Livermore National Laboratory. The prototype amplifier, which is an ensemble of modules from LLNL and Centre d'Etudes de Limeil-Valenton, is cassette-based with bottom access for maintenance. A sealed maintenance transfer vehicle which moves optical cassettes between the amplifier and the assembly cleanroom, and a vacuum gripper which holds laser slabs during cassette assembly will also be tested. The prototype amplifier will be used to verify amplifier optical performance, thermal recovery time, and cleanliness of mechanical operations

  1. An Implantable CMOS Amplifier for Nerve Signals

    Nielsen, Jannik Hammel; Lehmann, Torsten

    In this paper, a low noise high gain CMOS amplifier for minute nerve signals is presented. The amplifier is constructed in a fully differential topology to maximize noise rejection. By using a mixture of weak- and strong inversion transistors, optimal noise suppression in the amplifier is achieved....... A continuous-time current-steering offset-compensation technique is utilized in order to minimize the noise contribution and to minimize dynamic impact on the amplifier input nodes. The method for signal recovery from noisy nerve signals is presented. A prototype amplifier is realized in a standard...

  2. A Low Cost Amplifier And Acquisition System For Cortical-Electroncephalography In Non-Human Applications

    Viggiano, Andrea; Coppola, Giangennaro

    2014-01-01

    A simple circuit is described to make an AC-amplifier and an analog-to-digital converter in a single, compact solution, for use in basic research, but not on humans. The circuit sends data to and is powered from a common USB port of modern computers; using proper firmware and driver the communication with the device is an emulated RS232 serial port.

  3. A Low Cost Amplifier and Acquisition System for Cortical-Electroncephalography in Non-Human Applications

    2014-01-01

    A simple circuit is described to make an AC-amplifier and an analog-to-digital converter in a single, compact solution, for use in basic research, but not on humans. The circuit sends data to and is powered from a common USB port of modern computers; using proper firmware and driver the communication with the device is an emulated RS232 serial port.

  4. Concurrent Electroencephalography Recording During Transcranial Alternating Current Stimulation (tACS).

    Fehér, Kristoffer D; Morishima, Yosuke

    2016-01-01

    Oscillatory brain activities are considered to reflect the basis of rhythmic changes in transmission efficacy across brain networks and are assumed to integrate cognitive neural processes. Transcranial alternating current stimulation (tACS) holds the promise to elucidate the causal link between specific frequencies of oscillatory brain activity and cognitive processes. Simultaneous electroencephalography (EEG) recording during tACS would offer an opportunity to directly explore immediate neurophysiological effects of tACS. However, it is not trivial to measure EEG signals during tACS, as tACS creates a huge artifact in EEG data. Here we explain how to set up concurrent tACS-EEG experiments. Two necessary considerations for successful EEG recording while applying tACS are highlighted. First, bridging of the tACS and EEG electrodes via leaking EEG gel immediately saturates the EEG amplifier. To avoid bridging via gel, the viscosity of the EEG gel is the most important parameter. The EEG gel must be viscous to avoid bridging, but at the same time sufficiently fluid to create contact between the tACS electrode and the scalp. Second, due to the large amplitude of the tACS artifact, it is important to consider using an EEG system with a high resolution analog-to-digital (A/D) converter. In particular, the magnitude of the tACS artifact can exceed 100 mV at the vicinity of a stimulation electrode when 1 mA tACS is applied. The resolution of the A/D converter is of importance to measure good quality EEG data from the vicinity of the stimulation site. By following these guidelines for the procedures and technical considerations, successful concurrent EEG recording during tACS will be realized. PMID:26862814

  5. Increased Ac excision (iae): Arabidopsis thaliana mutations affecting Ac transposition

    The maize transposable element Ac is highly active in the heterologous hosts tobacco and tomato, but shows very much reduced levels of activity in Arabidopsis. A mutagenesis experiment was undertaken with the aim of identifying Arabidopsis host factors responsible for the observed low levels of Ac activity. Seed from a line carrying a single copy of the Ac element inserted into the streptomycin phosphotransferase (SPT) reporter fusion, and which displayed typically low levels of Ac activity, were mutagenized using gamma rays. Nineteen mutants displaying high levels of somatic Ac activity, as judged by their highly variegated phenotypes, were isolated after screening the M2 generation on streptomycin-containing medium. The mutations fall into two complementation groups, iae1 and iae2, are unlinked to the SPT::Ac locus and segregate in a Mendelian fashion. The iae1 mutation is recessive and the iae2 mutation is semi-dominant. The iae1 and iae2 mutants show 550- and 70-fold increases, respectively, in the average number of Ac excision sectors per cotyledon. The IAE1 locus maps to chromosome 2, whereas the SPT::Ac reporter maps to chromosome 3. A molecular study of Ac activity in the iae1 mutant confirmed the very high levels of Ac excision predicted using the phenotypic assay, but revealed only low levels of Ac re-insertion. Analyses of germinal transposition in the iae1 mutant demonstrated an average germinal excision frequency of 3% and a frequency of independent Ac re-insertions following germinal excision of 22%. The iae mutants represents a possible means of improving the efficiency of Ac/Ds transposon tagging systems in Arabidopsis, and will enable the dissection of host involvement in Ac transposition and the mechanisms employed for controlling transposable element activity

  6. HIGH AVERAGE POWER OPTICAL FEL AMPLIFIERS

    Historically, the first demonstration of the optical FEL was in an amplifier configuration at Stanford University [l]. There were other notable instances of amplifying a seed laser, such as the LLNL PALADIN amplifier [2] and the BNL ATF High-Gain Harmonic Generation FEL [3]. However, for the most part FELs are operated as oscillators or self amplified spontaneous emission devices. Yet, in wavelength regimes where a conventional laser seed can be used, the FEL can be used as an amplifier. One promising application is for very high average power generation, for instance FEL's with average power of 100 kW or more. The high electron beam power, high brightness and high efficiency that can be achieved with photoinjectors and superconducting Energy Recovery Linacs (ERL) combine well with the high-gain FEL amplifier to produce unprecedented average power FELs. This combination has a number of advantages. In particular, we show that for a given FEL power, an FEL amplifier can introduce lower energy spread in the beam as compared to a traditional oscillator. This properly gives the ERL based FEL amplifier a great wall-plug to optical power efficiency advantage. The optics for an amplifier is simple and compact. In addition to the general features of the high average power FEL amplifier, we will look at a 100 kW class FEL amplifier is being designed to operate on the 0.5 ampere Energy Recovery Linac which is under construction at Brookhaven National Laboratory's Collider-Accelerator Department

  7. High temperature charge amplifier for geothermal applications

    Lindblom, Scott C.; Maldonado, Frank J.; Henfling, Joseph A.

    2015-12-08

    An amplifier circuit in a multi-chip module includes a charge to voltage converter circuit, a voltage amplifier a low pass filter and a voltage to current converter. The charge to voltage converter receives a signal representing an electrical charge and generates a voltage signal proportional to the input signal. The voltage amplifier receives the voltage signal from the charge to voltage converter, then amplifies the voltage signal by the gain factor to output an amplified voltage signal. The lowpass filter passes low frequency components of the amplified voltage signal and attenuates frequency components greater than a cutoff frequency. The voltage to current converter receives the output signal of the lowpass filter and converts the output signal to a current output signal; wherein an amplifier circuit output is selectable between the output signal of the lowpass filter and the current output signal.

  8. Hermetisk AC-Krets

    Hirsch, Carl; Smirnoff, Alexander

    2007-01-01

    Under sex månader våren 2007 har ett samarbete mellan Volvo Lastvagnar och två studenter från KTH, inriktning Integrerad produktutveckling vid institutionen för maskinkonstruktion, pågått i form av ett examensarbete på 20 poäng. Dagens AC-system i Volvos lastbilar avger 20-40 g/år av köldmediet R134a som är en kraftfull växthusgas. Detta sker främst genom diffusion via slangar och tätningsmaterial. Syftet med detta examensarbete är att ta fram förslag på tekniska lösningar på ett nytt AC-syst...

  9. Cathode-follower power amplifier

    In circular accelerators and particularly in storage rings it is essential that the total impedance, as seen by the beam, be kept below some critical value. A model of the accelerating system was built using a single-ended cathode-follower amplifier driving a ferrite-loaded cavity. The system operated at 234.5 kHz with a peak output voltage of +-10 kV on the gap. The dynamic output impedance, as measured on the gap, was < 15 ohms

  10. Audio power amplifier design handbook

    Self, Douglas

    2013-01-01

    This book is essential for audio power amplifier designers and engineers for one simple reason...it enables you as a professional to develop reliable, high-performance circuits. The Author Douglas Self covers the major issues of distortion and linearity, power supplies, overload, DC-protection and reactive loading. He also tackles unusual forms of compensation and distortion produced by capacitors and fuses. This completely updated fifth edition includes four NEW chapters including one on The XD Principle, invented by the author, and used by Cambridge Audio. Cro

  11. High power RF solid state power amplifier system

    Sims, III, William Herbert (Inventor); Chavers, Donald Gregory (Inventor); Richeson, James J. (Inventor)

    2011-01-01

    A high power, high frequency, solid state power amplifier system includes a plurality of input multiple port splitters for receiving a high-frequency input and for dividing the input into a plurality of outputs and a plurality of solid state amplifier units. Each amplifier unit includes a plurality of amplifiers, and each amplifier is individually connected to one of the outputs of multiport splitters and produces a corresponding amplified output. A plurality of multiport combiners combine the amplified outputs of the amplifiers of each of the amplifier units to a combined output. Automatic level control protection circuitry protects the amplifiers and maintains a substantial constant amplifier power output.

  12. High-efficiency solid state power amplifier

    Wallis, Robert E. (Inventor); Cheng, Sheng (Inventor)

    2005-01-01

    A high-efficiency solid state power amplifier (SSPA) for specific use in a spacecraft is provided. The SSPA has a mass of less than 850 g and includes two different X-band power amplifier sections, i.e., a lumped power amplifier with a single 11-W output and a distributed power amplifier with eight 2.75-W outputs. These two amplifier sections provide output power that is scalable from 11 to 15 watts without major design changes. Five different hybrid microcircuits, including high-efficiency Heterostructure Field Effect Transistor (HFET) amplifiers and Monolithic Microwave Integrated Circuit (MMIC) phase shifters have been developed for use within the SSPA. A highly efficient packaging approach enables the integration of a large number of hybrid circuits into the SSPA.

  13. A low-noise transimpedance amplifier for the detection of “Violin-Mode” resonances in advanced Laser Interferometer Gravitational wave Observatory suspensions

    This paper describes the design and performance of an extremely low-noise differential transimpedance amplifier, which takes its two inputs from separate photodiodes. The amplifier was planned to serve as the front-end electronics for a highly sensitive shadow-displacement sensing system, aimed at detecting very low-level “Violin-Mode” (VM) oscillations in 0.4 mm diameter by 600 mm long fused-silica suspension fibres. Four such highly tensioned fibres support the 40 kg test-masses/mirrors of the Advanced Laser Interferometer Gravitational wave Observatory interferometers. This novel design of amplifier incorporates features which prevent “noise-gain peaking” arising from large area photodiode (and cable) capacitances, and which also usefully separate the DC and AC photocurrents coming from the photodiodes. In consequence, the differential amplifier was able to generate straightforwardly two DC outputs, one per photodiode, as well as a single high-gain output for monitoring the VM oscillations—this output being derived from the difference of the photodiodes’ two, naturally anti-phase, AC photocurrents. Following a displacement calibration, the amplifier's final VM signal output was found to have an AC displacement responsivity at 500 Hz of (9.43 ± 1.20) MV(rms) m−1(rms), and, therefore, a shot-noise limited sensitivity to such AC shadow- (i.e., fibre-) displacements of (69 ± 13) picometres/√Hz at this frequency, over a measuring span of ±0.1 mm

  14. YANG-MILLS FIELD AMPLIFIER

    Trunev A. P.

    2015-09-01

    Full Text Available The article presents a project of the Yang-Mills amplifier. Amplifier model is a multilayer spherical shell with increasing density towards the center. In the center of the amplifier is the core of high-density material. It is shown that in such a system, the amplitude of the Yang-Mills waves rises from the periphery to the center of several orders of magnitude. The role of the Yang-Mills field in the processes occurring in the nuclei of galaxies, stars and planets is discussed. The data modeling to strengthen the Yang-Mills field in the bowels of the planet, with an atomic explosion, and in some special devices such as the voltaic pile. To describe the mechanism of amplification chromodynamics field used as accurate results in Yang-Mills theory and numerical models developed based on an average and the exact equations as well. Among the exact solutions of the special role played by the centralsymmetric metric describing the contribution of the Yang-Mills field in the speed of recession of galaxies. Among the approximate numerical models can be noted the eight-scalar model we have developed for the simulation of non-linear color oscillations and chaos in the Yang-Mills theory. Earlier models were investigated spatio-temporal oscillations of the YangMills theory in the case of three and eight colors. The results of numerical simulation show that the nonlinear interaction does not lead to a spatial mixing of colors as it might be in the case of turbulent diffusion. Depending on the system parameters there is a suppression of the amplitude of the oscillations the first three by five colors or vice versa. The kinetic energy fluctuations or shared equally between the color components, or dominated by the kinetic energy of repressed groups of colors. In the present study, we found that amplification chromodynamic field leads to a sharp increase in the amplitude of the suppressed color, which can lead to an increase in entropy, excitation of nuclear

  15. Enhanced Gain in Photonic Crystal Amplifiers

    Ek, Sara; Semenova, Elizaveta; Hansen, Per Lunnemann;

    2012-01-01

    study of a 1 QW photonic crystal amplifier. Net gain is achieved which enables laser oscillation in photonic crystal micro cavities. The ability to freely tailor the dispersion in a semiconductor optical amplifier makes it possible to raise the optical gain considerably over a certain bandwidth. These...... results are promising for short and efficient semiconductor optical amplifiers. This effect will also benefit other devices, such as mode locked lasers....

  16. Superconducting ac cable

    The components of a superconducting 110 kV ac cable for power ratings >= 2000 MVA have been developed. The cable design especially considered was of the semiflexible type, with a rigid cryogenic envelope and flexible hollow coaxial cable cores pulled into the former. The cable core consists of spirally wound Nb-Al composite wires and a HDPE-tape wrapped electrical insulation. A 35 m long single phase test cable with full load terminations for 110 kV and 10 kA was constructed and successfully tested. The results obtained prove the technical feasibility and capability of our cable design. (orig.)

  17. High performance AC drives

    Ahmad, Mukhtar

    2010-01-01

    This book presents a comprehensive view of high performance ac drives. It may be considered as both a text book for graduate students and as an up-to-date monograph. It may also be used by R & D professionals involved in the improvement of performance of drives in the industries. The book will also be beneficial to the researchers pursuing work on multiphase drives as well as sensorless and direct torque control of electric drives since up-to date references in these topics are provided. It will also provide few examples of modeling, analysis and control of electric drives using MATLAB/SIMULIN

  18. Reflection amplifiers in self-regulated learning

    Verpoorten, Dominique

    2012-01-01

    Verpoorten, D. (2012). Reflection amplifiers in self-regulated learning. Doctoral thesis. November, 9, 2012, Heerlen, The Netherlands: Open Universiteit (CELSTEC). Datawyse / Universitaire Pers Maastricht.

  19. Dynamics of Soliton Cascades in Fiber Amplifiers

    Arteaga-Sierra, F R; Agrawal, Govind P

    2016-01-01

    We study numerically the formation of cascading solitons when femtosecond optical pulses are launched into a fiber amplifier with less energy than required to form a soliton of equal duration. As the pulse is amplified, cascaded fundamental solitons are created at different distances, without soliton fission, as each fundamental soliton moves outside the gain bandwidth through the Raman-induced spectral shifts. As a result, each input pulse creates multiple, temporally separated, ultrashort pulses of different wavelengths at the amplifier output. The number of pulses depends not only on the total gain of the amplifier but also on the width of input pulses.

  20. Ping-pong auto-zero amplifier with glitch reduction

    Larson, Mark R.

    2008-01-22

    A ping-pong amplifier with reduced glitching is described. The ping-pong amplifier includes a nulling amplifier coupled to a switching network. The switching network is used to auto-zero a ping amplifier within a ping-pong amplifier. The nulling amplifier drives the output of a ping amplifier to a proper output voltage level during auto-zeroing of the ping amplifier. By being at a proper output voltage level, glitches associated with transitioning between a ping amplifier and a pong amplifier are reduced or eliminated.

  1. Linearisation of RF Power Amplifiers

    Nielsen, Per Asbeck

    2001-01-01

    linearisation systems with focus on polar modulation feedback, and a chip oriented part focusing on integrating of separate building blocks of the system on a chip. The system oriented part of this thesis deals with analog feedback linearisation systems. The Polar modulation feedback system is compared with the...... more traditional Cartesian modulation feedback system in terms of loop settlement and dependencies between the feedback signals. A method to calculate the distortion functions of the linearisation system (AM/AM and AM/PM)based on the distortion functions of the power amplifier is presented. Also the...... polar loop architecture and it’s suitability to modern digital transmitters is discussed. A proposal of an architecture that is suitable for digital transmitters, which means that it has an interface to the digital back-end, defined by low-pass signals in polar form, is presented. Simulation guidelines...

  2. Transverse pumped laser amplifier architecture

    Bayramian, Andrew James; Manes, Kenneth; Deri, Robert; Erlandson, Al; Caird, John; Spaeth, Mary

    2013-07-09

    An optical gain architecture includes a pump source and a pump aperture. The architecture also includes a gain region including a gain element operable to amplify light at a laser wavelength. The gain region is characterized by a first side intersecting an optical path, a second side opposing the first side, a third side adjacent the first and second sides, and a fourth side opposing the third side. The architecture further includes a dichroic section disposed between the pump aperture and the first side of the gain region. The dichroic section is characterized by low reflectance at a pump wavelength and high reflectance at the laser wavelength. The architecture additionally includes a first cladding section proximate to the third side of the gain region and a second cladding section proximate to the fourth side of the gain region.

  3. Amplified spontaneous emission and its restraint in a terawatt Ti:sapphire amplifier

    2000-01-01

    Amplified spontaneous emission (ASE) and its restraint in a femtosecond Ti: sapphire chirped_pulse amplifier were investigated. The noises arising from ASE were effectively filtered out in the spatial, temporal and spectral domain. Pulses as short as 38 fs were amplified to peak power of 1.4 TW. The power ratio between the amplified femtosecond pulse and the ASE was higher than 106:1.

  4. Distributed feedback laser amplifiers combining the functions of amplifiers and channel filters

    Wang, Z.; Durhuus, T.; Mikkelsen, Benny;

    1994-01-01

    A dynamic model for distributed feedback amplifiers, including the mode coupled equations and the carrier rate equation, is established. The presented mode coupled equations have taken into account the interaction between fast changing optical signal and the waveguide with corrugations. By showin...... the possibility of amplifying 100 ps pulses without pulse broadening, we anticipate that a distributed feedback amplifier can be used as a combined amplifier and channel filter in high bit rate transmission systems....

  5. BROADBAND TRAVELLING WAVE SEMICONDUCTOR OPTICAL AMPLIFIER

    2010-01-01

    Broadband travelling wave semiconductor optical amplifier (100, 200, 300, 400, 800) for amplification of light, wherein the amplifier (100, 200, 300, 400, 800) comprises a waveguide region (101, 201, 301, 401, 801) for providing confinement of the light in transverse directions and adapted for...

  6. A general-purpose pulse amplifier

    In the paper proposals are made for using the technique, known from analogue computation, for transforming nuclear pulses to the shape and size desired by the means of ''operational amplifiers''. By using this technique it is possible, by means of one fundamental amplifier but with different feedback networks, to have pre-amplifiers and head-amplifiers with different pulse-handling performances and optimized with respect to the parameter of greatest interest, such as linearity, stability or overloading characteristics. As this technique involves the use of parallel-feedback it is specially suited for pre-amplifiers since most detectors are current-generators. An amplifier fulfilling the requirements necessary for use as an operational amplifier is described. The most important specifications are: 90 db gain from DC-10 kHz, then falling approximately 20 db/decade until 15 MHz (30 db gain). Four tubes are used in the amplifier. For most pulse-handling applications a stabilized power-supply is unnecessary and the stability will depend solely on the stability of the feedback network used. (author)

  7. Self-pulsation in Raman fiber amplifiers

    Pedersen, Martin Erland Vestergaard; Ott, Johan Raunkjær; Rottwitt, Karsten

    2009-01-01

    Dynamic behavior caused by Brillouin scattering in Raman fiber amplifiers is studied. Modes of self-pulsation steady state oscillations are found. Their dependence on amplification scheme is demonstrated.......Dynamic behavior caused by Brillouin scattering in Raman fiber amplifiers is studied. Modes of self-pulsation steady state oscillations are found. Their dependence on amplification scheme is demonstrated....

  8. High efficiency, low magnetic field gyroklystron amplifiers

    The possibility of operating a gyroklystron amplifier at high efficiency and low magnetic field is considered. Two devices are discussed: A two cavity second harmonic TE02 gyroklystron amplifier operating at 19.7 GHz with subharmonic bunching, and a fundamental mode TE01 gyrotwistron at 16 GHz. The nonlinear efficiency is given for both devices

  9. Waveguide optical amplifier for telecom applications

    Taccheo, Stefano; Zannin, Marcelo; Ennser, Karin; Careglio, Davide; Solé Pareta, Josep; Aracil Rico, Javier

    2009-01-01

    In this paper we review progress in optical gain clamped waveguide amplifiers for applications to optical communications. We demonstrate that compact waveguide devices may offer advantages compared to standard fiber amplifiers. In particular we focus on the application of gain clamping and optical burst switching networks where physical impairments may occur due to variation of the input power. Peer Reviewed

  10. Radiation tolerant isolation amplifiers for temperature measurement

    This paper concentrates on the selection of radiation tolerant isolation amplifiers, which are suitable for the signal conditioners for cryogenic system in the Large Hadron Collider (LHC). The evolution and the results of different commercial isolation amplifiers' parameters under neutron and gamma radiation are presented. In most cases, the tested isolation amplifiers' input offset voltage, bias currents and output offset voltage hardly changed during the radiation. The DC gain in input stage was only affected for some isolation amplifiers with a small open loop gain. Transmission coefficient showed decrease for all the tested isolation amplifiers. Also, the DC output voltage increased and the ripple voltage decreased for all the build-in isolated regulators. In addition, results on 1B41 signal conditioner showed that it was tolerant to 7-8x1012 n/cm2, which was 50% higher than the expected dose in the LHC

  11. An Implantable CMOS Amplifier for Nerve Signals

    Nielsen, Jannik Hammel; Lehmann, Torsten

    2001-01-01

    In this paper, a low noise high gain CMOS amplifier for minute nerve signals is presented. By using a mixture of weak- and strong inversion transistors, optimal noise suppression in the amplifier is achieved. A continuous-time offset-compensation technique is utilized in order to minimize impact on...... the amplifier input nodes. The method for signal recovery from noisy nerve signals is presented. A prototype amplifier is realized in a standard digital 0.5 μm CMOS single poly, n-well process. The prototype amplifier features a gain of 80 dB over a 3.6 kHz bandwidth, a CMRR of more than 87 dB and a...

  12. Design and performance of the beamlet amplifiers

    Erlandson, A.C.; Rotter, M.D.; Frank, M.D.; McCracken, R.W.

    1996-06-01

    In future laser systems, such as the National Ignition Facility (NIF), multi-segment amplifiers (MSAs) will be used to amplify the laser beam to the required levels. As a prototype of such a laser architecture, the authors have designed, built, and tested flash-lamp-pumped, Nd:Glass, Brewster-angle slab MSAs for the Beamlet project. In this article, they review the fundamentals of Nd:Glass amplifiers, describe the MSA geometry, discuss parameters that are important in amplifier design, and present our results on the characterization of the Beamlet MSAs. In particular, gain and beam steering measurements show that the Beamlet amplifiers meet all optical performance specifications and perform close to model predictions.

  13. Qubit readout with a directional parametric amplifier

    Sliwa, K. M.; Abdo, B.; Narla, A.; Shankar, S.; Hatridge, M.; Frunzio, L.; Schoelkopf, R. J.; Devoret, M. H.

    2014-03-01

    Josephson junction based quantum limited parametric amplifiers play an essential role in superconducting qubit measurements. These measurements necessitate circulators and isolators between the amplifier and qubit to add directionality and/or isolation. Unfortunately, this extra hardware limits both quantum measurement efficiency and experimental scalability. Here we present a quantum-limited Josephson-junction-based directional amplifier (JDA) based on a novel coupling between two nominally identical Josephson parametric converters (JPCs). The device achieves a forward gain of 11 dB with a 15 MHz dynamical bandwidth, but higher gains are possible at the expense of bandwidth. We also present measurements of a transmon qubit made with the JDA, and show minimal measurement back-action despite the absence of any isolator or circulator before the amplifier. These results provide a first step toward realizing on-chip integration of qubits and parametric amplifiers. Work supported by: IARPA, ARO, and NSF.

  14. mm-wave solid state amplifiers

    Wolfert, P. H.; Crowley, J. D.; Fank, F. B.

    The development of mm-wave amplifiers using InP Gunn diodes is reviewed including a low-noise eight-stage amplifier for replacement of a Ka-band TWTA and a three-stage amplifier for the 42.5 to 44.5 range with an output power of 100 mW and 20 dB associated gain. A detailed description of a three-stage amplifier for the 54 to 58 GHz range is given with 100 mW output power and 15 dB associated gain, a small signal gain of 30 dB and an N.F. of 15.5 to 16.5 dB. The design of a broad band, low-loss V-band circulator, which was used in the amplifier, is described.

  15. Detection of Non-Amplified Genomic DNA

    Corradini, Roberto

    2012-01-01

    This book offers a state-of-the-art overview on non amplified DNA detection methods and provides chemists, biochemists, biotechnologists and material scientists with an introduction to these methods. In fact all these fields have dedicated resources to the problem of nucleic acid detection, each contributing with their own specific methods and concepts. This book will explain the basic principles of the different non amplified DNA detection methods available, highlighting their respective advantages and limitations. The importance of non-amplified DNA sequencing technologies will be also discussed. Non-amplified DNA detection can be achieved by adopting different techniques. Such techniques have allowed the commercialization of innovative platforms for DNA detection that are expected to break into the DNA diagnostics market. The enhanced sensitivity required for the detection of non amplified genomic DNA has prompted new strategies that can achieve ultrasensitivity by combining specific materials with specifi...

  16. Semiconductor quantum-dot lasers and amplifiers

    Hvam, Jørn Märcher; Borri, Paola; Ledentsov, N. N.;

    2002-01-01

    We have produced GaAs-based quantum-dot edge-emitting lasers operating at 1.16 mu m with record-low transparency current, high output power, and high internal quantum efficiencies. We have also realized GaAs-based quantum-dot lasers emitting at 1.3 mu m, both high-power edge emitters and low-power...... biased to positive net gain. We have further measured gain recovery times in quantum dot amplifiers that are significantly lower than in bulk and quantum-well semiconductor optical amplifiers. This is promising for future demonstration of quantum dot devices with high modulation bandwidth...... surface emitting VCSELs. We investigated the ultrafast dynamics of quantum-dot semiconductor optical amplifiers. The dephasing time at room temperature of the ground-state transition in semiconductor quantum dots is around 250 fs in an unbiased amplifier, decreasing to below 50 fs when the amplifier is...

  17. Design of an 1800nm Raman amplifier

    Svane, Ask Sebastian; Rottwitt, Karsten

    2013-01-01

    We present the experimental results for a Raman amplifier that operates at 1810 nm and is pumped by a Raman fiber laser at 1680 nm. Both the pump laser and the Raman amplifier is polarization maintaining. A challenge when scaling Raman amplifiers to longer wavelengths is the increase in...... transmission loss, but also the reduction in the Raman gain coefficient as the amplifier wavelength is increased. Both polarization components of the Raman gain is characterized, initially for linearly co-polarized signal and pump, subsequently linearly polarized orthogonal signal and pump. The noise...... performance of the amplifier is also investigated for both configurations. Our results show an on/off gain exceeding 20 dB at 1810 nm for which the obtained effective noise figure is below 3 dB....

  18. Ac Hybrid Charge Controller

    Shalini S. Durgam

    2015-03-01

    Full Text Available One of the primary needs for socio-economic development in any nation in the world is the provision of reliable electricity supply systems with lower carbon footprint levels. The purpose of this work is the development of a hybrid Power system that harnesses the renewable energy in sun and electricity to generate electricity. The working model can able to run on dual mode- solar and electricity. It can also be driven independently either by solar or electricity. The battery can be charge from solar panel (40W or by power supply. The household single phase A.C. power supply of 230V is converted into 12V D.C. using step down transformer and rectifying circuit. The working model can achieve energy saving, low carbon emission, environmental protection for the upcoming future of human life.

  19. An upstream reach-extender for 10Gb/s PON applications based on an optimized semiconductor amplifier cascade.

    Porto, Stefano; Antony, Cleitus; Ossieur, Peter; Townsend, Paul D

    2012-01-01

    We present a reach-extender for the upstream transmission path of 10Gb/s passive optical networks based on an optimised cascade of two semiconductor optical amplifiers (SOAs). Through careful optimisation of the bias current of the second stage SOA, over 19dB input dynamic range and up to 12dB compression of the output dynamic range were achieved without any dynamic control. A reach of 70km and split up to 32 were demonstrated experimentally using an ac-coupled, continuous-mode receiver with a reduced 56ns ac-coupling constant. PMID:22274342

  20. AcEST: BP920072 [AcEST

    Full Text Available YMU001_000132_F11 525 Adiantum capillus-veneris mRNA. clone: YMU001_000132_F11. BP920072 - Show ... YGMYGEGEKALETFADMEKSGIVPDSVVFIAII 617 Query: 139 NACSR SCLFHECHSYFEAMSTHHGIVPCLEHHSCVV 32 ACS S L E + FE M ... KLMTRDVVSWNTLIAGYAQVGQNEGLFCTFSDMLGQRVKPDLITFVIVLNACSR ... 125 VF+ + +D VSWN++I+GY Q G F M+ + D IT++++++ +R S ... YGVHGYGKKAIQIFEEMLANGASP 384 Query: 166 DLITFVIVLNACSR SCLFHECHSYFEAMSTHHGIVPCLEHHSCVV 32 +TFV VL ACS L E ... KLMTRDVVSWNTLIAGYAQVGQNEGLFCTFSDMLGQRVKPDLITFVIVLNACSR S 122 +VFDK R + WN L G E + + M V+ D T+ VL AC S Sbjc ...

  1. Laser Cooled High-Power Fiber Amplifier

    Nemova, Galina

    2009-01-01

    A theoretical model for laser cooled continuous-wave fiber amplifier is presented. The amplification process takes place in the Tm3+-doped core of the fluoride ZBLAN (ZrF4-BaF2-LaF3-AlF3-NaF) glass fiber. The cooling process takes place in the Yb3+:ZBLAN fiber cladding. It is shown that for each value of the pump power and the amplified signal there is a distribution of the concentration of the Tm3+ along the length of the fiber amplifier, which provides its athermal operation. The influence ...

  2. Effect of Soliton Propagation in Fiber Amplifiers

    2001-01-01

    The propagation of optical solitons in fiber amplifiers is discussed by considering a model that includes linear high order dispersion, two-photon absorption, nonlinear high-order dispersion, self-induced Ramam and five-order nonlinear effects. Based on travelling wave method, the solutions of the nonlinear Schrdinger equations, and the influence on soliton propagation as well as high-order effect in the fiber amplifier are discussed in detail. It is found that because of existing five-order nonlinear effect, the solution is not of secant hyperbola type, but shows high gain state of the fiber amplifier which is very favourable to the propagation of solitons.

  3. Fundamentals of RF and microwave transistor amplifiers

    Bahl, Inder J

    2009-01-01

    A Comprehensive and Up-to-Date Treatment of RF and Microwave Transistor Amplifiers This book provides state-of-the-art coverage of RF and microwave transistor amplifiers, including low-noise, narrowband, broadband, linear, high-power, high-efficiency, and high-voltage. Topics covered include modeling, analysis, design, packaging, and thermal and fabrication considerations. Through a unique integration of theory and practice, readers will learn to solve amplifier-related design problems ranging from matching networks to biasing and stability. More than 240 problems are included to help read

  4. The 60 GHz solid state power amplifier

    Mcclymonds, J.

    1991-01-01

    A new amplifier architecture was developed during this contract that is superior to any other solid state approach. The amplifier produced 6 watts with 4 percent efficiency over a 2 GHz band at 61.5 GHz. The unit was 7 x 9 x 3 inches in size, 5.5 pounds in weight, and the conduction cooling through the baseplate is suitable for use in space. The amplifier used high efficiency GaAs IMPATT diodes which were mounted in 1-diode circuits, called modules. Eighteen modules were used in the design, and power combining was accomplished with a proprietary passive component called a combiner plate.

  5. AcEST: DK950147 [AcEST

    Full Text Available TST38A01NGRL0007_O05 706 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0007_O05. 5' end seq ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... OS=Medicago truncatula GN=MtrDRAFT_AC149576g3v2 PE ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... (Fragment) OS=Medicago truncatula GN=MtrDRAFT_AC14 ...

  6. AcEST: DK959344 [AcEST

    Full Text Available TST39A01NGRL0004_G23 714 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0004_G23. 5' end seq ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... OS=Medicago truncatula GN=MtrDRAFT_AC149576g3v2 PE ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... (Fragment) OS=Medicago truncatula GN=MtrDRAFT_AC14 ...

  7. AcEST: DK949716 [AcEST

    Full Text Available TST38A01NGRL0006_L20 613 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0006_L20. 5' end seq ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... OS=Medicago truncatula GN=MtrDRAFT_AC149576g3v2 PE ... _MEDTR Peptidase, trypsin-like serine and cysteine proteases ... (Fragment) OS=Medicago truncatula GN=MtrDRAFT_AC14 ...

  8. AcEST: BP920905 [AcEST

    Full Text Available EM + + D ++S L AC Sbjct: 374 NSAYKLFERMPKKNVVAWNAIISGYSQHGHPHEALALFIEMQAQGIKPDSFAIVSVLPAC 433 Query: 71 SHSSTLNDGKLIHFYILMNNFE...EM++ ++ + V + S L +C Sbjct: 255 SSERIFEKIAKKNAVSWTAMISSYNRGEFSEKALRSFSEMIKSGIEPNLVTLYSVLSSCG 314 Query: 68 HSSTLNDGKLIHFYILMNNFE...VVVMSCLKACS 69 ++ +F RRD VTW A+I GYA HG E A+ LF+ M+ EN+ + V +S L+AC+ Sbjct: 656 DSRLMFEKSLRRDFVTWNAMICGYAHHGKGEEAIQLFERMILEN...ELEKMHNKRLQEMCVSWNSIISGYVMKEQSEDAQMLFTRMME 596 Query: 122 ENVDTDGVVVMSCLKACSHSSTLNDGKLIHFYILMNNFE ...FCEADT-NVITWNAMIASYVHCEQSEKAIALFDRMVSENFKPSSITLVTLLMAC 543 Query: 71 SHSSTLNDGKLIHFYILMNNFEL 3 ++ +L G++

  9. Induction Motor Control through AC/DC/AC Converters

    Elfadili, Abderrahim; Giri, Fouad; Ouadi, Hamid; El Magri, Abdelmounime; Dugard, Luc; Abouloifa, Abdelmajid

    2010-01-01

    We consider the problem of controlling inductions motors driven through AC/DC rectifiers and DC/AC inverters. The control objectives are threefold: (i) forcing the motor speed to track a reference signal, (ii) regulating the DC Link voltage, (iii) assuring a satisfactory power factor correction (PFC) with respect to the power supply net. First, a nonlinear model of the whole controlled system is developed in the Park-coordinates. Then, a nonlinear multi-loop controller is synthesized using th...

  10. AC drives for industrial plants. Plant kudoyo AC drive sochi

    Miyazaki, M.; Shibata, M.; Yamada, S. (Toshiba Corp., Tokyo (Japan))

    1992-08-01

    Features and product series of AC drives for industrial plants were outlined. Configurations and features of various types of AC drives were briefly discussed which are put into market to meet various requirements for industrial plants and wide ranges of output voltage and capacity. The following product series were outlined; the power bipolar transistor inverter for 3.5-600 kVA in output capacity, IGBT inverter for AC 400 V in output voltage and 1,000 kVA or less, GTO inverter for AC 600 V and 700-2,000 kVA, and cycloconverter for AC 1,000-3,000 V and 1,000 kW-20 MW. The following subjects were outlined as current technical trends of AC drives for industrial plants; increasing in capacity of voltage-source PWM inverters, downsizing of converters through highly efficient cooling and highly dense mounting, spreading of sensorless vector controls, and development of high-voltage large-capacity PWM inverters. 6 figs., 2 tabs.

  11. High Energy Single Frequency Resonant Amplifier Project

    National Aeronautics and Space Administration — This SBIR phase I project proposes a single frequency high energy resonant amplifier for remote sensing. Current state-of-art technologies can not provide all...

  12. Noise in phase-preserving linear amplifiers

    Pandey, Shashank; Jiang, Zhang; Combes, Joshua; Caves, Carlton M.

    2014-12-01

    The purpose of a phase-preserving linear amplifier is to make a small signal larger, so that it can be perceived by instruments incapable of resolving the original signal, while sacrificing as little as possible in signal-to-noise. Quantum mechanics limits how well this can be done: the noise added by the amplifier, referred to the input, must be at least half a quantum at the operating frequency. This well-known quantum limit only constrains the second moments of the added noise. Here we provide the quantum constraints on the entire distribution of added noise: any phasepreserving linear amplifier is equivalent to a parametric amplifier with a physical state σ for the ancillary mode; σ determines the properties of the added noise.

  13. Cryogenic Amplifier Based Receivers at Submillimeter Wavelengths

    Chattopadhyay, Goutam; Reck, Theodore and; Schlecht, Erich; Lin, Robert; Deal, William

    2012-01-01

    The operating frequency of InP high electron mobility transistor (HEMT) based amplifiers has moved well in the submillimeter-wave frequencies over the last couple of years. Working amplifiers with usable gain in waveguide packages has been reported beyond 700 GHz. When cooled cryogenically, they have shown substantial improvement in their noise temperature. This has opened up the real possibility of cryogenic amplifier based heterodyne receivers at submillimeter wavelengths for ground-based, air-borne, and space-based instruments for astrophysics, planetary, and Earth science applications. This paper provides an overview of the science applications at submillimeter wavelengths that will benefit from this technology. It also describes the current state of the InP HEMT based cryogenic amplifier receivers at submillimeter wavelengths.

  14. Noise in phase-preserving linear amplifiers

    Pandey, Shashank; Jiang, Zhang; Combes, Joshua [Center for Quantum Information and Control, University of New Mexico, Albuquerque, NM 87131-0001 (United States); Caves, Carlton M. [Center for Quantum Information and Control, University of New Mexico, Albuquerque, NM 87131-0001, USA and Centre for Engineered Quantum Systems, School of Mathematics and Physics, University of Queensland, Brisbane, QLD 4072 (Australia)

    2014-12-04

    The purpose of a phase-preserving linear amplifier is to make a small signal larger, so that it can be perceived by instruments incapable of resolving the original signal, while sacrificing as little as possible in signal-to-noise. Quantum mechanics limits how well this can be done: the noise added by the amplifier, referred to the input, must be at least half a quantum at the operating frequency. This well-known quantum limit only constrains the second moments of the added noise. Here we provide the quantum constraints on the entire distribution of added noise: any phasepreserving linear amplifier is equivalent to a parametric amplifier with a physical state σ for the ancillary mode; σ determines the properties of the added noise.

  15. Quantum cloning with an optical fiber amplifier

    Fasel, Sylvain; Gisin, Nicolas; Ribordy, Grégoire; Scarani, Valerio; Zbinden, Hugo

    2002-01-01

    It has been shown theoretically that a light amplifier working on the physical principle of stimulated emission should achieve optimal quantum cloning of the polarization state of light. We demonstrate close-to-optimal universal quantum cloning of polarization in a standard fiber amplifier for telecom wavelengths. For cloning 1 --> 2 we find a fidelity of 0.82, the optimal value being 5/6 = 0.83.

  16. V-band IMPATT power amplifier

    Schell, S. W.

    1985-09-01

    This program is the result of the continuing demand and future requirement for a high data rate 60-GHz communications link. A reliable solid-state transmitter which delivers the necessary power over a wide bandwidth using the present IMPATT diode technology required the development of combining techniques. The development of a 60-GHz IMPATT power combiner amplifier is detailed. The results form a basis from which future wideband, high-power IMPATT amplifiers may be developed. As a result, several state-of-the-art advancements in millimeter-wave components technology were achieved. Specific achievements for the amplifier integration were: development of a nonresonant divider/combiner circuit; reproducible multiple junction circulator assemblies; and reliable high power 60-GHz IMPATT diodes. The various design approaches and tradeoffs which lead to the final amplifier configuration are discussed. A detailed circuit design is presented for the various amplifier components, and the conical line combiner, radial line combiner, and circulator development are discussed. The performance of the amplifier, the overall achievement of the program, the implications of the results, and an assessment of future development needs and recommendations are examined.

  17. Multiple excitation regenerative amplifier inertial confinement system

    The invention relates to apparatus and methods for producing high intensity laser radiation generation which is achieved through an optical amplifier-storage ring design. One or two synchronized, counterpropagating laser pulses are injected into a regenerative amplifier cavity and amplified by gain media which are pumped repetitively by electrical or optical means. The gain media excitation pulses are tailored to efficiently amplify the laser pulses during each transit. After the laser pulses have been amplified to the desired intensity level, they are either switched out of the cavity by some switch means, as for example an electro-optical device, for any well known laser end uses, or a target means may be injected into the regenerative amplifier cavity in such a way as to intercept simultaneously the counterpropagating laser pulses. One such well known end uses to which this invention is intended is for production of high density and temperature plasmas suitable for generating neutrons, ions and x-rays and for studying matter heated by high intensity laser radiation

  18. A low-noise instrumentation amplifier with DC suppression for recording ENG signals.

    Paraskevopoulou, Sivylla E; Eftekhar, Amir; Kulasekeram, Nishanth; Toumazou, Christofer

    2015-08-01

    This paper presents an AC-coupled instrumentation amplifier for electroneurogram (ENG) activity recording. For this design, we evaluate gain and noise requirements based on interference sources (electrodes, power line, EMG). The circuit has been implemented in a commercially-available 0.35μm CMOS technology with total power consumption 460μW. The amplifier achieves CMRR 107 dB and integrated input referred noise 940 nV. The gain is 63 dB and the bandwidth is 0.5 Hz- 13 kHz. The chosen topology enables to minimise on-chip capacitance (only 27 pF), with a total chip area of 0.4mm2. PMID:26736847

  19. The OPTHER Project: Progress toward the THz Amplifier

    Paoloni, C; Brunetti, F; Di Carlo, A;

    2011-01-01

    This paper describes the status of the OPTHER (OPtically driven TeraHertz AmplifiERs) project and progress toward the THz amplifier realization. This project represents a considerable advancement in the field of high frequency amplification. The design and realization of a THz amplifier within th...

  20. Pulsed ti: sapphire laser power amplifier

    We have demonstrated an all solid state Ti:Sapphire laser system consisting of a power oscillator and single pass amplifier. The electrical-to-optical efficiency far exceeds that of the current CW systems. The pump lasers have lower capital and operating costs than the Argon-ion laser. In the future, we plan to scale the output power to higher levels by adding a fourth pump laser and improving the output power of the current pump lasers. Modeling results suggest that a large increase in efficiency can be realized by improving the beam quality of the pump lasers, even at the cost of reduced output power. We will explore this option by adding apertures to the cavity and/or reducing the rod diameter along with optimizing the resonator design. Other improvements in efficiency which will be investigated include double passing the amplifier for better extraction. To complete this work, the laser system will be converted into a two-stage amplifier. A narrow band, lower power oscillator currently under development will be injected in to the amplifier to study the extraction and efficiency characteristics of the amplifier throughout the tuning range of Ti:Sapphire. Detailed beam quality measurements will also be made. Other work will include doubling the narrow band output for materials processing applications

  1. AcEST: BP915640 [AcEST

    Full Text Available YMU001_000074_A01 462 Adiantum capillus-veneris mRNA. clone: YMU001_000074_A01. BP915640 CL3685C ... y: 462 GPLILRACLVYMQGAPVGSLAEDGIVSAATGKDMEQSTVGFRLMLAKI IHRLIAAFKEVG 283 G IL+AC YM+G +GSL +D V ++VGF+LMLAK ... : 1032 GYYILKACDAYMKGYLIGSLTKDASVIDERSS-ANSTSVGFKLMLAKI APKLFSALSEVG 1090 Query: 282 AYCDAYE 262 A C+ ++ Sb ... uery: 453 ILRACLVYMQGAPVGSLAEDGIVSAATGKDMEQSTVGFRLMLAKI IHRLIAAFKEVGAYC 274 +L AC YM+G PVGS A G ST GF++ML+K ... ame = -1 Query: 423 GAPVGSLAEDGIVSAATGKDMEQSTVGFRLMLAKI I----HRLIAAFKEVGAYCD 271 G P+ L D +S GK + S RL + L+ ...

  2. AcEST: DK955197 [AcEST

    Full Text Available TST39A01NGRL0022_H07 532 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0022_H07. 5' end seq ... KDEVTALPLLK 192 Query: 194 RFAFGIACELLMSRYEKEEQEMLEEPF TTMMKGILQLPIKLPGTRFSKAIVAANMLRARF 373 R+ F +AC+L S ... KDEVMALPLLK 192 Query: 194 RFAFGIACELLMSRYEKEEQEMLEEPF TTMMKGILQLPIKLPGTRFSKAIVAANMLRARF 373 R+ F +AC+L S ... KDEVKVLP 189 Query: 185 LMKRFAFGIACELLMSRYEKEEQEMLEEPF TTMMKGILQLPIKLPGTRFSKAIVAANMLR 364 L++ F IA L + +Q+ ... KDEATVLP 177 Query: 185 LMKRFAFGIACELLMSRYEKEEQEMLEEPF TTMMKGILQLPIKLPGTRFSKAIVAANMLR 364 L+K F +A L E+ QE ...

  3. Speed Control of DC Motor using AC/AC/DC Converter Based on Intelligent Techniques

    Rakan Kh Antar

    2013-05-01

    Full Text Available    This paper describes the application of ac/ac/dc and ac/dc converters to control the speed of a separately excited DC motor. Artificial neural network and PI controller are trained to select the desired values of firing angles for triggering thyristors of the ac/ac/dc and ac/dc bridge converters in order to control the speed of the dc motor at a desired value with constant and different load torques in order to obtain the best speed response. Simulation results show that the rising time for ac/dc and ac/ac/dc converters at 250rpm are reduced about 79% and 89% respectively, while delay time it reduced about 69% and 64% respectively. Therefore, speed response of the dc motor is more efficient for closed loop system compared with open loop also the response of ac/ac/dc converter is better than ac/dc converter.

  4. Single mode terahertz quantum cascade amplifier

    Ren, Y., E-mail: yr235@cam.ac.uk; Wallis, R.; Shah, Y. D.; Jessop, D. S.; Degl' Innocenti, R.; Klimont, A.; Kamboj, V.; Beere, H. E.; Ritchie, D. A. [Cavendish Laboratory, University of Cambridge, JJ Thomson Avenue, CB3 0HE Cambridge (United Kingdom)

    2014-10-06

    A terahertz (THz) optical amplifier based on a 2.9 THz quantum cascade laser (QCL) structure has been demonstrated. By depositing an antireflective coating on the QCL facet, the laser mirror losses are enhanced to fully suppress the lasing action, creating a THz quantum cascade (QC) amplifier. Terahertz radiation amplification has been obtained, by coupling a separate multi-mode THz QCL of the same active region design to the QC amplifier. A bare cavity gain is achieved and shows excellent agreement with the lasing spectrum from the original QCL without the antireflective coating. Furthermore, a maximum optical gain of ∼30 dB with single-mode radiation output is demonstrated.

  5. Ultrashort pulse amplification in cryogenically cooled amplifiers

    Backus, Sterling J.; Kapteyn, Henry C.; Murnane, Margaret Mary

    2004-10-12

    A laser amplifier system amplifies pulses in a single "stage" from .about.10.sup.-9 joules to more than 10.sup.-3 joules, with average power of 1-10 watts, and beam quality M.sup.2 <2. The laser medium is cooled substantially below room temperature, as a means to improve the optical and thermal characteristics of the medium. This is done with the medium inside a sealed, evacuated or purged cell to avoid moisture or other materials condensing on the surface. A "seed" pulse from a separate laser is passed through the laser medium, one or more times, in any of a variety of configurations including single-pass, multiple-pass, and regenerative amplifier configurations.

  6. Transistorized pulse amplifiers (A.I.T.)

    The two amplifiers whose design and operation are described in this report have been studied for neutron detection units used in piles. They are designed to allow an important reduction of the volume and of the weight of the detector and its amplifier, and to simplify the operation of the detection assembly. To these characteristics can be added the mechanical and electrical robustness and the very reduced micro-phony. The first transistorized amplifier (AIT.1) is simple, very robust, and can be used for radioprotection installations. The second (AIT.4) has a better performance and makes it possible to replace the APT.2 in most of its applications (it has even been used satisfactorily in an apparatus where the micro-phony and the sensitivity to interference of the APT.2 made this latter unusable). (author)

  7. An automated test facility for neutronic amplifiers

    Neutronic amplifiers are used at the Chalk River Laboratory in applications such as neutron flux monitoring and reactor control systems. Routine preventive maintenance of control and safety systems included annual calibration and characterization of the neutronic amplifiers. An investigation into the traditional methods of annual routine maintenance of amplifiers concluded that frequency and phase response measurements in particular were labour intensive and subject to non-repeatable errors. A decision was made to upgrade testing methods and facilities by using programmable test equipment under the control of a computer. In order to verify the results of the routine measurements, expressions for the transfer functions were derived from the circuit diagrams. Frequency and phase responses were then calculated and plotted thus providing a bench-mark to which the test results can be compared. (author)

  8. Cryogenic cooling for high power laser amplifiers

    Perin J.P.; Millet F.; Divoky M.; Rus B.

    2013-01-01

    Using DPSSL (Diode Pumped Solid State Lasers) as pumping technology, PW-class lasers with enhanced repetition rates are developed. Each of the Yb YAG amplifiers will be diode-pumped at a wavelength of 940 nm. This is a prerequisite for achieving high repetition rates (light amplification duration 1 millisecond and repetition rate 10 Hz). The efficiency of DPSSL is inversely proportional to the temperature, for this reason the slab amplifier have to be cooled at a temperature in the range of 1...

  9. Transportable setup for amplifier phase fidelity measurements

    Tröbs, M.; Bogan, C.; Barke, S.; Kühn, G.; Reiche, J.; Heinzel, G.; Danzmann, K.

    2015-05-01

    One possible laser source for the Laser Interferometer Space Antenna (LISA) consists of an Ytterbium-doped fiber amplifier originally developed for inter-satellite communication, seeded by the laser used for the technology demonstrator mission LISA Pathfinder. LISA needs to transmit clock information between its three spacecraft to correct for phase noise between the clocks on the individual spacecraft. For this purpose phase modulation sidebands at GHz frequencies will be imprinted on the laser beams between spacecraft. Differential phase noise between the carrier and a sideband introduced within the optical chain must be very low. We report on a transportable setup to measure the phase fidelity of optical amplifiers.

  10. Beyond nonlinear saturation of backward Raman amplifiers

    Barth, Ido; Toroker, Zeev; Balakin, Alexey A.; Fisch, Nathaniel J.

    2016-06-01

    Backward Raman amplification is limited by relativistic nonlinear dephasing resulting in saturation of the leading spike of the amplified pulse. Pump detuning is employed to mitigate the relativistic phase mismatch and to overcome the associated saturation. The amplified pulse can then be reshaped into a monospike pulse with little precursory power ahead of it, with the maximum intensity increasing by a factor of two. This detuning can be employed advantageously both in regimes where the group velocity dispersion is unimportant and where the dispersion is important but small.

  11. Operational amplifier circuits analysis and design

    Nelson, J C C

    1995-01-01

    This book, a revised and updated version of the author's Basic Operational Amplifiers (Butterworths 1986), enables the non-specialist to make effective use of readily available integrated circuit operational amplifiers for a range of applications, including instrumentation, signal generation and processing.It is assumed the reader has a background in the basic techniques of circuit analysis, particularly the use of j notation for reactive circuits, with a corresponding level of mathematical ability. The underlying theory is explained with sufficient but not excessive, detail. A range of compu

  12. Optimization of Pr3+:ZBLAN fiber amplifiers

    Pedersen, B.; Miniscalco, J. W.; Quimby, R. S.

    1992-01-01

    Experimental parameters have been measured and used in a quantitative model of Pr3+-doped fluorozirconate fiber amplifiers. The optimum cutoff wavelength was determined to be 800 nm and the gain for 400 mW of pump was found to increase from 12 to 34 dB if the NA was increased from 0.15 to 0.......25. Lengthening the metastable state lifetime from 110 to 300 μs would significantly improve amplifier performance while concentration quenching can appreciably degrade it...

  13. Nuclear structure of $^{231}$Ac

    Boutami, R; Mach, H; Kurcewicz, W; Fraile, L M; Gulda, K; Aas, A J; García-Raffi, L M; Løvhøiden, G; Martínez, T; Rubio, B; Taín, J L; Tengblad, O

    2008-01-01

    The low-energy structure of 231Ac has been investigated by means of gamma ray spectroscopy following the beta-decay of 231Ra. Multipolarities of 28 transitions have been established by measuring conversion electrons with a mini-orange electron spectrometer. The decay scheme of 231Ra --> 231Ac has been constructed for the first time. The Advanced Time Delayed beta-gamma-gamma(t) method has been used to measure the half-lives of five levels. The moderately fast B(E1) transition rates derived suggest that the octupole effects, albeit weak, are still present in this exotic nucleus.

  14. AcEST: BP920800 [AcEST

    Full Text Available DLNLALQVHSRMVRFGFNAEVEACGALINMYGKCGKVLYAQRVFDDT 298 Query: 206 RQQDVISWNDIISACAQRGHGTEALENFSQMLHEGIVPNSMTFTSVMQA---CNSIEGG...G L +A S F ++ +D+ISW +I +Q EA+ F Sbjct: 217 SEKNEATSNCLINGYMGLGNLEQAESLFNQMPVKDIISWTTMIKGYSQNKRYREAIAVFY 276 Query: 119 QMLHEG...EKAWRIFDGVSCKNLPSWNAIITGCVQGGLLEEAIDLYRHMK 281 Query: 110 HEGIVPNSMTFTSVMQAC---NSIEGGR 36 + + PN +T +V+ AC +...N IIS AQ G +EA+E ++ M Sbjct: 383 DITIGNAVVVMYAKLGLVDSARAVFNWLPNTDVISWNTIISGYAQNGFASEAIEMYNIME 442 Query: 110 HEG...EIDLGEQIHSLSVKTGFESDMYVSGVLIDMYSKYGWLEKARRVLEML 406 Query: 206 RQQDVISWNDIISACAQRGHGTEALENFSQMLHEGIVPNSMTFTSVMQACNSIEGG

  15. AcEST: DK945549 [AcEST

    Full Text Available AGGCGATTTCATCTTTTCTGAGAACCCTGATTTTGTGATTGTGTAATTACA ACTGTGGAACAGAAGGATGAGAAGTCTACTGACACAACAAGATATCTCTGGAGAGGAGA...A AATTGAGAAGGTTTGAGTTCTCAACAATGGGCTATGAGGCAATAATGGGAAGGCACCGAT TGTGGGCTTGTATAGGTTTTGAC...LCTG 239 L++R+LRR + + ++ G AC+ DP +P PLC+G Sbjct: 108 LQQRELRRKLLADSGALNTNSVNGPRNWKACVQQDPSSRPGTPLCSG 154 >sp|A6UUY8|RNZ_META3...49 Tissue type young leaves Developmental stage sporophyte Contig ID CL454Contig1 Sequence GATGAGCGA...CCACCTGTGCAACCGTCAGCGCCTTTGTGCACTGGTG CAATGTCCTGTGGTTACCTTGTTTGGAATCTTAATTGTTCTCATGTAT

  16. AcEST: BP917632 [AcEST

    Full Text Available YMU001_000103_D10 554 Adiantum capillus-veneris mRNA. clone: YMU001_000103_D10. BP917632 - Show ... YSKCKIHQKALELLVLML 154 Query: 466 KDSLEPDEVTYLNVLKACARE EDLKV 543 +D++ P+ TY +VL++C D+++ Sbjct: 155 RDNVRPN ... 185 Query: 415 GHSDSS--KEALKLLTQMRKDSLEPDEVTYLNVLKACARE EDLK 540 + EA KL +M+ ++ PDE+ N++ AC R +++ Sbjct: 18 ...

  17. AcEST: DK961189 [AcEST

    Full Text Available OS=A... 127 7e-29 sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS... 125 2e-28 sp|P00785|AC...IRNSWGLNWGDSGYVKLQRNIDDPFGKCGIAMMPSYP 347 >sp|Q94B08|GCP1_ARATH Germination-specific cysteine protease 1 OS=

  18. AcEST: DK946687 [AcEST

    Full Text Available YMU02A01NGRL0013_G11 544 Adiantum capillus-veneris mRNA. clone: YMU02A01NGRL0013_G11. 5' end seq ... + G P+ TY+ + AC+ E Sbjct: 97 YSFNYMIRGLTNTWN-------DHEA ---ALSLYRRMKFSGLKPDKFTYNFVFIACAKLE 146 Query: 214 A ... Sbjct: 71 LIPKAVELGDFNYSSFLFSVTEEPNHYSFNYMIRGLTNTWNDHEA ALSLYRRMKFSGLKP 130 Query: 469 DGATFSCVLRACGNVGALDV ...

  19. AcEST: DK949372 [AcEST

    Full Text Available TST38A01NGRL0005_N02 627 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0005_N02. 5' end seq ... 363 DQLREKTC-GVDKFDDIVMACXXXXXXXXXXXXXXXXXXKARVHAYGVCD DPEYFYDYVQ 539 Q++EK G+ FDDIV+AC KA+VHA+ VCD DP+YFYD ... 264 QQVQEKKVPGITFFDDIVVACGSGGSIAGLSLGSYLSNLKAKVHAFAVCD DPDYFYDYTQ 323 Query: 540 GLLDGMNANIASRDIVNVIDAKGLG ...

  20. Predistortion of a Bidirectional Cuk Audio Amplifier

    Birch, Thomas Hagen; Nielsen, Dennis; Knott, Arnold;

    2014-01-01

    using predistortion. This paper suggests linearizing a nonlinear bidirectional Cuk audio amplifier using an analog predistortion approach. A prototype power stage was built and results show that a voltage gain of up to 9 dB and reduction in THD from 6% down to 3% was obtainable using this approach....

  1. Ultra-low Voltage CMOS Cascode Amplifier

    Lehmann, Torsten; Cassia, Marco

    In this paper, we design a folded cascode operational transconductance amplifier in a standard CMOS process, which has a measured 69 dB DC gain, a 2 MHz bandwidth and compatible input- and output voltage levels at a 1 V power supply. This is done by a novel Current Driven Bulk (CDB) technique...

  2. Compensation techniques for operational amplifier bias current

    Two techniques are proposed for the compensation of the input current on operational amplifiers that can be used on inverting and non-inverting configurations. A qualitative analysis of temperature drift problems is made, and as a practical application, the construction of a voltage follower for high impedance measurements is presented. (Author)

  3. Stereoscopy Amplifies Emotions Elicited by Facial Expressions.

    Hakala, Jussi; Kätsyri, Jari; Häkkinen, Jukka

    2015-12-01

    Mediated facial expressions do not elicit emotions as strongly as real-life facial expressions, possibly due to the low fidelity of pictorial presentations in typical mediation technologies. In the present study, we investigated the extent to which stereoscopy amplifies emotions elicited by images of neutral, angry, and happy facial expressions. The emotional self-reports of positive and negative valence (which were evaluated separately) and arousal of 40 participants were recorded. The magnitude of perceived depth in the stereoscopic images was manipulated by varying the camera base at 15, 40, 65, 90, and 115 mm. The analyses controlled for participants' gender, gender match, emotional empathy, and trait alexithymia. The results indicated that stereoscopy significantly amplified the negative valence and arousal elicited by angry expressions at the most natural (65 mm) camera base, whereas stereoscopy amplified the positive valence elicited by happy expressions in both the narrowed and most natural (15-65 mm) base conditions. Overall, the results indicate that stereoscopy amplifies the emotions elicited by mediated emotional facial expressions when the depth geometry is close to natural. The findings highlight the sensitivity of the visual system to depth and its effect on emotions. PMID:27551358

  4. Apuntes de Acústica

    Martín Domingo, Agustín

    2014-01-01

    Esta publicacion contiene unos apuntes para la parte de Acústica de las asignaturas de la ETSAM, junto con cierta cantidad de material adicional que excede el ámbito del curso. Aunque está lejos de ser completa y de estar libre de errores, el autor espera sea útil.

  5. SSTI Clark ACS Technology Demonstrations

    Freesland, Douglas

    1997-01-01

    SSTI Clark, one of two spacecraft built under NASA's Small Satellite Technology Initiative, includes seven ACS technology demonstrations. The technologies redefine the performance cost envelope, providing improved sensor and actuator performance at reduced costs. Six sensing technologies are being flown consisting of both hardware and algorithmic demonstrations: autonomous star tracker, hemispherical resonating gyro, GPS attitude determination, miniature horizon sensors, low cost course sun s...

  6. Energy saving in ac generators

    Nola, F. J.

    1980-01-01

    Circuit cuts no-load losses, without sacrificing full-load power. Phase-contro circuit includes gate-controlled semiconductor switch that cuts off applied voltage for most of ac cycle if generator idling. Switch "on" time increases when generator is in operation.

  7. Tunable microstrip SQUID amplifiers for the Gen 2 Axion Dark Matter eXperiment (ADMX)

    O'Kelley, Sean; Hilton, Gene; Clarke, John; ADMX Collaboration

    2016-03-01

    We present a series of tunable microstrip SQUID (Superconducting Quantum Interference Device) amplifiers (MSAs) for installation in ADMX. The axion dark matter candidate is detected via Primakoff conversion to a microwave photon in a high-Q (~100,000) tunable microwave cavity cooled with a dilution refrigerator in a 7-tesla magnetic field. The microwave photon frequency ν is a function of the unknown axion mass, so both the cavity and amplifier must be scanned over a wide frequency range. An MSA is a linear, phase-preserving amplifier consisting of a square washer loop, fabricated from a thin Nb film, incorporating two Josephson tunnel junctions with resistive shunts to prevent hysteresis. The input is coupled via a microstrip made from a square Nb coil deposited over the washer with an intervening insulating layer. Tunability is achieved by terminating the microstrip with GaAs varactors that operate below 100 mK. By varying the varactor capacitance with a bias voltage, the resonant frequency is varied by up to a factor of 2. We demonstrate several devices operating below 100 mK, matched to the discrete operating bands of ADMX at frequencies ranging from 560 MHz to 1 GHz. The MSAs exhibit gains exceeding 20 dB and the associated noise temperatures, measured with a hot/cold load, approach the standard quantum limit (hν/kB) . Supported by DOE Grants DE - FG02 - 97ER41029, DE - FG02 - 96ER40956, DE - AC52 - 07NA27344, DE - AC03 - 76SF00098, and the Livermore LDRD program.

  8. AcEST: DK950895 [AcEST

    Full Text Available |A7SFA3|A7SFA3_NEMVE Predicted protein OS=Nematostella vectens... 210 5e-53 tr|Q0CVA9|Q0CVA9_ASPTN ATP-citrate synthase subunit...stX Result : Swiss-Prot sp_hit_id Q54YA0 Definition sp|Q54YA0|ACLY_DICDI Probable ATP-citrate synthase OS=Dictyos...PIDYSWAQELGLIRKPAAFISTI 404 >sp|Q8X097|ACL1_NEUCR Probable ATP-citrate synthase subunit 1 OS=Neurospora cras...IRKPASFMTSI 844 >sp|Q9P7W3|ACL1_SCHPO Probable ATP-citrate synthase subunit 1 OS=Schizosaccharomyces pombe G....done Score E Sequences producing significant alignments: (bits) Value sp|Q54YA0|ACLY_DICDI Probable ATP-citrate synthase OS=Dictyos

  9. Investigation of the amplified spontaneous emission in Nd: glass disk laser amplifier

    A model program has been established to investigate the amplified spontaneous emission (ASE) in the Nd: glass disk amplifier with the Monte Carlo method and rays tracing. The distribution of ASE loading on the edge of a disk is firstly calculated. The effect of disk aspect radio on ASE gain reduction is also investigated. Allowance is made for the effect of different reflectivity under the condition of different incidence on two faces

  10. Class D audio amplifier with 4th order output filter and self-oscillating full-state hysteresis based feedback driving capacitive transducers

    Nielsen, Dennis; Knott, Arnold; Andersen, Michael A. E.

    2014-01-01

    A practical solution is presented for the design of a non-isolated high voltage DC/AC power converter. The converter is intended to be used as a class D audio amplifier for a Dielectric Electro Active Polymer (DEAP) transducer. A simple and effective hysteretic control scheme for the converter (b...... (buck with fourth- order output filter) is developed and analyzed. The proposed design is verified experimentally by a 125 VAR prototype amplifier, capable of delivering a peak output voltage of 240 V within the frequency range of 100 Hz – 3.5 kHz. A peak efficiency of 87 % is reported....

  11. AcEST: BP914304 [AcEST

    Full Text Available IDEHTFVFTLRAC 4 V+ NA++ Y G+ E A++ + +M+ E++ + TF+ LRAC Sbjct: 670 VTWNAMICGYAHHGKGEEAIQLFERMILENIKPNHVTFISI...KSLRRDFVTWNAMICGYAHHGKGEEAIQLFERMILENIKPN 703 Query: 339 NLTYVSLFKACGNVLDFGQG-RTIHGEARANGFSSDRFICTTLI...TFVFTLRAC 4 +F + + V+ N ++ +YV A +++M + D TL+AC Sbjct: 484 QIFERMCDRDNVTWNTIIGSYVQDENESEAFDLFKRMNLCGIVSDGACL...K + A+Q+ + R + +W++MI++ +A + ++ M Sbjct: 93 LGNSLINFYSKFEDVASAEQVFRRMTLRDVVTWSSMIAAYAGNNHPAKAFDTFERMTDAN 152... + R + +W++MI++ +A + ++ M Sbjct: 93 LGNSLINFYSKFEDVASAEQVFRRMTLRDVVTWSSMIAAYAGNNHPAKAFDTFERM

  12. AcEST: BP911793 [AcEST

    Full Text Available + +VSWN +++ Y QHG + ++L+ M+AE T N + + A Sbjct: 58 EAKFVFERIQNKDVVSWNCIINGYSQHGPSGSSHVMELFQRMRAENTAPNAHTFAGVF... N + + A Sbjct: 58 EAKFVFERIQNKDVVSWNCIINGYSQHGPSGSSHVMELFQRMRAENTAPNAHTFAGVFTA 117 Query: 359 CIQTGNLELCKQM...D VT S+LSACSH G + +G YF Sbjct: 602 IIGGSAQHGRGQDALQLFERMKMEGVKPDIVTFVSLLSACSHAGLLEEGRRYF 654 Score = 115 bit...53 QTGNLELCKQMHFNIVSAGNELNPSLASSLIRTYGNCGSMLDAHAVFDSLPLPDIVSWNV 174 Q +E+ K++ F+++ N S +++I Y CG + +A +FD +P D VSW Sbjct: 324 QGERME... L+ M +E + I+LV +L AC+ TG+LE + +H Sbjct: 498 VITWNAMIASYVHCEQSEKAIALFDRMVSENFKPSSITLVTLLMACVNTGSLER

  13. AcEST: BP921649 [AcEST

    Full Text Available 40 + ++LV YAK L + ++ +P R W+ +I+ + + ++E AL+ + M+ G Sbjct: 144 VASSLVGMYAKFNLFENSLQVFDEMPERDVASWNTVISCFYQSGEAEKALELFGRME...LDCYKEM 52 ++L +GNALVD YAKCG L A ++ +R+ R V W+ +I Y + E A D +K M Sbjct: 461 KNLFVGNALVDMYAKCGALEDARQIFERMCDRDNVTWNTIIGSYVQDEN...RD+ WNA+I Sbjct: 237 LEQGKQIHCYAIRSG-IESDVLVVNGLVNMYAKCGNVNTAHKLFERMPIRDVASWNAIIG 295 Query: 411 GYVNHGRAEVALDCFGKME...SNDVV-GNALVNMYAKCGNVNSAYKLFERMPKKNVVAWNAIIS 396 Query: 411 GYVNHGRAEVALDCFGKME... HGR + AL F +M+ EG PD +TF +L AC G + + + + Sbjct: 603 IGGSAQHGRGQDALQLFERMKMEGVKPDIVTFVSLLSACSHAGLLEEGRRYFCSM

  14. AcEST: BP919669 [AcEST

    Full Text Available D + RDV SW ++S + + G+ ++F M G +P+ Sbjct: 148 LVGMYAKFNLFENSLQVFDEMPERDVASWNTVISCFYQSGEAEKALELFGRMESSGFEPN 20...+ +++AC L + +G+E+H + K+G EL V Sbjct: 190 EKALELFGRMESSGFEPNSVSLTVAISACSRLLWLERGKE...F Sbjct: 468 IY---VVNSLIDSYGKCSHVEDAERIFEECTIGDLVSFTSMITAYAQYGQGEEALKLFLE 524 Query: 226 MVGEGTKPDSISLLVVLRA-YNF...+ IR DV W +LMSGY+K D ++F ++ Sbjct: 44 SLINVYFTCKDHCSARHVFENFDIRSDVYIWNSLMSGYSKNSMFHDTLEVFKRLLNCSIC 103 Query: 208 KPDSISLLVVLRAYNF...KPD Sbjct: 261 VDMYAKCGCIETAVEVFEKLTRRNVFSWAALIGGYAAYGYAKKATTCLDRIEREDGIKPD 320 Query: 199 SISLLVVLRAYNFLGFP

  15. AcEST: DK957916 [AcEST

    Full Text Available PQKQPVPAVSHSPQKSSTPPTPAATKPKEEPSVPKEVPKLQQGKLEKT 967 Query: 577 --TTEASQGIPVEEG...G E+ P+ P Sbjct: 1974 QEQGRAPSQDQEAPSPEALPSPGQEPAAGASPRRGELRRGSSAESALPRAGP 2025 >sp|Q05175|BASP_RAT Brain ac... +P AP P Sbjct: 388 ERETAASAGPQG----AFPEPRPAQPSAGPEPRPAQPSAGPEPRPAQPSAAPEPRP---- 439 Query: 571 GQTTE... L ++ +A+ +E AP Sbjct: 406 IVTTPEPEGSGEEDVPKPDEIPEKEVTEEELIKVSTAAPAKASPEEEVVKATTLAPSEED 465 Query: 550 VSPYIASGQTTE... Query: 424 KGQAYEAIPDPHVDPAAGVHERLAQLQLGDEPEATKPKEAPG-VSPYI--ASGQTTEASQ 594 K A E P + + G E + E EA P A G +P

  16. AcEST: DK956923 [AcEST

    Full Text Available CCATAGTCTCAA CAGCGATAAGCAGGAAATGCATGCAGTGACCATGGGTAAGAAAAGGGTCATGGTGGGCGC CATTAACACGATACTTATCCTA...CTCCTCTTGCAGTTTATGAAGCAATGTTCTTCCTCTTC TAGTCATGATGATGATGGCGATGCCTTTGCGGATGACACTCTAAGCAGACGCAACGAT...AC GGTCGAGTCTGCTCCTCGACATTGGCCAAGGCGAATGCTGGGCAGCCAAGAACCTGCCTC CAACAAGACTTCATATGGTATTCCTGAT...H At1g73965 (CLE13 / CLAVATA3/ESR-Related 13) (CLE13) OS=Arabidopsis thaliana Align length 25 Sco...icant alignments: (bits) Value tr|Q6NMF0|Q6NMF0_ARATH At1g73965 (CLE13 / CLAVATA3/ESR-Related 1... 49 3e-04

  17. AcEST: BP921492 [AcEST

    Full Text Available + AL +G+ +H Sbjct: 286 DVASWNAIIGGYSLNSQHHEALAFFNRMQVRGIKPNSITMVSVLPACAHLFAL... ++ L +GK +H Sbjct: 178 NLVSWTAMVSGYAQGGFADEALRMFYEMQGEDVKANYVTVASVLPACAQLSDLQQGKEIH 237 Query: 153 AC...FDRMPEK 171 Query: 333 DVVSWSAMIAMYGQQGCGKEAFQLFQEMACEGGMPNRVTYVSILDACASVAALPEGKLVH 154 +V+W+++++ + Q G EA Q+F +M G P+ T+VS+L ACA...333 DVVSWSAMIAMYGQQGCGKEAFQLFQEMACE-GGMPNRVTYVSILDACASVAALPEGKLV 157 +V +W+AMI+ YG G G++A +LF +M + G +PN VT+V++L ACA...SKL 85 Query: 288 GCGKEAFQLFQEMACEGGMPNRVTYVSILDACASVAALPEGKLVHACFMESELELDVVVG 109 ++ M P+ T+ S++ +CA ++AL G

  18. Mutation of an aminopeptidase N gene is associated with Helicoverpa armigera resistance to Bacillus thuringiensis Cry1Ac toxin.

    Zhang, Shaoping; Cheng, Hongmei; Gao, Yulin; Wang, Guirong; Liang, Gemei; Wu, Kongming

    2009-07-01

    A Cry1Ac-resistant strain (Bt-R) of Helicoverpa armigera, with 2971-fold resistance, was derived by selection with Cry1Ac toxin for 75 generations. We used cDNA-amplified fragment length polymorphism analysis to identify those genes differentially expressed in the Cry1Ac-resistant and -susceptible strains, which revealed 212 differentially expressed transcripts among 2000 screened cDNAs. Among these transcript-derived fragments (TDFs), 37 showed some homology to known sequences, including Aminopeptidase N (APN), which is expressed in the midgut epithelium and has been implicated as a Cry1A subfamily receptor in several moths, including H. armigera. We confirmed the TDF by RT-PCR and identified a deletion mutation of apn1 in the Bt-R strain. We expressed the TDF in bacteria. The partial HaAPN1-96S wild-type protein, bound to Cry1Ac on ligand blots, whereas HaAPN1-BtR did not. This suggested that HaAPN1 is a receptor for Bt Cry1Ac and that its deletion mutation is associated with Cry1Ac resistance in H. armigera. The absence of one binding site is responsible for its resistance to Cry1Ac. We developed an allele-specific PCR to monitor whether the apn1 gene in an H. armigera field population produced a similar mutation. No deleted mutants were found in 2250 individuals collected from the field in 2006-2007. PMID:19376227

  19. Control of AC133/CD133 and impact on human hematopoietic progenitor cells through nucleolin.

    Bhatia, S; Reister, S; Mahotka, C; Meisel, R; Borkhardt, A; Grinstein, E

    2015-11-01

    AC133 is a prominent surface marker of CD34+ and CD34- hematopoietic stem/progenitor cell (HSPC) subsets. AC133+ HSPCs contain high progenitor cell activity and are capable of hematopoietic reconstitution. Furthermore, AC133 is used for prospective isolation of tumor-initiating cells in several hematological malignancies. Nucleolin is a multifunctional factor of growing and cancer cells, which is aberrantly active in certain hematological neoplasms, and serves as a candidate molecular target for cancer therapy. Nucleolin is involved in gene transcription and RNA metabolism and is prevalently expressed in HSPCs, as opposed to differentiated hematopoietic tissue. The present study dissects nucleolin-mediated activation of surface AC133 and its cognate gene CD133, via specific interaction of nucleolin with the tissue-dependent CD133 promoter P1, as a mechanism that crucially contributes to AC133 expression in CD34+ HSPCs. In mobilized peripheral blood (MPB)-derived HSPCs, nucleolin elevates colony-forming unit (CFU) frequencies and enriches granulocyte-macrophage CFUs. Furthermore, nucleolin amplifies long-term culture-initiating cells and also promotes long-term, cytokine-dependent maintenance of hematopoietic progenitor cells. Active β-catenin, active Akt and Bcl-2 levels in MPB-derived HSPCs are nucleolin-dependent, and effects of nucleolin on these cells partially rely on β-catenin activity. The study provides new insights into molecular network relevant to stem/progenitor cells in normal and malignant hematopoiesis. PMID:26183533

  20. Performance of AC/graphite capacitors at high weight ratios of AC/graphite

    Wang, Hongyu [IM and T Ltd., Advanced Research Center, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan); Yoshio, Masaki [Advanced Research Center, Department of Applied Chemistry, Saga University, 1341 Yoga-machi, Saga 840-0047 (Japan)

    2008-03-01

    The effect of negative to positive electrode materials' weight ratio on the electrochemical performance of both activated carbon (AC)/AC and AC/graphite capacitors has been investigated, especially in the terms of capacity and cycle-ability. The limited capacity charge mode has been proposed to improve the cycle performance of AC/graphite capacitors at high weight ratios of AC/graphite. (author)

  1. Plasmonic amplifier of the evanescent field of free electrons

    So, J.-K.; Ou, J.Y.; Adamo, G.; García de Abajo, F. J.; MacDonald, K. F.; Zheludev, N.I.

    2013-01-01

    We show experimentally for the first time that free electron evanescent fields can be amplified by a plasmonic nanolayer in much that same way as optical evanescent fields are amplified in the poor-man's super-lens.

  2. Simultaneous distribution of AC and DC power

    Polese, Luigi Gentile

    2015-09-15

    A system and method for the transport and distribution of both AC (alternating current) power and DC (direct current) power over wiring infrastructure normally used for distributing AC power only, for example, residential and/or commercial buildings' electrical wires is disclosed and taught. The system and method permits the combining of AC and DC power sources and the simultaneous distribution of the resulting power over the same wiring. At the utilization site a complementary device permits the separation of the DC power from the AC power and their reconstruction, for use in conventional AC-only and DC-only devices.

  3. Cryogenic cooling for high power laser amplifiers

    Perin J.P.

    2013-11-01

    Full Text Available Using DPSSL (Diode Pumped Solid State Lasers as pumping technology, PW-class lasers with enhanced repetition rates are developed. Each of the Yb YAG amplifiers will be diode-pumped at a wavelength of 940 nm. This is a prerequisite for achieving high repetition rates (light amplification duration 1 millisecond and repetition rate 10 Hz. The efficiency of DPSSL is inversely proportional to the temperature, for this reason the slab amplifier have to be cooled at a temperature in the range of 100 K–170 K with a heat flux of 1 MW*m−2. This paper describes the thermo-mechanical analysis for the design of the amplification laser head, presents a preliminary proposal for the required cryogenic cooling system and finally outlines the gain of cryogenic operation for the efficiency of high pulsed laser.

  4. High power single-frequency Innoslab amplifier.

    Han, Ke-Zhen; Ning, Jian; Zhang, Bai-Tao; Wang, Yi-Ran; Zhang, Hai-Kun; Nie, Hong-Kun; Sun, Xiao-Li; He, Jing-Liang

    2016-07-10

    A laser diode array (LDA) end-pumped continuous-wave single-frequency Innoslab amplifier has been demonstrated. The Gaussian ray bundle method was used to model the light propagation in the Innoslab amplifier for the first time to the best of our knowledge. With discrete reflectors, the maximum output of 60 W with a linewidth of 44 MHz was achieved under the pump power of 245 W, corresponding to the optical-optical efficiency of 24.5%. The beam quality factor M2 at the output power of 51 W in the horizontal and vertical direction was measured to be 1.4 and 1.3, respectively. The long-term power instability in 2 h was less than 0.25%. PMID:27409308

  5. Cryogenic cooling for high power laser amplifiers

    Using DPSSL (Diode Pumped Solid State Lasers) as pumping technology, PW-class lasers with enhanced repetition rates are developed. Each of the Yb YAG amplifiers will be diode-pumped at a wavelength of 940 nm. This is a prerequisite for achieving high repetition rates (light amplification duration 1 millisecond and repetition rate 10 Hz). The efficiency of DPSSL is inversely proportional to the temperature, for this reason the slab amplifier have to be cooled at a temperature in the range of 100 K-170 K with a heat flux of 1 MW*m-2. This paper describes the thermo-mechanical analysis for the design of the amplification laser head, presents a preliminary proposal for the required cryogenic cooling system and finally outlines the gain of cryogenic operation for the efficiency of high pulsed laser. (authors)

  6. Cryogenic cooling for high power laser amplifiers

    Perin, J. P.; Millet, F.; Divoky, M.; Rus, B.

    2013-11-01

    Using DPSSL (Diode Pumped Solid State Lasers) as pumping technology, PW-class lasers with enhanced repetition rates are developed. Each of the Yb YAG amplifiers will be diode-pumped at a wavelength of 940 nm. This is a prerequisite for achieving high repetition rates (light amplification duration 1 millisecond and repetition rate 10 Hz). The efficiency of DPSSL is inversely proportional to the temperature, for this reason the slab amplifier have to be cooled at a temperature in the range of 100 K-170 K with a heat flux of 1 MW*m-2. This paper describes the thermo-mechanical analysis for the design of the amplification laser head, presents a preliminary proposal for the required cryogenic cooling system and finally outlines the gain of cryogenic operation for the efficiency of high pulsed laser.

  7. Fundamentals of fiber lasers and fiber amplifiers

    Ter-Mikirtychev, Valerii (Vartan)

    2014-01-01

    This book covers the fundamental aspects of fiber lasers and fiber amplifiers, and includes a wide range of material from laser physics fundamentals to state-of-the-art topics in this rapidly growing field of quantum electronics. Emphasis is placed on the nonlinear processes taking place in fiber lasers and amplifiers, their similarities, differences to, and their advantages over other solid-state lasers. The reader will learn basic principles of solid-state physics and optical spectroscopy of laser active centers in fibers, main operational laser regimes, and practical recommendations and suggestions on fiber laser research, laser applications, and laser product development. The book will be useful for students, researchers, and professionals who work with lasers, in the optical communications, chemical and biological industries, etc.

  8. SINGLE CONVERSION ISOLATED IMPEDANCE TRANSFORMATION AMPLIFIER

    2003-01-01

    The invention relates to a switch mode power amplifier. A first and a second change-over switch are inserted between a DC voltage supply and a primary side of an isolation transformer. Two secondary windings are connected to a power output terminal. A first and a second secondary side power switch...... are adapted to connect the two secondary windings to the power connector of the power output terminal. The pulse width modulation means is adapted to generate control signals for the driver means of the first and the second change-over switch so as to cause every second pulse to be inverted. The pulse...... width modulation means is also adapted to generate a third and a fourth control signal for said driver means of the power switches of said first and said second secondary. The invention also relates to a method of controlling a switch mode power amplifier...

  9. First lasing of the regenerative amplifier FEL

    The regenerative amplifier free-electron laser (RAFEL) is a high-gain RF-linac FEL capable of producing high optical power from a compact design. The combination of a high-gain and small optical feedback enables the FEL to reach saturation and produce a high optical power and high extraction efficiency without the risk of optical damage to the mirrors. This paper summarizes the first lasing of the regenerative amplifier FEL and describes recent experimental results. The highest optical energy achieved thus far at 16.3 μm is 1.7 J over a train of 900 micropulses. We infer pulse energy of 1.9 mJ in each 16 ps micropulse, corresponding to a peak power of 120 MW

  10. Noise Gain Features of Fiber Raman Amplifier

    Georgii S. Felinskyi

    2016-01-01

    Full Text Available The formation dynamics of the optical noise in a silica single mode fiber (SMF as function of the pump power variation in the counter pumped fiber Raman amplifier (FRA is experimentally studied. The ratio between the power of amplified spontaneous emission and the power of incoherent optical noise is quantitatively determined by detailed analysis of experimental data in the pump powers range of 100–300 mW within the full band of Stokes frequencies, including FRA working wavelengths over the C + L transparency windows. It is found out the maximum of Raman gain coefficient for optical noise does not exceed ~60% of corresponding peak at the gain profile maximum of coherent signal. It is shown that the real FRA noise figure may be considerably less than 3 dB over a wide wavelength range (100 nm at a pump power of several hundreds of mW.

  11. Noise and saturation properties of semiconductor quantum dot optical amplifiers

    Berg, Tommy Winther; Mørk, Jesper

    2002-01-01

    We present a detailed theoretical analysis of quantum dot optical amplifiers. Due to the presence of a reservoir of wetting layer states, the saturation and noise properties differ markedly from bulk or QW amplifiers and may be significantly improved.......We present a detailed theoretical analysis of quantum dot optical amplifiers. Due to the presence of a reservoir of wetting layer states, the saturation and noise properties differ markedly from bulk or QW amplifiers and may be significantly improved....

  12. Application module of universal amplifier in education process

    CHALOUPEK, Pavel

    2013-01-01

    This thesis deals with the teaching and implementation module for teaching in secondary schools and their role in education. Following the theory being discussed in relation to a valid educational program. Learning amplifier module implemented by the assignment to DPS. The activity of the amplifier module to simulate in Multisim simulation program. Next is made circuitry design in discrete amplifier module. There evaluated the feasibility and simulation of realizations amplifier module in sec...

  13. Pump to signal noise transfer in parametric fiber amplifiers

    Lund-Hansen, Toke; Rottwitt, Karsten; Peucheret, Christophe; Lali-Dastjerdi, Zohreh; Rishøj, Lars Søgaard; Svane, Ask Sebastian; Andersen, Lasse Mejling; Cristofori, Valentina

    2010-01-01

    Fiber optic parametric amplifiers have been suggested due to their potential low spontaneous emission. However, by nature the parametric amplifier only work in a forward pumped configuration, which result in transfer of relative intensity noise in the pump to the signal.......Fiber optic parametric amplifiers have been suggested due to their potential low spontaneous emission. However, by nature the parametric amplifier only work in a forward pumped configuration, which result in transfer of relative intensity noise in the pump to the signal....

  14. Amplifier/compressor fiber Raman lasers.

    Islam, M N; Mollenauer, L F; Stolen, R H; Simpson, J R; Shang, H T

    1987-10-01

    We show that the chirp from cross-phase modulation (XPM) dominates the operation of fiber Raman lasers (FRL's). Thus a FRL in the anomalous group-velocity regime is best described as a XPM-chirped Raman amplifier followed by a linear fiber compressor. While the output of such a laser is generally a narrow pulse with a broad pedestal, we show both experimentally and by computer simulation that negligible background is achievable. PMID:19741882

  15. Radiation and particle detector and amplifier

    Schmidt, K. C. (Inventor)

    1973-01-01

    A radiation or charged particle detector is described which incorporates a channel multiplier structure to amplify the detected rays or particles. The channel multiplier structure has a support multiplying element with a longitudinal slot along one side. The element supports a pair of plates positioned contiguous with the slot. The plates funnel the particles or rays to be detected into the slotted aperture and the element, thus creating an effectively wide aperture detector of the windowless type.

  16. Amplifying the Hawking Signal in BECs

    Roberto Balbinot

    2014-01-01

    Full Text Available We consider simple models of Bose-Einstein condensates to study analog pair-creation effects, namely, the Hawking effect from acoustic black holes and the dynamical Casimir effect in rapidly time-dependent backgrounds. We also focus on a proposal by Cornell to amplify the Hawking signal in density-density correlators by reducing the atoms’ interactions shortly before measurements are made.

  17. Design and simulation of a gyroklystron amplifier

    Chauhan, M. S., E-mail: mschauhan.rs.ece@iitbhu.ac.in; Swati, M. V.; Jain, P. K. [Centre of Research in Microwave Tubes, Department of Electronics Engineering, Indian Institute of Technology, Banaras Hindu University, Varanasi 221005 (India)

    2015-03-15

    In the present paper, a design methodology of the gyroklystron amplifier has been described and subsequently used for the design of a typically selected 200 kW, Ka-band, four-cavity gyroklystron amplifier. This conceptual device design has been validated through the 3D particle-in-cell (PIC) simulation and nonlinear analysis. Commercially available PIC simulation code “MAGIC” has been used for the electromagnetic study at the different location of the device RF interaction structure for the beam-absent case, i.e., eigenmode study as well as for the electron beam and RF wave interaction behaviour study in the beam present case of the gyroklystron. In addition, a practical problem of misalignment of the RF cavities with drift tubes within the tube has been also investigated and its effect on device performance studied. The analytical and simulation results confirmed the validity of the gyroklystron device design. The PIC simulation results of the present gyroklystron produced a stable RF output power of ∼218 kW for 0% velocity spread at 35 GHz, with ∼45 dB gain, 37% efficiency, and a bandwidth of 0.3% for a 70 kV, 8.2 A gyrating electron beam. The simulated values of RF output power have been found in agreement with the nonlinear analysis results within ∼5%. Further, the PIC simulation has been extended to study a practical problem of misalignment of the cavities axis and drift tube axis of the gyroklystron amplifier and found that the RF output power is more sensitive to misalignments in comparison to the device bandwidth. The present paper, gyroklystron device design, nonlinear analysis, and 3D PIC simulation using commercially available code had been systematically described would be of use to the high-power gyro-amplifier tube designers and research scientists.

  18. Design and simulation of a gyroklystron amplifier

    In the present paper, a design methodology of the gyroklystron amplifier has been described and subsequently used for the design of a typically selected 200 kW, Ka-band, four-cavity gyroklystron amplifier. This conceptual device design has been validated through the 3D particle-in-cell (PIC) simulation and nonlinear analysis. Commercially available PIC simulation code “MAGIC” has been used for the electromagnetic study at the different location of the device RF interaction structure for the beam-absent case, i.e., eigenmode study as well as for the electron beam and RF wave interaction behaviour study in the beam present case of the gyroklystron. In addition, a practical problem of misalignment of the RF cavities with drift tubes within the tube has been also investigated and its effect on device performance studied. The analytical and simulation results confirmed the validity of the gyroklystron device design. The PIC simulation results of the present gyroklystron produced a stable RF output power of ∼218 kW for 0% velocity spread at 35 GHz, with ∼45 dB gain, 37% efficiency, and a bandwidth of 0.3% for a 70 kV, 8.2 A gyrating electron beam. The simulated values of RF output power have been found in agreement with the nonlinear analysis results within ∼5%. Further, the PIC simulation has been extended to study a practical problem of misalignment of the cavities axis and drift tube axis of the gyroklystron amplifier and found that the RF output power is more sensitive to misalignments in comparison to the device bandwidth. The present paper, gyroklystron device design, nonlinear analysis, and 3D PIC simulation using commercially available code had been systematically described would be of use to the high-power gyro-amplifier tube designers and research scientists

  19. Design and simulation of a gyroklystron amplifier

    Chauhan, M. S.; Swati, M. V.; Jain, P. K.

    2015-03-01

    In the present paper, a design methodology of the gyroklystron amplifier has been described and subsequently used for the design of a typically selected 200 kW, Ka-band, four-cavity gyroklystron amplifier. This conceptual device design has been validated through the 3D particle-in-cell (PIC) simulation and nonlinear analysis. Commercially available PIC simulation code "MAGIC" has been used for the electromagnetic study at the different location of the device RF interaction structure for the beam-absent case, i.e., eigenmode study as well as for the electron beam and RF wave interaction behaviour study in the beam present case of the gyroklystron. In addition, a practical problem of misalignment of the RF cavities with drift tubes within the tube has been also investigated and its effect on device performance studied. The analytical and simulation results confirmed the validity of the gyroklystron device design. The PIC simulation results of the present gyroklystron produced a stable RF output power of ˜218 kW for 0% velocity spread at 35 GHz, with ˜45 dB gain, 37% efficiency, and a bandwidth of 0.3% for a 70 kV, 8.2 A gyrating electron beam. The simulated values of RF output power have been found in agreement with the nonlinear analysis results within ˜5%. Further, the PIC simulation has been extended to study a practical problem of misalignment of the cavities axis and drift tube axis of the gyroklystron amplifier and found that the RF output power is more sensitive to misalignments in comparison to the device bandwidth. The present paper, gyroklystron device design, nonlinear analysis, and 3D PIC simulation using commercially available code had been systematically described would be of use to the high-power gyro-amplifier tube designers and research scientists.

  20. Electrically Pumped Vertical-Cavity Amplifiers

    Greibe, Tine

    2007-01-01

    In this work, the design of electrically pumped vertical cavity semiconductor optical amplifiers (eVCAs) for use in a mode-locked external-cavity laser has been developed, investigated and analysed. Four different eVCAs, one top-emitting and three bottom emitting structures, have been designed and...... discussed. The thesis concludes with recommendations for further work towards the realisation of compact electrically pumped mode-locked vertical externalcavity surface emitting lasers....

  1. CMOS RF Power Amplifiers for Wireless Communications

    Fritzin, Jonas

    2011-01-01

    The wireless market has experienced a remarkable development and growth since the introduction of the first modern mobile phone systems, with a steady increase in the number of subscribers, new application areas, and higher data rates. As mobile phones and wireless connectivity have become consumer mass markets, the prime goal of the IC manufacturers is to provide low-cost solutions. The power amplifier (PA) is a key building block in all RF transmitters. To lower the costs and allow full int...

  2. Amplifying youth voices in the developing world.

    Fotenos, Saori; Rohatgi, Deepti

    2007-01-01

    Low-literacy youth in the slums of Brazil have been historically unequipped to share their ideas on how to improve their lives, because outside of the spoken word, it is difficult for them to express their thoughts persuasively. The Amplifying Voices afterschool video program piloted at Projeto Uerê in Rio de Janeiro shows that youth can leverage technological tools to voice their perspectives on social issues relevant to themselves and their communities. PMID:18271053

  3. X-band magnicon amplifier experiment

    The magnicon, a ''scanning beam'' microwave amplifier tube related to the gyrocon, is of interest as a possible replacement for klystron amplifiers in future linear accelerators. It consists of a multicavity deflection system, whose purpose is to spin up an electron beam to high transverse momentum (α ≡ υperpendicular / υz approx-gt 1), followed by an output cavity that employs a cyclotron resonant mechanism to extract principally the transverse beam momentum. The deflection cavities are designed to produce an electron beam whose entry point and guiding center rotate in space about the cavity axis at the drive frequency. The output cavity employs a synchronously rotating mode, making possible a highly efficient interaction. This paper presents an overview of magnicon theory and design considerations, and discusses the progress of an experimental program to develop a frequency-doubling magnicon amplifier at X-band. This magnicon will require a sequence of 3 or 4 deflection cavities, in order to generate the required transverse momentum, followed by an output cavity operating at twice the drive frequency. The initial experiment was designed to measure the gain between two such deflection cavities operating in the TM110 mode a 5.7 GHz. These cavities were powered by a 170A, 500 keV electron beam immersed in an 8.1 kG magnetic field. In low power amplifier experiments, a gain of ∼15 dB was observed in the preferred circular polarization, at a frequency shift of approximately -0.18%, and a gain of ∼3 dB in the opposite circular polarization, at a frequency shift of approximately +0.06%. These results are in good agreement with theory and numerical simulation. The complete magnicon experiment is presently under design, and will also be discussed

  4. Quantum noise in ideal operational amplifiers

    Courty, Jean-Michel; Grassia, Francesca; Reynaud, Serge

    1998-01-01

    We consider a model of quantum measurement built on an ideal operational amplifier operating in the limit of infinite gain, infinite input impedance and null output impedance and with a feddback loop. We evaluate the intensity and voltage noises which have to be added to the classical amplification equations in order to fulfill the requirements of quantum mechanics. We give a description of this measurement device as a quantum network scattering quantum fluctuations from input to output ports.

  5. The development of DUV chemically amplified resists

    Thackeray, J.W.; Fedynyshyn, T.H.; Small, R.D. [Shipley Co. Inc., Marlboro, MA (United States)

    1993-12-31

    The development of deep ultraviolet (DUV) resists has necessitated the introduction of new concepts in resist materials and chemistry. Successful DUV resist systems now employ the concept of chemical amplification. This catalytic reaction leads to a substantial enhancement in the imaging dose. Another benefit of chemical amplified resists is that they allow the design of materials which can be transparent to DUV exposure wavelengths, yet they can still have high sensitivity. Commercial and prototype positive- and negative-tone resists are now readily available and these resists have been used in pilot production to make the most advanced integrated circuits with {le}0.35 {mu}m design rules. At Shipley, we have undertaken to develop both negative- and positive-tone chemically amplified resists for DUV lithography. These resists are capable of high resolution (0.3 {mu}m), fast photospeed ({le}30 mJ/sq. cm), and excellent etch resistance. This presentation will discuss the chemical and lithographic properties of the Shipley negative- and positive-tone DUV chemically amplified resists. General discussion of the importance of activation energy for the catalytic process, catalytic chain length, and environmental stability will be given.

  6. Charge sensitive amplifies. The state of arts

    Mori, Kunishiro [Clear Pulse Co., Tokyo (Japan)

    1996-07-01

    In the radiation detectors, signals are essentially brought with charges produced by radiation, then it is naturally the best way to use a charge sensitive amplifier (CSA) system to extract those signals. The CSA is thought to be the best amplifier suitable to almost all the radiation detectors, if neglecting economical points of view. The CSA has been only applied to special fields like radiation detection because the concept of `charges` is not so universal against the concepts of `voltage` and `current`. The CSA, however, is low in noise and a high speed amplifier and may be applicable not only to radiation measurement but also piezoelectric devices and also bolometers. In this article, noise in the CSA, basic circuit on the CSA, concepts of `equivalent noise charge` (ENC), a method for the ENC, and importance of the `open-loop gain` in the CSA to achieve better performance of it and how to realize in a practical CSA were described. And, characteristics on a counting rate of the CSA, various circuit used in the CSA, and CSAs which are commercially available at present and special purpose CSAs were also introduced. (G.K.)

  7. Gyro-amplifiers modeling with MAGY

    Levush, Baruch; Nguyen, Khanh; Botton, Moti; Vlasov Antonsen, Alexander, Jr.

    1999-11-01

    Recent modeling results of several experiments on gyroklystron amplifier at the Naval Research Laboratory are presented. Modeling was performed using the quasi three-dimensional, self-consistent code MAGY[1] . Amplifiers in both Ka- and W-bands have been studied [2,3]. Using known experimental input parameters, code-predicted salient amplifier performance characteristics, e.g. efficiency, bandwidth, drive curve, have been found to be in good agreement with experimental results. Self-consistent phenomena, such as effects of window reflections on bandwidth and higher-order-mode interaction in uptaper, will also be presented. MAGY has also been used to design gyro-TWTs. The code has been successfully benchmarked against linear theory. Issues such as absolute instability, backward-wave oscillations, and effect of reflection in gyro-TWTs have been investigated. Detailed results of design trade-off studies for a Ka-band gyro-TWT will also be presented and discussed. [1] M. Botton, et al.,IEEE Trans. Plasma Sci.,Vol.26(1998) [3] J.P. Calame, et al.,Phys. of Plasmas,Vol.6(1999) [4] M. Blank, et al.,Submitted to Phys. of Plasmas (1999)

  8. High Power 35GHz Gyroklystron Amplifiers

    Choi, Jin; McCurdy, A.; Wood, F.; Kyser, R.; Danly, B.; Levush, B.; Parker, R.

    1997-05-01

    High power coherent radiation sources at 35GHz are attractive for next generation high gradient particle accelerators. A multi-cavity gyroklystron amplifier is considered a promising candidate for high power millimeter wave generation. Experiments on two-cavity and three cavity gyroklystron amplifiers are underway to demonstrate a 140kW, 35GHz coherent radiation amplification. Though this power is low compared with that needed for colliders, many of the issues associated with the bandwidth of such devices can be addressed in the present experiments. High bandwidth is important to permit the rapid phase shifts required for RF pulse compression schemes presently under investigation. Large signal calculations (P.E. Latham, W. Lawson, V. Irwin, IEEE Trans. Plasma Sci., Vol. 22, No. 5, pp. 804-817, 1994.) predict that the two-cavity gyroklystron produces a peak power of 140kW, corresponding to 33% efficiency. Calculations also show that a stagger tuned three cavity circuit increases a bandwidth to more than 0.7%. Experimental results of the amplifier will be presented and compared with the theory.

  9. Polarization of Tapered Semiconductor Travelling-Wave Amplifiers

    Huang Dexiu; Li Hong

    2001-01-01

    The polarization of a tapered semi-conductor travelling-wave amplifier has been investigated with the transfer matrix method based on convective equation. It is shown that the apparent polarization mode competition exists, and polarization-independent tapered semiconductor travellingwave amplifiers can be obtained through the optimization of amplifier parameters.

  10. Digital system provides superregulation of nanosecond amplifier-discriminator circuit

    Forges, K. G.

    1966-01-01

    Feedback system employing a digital logic comparator to detect and correct amplifier drift provides stable gain characteristics for nanosecond amplifiers used in counting applications. Additional anticoincidence logic enables application of the regulation circuit to the amplifier and discriminator while they are mounted in an operable circuit.

  11. AcEST: DK952954 [AcEST

    Full Text Available TST38A01NGRL0015_H21 616 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0015_H21. 5' end seq ... LIHAHIVCSCNDVDNFVRSTLVNLYSKCGSIEDAHNVFAKLATRRSVDWSMMIS ... 541 ++ Q K +HA I + D + V + L+++Y+KCGSI DA F +++T+ ... LIHAHIVCSCNDVDNFVRSTLVNLYSKCGSIEDAHNVFAKLATRRSVDWSMMIS GS 547 + + IHA S D ++ LV LYS+CG IE+++ F + ++ W+ ++S ... LIHAHIVCSCNDVDNFVRSTLVNLYSKCGSIEDAHNVFAKLATRRSVDWSMMIS ... 541 DL + IH+ I+ + ++ +V S L+++Y+K G ++ A ++ + A + ... EA+ LF +M G+ P + + L AC Sbjct: 243 RVFDGLRLKDHSSWVAMIS GLSKNECEAEAIRLFCDMYVLGIMPTPYAFSSVLSACKKIE 302 Query ...

  12. AcEST: BP912540 [AcEST

    Full Text Available YMU001_000020_B03 501 Adiantum capillus-veneris mRNA. clone: YMU001_000020_B03. BP912540 - Show ... 2 EELTVHHTASVGDVEALKALLAEGADKDEKDSEGRTALHFACGYGEVMCAE VLLEAGVAV 181 EE VH TAS+GDVE LKA LA G +KDE+DSEGRTAL ... ry: 14 VHHTASVGDVEALKALLAEGADKDEKDSEGRTALHFACGYGEVMCAE VLLEAGVAVDAVD 193 +H A V ++ LL GAD KD G LH AC YG AE ... uery: 26 ASVGDVEALKALLAEGADKDEKDSEGR--TALHFACGYGEVMCAE VLLEAGVAVDAVDKN 199 + GD+E +K L + + + +D EGR T LHFA ... ry: 14 VHHTASVGDVEALKALLAEGADKDEKDSEGRTALHFACGYGEVMCAE VLLEAGVAVDAVD 193 +H A ++E + LL GAD + +D G LH A YG ...

  13. AcEST: DK948526 [AcEST

    Full Text Available TST38A01NGRL0003_I19 675 Adiantum capillus-veneris mRNA. clone: TST38A01NGRL0003_I19. 5' end seq ... IAMVRTTTPVYV 214 Query: 542 ALALFNQARVSSLPIIDDNGSLIDIY ARSDITALARDDTY 661 AL +F Q RVS+LP++D+ G ++DIY ++ D+ ... LA + TY Sbjct: 215 ALGIFVQHRVSALPVVDEKGRVVDIY SKFDVINLAAEKTY 254 >sp|Q09138|AAKG1_PIG 5'-AMP-acti ... IAMVRTTTPVYV 215 Query: 542 ALALFNQARVSSLPIIDDNGSLIDIY ARSDITALARDDTY 661 AL +F Q RVS+LP++D+ G ++DIY ++ D+ ... LA + TY Sbjct: 216 ALGIFVQHRVSALPVVDEKGRVVDIY SKFDVINLAAEKTY 255 >sp|O54950|AAKG1_MOUSE 5'-AMP-ac ...

  14. AcEST: DK962916 [AcEST

    Full Text Available TST39A01NGRL0015_C06 596 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0015_C06. 5' end seq ... NA. clone: TST39A01NGRL0015_C06. 5' end sequence. Acce ssion DK962916 Tissue type prothallia with plantlet ... 2 Query: 317 MPKSKEPCSQEACDIQTCLVKNNFITERCFPVIEALQACCE K 442 MP+ K+PC ++AC+IQ CL NN++ +C VI+ L+ CC + Sbjct ... me = +2 Query: 335 PCSQEACDIQTCLVKNNFITERCFPVIEALQACCE K 442 PC +EAC IQ CL+ + + +C VI+ L CC K Sbjct: 4 PCQ ... = +2 Query: 326 SKEPCSQEACDIQTCLVKNNFITERCFPVIEALQACCE KCNSK 454 + E C+ CD +TC +K F +C AL CCE KC K Sbjct: 4 ...

  15. AcEST: DK955705 [AcEST

    Full Text Available TST39A01NGRL0023_N02 635 Adiantum capillus-veneris mRNA. clone: TST39A01NGRL0023_N02. 5' end seq ... NA. clone: TST39A01NGRL0023_N02. 5' end sequence. Acce ssion DK955705 Tissue type prothallia with plantlet ... 2 Query: 296 MPKSKEPCSQEACDIQTCLVKNNFITERCFPVIEALQACCE K 421 MP+ K+PC ++AC+IQ CL NN++ +C VI+ L+ CC + Sbjct ... me = +2 Query: 314 PCSQEACDIQTCLVKNNFITERCFPVIEALQACCE K 421 PC +EAC IQ CL+ + + +C VI+ L CC K Sbjct: 4 PCQ ... = +2 Query: 305 SKEPCSQEACDIQTCLVKNNFITERCFPVIEALQACCE KCNSK 433 + E C+ CD +TC +K F +C AL CCE KC K Sbjct: 4 ...

  16. AcEST: DK961330 [AcEST

    Full Text Available FWVPCMHTPIKQEKHTHA 405 +AR P W +++PI+ ++C++ P + AK+ PL DVTH+F+V + +QE Sbjct: 61 VARRTRP-SWHEDNPINYVQCDISDPDD...+IL +D PGGPWKVYG Sbjct: 4 WWAGAIGAAKKKLEEDDAPPKHS---SVALIVGVTGIIGNSLAEILPLADTPGGP...AWHEDNPINYIQCDISDPDDSLAKLSPLTDVTHVFYVTCANR--STEPENCE 117 Query: 406 MATHMFENIIGVLLTHAPNLQHVCMQTSDKHY-... : Swiss-Prot sp_hit_id Q7MXT7 Definition sp|Q7MXT7|LPXD_PORGI UDP-3-O-[3-hydroxymyristoyl] glucosamine N-ac...lue sp|Q7MXT7|LPXD_PORGI UDP-3-O-[3-hydroxymyristoyl] glucosamine N-... 34 0.62 sp|P60369|KR103_HUMAN Kerati

  17. AcEST: BP913772 [AcEST

    Full Text Available N VT V L C+ G G+ H Sbjct: 350 NVVTWSAVIAGYAQRGLGFEALDVFRQMRLCGSEPNVVTLVSLLSGCALAGTLLHGKETH 409 Query: 376 IEIER--RGLLEVDP-...VFNKLSVQDIVSW 236 + + A ++G+++H I RRGL + PV+ + LV MY R G L Q VF+++ +D+VSW Sbjct: 296 ASLAALEQGKLIHGYILRRGLDSILPVI-S... TF M+ +PN+VT V VL+AC+ + Q + Sbjct: 250 SWSAMIACYAKNGKAFEALRTFREMMRETKDSSPNSVTMVSVLQACASLA...MIEGGVAPNAVTFVVVLRACSQTGSYSQSQTFFEAMSKNF 50 + G A G + F+ M + GV PNAVTFV VLR CS G + Q F++M F Sbjct: 312 ALNGLAMNGFGEKCLELFSL...L YA G + + +F++ D+ +TA + + Sbjct: 48 IHAAILRHNLLLHPRYPVLNLKLHRAYASHGKIRHSLALFHQTIDP

  18. Analysis of multipass laser amplifier systems for storage laser media

    The performance characteristics of single pass and multipass storage laser amplifiers are presented and compared. The effects of the multipass amplifier parameters on the extraction characteristics are examined. For a wide range of conditions the multipass amplifier is found to provide high energy gain and high efficiency simultaneously. This is a significant advantage over the single pass laser amplifier. Finally, three specific storage laser amplifier systems, flashlamp pumped V:MgF2, XeF laser pumped Tm:Glass, and photolytically pumped Selenium, are examined. The performance characteristics for each of the three systems are calculated and compared

  19. Analysis of multipass laser amplifier systems for storage laser media

    Harvey, J.F.

    1980-03-25

    The performance characteristics of single pass and multipass storage laser amplifiers are presented and compared. The effects of the multipass amplifier parameters on the extraction characteristics are examined. For a wide range of conditions the multipass amplifier is found to provide high energy gain and high efficiency simultaneously. This is a significant advantage over the single pass laser amplifier. Finally, three specific storage laser amplifier systems, flashlamp pumped V:MgF/sub 2/, XeF laser pumped Tm:Glass, and photolytically pumped Selenium, are examined. The performance characteristics for each of the three systems are calculated and compared.

  20. Characterization of a Common-Gate Amplifier Using Ferroelectric Transistors

    Hunt, Mitchell; Sayyah, Rana; MacLeod, Todd C.; Ho, Fat D.

    2011-01-01

    In this paper, the empirical data collected through experiments performed using a FeFET in the common-gate amplifier circuit is presented. The FeFET common-gate amplifier was characterized by varying all parameters in the circuit, such as load resistance, biasing of the transistor, and input voltages. Due to the polarization of the ferroelectric layer, the particular behavior of the FeFET common-gate amplifier presents interesting results. Furthermore, the differences between a FeFET common-gate amplifier and a MOSFET common-gate amplifier are examined.

  1. Characterization of a Common-Source Amplifier Using Ferroelectric Transistors

    Hunt, Mitchell; Sayyah, Rana; MacLeond, Todd C.; Ho, Pat D.

    2010-01-01

    This paper presents empirical data that was collected through experiments using a FeFET in the established common-source amplifier circuit. The unique behavior of the FeFET lends itself to interesting and useful operation in this widely used common-source amplifier. The paper examines the effect of using a ferroelectric transistor for the amplifier. It also examines the effects of varying load resistance, biasing, and input voltages on the output signal and gives several examples of the output of the amplifier for a given input. The difference between a commonsource amplifier using a ferroelectric transistor and that using a MOSFET is addressed.

  2. Increased long-flight activity triggered in beet armyworm by larval feeding on diet containing Cry1Ac protoxin.

    Xing Fu Jiang

    Full Text Available Evaluating ecological safety and conducting pest risk analysis for transgenic crops are vitally important before their commercial planting. The beet armyworm, Spodoptera exigua, a long-distance migratory insect pest, is not a direct target of transgenic Cry1Ac-expressing cotton in China, but nevertheless it has recently become an important pest. Migrants leaving their natal field arrive in other appropriate habitat far away in a short time, often followed by larval outbreaks. S. exigua has low susceptibility to Cry1Ac. However, our results from laboratory experiments identified (i sublethal effects of Cry1Ac protoxin on larval development rate, larval and pupal weight, and adult lifetime fecundity, and (ii increased long-flight behavior triggered by Cry1Ac which may contribute to larval outbreaks elsewhere. No significant differences in larval mortality, pupation rate, adult emergence rate, longevity, pre-oviposition period, or oviposition period were observed between controls and larvae fed on artificial diet incorporating a low concentration of Cry1Ac protoxin. The negative sublethal effects on some developmental and reproductive traits and lack of effect on others suggest they do not contribute to the observed severity of S. exigua outbreaks after feeding on Cry1Ac cotton. Interestingly, the percentage of long fliers increased significantly when larvae were reared on diet containing either of two low-dose treatments of Cry1Ac, suggesting a possible increased propensity to disperse long distances triggered by Cry1Ac. We hypothesize that negative effects on development and reproduction caused by Cry1Ac in the diet are offset by increased flight propensity triggered by the poor food conditions, thereby improving the chances of escaping adverse local conditions before oviposition. Increased long-flight propensity in turn may amplify the area damaged by outbreak populations. This phenomenon might be common in other migratory insect pests receiving

  3. Increased long-flight activity triggered in beet armyworm by larval feeding on diet containing Cry1Ac protoxin.

    Jiang, Xing Fu; Chen, Jian; Zhang, Lei; Sappington, Thomas W; Luo, Li Zhi

    2013-01-01

    Evaluating ecological safety and conducting pest risk analysis for transgenic crops are vitally important before their commercial planting. The beet armyworm, Spodoptera exigua, a long-distance migratory insect pest, is not a direct target of transgenic Cry1Ac-expressing cotton in China, but nevertheless it has recently become an important pest. Migrants leaving their natal field arrive in other appropriate habitat far away in a short time, often followed by larval outbreaks. S. exigua has low susceptibility to Cry1Ac. However, our results from laboratory experiments identified (i) sublethal effects of Cry1Ac protoxin on larval development rate, larval and pupal weight, and adult lifetime fecundity, and (ii) increased long-flight behavior triggered by Cry1Ac which may contribute to larval outbreaks elsewhere. No significant differences in larval mortality, pupation rate, adult emergence rate, longevity, pre-oviposition period, or oviposition period were observed between controls and larvae fed on artificial diet incorporating a low concentration of Cry1Ac protoxin. The negative sublethal effects on some developmental and reproductive traits and lack of effect on others suggest they do not contribute to the observed severity of S. exigua outbreaks after feeding on Cry1Ac cotton. Interestingly, the percentage of long fliers increased significantly when larvae were reared on diet containing either of two low-dose treatments of Cry1Ac, suggesting a possible increased propensity to disperse long distances triggered by Cry1Ac. We hypothesize that negative effects on development and reproduction caused by Cry1Ac in the diet are offset by increased flight propensity triggered by the poor food conditions, thereby improving the chances of escaping adverse local conditions before oviposition. Increased long-flight propensity in turn may amplify the area damaged by outbreak populations. This phenomenon might be common in other migratory insect pests receiving sublethal doses

  4. Speed Control of DC Motor using AC/AC/DC Converter Based on Intelligent Techniques

    Rakan Kh Antar

    2013-01-01

       This paper describes the application of ac/ac/dc and ac/dc converters to control the speed of a separately excited DC motor. Artificial neural network and PI controller are trained to select the desired values of firing angles for triggering thyristors of the ac/ac/dc and ac/dc bridge converters in order to control the speed of the dc motor at a desired value with constant and different load torques in order to obtain the best speed response. Simulation results show that the rising time fo...

  5. Low noise amplifier for ZnS(Ag) scintillation chamber

    A new pulse amplifier that can be used with standard photomultiplier tubes coupled with Zn(Ag) scintillation chamber is presented. The amplifier based on an IC operational amplifier LF 356N consists of a low-noise charge sensitive preamplifier and pulse shaping circuits for optimization of signal to noise ratio. Temperature instability is ≤ 0.05%/oC. Dynamic range for linear output signals is equal +7 V. The presented amplifier is used in a measuring head for 0.17 L Lucas chambers developed in Department of Nuclear Instruments and Methods of the INCT in laboratory investigations aimed to develop methods and instruments for measurement of radon concentration in the air. The amplifier can also be employed for measurement of ionizing radiation by means of other scintillators coupled to PM tube. The amplifier is followed by a pulse discriminator with adjustable discrimination level. The amplifier output signal and discriminator output pulses are fed to external devices. (author)

  6. A cryo-amplifier working in a double loop-flux locked loop scheme for SQUID readout of TES detectors

    Torrioli, Guido; Bastia, Paolo; Piro, Luigi; Macculi, Claudio; Colasanti, Luca

    2010-07-01

    In this paper we report on a novel SQUID readout scheme, called Double Loop-Flux Locked loop (DL-FLL), that we are investigating in the frame of ASI and ESA technological development contracts. This scheme is based on the realization of a cryogenic amplifier which is used in order to readout TES detectors in the Frequency Division Multiplexing technique, where high loop-gain is required up to few MHz. Loop-gain in feedback systems is, usually, limited by the propagation delay of the signals traveling in the loop because of the distance between the feedback loop elements. This problem is particularly evident in the case of SQUID systems, where the elements of the feedback loop are placed both at cryogenic and room temperature. To solve this issue we propose a low power dissipation cryo-amplifier capable to work at cryogenic temperatures so that it can be placed close to the SQUID realizing a local cryogenic loop. The adoption of the DL-FLL scheme allows to simplify considerably the cryo-amplifier which, being AC-coupled, don't require the features of a precision DC-coupled amplifier and can be made with a limited number of electronic components and with a consequent reduction of power dissipation.

  7. High sensitivity amplifier/discriminator for PWC's

    The facility support group at Fermilab is designing and building a general purpose beam chamber for use in several locations at the laboratory. This pwc has 128 wires per plane spaced 1 mm apart. An initial production of 25 signal planes is anticipated. In proportional chambers, the size of the signal depends exponentially on the charge stored per unit of length along the anode wire. As the wire spacing decreases, the capacitance per unit length decreases, thereby requiring increased applied voltage to restore the necessary charge per unit length. In practical terms, this phenomenon is responsible for difficulties in constructing chambers with less than 2 mm wire spacing. 1 mm chambers, therefore, are frequently operated very near to their breakdown point and/or a high gain gas containing organic compounds such as magic gas is used. This argon/iso-butane mixture has three drawbacks: it is explosive when exposed to the air, it leaves a residue on the wires after extended use and is costly. An amplifier with higher sensitivity would reduce the problems associated with operating chambers with small wire spacings and allow them to be run a safe margin below their breakdown voltage even with an inorganic gas mixture such as argon/CO2, this eliminating the need to use magic gas. Described here is a low cost amplifier with a usable threshold of less than 0.5 μA. Data on the performance of this amplifier/discriminator in operation on a prototype beam chamber are given. This data shows the advantages of the high sensitivity of this design

  8. Time amplifying techniques towards atomic time resolution

    2009-01-01

    High speed imaging technology has opened applications in many fields,such as collision,detonating, high voltage discharge,disintegration and transfer of phonon and exciton in solid,photosynthesis primitive reaction,and electron dynamics inside atom shell.In principle,all of the transient processes need to be explained theoretically and,at the same time,the time amplifying technique is required for observations of these processes.The present review concerns the atomic time amplifying mechanism of optical information and the extremely-high speed imaging methods,which are expressed in terms of the short time amplifying techniques.It is well-known that for extremely-high speed imaging with the converter tube,the temporal resolution is in the order of sub-picosecond of the streak imaging,and the imaging frequency is 6×10 8 ―5×10 9 fps(frame per second)of the frame imaging.On the other hand,for the tubeless extremely-high speed imaging,the imaging frequency is 10 7 ―10 14 fps,and its mechanism of forming high speed and framing could involve a lot of factors of the light under investigation,for instance,light speed,light parallelism,the parameters of light wave such as amplitude,phase,polari- zation and wavelength,and even quantum properties of photon.In the cascaded system of electro- magnetic wave and particle wave,it is possible to simultaneously realize extremely-high resolution in time and space,which is higher than a kite resolution.Then it would be possible to break the limit of the Heisenberg uncertainty relation of the optical frequency band.

  9. Time amplifying techniques towards atomic time resolution

    LI JingZhen

    2009-01-01

    High speed imaging technology has opened applications in many fields,such as collision,detonating,high voltage discharge,disintegration and transfer of phonon and exciton in solid,photosynthesis primitive reaction,and electron dynamics inside atom shell.In principle,all of the transient processes need to be explained theoretically and,st the same time,the time amplifying technique is required for observations of these processes.The present review concerns the atomic time amplifying mechanism of optical information and the extremely-high speed imaging methods,which are expressed in terms of the short time amplifying techniques.It is well-known that for extremely-high speed imaging with the converter tube,the temporal resolution is in the order of sub-picosecond of the streak imaging,and the imaging frequency is 6×10~8-5×10~9 fps(frame per second)of the frame imaging.On the other hand,for the tubeless extremely-high speed imaging,the imaging frequency is 10~7-10~(14) fps,and its mechanism of forming high speed and framing could involve a lot of factors of the light under investigation,for instance,light speed,light parallelism,the parameters of light wave such as amplitude,phase,polarization and wavelength,and even quantum properties of photon.In the cascaded system of electromagnetic wave and particle wave,it is possible to simultaneously realize extremely-high resolution in time and space,which is higher than a kite resolution.Then it would be possible to break the limit of the Heisenberg uncertainty relation of the optical frequency band.

  10. Universality of ac conduction in disordered solids

    Dyre, Jeppe; Schrøder, Thomas

    2000-01-01

    non-power-law universalities. It is argued that ac universality reflects an underlying percolation determining dc as well as ac conductivity in the extreme disorder limit. Three analytical approximations to the universal ac conductivities are presented and compared to computer simulations. Finally......The striking similarity of ac conduction in quite different disordered solids is discussed in terms of experimental results, modeling, and computer simulations. After giving an overview of experiment, a macroscopic and a microscopic model are reviewed. For both models the normalized ac conductivity...... as a function of a suitably scaled frequency becomes independent of details of the disorder in the extreme disorder limit, i.e., when the local randomly varying mobilities cover many orders of magnitude. The two universal ac conductivities are similar, but not identical; both are examples of unusual...